BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22855_g1_i1 len=1520 path=[129:0-149 279:150-919 1046:920-1519]

Length=1520
                                                                      Score     E

ref|XP_007032884.1|  Pollen Ole e 1 allergen and extensin family ...    238   3e-71   
ref|XP_011099048.1|  PREDICTED: vegetative cell wall protein gp1-...    241   9e-71   
ref|XP_009803847.1|  PREDICTED: vegetative cell wall protein gp1        237   1e-68   
gb|KDO72303.1|  hypothetical protein CISIN_1g019020mg                   234   2e-68   
ref|XP_006338330.1|  PREDICTED: vegetative cell wall protein gp1-...    236   2e-68   
ref|XP_006430959.1|  hypothetical protein CICLE_v10012100mg             234   4e-68   
ref|XP_009586796.1|  PREDICTED: vegetative cell wall protein gp1        233   2e-67   
ref|XP_006482439.1|  PREDICTED: proline-rich extensin-like protei...    234   5e-67   
ref|XP_004232133.1|  PREDICTED: formin-2                                231   8e-67   
ref|XP_010260908.1|  PREDICTED: vegetative cell wall protein gp1        231   2e-66   
gb|KDP24305.1|  hypothetical protein JCGZ_25601                         228   5e-66   
ref|XP_006384278.1|  hypothetical protein POPTR_0004s11300g             228   9e-66   
ref|XP_010999442.1|  PREDICTED: vegetative cell wall protein gp1-...    227   9e-66   
ref|XP_010999441.1|  PREDICTED: vegetative cell wall protein gp1-...    227   2e-65   
ref|XP_002525926.1|  conserved hypothetical protein                     225   2e-64   Ricinus communis
emb|CDP02346.1|  unnamed protein product                                223   4e-64   
ref|XP_011085586.1|  PREDICTED: proline-rich extensin-like protei...    221   4e-63   
ref|XP_010099300.1|  hypothetical protein L484_018162                   221   6e-63   
ref|XP_007215343.1|  hypothetical protein PRUPE_ppa005351mg             223   1e-62   
ref|XP_008230302.1|  PREDICTED: proline-rich receptor-like protei...    219   4e-62   
ref|XP_008230301.1|  PREDICTED: formin-2-like isoform X1                219   7e-62   
ref|XP_004491943.1|  PREDICTED: formin-like protein 3-like              216   2e-61   
gb|KHN30305.1|  hypothetical protein glysoja_037816                     213   3e-60   
ref|XP_003530454.1|  PREDICTED: proline-rich extensin-like protei...    213   4e-60   
ref|XP_008230300.1|  PREDICTED: collagen alpha-2(IV) chain-like         212   1e-59   
ref|XP_007032885.1|  Pollen Ole e 1 allergen and extensin family ...    209   4e-59   
ref|XP_007139401.1|  hypothetical protein PHAVU_008G026300g             210   4e-59   
ref|XP_006373407.1|  hypothetical protein POPTR_0017s13490g             208   1e-57   
gb|KHN46667.1|  hypothetical protein glysoja_045665                     205   2e-57   
ref|XP_008348098.1|  PREDICTED: uncharacterized protein LOC103411228    202   3e-57   
ref|XP_010660567.1|  PREDICTED: proline-rich receptor-like protei...    204   5e-57   
ref|XP_009594727.1|  PREDICTED: proline-rich extensin-like protei...    203   1e-56   
ref|XP_009801372.1|  PREDICTED: proline-rich extensin-like protei...    202   2e-56   
gb|ACJ85269.1|  unknown                                                 197   2e-55   Medicago truncatula
ref|XP_008348099.1|  PREDICTED: collagen alpha-2(IV) chain-like         201   3e-55   
ref|XP_011021085.1|  PREDICTED: leucine-rich repeat extensin-like...    199   7e-55   
ref|XP_009378266.1|  PREDICTED: uncharacterized protein LOC103966...    195   1e-54   
ref|XP_010694174.1|  PREDICTED: leucine-rich repeat extensin-like...    199   1e-54   
ref|XP_010032567.1|  PREDICTED: putative uncharacterized protein ...    197   2e-54   
ref|XP_003621548.1|  hypothetical protein MTR_7g016950                  201   2e-54   
ref|XP_009378330.1|  PREDICTED: formin-2-like                           198   2e-54   
ref|XP_009378265.1|  PREDICTED: uncharacterized protein LOC103966...    195   2e-54   
gb|EYU39348.1|  hypothetical protein MIMGU_mgv1a010319mg                197   2e-54   
ref|XP_008357800.1|  PREDICTED: collagen alpha-1(XXVII) chain-like      193   2e-53   
ref|XP_009378263.1|  PREDICTED: LOW QUALITY PROTEIN: collagen alp...    191   8e-53   
ref|XP_008353504.1|  PREDICTED: uncharacterized protein LOC103417...    191   1e-52   
ref|XP_008353505.1|  PREDICTED: uncharacterized protein LOC103417...    190   1e-52   
ref|XP_008811043.1|  PREDICTED: proline-rich protein 4                  191   1e-52   
ref|XP_008353503.1|  PREDICTED: collectin-12-like isoform X1            191   1e-52   
gb|KHG02822.1|  Major pollen allergen Lig v 1                           190   2e-52   
gb|KGN52531.1|  hypothetical protein Csa_5G642130                       191   2e-52   
gb|KHN29758.1|  hypothetical protein glysoja_035444                     189   2e-52   
ref|XP_008362215.1|  PREDICTED: uncharacterized protein LOC103425895    189   2e-52   
ref|XP_009373766.1|  PREDICTED: protein app1-like                       193   2e-52   
ref|XP_003554935.1|  PREDICTED: proline-rich protein 4-like             189   2e-52   
ref|XP_009378268.1|  PREDICTED: collagen and calcium-binding EGF ...    190   2e-52   
gb|KHG25921.1|  Major pollen allergen Lig v 1                           188   3e-52   
gb|KHN29757.1|  hypothetical protein glysoja_035443                     188   6e-52   
ref|XP_003554939.1|  PREDICTED: pollen-specific protein-like At4g...    184   1e-51   
ref|XP_008459405.1|  PREDICTED: major pollen allergen Lol p 11          184   3e-51   
ref|XP_004304196.1|  PREDICTED: uncharacterized protein LOC101309654    187   1e-50   
ref|XP_003554938.1|  PREDICTED: uncharacterized protein LOC100779028    184   1e-50   
ref|XP_008342050.1|  PREDICTED: vegetative cell wall protein gp1-...    187   4e-50   
ref|XP_010936428.1|  PREDICTED: pollen-specific protein C13-like        182   2e-49   
ref|XP_006593706.1|  PREDICTED: uncharacterized protein LOC100808822    180   7e-49   
ref|XP_009415140.1|  PREDICTED: steroidogenic factor 1                  179   1e-48   
ref|XP_008785745.1|  PREDICTED: proline-rich protein 4-like             174   2e-46   
emb|CDX69501.1|  BnaA10g18500D                                          175   5e-46   
ref|XP_003554983.1|  PREDICTED: leucine-rich repeat extensin-like...    174   6e-46   
gb|KHN29763.1|  Major cell-surface adhesin PAc                          174   7e-46   
ref|XP_007151392.1|  hypothetical protein PHAVU_004G042600g             171   2e-44   
ref|XP_006363256.1|  PREDICTED: 36.4 kDa proline-rich protein-like      170   2e-44   
ref|XP_009121547.1|  PREDICTED: WAS/WASL-interacting protein fami...    168   1e-43   
ref|XP_009393071.1|  PREDICTED: proline-rich protein 4-like             164   5e-43   
ref|XP_006593705.1|  PREDICTED: vegetative cell wall protein gp1-...    166   1e-42   
ref|XP_010549968.1|  PREDICTED: cyclin-dependent kinase 12              164   2e-42   
gb|ABD96850.1|  hypothetical protein                                    164   3e-42   Tarenaya spinosa
gb|KEH25152.1|  pollen Ole e I family allergen                          164   3e-42   
gb|AFK48758.1|  unknown                                                 164   3e-42   
gb|KHN29761.1|  hypothetical protein glysoja_035447                     160   6e-42   
emb|CDX85534.1|  BnaA02g02790D                                          164   6e-42   
ref|XP_007151393.1|  hypothetical protein PHAVU_004G042700g             161   6e-42   
ref|XP_010317827.1|  PREDICTED: formin-like protein 3                   162   1e-41   
emb|CDX90973.1|  BnaC02g06240D                                          162   1e-41   
ref|XP_009126068.1|  PREDICTED: proline-rich extensin-like protei...    162   3e-41   
ref|XP_003554940.2|  PREDICTED: splicing factor 3A subunit 1-like       160   3e-41   
gb|KHN29755.1|  hypothetical protein glysoja_035441                     159   3e-41   
emb|CDX85533.1|  BnaA02g02800D                                          161   4e-41   
ref|XP_006400102.1|  hypothetical protein EUTSA_v10013771mg             162   5e-41   
ref|XP_004304197.1|  PREDICTED: collagen alpha-2(IV) chain-like         160   3e-40   
ref|XP_004507286.1|  PREDICTED: proline-rich protein 4-like             156   2e-39   
ref|XP_009392504.1|  PREDICTED: splicing factor 3A subunit 2-like       152   1e-38   
ref|NP_197082.1|  pollen Ole e 1 allergen and extensin family pro...    155   1e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KHG10418.1|  Major pollen allergen Pla l 1                           154   2e-38   
ref|XP_010029417.1|  PREDICTED: proline-rich protein 4-like             154   2e-38   
gb|KFK25802.1|  hypothetical protein AALP_AA8G163000                    155   2e-38   
ref|XP_010420252.1|  PREDICTED: WAS/WASL-interacting protein fami...    154   3e-38   
ref|XP_002873741.1|  hypothetical protein ARALYDRAFT_488422             154   3e-38   
ref|XP_010492425.1|  PREDICTED: vegetative cell wall protein gp1-...    155   3e-38   
ref|XP_004137142.1|  PREDICTED: uncharacterized protein LOC101209177    151   5e-38   
ref|XP_010453723.1|  PREDICTED: vegetative cell wall protein gp1-...    151   3e-37   
ref|XP_006287924.1|  hypothetical protein CARUB_v10001160mg             151   3e-37   
ref|XP_008455556.1|  PREDICTED: formin-like protein 7                   148   5e-37   
ref|XP_007151394.1|  hypothetical protein PHAVU_004G042800g             150   5e-37   
ref|XP_010939464.1|  PREDICTED: leucine-rich repeat extensin-like...    147   5e-36   
ref|XP_008357923.1|  PREDICTED: uncharacterized protein LOC103421656    139   2e-34   
ref|XP_008342051.1|  PREDICTED: formin-like protein 3                   139   2e-33   
ref|XP_009378267.1|  PREDICTED: major pollen allergen Lig v 1-like      130   4e-32   
ref|XP_008348265.1|  PREDICTED: isoprenylcysteine alpha-carbonyl ...    135   5e-32   
ref|XP_007215966.1|  hypothetical protein PRUPE_ppa011450mg             109   8e-24   
gb|ACN41080.1|  unknown                                               99.8    1e-19   Picea sitchensis
gb|ABK26139.1|  unknown                                               99.4    1e-19   Picea sitchensis
gb|ABK24101.1|  unknown                                               87.4    1e-15   Picea sitchensis
ref|XP_010030796.1|  PREDICTED: uncharacterized protein LOC104420701  83.2    2e-15   
gb|ABN09049.1|  hypothetical protein MtrDRAFT_AC172742g21v1           80.5    1e-14   Medicago truncatula
gb|EPS70189.1|  hypothetical protein M569_04566                       86.3    2e-14   
ref|XP_003621580.1|  hypothetical protein MTR_7g017350                78.6    3e-14   
ref|XP_010528432.1|  PREDICTED: pollen-specific leucine-rich repe...  83.6    3e-14   
ref|XP_010528433.1|  PREDICTED: leucine-rich repeat extensin-like...  75.5    1e-11   
ref|XP_009336449.1|  PREDICTED: formin-1-like                         72.8    9e-11   
ref|XP_008389918.1|  PREDICTED: leucine-rich repeat extensin-like...  70.5    5e-10   
ref|XP_004983237.1|  PREDICTED: proline-rich protein 4-like           68.2    2e-09   
gb|ABK21071.1|  unknown                                               67.4    4e-09   Picea sitchensis
gb|ABK25840.1|  unknown                                               67.0    8e-09   Picea sitchensis
ref|XP_010090678.1|  hypothetical protein L484_017484                 66.2    1e-08   
gb|ABK26099.1|  unknown                                               66.2    1e-08   Picea sitchensis
ref|XP_007226510.1|  hypothetical protein PRUPE_ppa025866mg           65.9    2e-08   
ref|XP_008222217.1|  PREDICTED: proline-rich protein 4                65.9    2e-08   
ref|XP_003576722.2|  PREDICTED: uncharacterized protein LOC100821140  64.7    3e-08   
ref|XP_006856325.1|  hypothetical protein AMTR_s00047p00152060        64.7    3e-08   
ref|NP_001140928.1|  hypothetical protein precursor                   63.9    4e-08   Zea mays [maize]
ref|XP_004140544.1|  PREDICTED: uncharacterized protein LOC101219402  65.1    5e-08   
ref|XP_009600627.1|  PREDICTED: major pollen allergen Lol p 11-like   62.4    6e-08   
ref|XP_002964293.1|  hypothetical protein SELMODRAFT_438958           62.8    3e-07   
ref|XP_009797814.1|  PREDICTED: major pollen allergen Lol p 11-like   60.5    3e-07   
ref|XP_004492161.1|  PREDICTED: major pollen allergen Ole e 1-like    60.5    3e-07   
ref|XP_002966791.1|  hypothetical protein SELMODRAFT_439721           62.8    3e-07   
ref|XP_004170598.1|  PREDICTED: uncharacterized protein LOC101229108  62.0    3e-07   
ref|XP_008459888.1|  PREDICTED: leucine-rich repeat extensin-like...  62.4    4e-07   
gb|KHF98099.1|  Major pollen allergen Lol p 11                        60.1    4e-07   
ref|XP_009412767.1|  PREDICTED: proline-rich protein 4-like           61.2    5e-07   
ref|XP_002968741.1|  hypothetical protein SELMODRAFT_409806           61.6    6e-07   
ref|XP_006447015.1|  hypothetical protein CICLE_v10016966mg           59.3    6e-07   
ref|XP_002299330.2|  hypothetical protein POPTR_0001s13450g           60.5    7e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011036125.1|  PREDICTED: leucine-rich repeat extensin-like...  61.2    7e-07   
gb|EEE70019.1|  hypothetical protein OsJ_29955                        60.1    8e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84856.1|  hypothetical protein OsI_31975                        60.1    8e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_003622081.1|  hypothetical protein MTR_7g027020                58.9    8e-07   
ref|XP_004231761.1|  PREDICTED: pollen allergen Che a 1               58.9    9e-07   
ref|XP_010103032.1|  hypothetical protein L484_005787                 58.9    9e-07   
ref|XP_006338717.1|  PREDICTED: pollen allergen Che a 1-like isof...  58.9    9e-07   
ref|XP_004304541.1|  PREDICTED: uncharacterized protein LOC101296410  58.5    1e-06   
ref|NP_001063620.1|  Os09g0508200                                     59.3    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007139104.1|  hypothetical protein PHAVU_008G001600g           60.1    2e-06   
ref|XP_004957299.1|  PREDICTED: uncharacterized protein LOC101775204  59.3    2e-06   
ref|XP_011020818.1|  PREDICTED: sulfated surface glycoprotein 185...  60.1    2e-06   
ref|XP_002303768.2|  hypothetical protein POPTR_0003s16550g           59.7    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_008341256.1|  PREDICTED: uncharacterized protein LOC103404151  58.2    2e-06   
ref|NP_001235830.1|  uncharacterized protein LOC100500029 precursor   58.2    2e-06   
ref|XP_008450135.1|  PREDICTED: major pollen allergen Ole e 1-like    57.8    2e-06   
ref|XP_002300128.1|  hypothetical protein POPTR_0001s33380g           57.8    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_003551861.1|  PREDICTED: leucine-rich repeat extensin-like...  58.9    3e-06   
ref|XP_002514867.1|  hydrolase, acting on ester bonds, putative       59.3    3e-06   Ricinus communis
ref|XP_006442530.1|  hypothetical protein CICLE_v10024378mg           57.0    3e-06   
ref|XP_008804096.1|  PREDICTED: leucine-rich repeat extensin-like...  58.5    4e-06   
ref|XP_007215048.1|  hypothetical protein PRUPE_ppa012112mg           57.0    4e-06   
gb|KHF99541.1|  Major pollen allergen Pla l 1                         56.2    5e-06   
ref|XP_003549067.1|  PREDICTED: major pollen allergen Ole e 1-like    56.6    5e-06   
ref|XP_010530959.1|  PREDICTED: uncharacterized protein LOC104807398  58.2    5e-06   
ref|XP_003530903.1|  PREDICTED: actin cytoskeleton-regulatory com...  57.8    5e-06   
gb|KHN24972.1|  Olee1-like protein                                    57.8    5e-06   
emb|CDX91146.1|  BnaC02g04510D                                        57.8    5e-06   
ref|XP_002990583.1|  hypothetical protein SELMODRAFT_448085           59.7    6e-06   
ref|XP_009125887.1|  PREDICTED: uncharacterized protein LOC103850845  57.8    6e-06   
ref|XP_007161686.1|  hypothetical protein PHAVU_001G089800g           56.2    7e-06   
ref|XP_011045748.1|  PREDICTED: major pollen allergen Ole e 1         55.8    8e-06   
gb|KHN12588.1|  Olee1-like protein                                    57.4    8e-06   
ref|XP_004148007.1|  PREDICTED: major pollen allergen-like            55.8    8e-06   
gb|EAZ04111.1|  hypothetical protein OsI_26257                        56.2    1e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_006373238.1|  hypothetical protein POPTR_0017s09980g           55.5    1e-05   
gb|KDP26854.1|  hypothetical protein JCGZ_18012                       57.4    1e-05   
gb|AFK43957.1|  unknown                                               55.5    1e-05   
ref|XP_002462641.1|  hypothetical protein SORBIDRAFT_02g029420        57.0    1e-05   Sorghum bicolor [broomcorn]
ref|XP_008231068.1|  PREDICTED: uncharacterized protein LOC103330298  55.5    1e-05   
ref|XP_004310230.1|  PREDICTED: uncharacterized protein LOC101309608  57.0    1e-05   
ref|NP_001064312.1|  Os10g0205700                                     56.6    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009378008.1|  PREDICTED: uncharacterized protein LOC103966560  55.5    1e-05   
ref|XP_002977017.1|  hypothetical protein SELMODRAFT_443385           55.8    2e-05   
ref|XP_010682699.1|  PREDICTED: leucine-rich repeat extensin-like...  57.0    2e-05   
ref|XP_010024180.1|  PREDICTED: major pollen allergen Ole e 1-like    55.1    2e-05   
ref|XP_010656997.1|  PREDICTED: extensin                              57.0    2e-05   
ref|XP_010929590.1|  PREDICTED: vegetative cell wall protein gp1-...  56.6    2e-05   
gb|EAY77967.1|  hypothetical protein OsI_33013                        56.2    2e-05   Oryza sativa Indica Group [Indian rice]
gb|ACU17694.1|  unknown                                               54.7    2e-05   Glycine max [soybeans]
gb|KHG27745.1|  Pollen-specific C13                                   54.3    3e-05   
gb|ACJ83911.1|  unknown                                               53.9    4e-05   Medicago truncatula
gb|AFK47865.1|  unknown                                               53.9    4e-05   
ref|XP_010252764.1|  PREDICTED: uncharacterized protein LOC104594245  54.3    4e-05   
gb|KDP41800.1|  hypothetical protein JCGZ_26818                       53.5    4e-05   
ref|XP_002980755.1|  hypothetical protein SELMODRAFT_444621           54.3    4e-05   
gb|AFK46977.1|  unknown                                               53.5    5e-05   
ref|XP_010492060.1|  PREDICTED: uncharacterized protein LOC104769530  55.1    5e-05   
ref|XP_010419879.1|  PREDICTED: uncharacterized protein LOC104705560  54.7    6e-05   
ref|XP_006366520.1|  PREDICTED: olee1-like protein-like               53.1    7e-05   
ref|XP_006856296.1|  hypothetical protein AMTR_s00047p00112050        53.1    8e-05   
ref|NP_001238557.1|  uncharacterized protein LOC100527603 precursor   52.0    8e-05   
emb|CDP13383.1|  unnamed protein product                              54.7    9e-05   
ref|XP_007208803.1|  hypothetical protein PRUPE_ppa024703mg           52.8    9e-05   
ref|XP_009134109.1|  PREDICTED: pollen-specific protein C13           52.4    1e-04   
ref|XP_007210061.1|  hypothetical protein PRUPE_ppa018487mg           52.4    1e-04   
ref|XP_002512897.1|  conserved hypothetical protein                   52.4    1e-04   Ricinus communis
ref|XP_002974776.1|  hypothetical protein SELMODRAFT_414879           53.9    1e-04   
ref|XP_002963687.1|  hypothetical protein SELMODRAFT_405039           53.9    1e-04   
ref|XP_010321468.1|  PREDICTED: LOW QUALITY PROTEIN: major pollen...  52.0    1e-04   
ref|XP_002268073.1|  PREDICTED: pollen-specific protein C13           52.0    1e-04   Vitis vinifera
gb|KFK25544.1|  hypothetical protein AALP_AA8G128700                  53.5    2e-04   
ref|XP_009613032.1|  PREDICTED: uncharacterized protein LOC104106240  52.0    2e-04   
gb|ABO43960.1|  unknown                                               53.1    2e-04   Euphorbia pulcherrima
emb|CAN77170.1|  hypothetical protein VITISV_029841                   54.7    2e-04   Vitis vinifera
ref|XP_010556297.1|  PREDICTED: pollen allergen Che a 1               51.6    2e-04   
ref|XP_010647219.1|  PREDICTED: proline-rich protein 4-like           53.9    2e-04   
ref|XP_010679984.1|  PREDICTED: pollen-specific protein-like At4g...  51.6    2e-04   
ref|XP_008225290.1|  PREDICTED: olee1-like protein                    51.2    3e-04   
ref|XP_007148052.1|  hypothetical protein PHAVU_006G176500g           51.2    3e-04   
ref|XP_002450273.1|  hypothetical protein SORBIDRAFT_05g003010        52.8    3e-04   Sorghum bicolor [broomcorn]
ref|XP_008450951.1|  PREDICTED: olee1-like protein                    51.2    3e-04   
ref|XP_010926790.1|  PREDICTED: leucine-rich repeat extensin-like...  52.8    3e-04   
emb|CDY05022.1|  BnaC03g28200D                                        50.8    3e-04   
emb|CDY12288.1|  BnaA09g24880D                                        50.8    3e-04   
ref|XP_011090511.1|  PREDICTED: major pollen allergen Lol p 11-like   50.8    3e-04   
ref|XP_010025282.1|  PREDICTED: RNA-binding protein 12                52.8    3e-04   
gb|EMS53826.1|  hypothetical protein TRIUR3_00757                     50.4    3e-04   
ref|XP_009415871.1|  PREDICTED: leucine-rich repeat extensin-like...  52.8    4e-04   
ref|XP_003546028.1|  PREDICTED: olee1-like protein-like               50.8    4e-04   
gb|ACU23617.1|  unknown                                               50.4    4e-04   Glycine max [soybeans]
gb|EAZ15608.1|  hypothetical protein OsJ_31017                        52.4    5e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010110924.1|  hypothetical protein L484_005655                 50.4    5e-04   
ref|XP_009785181.1|  PREDICTED: uncharacterized protein LOC104233482  50.4    5e-04   
gb|EMT06446.1|  hypothetical protein F775_22336                       50.1    5e-04   
ref|XP_007025385.1|  Olee1-like protein                               50.4    6e-04   
ref|XP_009421183.1|  PREDICTED: pollen-specific protein C13-like      50.1    7e-04   
ref|XP_011088500.1|  PREDICTED: extensin-like                         52.4    8e-04   
ref|XP_003541705.1|  PREDICTED: olee1-like protein-like               50.1    8e-04   
ref|XP_004144129.1|  PREDICTED: olee1-like protein-like               49.7    8e-04   
ref|XP_010547621.1|  PREDICTED: protein DOWNSTREAM OF FLC             49.7    0.001   
ref|XP_002522879.1|  conserved hypothetical protein                   49.7    0.001   Ricinus communis
ref|XP_009121794.1|  PREDICTED: uncharacterized protein LOC103846599  51.2    0.001   



>ref|XP_007032884.1| Pollen Ole e 1 allergen and extensin family protein [Theobroma 
cacao]
 gb|EOY03810.1| Pollen Ole e 1 allergen and extensin family protein [Theobroma 
cacao]
Length=228

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 142/186 (76%), Gaps = 2/186 (1%)
 Frame = -3

Query  1512  LKMSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             LKMSW  +  LL   +N  +EA R   +AV+VGTVYCDTCF  D S+A+H ISGASVAVE
Sbjct  4     LKMSWFPLILLLSLTINNLSEASRKLHSAVVVGTVYCDTCFQEDISKAAHLISGASVAVE  63

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C    + PSFR+EV+T++HG+F+VHLPFSV KHVKKIK CSVKLI SSEP+CAVASTATS
Sbjct  64    CKDGTSRPSFRQEVRTNEHGDFKVHLPFSVGKHVKKIKRCSVKLIRSSEPYCAVASTATS  123

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADS-PITDPNNPAF  976
             SS+HLK R++G HIFSAGFFTFKPL QP +CNQKPS+    K++N  ++     PN P F
Sbjct  124   SSLHLKSREQGTHIFSAGFFTFKPLKQPNICNQKPSVEDS-KQVNTQNTLRFGQPNFPTF  182

Query  975   LPPIRD  958
              PP+ +
Sbjct  183   PPPLAE  188



>ref|XP_011099048.1| PREDICTED: vegetative cell wall protein gp1-like [Sesamum indicum]
Length=354

 Score =   241 bits (615),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 149/189 (79%), Gaps = 7/189 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVL--NGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW      +CF    N  +EA+  +  P+AV+VGTVYCDTCFH DF +ASHFISGASVA
Sbjct  1     MSWFLTLIFICFTFSSNYLSEAKHQKKLPSAVVVGTVYCDTCFHQDFPKASHFISGASVA  60

Query  1338  VECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             +EC  + + PSFR+EVKT+ +GEFR+HLPFSVSKH +KI+GCSV+L++S+EPFCAVA+TA
Sbjct  61    LECNDTSSRPSFRQEVKTNKNGEFRIHLPFSVSKHARKIRGCSVRLLSSNEPFCAVAATA  120

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGAD--SPITDPNN  985
             TSSS++LK RK G HIFSAGFFTFKPL QP +C+QKPS    FKK++     SPI +P++
Sbjct  121   TSSSLNLKSRKRGTHIFSAGFFTFKPLKQPLICDQKPSTE-NFKKLSSPQKLSPIDNPDD  179

Query  984   PAFLPPIRD  958
             PAF PP+RD
Sbjct  180   PAFPPPLRD  188



>ref|XP_009803847.1| PREDICTED: vegetative cell wall protein gp1 [Nicotiana sylvestris]
Length=403

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 142/194 (73%), Gaps = 8/194 (4%)
 Frame = -3

Query  1515  KLKMSWVRITFLLCFVL-------NGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFI  1357
             K ++SWV I  L   V         G T   ++ P AV+ GTV+CDTCF   FS ASHFI
Sbjct  3     KSRISWVWIVLLFLGVTFHNFSTTQGRTTRHKHHPTAVIEGTVFCDTCFQQQFSGASHFI  62

Query  1356  SGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFC  1177
             SGA+VAVEC  S    SF KEVKT++HG+F V LP SVSKHVKKIKGCSVKLI SS+P+C
Sbjct  63    SGATVAVECADSARRSSFYKEVKTNEHGKFSVDLPISVSKHVKKIKGCSVKLIKSSDPYC  122

Query  1176  AVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKING-ADSPI  1000
             AVASTATSSS+HLK RK+G HIFSAGFFTFKPLNQP+LC+QKPSI    KK+     S I
Sbjct  123   AVASTATSSSLHLKSRKQGTHIFSAGFFTFKPLNQPDLCSQKPSIQSSKKKLTDPQKSAI  182

Query  999   TDPNNPAFLPPIRD  958
             ++PN+P F PPI+D
Sbjct  183   SNPNDPTFYPPIQD  196



>gb|KDO72303.1| hypothetical protein CISIN_1g019020mg [Citrus sinensis]
Length=347

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 146/191 (76%), Gaps = 8/191 (4%)
 Frame = -3

Query  1512  LKMSWVRITFLLCFVLNGFTEAR-----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGA  1348
             +KMSW  + F L F++ G  EA      +  P+AV+VGTVYCDTCF  +FS+ASHFISGA
Sbjct  1     MKMSWFYLIFFLSFII-GNLEAESNHHEKRHPSAVVVGTVYCDTCFQDNFSKASHFISGA  59

Query  1347  SVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVA  1168
             SVAVEC    + PSFR+EVKTD+HGEF+V LPFSVSKHVKKI  CSVKLINSSEP+C VA
Sbjct  60    SVAVECKDETSKPSFRQEVKTDEHGEFKVDLPFSVSKHVKKINRCSVKLINSSEPYCGVA  119

Query  1167  STATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPN  988
             STATSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPS+      +N  ++ +   +
Sbjct  120   STATSSSLHLKSRKQGIHIFSAGFFTFKPLKQPNLCNQKPSLENS-TSLNSEEASLPPFD  178

Query  987   NPA-FLPPIRD  958
             +P+ F PPI+D
Sbjct  179   SPSTFPPPIQD  189



>ref|XP_006338330.1| PREDICTED: vegetative cell wall protein gp1-like [Solanum tuberosum]
Length=378

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 144/193 (75%), Gaps = 8/193 (4%)
 Frame = -3

Query  1512  LKMSWVRITFL-LCFVLNGFTEAR------RYPPAAVLVGTVYCDTCFHHDFSEASHFIS  1354
             +++SWV I  L L F  +  + +R      R+   AV+ GTV+CDTCF   FS ASHFIS
Sbjct  4     IRISWVWIVVLFLGFTFHNLSTSRAKSTRHRHHSTAVVEGTVFCDTCFQQQFSGASHFIS  63

Query  1353  GASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCA  1174
             GA+VAVEC  S    SF KEVKT++HG+F V LP SVSKHVKKIKGCSVKLI SSEP+CA
Sbjct  64    GATVAVECADSVRRSSFYKEVKTNEHGKFSVDLPISVSKHVKKIKGCSVKLIKSSEPYCA  123

Query  1173  VASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKING-ADSPIT  997
             VASTATSSS+HLK RK+G HIFSAGFFTFKPLNQP+LC+QKPSI    KK+     S I+
Sbjct  124   VASTATSSSLHLKSRKQGTHIFSAGFFTFKPLNQPDLCSQKPSIQNSKKKLTDPQKSAIS  183

Query  996   DPNNPAFLPPIRD  958
             +PN+P F PPI+D
Sbjct  184   NPNDPTFYPPIQD  196



>ref|XP_006430959.1| hypothetical protein CICLE_v10012100mg [Citrus clementina]
 gb|ESR44199.1| hypothetical protein CICLE_v10012100mg [Citrus clementina]
Length=347

 Score =   234 bits (596),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 148/192 (77%), Gaps = 10/192 (5%)
 Frame = -3

Query  1512  LKMSWVRITFLLCFVLNGFTEA------RRYPPAAVLVGTVYCDTCFHHDFSEASHFISG  1351
             +KMSW  + F L F++ G  EA      +R+P +A++VGTVYCDTCF  +FS+ASHFISG
Sbjct  1     MKMSWFYLIFFLSFII-GNLEAESNHHEKRHP-SAIVVGTVYCDTCFQDNFSKASHFISG  58

Query  1350  ASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAV  1171
             ASVAVEC    + PSFR+EVKTD+HGEF+V LPFSVSKHVKKI  CSVKLINSSEP+C V
Sbjct  59    ASVAVECKDETSKPSFRQEVKTDEHGEFKVDLPFSVSKHVKKINRCSVKLINSSEPYCGV  118

Query  1170  ASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDP  991
             ASTATSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPS+      +N  ++ +   
Sbjct  119   ASTATSSSLHLKSRKQGIHIFSAGFFTFKPLKQPNLCNQKPSLENS-TSLNSEEASLPPF  177

Query  990   NNPA-FLPPIRD  958
             ++P+ F PPI+D
Sbjct  178   DSPSTFPPPIQD  189



>ref|XP_009586796.1| PREDICTED: vegetative cell wall protein gp1 [Nicotiana tomentosiformis]
Length=403

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 140/194 (72%), Gaps = 8/194 (4%)
 Frame = -3

Query  1515  KLKMSWVRITFLLCFVL-------NGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFI  1357
             K ++SWV I  L   V           T   R+   AV+ GTV+CDTCF   FS ASHFI
Sbjct  3     KSRISWVWIVLLFLGVTFHNLSTSQARTTRHRHHLTAVVEGTVFCDTCFQQQFSGASHFI  62

Query  1356  SGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFC  1177
             SGA+VAVEC +S    SF KEVKT++HG+F V LP SVSKHV KIKGCSVKLI SSEP+C
Sbjct  63    SGATVAVECAESVKRSSFYKEVKTNEHGKFSVDLPISVSKHVNKIKGCSVKLIKSSEPYC  122

Query  1176  AVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKING-ADSPI  1000
             AVASTATSSS+HLK RK+G HIFSAGFFTFKPLNQP+LC+QKPSI    KK+     S I
Sbjct  123   AVASTATSSSLHLKSRKQGTHIFSAGFFTFKPLNQPDLCSQKPSIQSSKKKLTDPQKSAI  182

Query  999   TDPNNPAFLPPIRD  958
             ++PN+P F PPI+D
Sbjct  183   SNPNDPTFYPPIQD  196



>ref|XP_006482439.1| PREDICTED: proline-rich extensin-like protein EPR1-like [Citrus 
sinensis]
Length=464

 Score =   234 bits (598),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 146/191 (76%), Gaps = 8/191 (4%)
 Frame = -3

Query  1512  LKMSWVRITFLLCFVLNGFTEAR-----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGA  1348
             +KMSW  + F L F++ G  EA      +  P+AV+VGTVYCDTCF  +FS+ASHFISGA
Sbjct  1     MKMSWFYLIFFLSFII-GNLEAESNHHEKRHPSAVVVGTVYCDTCFQDNFSKASHFISGA  59

Query  1347  SVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVA  1168
             SVAVEC    + PSFR+EVKTD+HGEF+V LPFSVSKHVKKI  CSVKLINSSEP+C VA
Sbjct  60    SVAVECKDETSKPSFRQEVKTDEHGEFKVDLPFSVSKHVKKINRCSVKLINSSEPYCGVA  119

Query  1167  STATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPN  988
             STATSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPS+      +N  ++ +   +
Sbjct  120   STATSSSLHLKSRKQGIHIFSAGFFTFKPLKQPNLCNQKPSLENS-TSLNSEEASLPPFD  178

Query  987   NPA-FLPPIRD  958
             +P+ F PPI+D
Sbjct  179   SPSTFPPPIQD  189



>ref|XP_004232133.1| PREDICTED: formin-2 [Solanum lycopersicum]
Length=370

 Score =   231 bits (589),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 143/193 (74%), Gaps = 8/193 (4%)
 Frame = -3

Query  1512  LKMSWVRITFL-LCFVLNGFTEAR------RYPPAAVLVGTVYCDTCFHHDFSEASHFIS  1354
             +++SWV I  L L F  +  + ++      R+   AV+ GTV+CDTCF   FS ASHFIS
Sbjct  4     IRISWVWILVLFLGFTFHNLSTSQAENTRHRHHSTAVIEGTVFCDTCFQQHFSGASHFIS  63

Query  1353  GASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCA  1174
             GA+VAVEC  S    SF KEVKT++HG+F V LP SVSKHVKKIKGCSVKLI SSEP+CA
Sbjct  64    GATVAVECADSVRRSSFYKEVKTNEHGKFSVDLPISVSKHVKKIKGCSVKLIKSSEPYCA  123

Query  1173  VASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKING-ADSPIT  997
             VASTATSSS+HLK R +G HIFSAGFFTFKPLNQP+LC+QKPSI    KK+     S I+
Sbjct  124   VASTATSSSLHLKSRTQGTHIFSAGFFTFKPLNQPDLCSQKPSIQKSKKKLTDPQKSAIS  183

Query  996   DPNNPAFLPPIRD  958
             +PN+P F PPI+D
Sbjct  184   NPNDPTFYPPIQD  196



>ref|XP_010260908.1| PREDICTED: vegetative cell wall protein gp1 [Nelumbo nucifera]
Length=383

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 143/186 (77%), Gaps = 4/186 (2%)
 Frame = -3

Query  1509  KMSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             +M W+ I F    + N  +EA+  +  P+AV+VGTVYCDTCF  DFS  SHFISGASV+V
Sbjct  5     RMFWLLI-FSFGLLFNNLSEAKHEKKLPSAVVVGTVYCDTCFQQDFSRTSHFISGASVSV  63

Query  1335  ECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTAT  1156
             ECG   + PSF +EV+TD+HG+F+VHLPF+VSKHVK IKGCSVKLI+SSEPFCAVASTAT
Sbjct  64    ECGDGGSEPSFHQEVQTDEHGQFKVHLPFAVSKHVKSIKGCSVKLISSSEPFCAVASTAT  123

Query  1155  SSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNPAF  976
             SSS+HLK RK+G HIFSAGFF+FKPL QP+LCNQKP +    K+ +   + ++ P+ P F
Sbjct  124   SSSLHLKSRKQGVHIFSAGFFSFKPLKQPDLCNQKPKLETS-KEFSPKKTGLSSPSLPLF  182

Query  975   LPPIRD  958
              P  +D
Sbjct  183   PPVTQD  188



>gb|KDP24305.1| hypothetical protein JCGZ_25601 [Jatropha curcas]
Length=353

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 140/192 (73%), Gaps = 10/192 (5%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRYP----PAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MS   + F LCF LN    ++  P    P+AV+VGTVYCDTCF  DFS+ S FISGASVA
Sbjct  1     MSCFFVIFFLCFTLNNLNLSQARPLQNLPSAVVVGTVYCDTCFQEDFSKNSRFISGASVA  60

Query  1338  VECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             VEC        F +EVKT++HGEFRVHLPFSVSKHVKKIK CSVKLI+S+EP+CA+ASTA
Sbjct  61    VECRDENAKKGFYQEVKTNNHGEFRVHLPFSVSKHVKKIKKCSVKLISSNEPYCAIASTA  120

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGAD----SPITDP  991
             TSS++HLK RK+G HIFSAGFF+FKP NQP LCNQKPSI    K++N        P + P
Sbjct  121   TSSTLHLKSRKQGIHIFSAGFFSFKPQNQPNLCNQKPSIQDS-KELNSQKISSIPPFSTP  179

Query  990   -NNPAFLPPIRD  958
              +NP F PP+ D
Sbjct  180   ISNPIFPPPLED  191



>ref|XP_006384278.1| hypothetical protein POPTR_0004s11300g [Populus trichocarpa]
 gb|ERP62075.1| hypothetical protein POPTR_0004s11300g [Populus trichocarpa]
Length=365

 Score =   228 bits (582),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 140/185 (76%), Gaps = 3/185 (2%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             M W  I FLL F  N  +EA   +  P+AV+VGTVYCDTCF   FS  SHFISGA VAVE
Sbjct  1     MPWFFIIFLLGFTFNNPSEASHGKKLPSAVVVGTVYCDTCFQEYFSRNSHFISGAHVAVE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C   ++ PSFR+E KTD+HGEF+VHLPFSVSKHVKKIK CSV+L++SSEP+CAVASTATS
Sbjct  61    CKDEKSRPSFREEAKTDEHGEFKVHLPFSVSKHVKKIKRCSVELLSSSEPYCAVASTATS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNPAFL  973
             SS+ LK RKEG HIFSAGFFTFKP  +P LCNQKPSI    ++ +  ++ +   +NP F 
Sbjct  121   SSLRLKSRKEGTHIFSAGFFTFKPEKEPFLCNQKPSIENP-REFSSKEASLPSFDNPTFP  179

Query  972   PPIRD  958
             PP++D
Sbjct  180   PPLQD  184



>ref|XP_010999442.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Populus 
euphratica]
Length=322

 Score =   227 bits (578),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 138/185 (75%), Gaps = 3/185 (2%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             M W  I  LL F     TEA   +  P+AV+VGTVYCDTCF  DF+  SHFISGA VAVE
Sbjct  1     MPWFFIILLLGFTFANPTEASHGKKLPSAVVVGTVYCDTCFQEDFTRNSHFISGARVAVE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C   ++ PSFR+E KTD+HGEF+VHLP SVSKHV+KIK CSV+L++SSEP+CAVASTATS
Sbjct  61    CKDEKSRPSFREEAKTDEHGEFKVHLPLSVSKHVEKIKRCSVELLSSSEPYCAVASTATS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNPAFL  973
             SS+ LK RKEG HIFSAGFFTFKP  QP LCNQKPSI    ++ +  ++ +   +NP F 
Sbjct  121   SSLRLKSRKEGTHIFSAGFFTFKPEKQPFLCNQKPSIENS-REFSSKEASLPPFDNPTFP  179

Query  972   PPIRD  958
             PP++D
Sbjct  180   PPLQD  184



>ref|XP_010999441.1| PREDICTED: vegetative cell wall protein gp1-like isoform X1 [Populus 
euphratica]
Length=343

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 138/185 (75%), Gaps = 3/185 (2%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             M W  I  LL F     TEA   +  P+AV+VGTVYCDTCF  DF+  SHFISGA VAVE
Sbjct  1     MPWFFIILLLGFTFANPTEASHGKKLPSAVVVGTVYCDTCFQEDFTRNSHFISGARVAVE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C   ++ PSFR+E KTD+HGEF+VHLP SVSKHV+KIK CSV+L++SSEP+CAVASTATS
Sbjct  61    CKDEKSRPSFREEAKTDEHGEFKVHLPLSVSKHVEKIKRCSVELLSSSEPYCAVASTATS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNPAFL  973
             SS+ LK RKEG HIFSAGFFTFKP  QP LCNQKPSI    ++ +  ++ +   +NP F 
Sbjct  121   SSLRLKSRKEGTHIFSAGFFTFKPEKQPFLCNQKPSIENS-REFSSKEASLPPFDNPTFP  179

Query  972   PPIRD  958
             PP++D
Sbjct  180   PPLQD  184



>ref|XP_002525926.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36446.1| conserved hypothetical protein [Ricinus communis]
Length=383

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 139/203 (68%), Gaps = 22/203 (11%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEA--RRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             M W  I F LC   N  +EA   +  P+AV+VGTVYCDTCFH DFS+ SHFISGA+VAVE
Sbjct  1     MPWFFIIFFLCSTFNHLSEASHNKKLPSAVVVGTVYCDTCFHEDFSKNSHFISGATVAVE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C    +  SF +EVKTD+HGEFRVHLPFSV KHVK+IK CSVKL++SSEP+CAVASTATS
Sbjct  61    CKDENS--SFHQEVKTDEHGEFRVHLPFSVGKHVKRIKKCSVKLLSSSEPYCAVASTATS  118

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHG---------------GFKKIN  1018
             SS+ LK RK+G HIFSAGFF+FKP  QP LCNQKPSI                 G   I 
Sbjct  119   SSLRLKSRKQGLHIFSAGFFSFKPQKQPNLCNQKPSIQDSKEFNSKKISSIPTIGAGSIP  178

Query  1017  GADSPITD---PNNPAFLPPIRD  958
                SP+ D   PN P   PP++D
Sbjct  179   SVSSPLQDPTIPNLPPVSPPLQD  201



>emb|CDP02346.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   223 bits (568),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 143/188 (76%), Gaps = 7/188 (4%)
 Frame = -3

Query  1515  KLKMSWV-RITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGAS  1345
             + ++S V R+ F + F     +EAR     P+AV+VG VYCDTCF   FS+ SHFISGAS
Sbjct  5     RRRLSLVCRLIFFISF---ASSEARTPEKLPSAVVVGAVYCDTCFQQGFSKDSHFISGAS  61

Query  1344  VAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAS  1165
             VAVECG+  + PSFR+  KT++HGEF+VHLP SVSKHVKKIKGCSVKLI+SSEP+CAVAS
Sbjct  62    VAVECGEENSKPSFREVAKTNEHGEFKVHLPLSVSKHVKKIKGCSVKLISSSEPYCAVAS  121

Query  1164  TATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGAD-SPITDPN  988
             TATSS +HL+ RK+G HIFSAGFF+FKPLNQP LC QKP I    +  N A  + I+DP+
Sbjct  122   TATSSPVHLRSRKDGTHIFSAGFFSFKPLNQPALCVQKPIISRSNELPNTAKLTSISDPD  181

Query  987   NPAFLPPI  964
             +P F PP+
Sbjct  182   DPNFSPPV  189



>ref|XP_011085586.1| PREDICTED: proline-rich extensin-like protein EPR1 [Sesamum indicum]
Length=368

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 142/186 (76%), Gaps = 4/186 (2%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRYP--PAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             MSW      LC      +E + +   P+AV+VGTVYCDTCF  DF +ASHFISGASVAVE
Sbjct  1     MSWFWTIIFLCVAFTISSEGKHHKKHPSAVVVGTVYCDTCFQQDFPKASHFISGASVAVE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C  + + PSF++ VKTD +GEFRVHLPFSVSKHVKKIK C+V+LI+S+EPFCAVA+TA S
Sbjct  61    CKTTSSKPSFQQVVKTDKNGEFRVHLPFSVSKHVKKIKKCAVQLISSNEPFCAVAATAAS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSP-ITDPNNPAF  976
             SS+ LK RK G H+FSAGFFTFKPL QPE+CNQKPSI   FK +  AD P + +PN+P F
Sbjct  121   SSLSLKTRKHGTHVFSAGFFTFKPLKQPEICNQKPSI-SSFKNLESADKPSVLNPNDPLF  179

Query  975   LPPIRD  958
              PP++D
Sbjct  180   PPPLQD  185



>ref|XP_010099300.1| hypothetical protein L484_018162 [Morus notabilis]
 gb|EXB77646.1| hypothetical protein L484_018162 [Morus notabilis]
Length=377

 Score =   221 bits (563),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 133/188 (71%), Gaps = 5/188 (3%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRYP--PAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             MSW          ++  +EA+     P+AV+VG VYCDTCF  DF + SHFISGA+VAVE
Sbjct  1     MSWFLTILFTILTISHLSEAKHETKLPSAVVVGRVYCDTCFQADFDKTSHFISGATVAVE  60

Query  1332  CGQSRN-GPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTAT  1156
             C   R+  P F +E KTD  GEF+VHLPF VSKHVKKI+ CSVKLI+SSEP+CAVASTAT
Sbjct  61    CKYGRSEKPVFMEEAKTDKRGEFKVHLPFKVSKHVKKIEECSVKLISSSEPYCAVASTAT  120

Query  1155  SSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNP--  982
             SSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPSI    K     +  I + NNP  
Sbjct  121   SSSLHLKSRKQGTHIFSAGFFTFKPLKQPTLCNQKPSIQNSNKDSQTPNKAILNSNNPYL  180

Query  981   AFLPPIRD  958
              F PP++D
Sbjct  181   EFPPPLQD  188



>ref|XP_007215343.1| hypothetical protein PRUPE_ppa005351mg [Prunus persica]
 gb|EMJ16542.1| hypothetical protein PRUPE_ppa005351mg [Prunus persica]
Length=465

 Score =   223 bits (568),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 123/160 (77%), Gaps = 4/160 (3%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW      L   L+  T +     +  P+AV+VGTVYCDTCF  +FS ASHFISGASV 
Sbjct  1     MSWFFTVLFLISTLSLSTPSEASHEKKTPSAVVVGTVYCDTCFQAEFSHASHFISGASVG  60

Query  1338  VECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             VEC    + PSF+ EVKTD HG FRVHLPFSVSKHVKKI+GCSVKLI+SSEP+CAVAS A
Sbjct  61    VECKDGSSKPSFQTEVKTDSHGVFRVHLPFSVSKHVKKIEGCSVKLISSSEPYCAVASIA  120

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIH  1039
             TSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPSI 
Sbjct  121   TSSSLHLKSRKQGTHIFSAGFFTFKPLKQPSLCNQKPSIQ  160



>ref|XP_008230302.1| PREDICTED: proline-rich receptor-like protein kinase PERK2 isoform 
X2 [Prunus mume]
Length=366

 Score =   219 bits (557),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW          L+  T +     +  P+AV+VGTVYCDTCF  +FS ASHFISGASV 
Sbjct  1     MSWFFTVLFFISTLSLVTPSEASHEKKHPSAVVVGTVYCDTCFQAEFSHASHFISGASVG  60

Query  1338  VECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             VEC    + PSF+ EVKTD HG FRV LPFSVSKHVKKI+GCSVKLI+SSEP+CAVASTA
Sbjct  61    VECKDGSSKPSFQTEVKTDSHGVFRVQLPFSVSKHVKKIEGCSVKLISSSEPYCAVASTA  120

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIH  1039
             TSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPSI 
Sbjct  121   TSSSLHLKSRKQGTHIFSAGFFTFKPLKQPSLCNQKPSIQ  160



>ref|XP_008230301.1| PREDICTED: formin-2-like isoform X1 [Prunus mume]
Length=419

 Score =   219 bits (559),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW          L+  T +     +  P+AV+VGTVYCDTCF  +FS ASHFISGASV 
Sbjct  1     MSWFFTVLFFISTLSLVTPSEASHEKKHPSAVVVGTVYCDTCFQAEFSHASHFISGASVG  60

Query  1338  VECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             VEC    + PSF+ EVKTD HG FRV LPFSVSKHVKKI+GCSVKLI+SSEP+CAVASTA
Sbjct  61    VECKDGSSKPSFQTEVKTDSHGVFRVQLPFSVSKHVKKIEGCSVKLISSSEPYCAVASTA  120

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIH  1039
             TSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPSI 
Sbjct  121   TSSSLHLKSRKQGTHIFSAGFFTFKPLKQPSLCNQKPSIQ  160



>ref|XP_004491943.1| PREDICTED: formin-like protein 3-like [Cicer arietinum]
Length=361

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 140/192 (73%), Gaps = 10/192 (5%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEA---RRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             MSW  +   L      F+EA   ++  P+AV+VGTVYCDTCF  DFS  SHFISGASV V
Sbjct  1     MSWFLVILFLIVTFGSFSEASHDKKPLPSAVVVGTVYCDTCFQQDFSMDSHFISGASVEV  60

Query  1335  EC--GQSRNGPS--FRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVA  1168
             EC  G   + P+  F+K+VKT+ HGEFRV LPFSVSKHVKKIKGC VKLI+S+EP+CAVA
Sbjct  61    ECKDGNKISKPTRRFKKQVKTNKHGEFRVQLPFSVSKHVKKIKGCVVKLISSNEPYCAVA  120

Query  1167  STATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKP--SIHGGFKKINGADSPITD  994
             STATSSS+HLK +K+G HIFSAGFF+FKPL QP LCNQKP    H  F  +  + S I +
Sbjct  121   STATSSSLHLKSKKQGLHIFSAGFFSFKPLKQPNLCNQKPKNKNHHLFDSLKTS-SYIPN  179

Query  993   PNNPAFLPPIRD  958
               +P+F PP++D
Sbjct  180   YIDPSFQPPLQD  191



>gb|KHN30305.1| hypothetical protein glysoja_037816 [Glycine soja]
Length=345

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 138/190 (73%), Gaps = 10/190 (5%)
 Frame = -3

Query  1506  MSWVRITFLLCFVL---NGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             MSW  +T  L       +  T   +  P+AV+VGTVYCDTCF  DFS  +HFISGASVAV
Sbjct  1     MSWFLVTLFLSLTFGTTHSETSHHKKLPSAVVVGTVYCDTCFQQDFSMGNHFISGASVAV  60

Query  1335  EC--GQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             EC  G  R+ P FRKEVKTD+HGEF+V LPFSVSKHVK+IKGC+VKLINSSEP+CAVAS 
Sbjct  61    ECKDGYGRSKPRFRKEVKTDEHGEFKVQLPFSVSKHVKRIKGCTVKLINSSEPYCAVASA  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHG--GFKKINGADSPITDPN  988
             ATSSS+ LK RK+G+HIFSAGFF+FKPL QP LCNQKPSI    G   +     P  D  
Sbjct  121   ATSSSLRLKSRKQGQHIFSAGFFSFKPLRQPNLCNQKPSIQNIKGLDYVKHIFPPKID--  178

Query  987   NPAFLPPIRD  958
              P+F PP++D
Sbjct  179   -PSFPPPLQD  187



>ref|XP_003530454.1| PREDICTED: proline-rich extensin-like protein EPR1-like [Glycine 
max]
Length=345

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 138/188 (73%), Gaps = 6/188 (3%)
 Frame = -3

Query  1506  MSWVRITFLLCFVL---NGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             MSW  +   L       +  T   +  P+AV+VGTVYCDTCF  DFS  +HFISGASVAV
Sbjct  1     MSWFLVILFLSLTFGTTHSETSHHKKLPSAVVVGTVYCDTCFQQDFSMGNHFISGASVAV  60

Query  1335  EC--GQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             EC  G  R+ P FRKEVKTDDHGEF+V LPFSVSKHVK+IKGC+VKLINSSEP+CAVAS 
Sbjct  61    ECKDGYGRSKPRFRKEVKTDDHGEFKVQLPFSVSKHVKRIKGCTVKLINSSEPYCAVASA  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNP  982
             ATSSS+ LK RK+G+HIFSAGFF+FKPL QP LCNQKPSI    K ++ A        +P
Sbjct  121   ATSSSLRLKSRKQGQHIFSAGFFSFKPLRQPNLCNQKPSIQ-NIKGLDYAKHIFPPKIDP  179

Query  981   AFLPPIRD  958
             +F PP++D
Sbjct  180   SFPPPLQD  187



>ref|XP_008230300.1| PREDICTED: collagen alpha-2(IV) chain-like [Prunus mume]
Length=360

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -3

Query  1443  RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFR  1264
             + PP+AV+VGTVYCDTCF  +FS ASHFISGASV VEC    + PSF+ EVKTD HG FR
Sbjct  26    KKPPSAVVVGTVYCDTCFQAEFSHASHFISGASVGVECKDGSSKPSFQAEVKTDSHGVFR  85

Query  1263  VHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFTFK  1084
             VHLPFSVSK +KKI+GCSVKLI+SSEP+CAVAST TSSS+HLK  ++G HIFSAGFF+FK
Sbjct  86    VHLPFSVSKRIKKIEGCSVKLISSSEPYCAVASTTTSSSLHLKSSEQGTHIFSAGFFSFK  145

Query  1083  PLNQPELCNQKPSI  1042
             PL QP LCNQKPSI
Sbjct  146   PLKQPSLCNQKPSI  159



>ref|XP_007032885.1| Pollen Ole e 1 allergen and extensin family protein [Theobroma 
cacao]
 gb|EOY03811.1| Pollen Ole e 1 allergen and extensin family protein [Theobroma 
cacao]
Length=323

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  1431  AAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLP  1252
             +AV+VGTVYCDTCF  +FS  S+FISGASVAVEC    + PSFR+EVKT++HGEF++HLP
Sbjct  27    SAVVVGTVYCDTCFQEEFSRTSYFISGASVAVECKDGTSRPSFRQEVKTNEHGEFKIHLP  86

Query  1251  FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQ  1072
             FSVSKHVKKIKGCSVKLI S EP+CAVASTATSSS+HLK R  G HIFSAGFFTFKPL Q
Sbjct  87    FSVSKHVKKIKGCSVKLIRSREPYCAVASTATSSSLHLKSRMHGTHIFSAGFFTFKPLKQ  146

Query  1071  PELCNQKPSIH  1039
             P LC+QKPS  
Sbjct  147   PTLCSQKPSTQ  157



>ref|XP_007139401.1| hypothetical protein PHAVU_008G026300g [Phaseolus vulgaris]
 gb|ESW11395.1| hypothetical protein PHAVU_008G026300g [Phaseolus vulgaris]
Length=345

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 134/191 (70%), Gaps = 12/191 (6%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEA----RRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW  +   L     G T +    +R  P+AV+VGTVYCDTCF  DFS  +HFISGASVA
Sbjct  1     MSWFLVILFLSLTF-GTTRSEGSYKRKLPSAVVVGTVYCDTCFQQDFSMGNHFISGASVA  59

Query  1338  VEC--GQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAS  1165
             VEC  G     P FRKEVKTD HGEF+V LPFSVSKHVK IKGC+VKLINSSEP+CAVAS
Sbjct  60    VECKDGYGTTKPRFRKEVKTDKHGEFKVQLPFSVSKHVKSIKGCTVKLINSSEPYCAVAS  119

Query  1164  TATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHG--GFKKINGADSPITDP  991
              ATSSS+ LK RK+G HIFSAGFF+FKPL QP LCNQKPSI    G   +     P  D 
Sbjct  120   AATSSSLRLKSRKQGLHIFSAGFFSFKPLKQPNLCNQKPSIQNMKGLDSVKTISYPKLD-  178

Query  990   NNPAFLPPIRD  958
               P+F PP++D
Sbjct  179   --PSFPPPLQD  187



>ref|XP_006373407.1| hypothetical protein POPTR_0017s13490g [Populus trichocarpa]
 gb|ERP51204.1| hypothetical protein POPTR_0017s13490g [Populus trichocarpa]
Length=410

 Score =   208 bits (529),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 136/186 (73%), Gaps = 4/186 (2%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRYP---PAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             M W  I FLL    N  +    +    P+AV+VGTV+CDTCF   FS  SHFISGASVAV
Sbjct  1     MPWFFIIFLLSCTFNNLSAEASHGKKLPSAVVVGTVFCDTCFQEAFSRNSHFISGASVAV  60

Query  1335  ECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTAT  1156
             EC    + P FR+EVKTD+HGEF+VHLPFSVSKHVKKIK CSVKL++SSEPFCAVAS+AT
Sbjct  61    ECKDEESRPGFREEVKTDEHGEFKVHLPFSVSKHVKKIKRCSVKLLSSSEPFCAVASSAT  120

Query  1155  SSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNPAF  976
             SSS+HLK RK+G HIFS+GFFTFKP  QP LCNQKPS     ++ +   + +   +NP F
Sbjct  121   SSSLHLKSRKQGTHIFSSGFFTFKPEKQPILCNQKPSTENS-REFSSRKASLPSIDNPTF  179

Query  975   LPPIRD  958
              PP++D
Sbjct  180   PPPLQD  185



>gb|KHN46667.1| hypothetical protein glysoja_045665 [Glycine soja]
Length=337

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 140/192 (73%), Gaps = 14/192 (7%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW  +   L     G T +     +  P+AV+VGTVYCDTCF  DFS  +HFISGASVA
Sbjct  1     MSWFLVILFLSLTF-GITHSEASHDKKLPSAVVVGTVYCDTCFQQDFSTGNHFISGASVA  59

Query  1338  VEC--GQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAS  1165
             VEC  G  R+ P FRKEVKTD+HGEF+V LPFSVSKHVK+IKGC+VKLINSSEP+CAVAS
Sbjct  60    VECKDGYGRSKPRFRKEVKTDEHGEFKVQLPFSVSKHVKRIKGCTVKLINSSEPYCAVAS  119

Query  1164  TATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGAD--SPITDP  991
              ATSSS+ LK RKEG HIFSAGFF+FKPL QP LCNQKPSI    + I G D    I  P
Sbjct  120   AATSSSLCLKSRKEGLHIFSAGFFSFKPLRQPVLCNQKPSI----QNIKGPDYVKHIFPP  175

Query  990   N-NPAFLPPIRD  958
               +P+F PP+++
Sbjct  176   KIDPSFPPPLQN  187



>ref|XP_008348098.1| PREDICTED: uncharacterized protein LOC103411228 [Malus domestica]
Length=253

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 125/169 (74%), Gaps = 6/169 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVL--NGFTEA--RRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW +    L   L  +  +EA      P+AV+VGTVYCDTCF  DFS  SHFISGASV 
Sbjct  1     MSWFQTVIFLVTTLTFHAPSEASYEEIQPSAVVVGTVYCDTCFQEDFSNTSHFISGASVG  60

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   +   PSF  +VKT+ HG+F+VHLPFSVSK VKKI+GCSVKLI SSEP+CAVAS+
Sbjct  61    VECKDGTSTKPSFNAQVKTNSHGQFKVHLPFSVSKDVKKIEGCSVKLIRSSEPYCAVASS  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKING  1015
              TSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPSI    KK+N 
Sbjct  121   XTSSSLHLKARKQGTHIFSAGFFTFKPLKQPSLCNQKPSIQNS-KKLNS  168



>ref|XP_010660567.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Vitis 
vinifera]
 emb|CBI16929.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 138/186 (74%), Gaps = 8/186 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEA---RRYP---PAAVLVGTVYCDTCFHHDFSEASHFISGAS  1345
             MSW  + F+LCF     + A   ++ P   P+AV+VGTV+CDTCF  DFS+ SHFISGAS
Sbjct  1     MSWFTMIFILCFTFIDPSVADHGKKVPSSSPSAVVVGTVFCDTCFQEDFSKTSHFISGAS  60

Query  1344  VAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAS  1165
             V VECG     PSF+KE KT++HG F+VHLP SVSKHV+KIK CSV+LI+SSEP+C+VAS
Sbjct  61    VVVECGDGSLKPSFQKEAKTNEHGVFKVHLPISVSKHVRKIKRCSVRLISSSEPYCSVAS  120

Query  1164  TATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNN  985
             TATSSS+ LK RK+G HIFSAGFF+FKPL QP LCNQKPS+  G  K  G+   +  PN+
Sbjct  121   TATSSSLRLKSRKQGIHIFSAGFFSFKPLKQPYLCNQKPSV--GNSKQLGSIKSLYPPND  178

Query  984   PAFLPP  967
             P   PP
Sbjct  179   PIQFPP  184



>ref|XP_009594727.1| PREDICTED: proline-rich extensin-like protein EPR1 [Nicotiana 
tomentosiformis]
Length=347

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = -3

Query  1518  KKLKMSWVRITFL-LCFVLNGFTEAR---RYPPAAVLVGTVYCDTCFHHDFSEASHFISG  1351
             K++   W+   FL   F     ++AR    + P AV++GTV CD C+  DFS+ASHFISG
Sbjct  4     KRISWFWIINLFLGFSFYNLSVSQARPISSHQPTAVVIGTVLCDACYQQDFSKASHFISG  63

Query  1350  ASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAV  1171
             A VAVEC  S    SF +EVKT+ HG+F VHLPF V K+VK+IKGCSVKLINSS+P CAV
Sbjct  64    AIVAVECANSGKRSSFYQEVKTNKHGKFSVHLPFLVDKYVKQIKGCSVKLINSSKPHCAV  123

Query  1170  ASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGF-KKINGADSPITD  994
             AS ATSSS  L  RK+  HIFSAGFFTFKP+NQP+LCNQKPS H  + K++    S  + 
Sbjct  124   ASPATSSSFQLHSRKKRIHIFSAGFFTFKPVNQPKLCNQKPSSHSIYNKEVYVQKSLTST  183

Query  993   PNNPAFLPPIR  961
             PN+P F  PI+
Sbjct  184   PNDPTFSQPIQ  194



>ref|XP_009801372.1| PREDICTED: proline-rich extensin-like protein EPR1 [Nicotiana 
sylvestris]
Length=316

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 132/186 (71%), Gaps = 2/186 (1%)
 Frame = -3

Query  1518  KKLKMSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             K++   W+ I  LL   ++      R+   AV++GTV CD C+  DFS+ASHFI GA VA
Sbjct  4     KRISWFWI-ILHLLNLSVSQARPISRHHLTAVVIGTVLCDACYLQDFSKASHFIPGAIVA  62

Query  1338  VECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             VEC  S    SF +EVKT+ HG+F VHLPF V K+VK+IKGCSVKLI+SS+P CAVAS A
Sbjct  63    VECANSGKRSSFYQEVKTNKHGKFSVHLPFLVDKYVKQIKGCSVKLISSSKPHCAVASPA  122

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGF-KKINGADSPITDPNNP  982
             TSSS  L+ RK+G HIFSAGFFTFKP+NQP+LCNQKPS H  + K++   +S  + PN+P
Sbjct  123   TSSSFQLRSRKKGIHIFSAGFFTFKPVNQPKLCNQKPSSHSTYNKEVYLENSLTSTPNDP  182

Query  981   AFLPPI  964
              F  PI
Sbjct  183   TFSQPI  188



>gb|ACJ85269.1| unknown [Medicago truncatula]
Length=261

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 127/170 (75%), Gaps = 8/170 (5%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR------RYPPAAVLVGTVYCDTCFHHDFSEASHFISGAS  1345
             MSW  +   L      F+EA       + P +AV+VGTVYCDTCF  DFS  +HFISGAS
Sbjct  1     MSWFLVILFLIVTFGTFSEASHHHHHHKKPLSAVVVGTVYCDTCFQQDFSMGNHFISGAS  60

Query  1344  VAVEC--GQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAV  1171
             V VEC  G   + P F+K+VKT++HGEF++ LPFSVSKHVK+IKGC VKL++S+EPFC++
Sbjct  61    VEVECKDGNEISKPRFKKQVKTNEHGEFKIQLPFSVSKHVKRIKGCVVKLVSSNEPFCSI  120

Query  1170  ASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKI  1021
             AS A+SSS+HLK RK+G HIFSAGFF+FKPL QP LCNQKPS+    KK+
Sbjct  121   ASAASSSSLHLKSRKQGLHIFSAGFFSFKPLKQPNLCNQKPSVVQNTKKL  170



>ref|XP_008348099.1| PREDICTED: collagen alpha-2(IV) chain-like [Malus domestica]
Length=384

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 128/167 (77%), Gaps = 5/167 (3%)
 Frame = -3

Query  1506  MSWVRITFL---LCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             MSW+ + FL   L F         +  P+AV+VGTVYCDTCF  DFS  SHFISGA V V
Sbjct  1     MSWLTVIFLVITLTFHTPSEASHEKNDPSAVVVGTVYCDTCFQEDFSHTSHFISGAFVGV  60

Query  1335  ECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             EC   S   PSF+ +VKT+ HG+F+VHLPFSVSKHVKKI+GCSVKLI+SSEP+CAVAS+A
Sbjct  61    ECNDGSSTKPSFKAQVKTNSHGQFKVHLPFSVSKHVKKIEGCSVKLISSSEPYCAVASSA  120

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKIN  1018
             TSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPSI    KK+N
Sbjct  121   TSSSLHLKXRKQGTHIFSAGFFTFKPLKQPGLCNQKPSIQNS-KKLN  166



>ref|XP_011021085.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Populus 
euphratica]
Length=379

 Score =   199 bits (507),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 133/186 (72%), Gaps = 5/186 (3%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRY---PPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             M W  I FLL    N  +    +    P+AV+VGTV+CDTCF   FS  SHFISGASVAV
Sbjct  1     MPWFFIIFLLSCTFNNLSAEASHGKKLPSAVVVGTVFCDTCFQEAFSRNSHFISGASVAV  60

Query  1335  ECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTAT  1156
             EC    + PSFR EVKTD+HGEF+VHLPF VSKHVK+IK CSVKL++SSEP+CAVAS+A 
Sbjct  61    ECKDEESRPSFR-EVKTDEHGEFKVHLPFPVSKHVKEIKRCSVKLLSSSEPYCAVASSAA  119

Query  1155  SSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNPAF  976
             SSS+HLK RK+G  IFSAGFFTFKP  QP LCNQKPSI    ++ +  ++ +   + P F
Sbjct  120   SSSLHLKSRKQGTRIFSAGFFTFKPEKQPILCNQKPSIENS-REFSSREASLPSIDYPTF  178

Query  975   LPPIRD  958
              P ++D
Sbjct  179   PPALQD  184



>ref|XP_009378266.1| PREDICTED: uncharacterized protein LOC103966779 isoform X2 [Pyrus 
x bretschneideri]
Length=254

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 132/189 (70%), Gaps = 7/189 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW      L   L   T +        P+AV+VGTVYCDTCF  DFS  SHFISGASV 
Sbjct  1     MSWFLTVIFLVTTLTFHTPSEASYEEIQPSAVVVGTVYCDTCFQEDFSNTSHFISGASVG  60

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   +   PSF  +VKT+ HG+F++HLPFSVSK VKKI+GCSVKLI+SSEP+CAVAS+
Sbjct  61    VECKDGTSTKPSFNAQVKTNSHGQFKLHLPFSVSKDVKKIEGCSVKLISSSEPYCAVASS  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGAD-SPITDPNN  985
             ATSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPS     KK+N  + S +  P++
Sbjct  121   ATSSSLHLKARKQGTHIFSAGFFTFKPLKQPSLCNQKPSTQNS-KKLNSQEFSEMAFPSS  179

Query  984   PAFLPPIRD  958
                 P + D
Sbjct  180   SQVDPKMTD  188



>ref|XP_010694174.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Beta 
vulgaris subsp. vulgaris]
Length=382

 Score =   199 bits (506),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 131/189 (69%), Gaps = 10/189 (5%)
 Frame = -3

Query  1512  LKMSWVRITFLLCFVLNGFTEARRY--PPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             L+  W     +L   ++  +EAR +   P+AV+VG V+CDTCF  D S+ SH+ISGA+VA
Sbjct  5     LRNCWPLSLVILILTVSCTSEARHHHKKPSAVIVGAVFCDTCFQDDLSKGSHYISGATVA  64

Query  1338  VECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             V C + R+ P F +EVKTD+ G F+V LPFSVSKHVKKI+GC VKL+ SSE +CAVASTA
Sbjct  65    VRCAEGRSRPEFYQEVKTDNQGNFKVQLPFSVSKHVKKIEGCIVKLVKSSEAYCAVASTA  124

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNPA  979
             TSS IHLK +K GKHIFSAGFFTFKP  QP +CNQ+PS+       N   + + D  NP 
Sbjct  125   TSSLIHLKGKKGGKHIFSAGFFTFKPFKQPGVCNQQPSV------TNSQLNSLEDLFNPQ  178

Query  978   F--LPPIRD  958
             +  +P I D
Sbjct  179   YPTIPTIPD  187



>ref|XP_010032567.1| PREDICTED: putative uncharacterized protein FLJ22184 [Eucalyptus 
grandis]
 gb|KCW51966.1| hypothetical protein EUGRSUZ_J01410 [Eucalyptus grandis]
Length=332

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 124/176 (70%), Gaps = 4/176 (2%)
 Frame = -3

Query  1506  MSWVRITFLL---CFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             MSW  I FL     F ++  T   + P + V+VGTVYC+TCF   FS+ASHFI GASVAV
Sbjct  1     MSWFLIAFLFLSFAFSISKATHENKLP-STVVVGTVYCNTCFTQGFSKASHFIPGASVAV  59

Query  1335  ECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTAT  1156
             EC       SF KE KTD+HGEF+V LPFS+ KHV++I+GCSVKLI+SSEP CAVAS  T
Sbjct  60    ECKDGSAKLSFHKEAKTDEHGEFKVSLPFSIGKHVRRIEGCSVKLISSSEPNCAVASPVT  119

Query  1155  SSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPN  988
             SSS+H K RK G H+FSAGFFTFKPL +P+LCN+KPS   G +K     +P  DP 
Sbjct  120   SSSLHFKMRKNGDHVFSAGFFTFKPLQRPKLCNEKPSSEFGSEKDFRFPAPSYDPT  175



>ref|XP_003621548.1| hypothetical protein MTR_7g016950 [Medicago truncatula]
 gb|ABD33344.1| Pollen Ole e 1 allergen and extensin [Medicago truncatula]
 gb|AES77766.1| pollen protein Ole E I-like protein [Medicago truncatula]
Length=465

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 127/171 (74%), Gaps = 9/171 (5%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR-------RYPPAAVLVGTVYCDTCFHHDFSEASHFISGA  1348
             MSW  +   L      F+EA        + P +AV+VGTVYCDTCF  DFS  +HFISGA
Sbjct  1     MSWFLVILFLIVTFGTFSEASHHHHHHHKKPLSAVVVGTVYCDTCFQQDFSMGNHFISGA  60

Query  1347  SVAVEC--GQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCA  1174
             SV VEC  G   + P F+K+VKT++HGEF++ LPFSVSKHVK+IKGC VKL++S+EPFC+
Sbjct  61    SVEVECKDGNEISKPRFKKQVKTNEHGEFKIQLPFSVSKHVKRIKGCVVKLVSSNEPFCS  120

Query  1173  VASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKI  1021
             +AS A+SSS+HLK RK+G HIFSAGFF+FKPL QP LCNQKPS+    KK+
Sbjct  121   IASAASSSSLHLKSRKQGLHIFSAGFFSFKPLKQPNLCNQKPSVVQNTKKL  171



>ref|XP_009378330.1| PREDICTED: formin-2-like [Pyrus x bretschneideri]
Length=372

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 128/167 (77%), Gaps = 5/167 (3%)
 Frame = -3

Query  1506  MSWVRITFL---LCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             MSW+ + FL   L F         +  P+AV+VGTVYCD+CF  DFS  SHFISGASV V
Sbjct  1     MSWLTVIFLVTTLTFHTPSEASHEKNDPSAVVVGTVYCDSCFQEDFSHTSHFISGASVDV  60

Query  1335  ECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             EC   S   PSF+ +VKT+ HG+F+VHLPFSVSK VKKI+GCSVKLI+SSEP+CAVAS+A
Sbjct  61    ECKDGSSTKPSFKAQVKTNSHGQFKVHLPFSVSKQVKKIEGCSVKLISSSEPYCAVASSA  120

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKIN  1018
             TSSS+HLK RK+G H+FSAGFFTFKPL QP LCNQKPSI    KK+N
Sbjct  121   TSSSLHLKARKQGTHVFSAGFFTFKPLKQPGLCNQKPSIQNS-KKLN  166



>ref|XP_009378265.1| PREDICTED: uncharacterized protein LOC103966779 isoform X1 [Pyrus 
x bretschneideri]
Length=267

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 132/189 (70%), Gaps = 7/189 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW      L   L   T +        P+AV+VGTVYCDTCF  DFS  SHFISGASV 
Sbjct  1     MSWFLTVIFLVTTLTFHTPSEASYEEIQPSAVVVGTVYCDTCFQEDFSNTSHFISGASVG  60

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   +   PSF  +VKT+ HG+F++HLPFSVSK VKKI+GCSVKLI+SSEP+CAVAS+
Sbjct  61    VECKDGTSTKPSFNAQVKTNSHGQFKLHLPFSVSKDVKKIEGCSVKLISSSEPYCAVASS  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGAD-SPITDPNN  985
             ATSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPS     KK+N  + S +  P++
Sbjct  121   ATSSSLHLKARKQGTHIFSAGFFTFKPLKQPSLCNQKPSTQNS-KKLNSQEFSEMAFPSS  179

Query  984   PAFLPPIRD  958
                 P + D
Sbjct  180   SQVDPKMTD  188



>gb|EYU39348.1| hypothetical protein MIMGU_mgv1a010319mg [Erythranthe guttata]
Length=316

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 128/178 (72%), Gaps = 9/178 (5%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECG  1327
             MSW      L F  +  +E      +AV+VGTVYC TCF  +   AS FI GASV V+C 
Sbjct  1     MSWFWAVIFLTFAFSYSSEGFNKKSSAVVVGTVYCQTCFQQN--SASRFIEGASVVVKCK  58

Query  1326  QSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS  1147
                +  SFR+EVKTD  GEF+V LP S+SKHV KIK CSVKLI+S++P+CAVA+TATSS 
Sbjct  59    DKTS--SFRQEVKTDSRGEFKVDLPLSISKHVNKIKQCSVKLISSNKPYCAVAATATSSR  116

Query  1146  IHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNPAFL  973
             +HLK R +G H+FSAGFFTF+PL +PE+C+QKPSI+G  +KI    SPI++PN+P FL
Sbjct  117   LHLKSRTQGAHVFSAGFFTFRPLKEPEICDQKPSINGD-EKI----SPISNPNDPTFL  169



>ref|XP_008357800.1| PREDICTED: collagen alpha-1(XXVII) chain-like [Malus domestica]
Length=294

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 124/169 (73%), Gaps = 6/169 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW      L   L   T +     +  P+AV+VGTVYCDTCF  DFS  SHFISGASV 
Sbjct  1     MSWFFTVLFLVTALTFHTPSEASHEKNDPSAVVVGTVYCDTCFQEDFSHTSHFISGASVG  60

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   S   PSF+ EVKT+ HG+ +V LPFSVSKHVKKI+GCSVKLI+SSEP+CAVAS+
Sbjct  61    VECKDGSSTKPSFKAEVKTNSHGQIKVQLPFSVSKHVKKIEGCSVKLISSSEPYCAVASS  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKING  1015
             ATSSS+HLK RK+G HIFSAGFFTFKP  QP LCNQKPSI    KK+N 
Sbjct  121   ATSSSLHLKARKQGTHIFSAGFFTFKPPKQPSLCNQKPSIQNS-KKLNS  168



>ref|XP_009378263.1| PREDICTED: LOW QUALITY PROTEIN: collagen alpha-1(XXVII) chain-like 
[Pyrus x bretschneideri]
Length=270

 Score =   191 bits (485),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 122/167 (73%), Gaps = 5/167 (3%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFT---EARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             MSW      L   L   T    +    P+AV VGTVYCDTCF  DFS  SHFISGASV V
Sbjct  1     MSWFLTVIFLVTALTFHTPSEASHENDPSAVAVGTVYCDTCFQEDFSHTSHFISGASVGV  60

Query  1335  ECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             EC   S   PSF+ EVKT+ HG+F+V LPFSVSKHVKKI+GCSVKLI+SSEP+CAVAS+A
Sbjct  61    ECKDGSSTKPSFKAEVKTNSHGQFKVQLPFSVSKHVKKIEGCSVKLISSSEPYCAVASSA  120

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKIN  1018
             TSSS+HLK RK+G HIFSAGFFTFKP  QP LCN+KPSI    K IN
Sbjct  121   TSSSLHLKARKQGTHIFSAGFFTFKPPKQPSLCNRKPSIQNS-KXIN  166



>ref|XP_008353504.1| PREDICTED: uncharacterized protein LOC103417079 isoform X2 [Malus 
domestica]
Length=269

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 129/189 (68%), Gaps = 7/189 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW      L   L   T +        P+AV+VGTVYCDTCF  DFS  SHFISGASV 
Sbjct  1     MSWFLTVIFLVTTLTFHTPSEAIYEEIQPSAVVVGTVYCDTCFQEDFSNTSHFISGASVG  60

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   +   PSF  +VKT+ HG+F+VHLPFSVSK VKKI+GCSVKLI SSEP+CAVAS+
Sbjct  61    VECXDGTSTKPSFNAQVKTNSHGQFKVHLPFSVSKDVKKIEGCSVKLIRSSEPYCAVASS  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGAD-SPITDPNN  985
             ATSSS+HLK  K+G  IFSAGFFTFKPL QP LCNQKPSI    KK+N    S +  P++
Sbjct  121   ATSSSLHLKAXKQGTXIFSAGFFTFKPLKQPSLCNQKPSIQNS-KKLNSQKFSEMAFPSS  179

Query  984   PAFLPPIRD  958
                 P + D
Sbjct  180   SQVDPKMHD  188



>ref|XP_008353505.1| PREDICTED: uncharacterized protein LOC103417079 isoform X3 [Malus 
domestica]
Length=263

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 129/189 (68%), Gaps = 7/189 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW      L   L   T +        P+AV+VGTVYCDTCF  DFS  SHFISGASV 
Sbjct  1     MSWFLTVIFLVTTLTFHTPSEAIYEEIQPSAVVVGTVYCDTCFQEDFSNTSHFISGASVG  60

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   +   PSF  +VKT+ HG+F+VHLPFSVSK VKKI+GCSVKLI SSEP+CAVAS+
Sbjct  61    VECXDGTSTKPSFNAQVKTNSHGQFKVHLPFSVSKDVKKIEGCSVKLIRSSEPYCAVASS  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGAD-SPITDPNN  985
             ATSSS+HLK  K+G  IFSAGFFTFKPL QP LCNQKPSI    KK+N    S +  P++
Sbjct  121   ATSSSLHLKAXKQGTXIFSAGFFTFKPLKQPSLCNQKPSIQNS-KKLNSQKFSEMAFPSS  179

Query  984   PAFLPPIRD  958
                 P + D
Sbjct  180   SQVDPKMHD  188



>ref|XP_008811043.1| PREDICTED: proline-rich protein 4 [Phoenix dactylifera]
Length=277

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 115/154 (75%), Gaps = 3/154 (2%)
 Frame = -3

Query  1500  WVRITFLLCFVLNGFTEAR---RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVEC  1330
             +  +    CF L+G   AR   +Y P+A++VGTVYCDTCFH +FS+ SHFI+GASVAVEC
Sbjct  8     YCLLIISFCFCLHGSLAARHGKKYHPSAMVVGTVYCDTCFHKEFSKPSHFIAGASVAVEC  67

Query  1329  GQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSS  1150
             G      SFRKEVKT+  GEFRV LP  V KH++ I+ CSVKLI S+EPFC++AS+ATS+
Sbjct  68    GDGAAKLSFRKEVKTNRRGEFRVRLPLEVGKHIRLIESCSVKLIRSNEPFCSIASSATSA  127

Query  1149  SIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKP  1048
              + LK R+ G  ++SAGFFTF+PL QPELC QKP
Sbjct  128   GLRLKSRRNGVPVYSAGFFTFRPLKQPELCFQKP  161



>ref|XP_008353503.1| PREDICTED: collectin-12-like isoform X1 [Malus domestica]
Length=278

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 121/168 (72%), Gaps = 6/168 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW      L   L   T +        P+AV+VGTVYCDTCF  DFS  SHFISGASV 
Sbjct  1     MSWFLTVIFLVTTLTFHTPSEAIYEEIQPSAVVVGTVYCDTCFQEDFSNTSHFISGASVG  60

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   +   PSF  +VKT+ HG+F+VHLPFSVSK VKKI+GCSVKLI SSEP+CAVAS+
Sbjct  61    VECXDGTSTKPSFNAQVKTNSHGQFKVHLPFSVSKDVKKIEGCSVKLIRSSEPYCAVASS  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKIN  1018
             ATSSS+HLK  K+G  IFSAGFFTFKPL QP LCNQKPSI    KK+N
Sbjct  121   ATSSSLHLKAXKQGTXIFSAGFFTFKPLKQPSLCNQKPSIQNS-KKLN  167



>gb|KHG02822.1| Major pollen allergen Lig v 1 [Gossypium arboreum]
Length=277

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 126/161 (78%), Gaps = 5/161 (3%)
 Frame = -3

Query  1506  MSWVRITFLLCFVL-NGFTEAR---RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MS    T LLCF++ N ++E     +   +AV+VGTVYCDTCF  D S  +HFISGA+VA
Sbjct  1     MSGFFFTLLLCFIIFNCYSEGSHGYQQQQSAVVVGTVYCDTCFQSDISRPTHFISGATVA  60

Query  1338  VECGQSRNG-PSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   ++   SFR++VKT+ HGEF+VHLPFSVSKHVKKI+GC VKLI SSEP+CAVAS+
Sbjct  61    VECKDGKSSRASFRQQVKTNRHGEFKVHLPFSVSKHVKKIEGCEVKLIKSSEPYCAVASS  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIH  1039
             ATSSS+HLK  K+G H+FSAGFFTFKP  QP LC+QKPS+H
Sbjct  121   ATSSSLHLKSMKQGTHVFSAGFFTFKPFKQPTLCSQKPSVH  161



>gb|KGN52531.1| hypothetical protein Csa_5G642130 [Cucumis sativus]
Length=300

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 120/170 (71%), Gaps = 2/170 (1%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             MSW+ I  LL F     +EAR  R  P+AV+VGTV+CDTC+   FS+ SHFISGA+VAVE
Sbjct  1     MSWLLILLLLNFSFFDLSEARHHRKLPSAVVVGTVFCDTCYQEKFSKTSHFISGATVAVE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             CG     PSFR+EVKTD  GEF+V+LP  VSKHVKKI+ C V+L+ SSEP+C VA+TA S
Sbjct  61    CGNKGPEPSFREEVKTDKRGEFKVNLPVLVSKHVKKIEECYVELVKSSEPYCDVAATAKS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSP  1003
             SS+ LK RK+  H FSAGFFTFKPL QP LCNQKP     F  +     P
Sbjct  121   SSLQLKSRKQNTHTFSAGFFTFKPLKQPNLCNQKPQNPNTFDDMKEIQLP  170



>gb|KHN29758.1| hypothetical protein glysoja_035444 [Glycine soja]
Length=257

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 122/175 (70%), Gaps = 2/175 (1%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             M W  +   L       ++A   +  P+A++VGTVYCDTCF H+FS  SHFISGASVAV+
Sbjct  1     MCWFLLIVFLSLTYGSLSKASYDKKLPSAIVVGTVYCDTCFQHNFSSRSHFISGASVAVK  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C   ++ PSF KEVKT+++GEF+V LPF V K VK+IKGC+ KLI+S+EP C+VAS  TS
Sbjct  61    CKVGKSVPSFNKEVKTNENGEFKVQLPFKVWKQVKRIKGCTFKLISSNEPHCSVASVDTS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPN  988
             SS++LK  K+G+HIFSAG F+FKP+ +P  CNQKPS+      +     P  DP+
Sbjct  121   SSVNLKAIKQGEHIFSAGLFSFKPIKKPNFCNQKPSVPNSKAHVKNEFLPNIDPS  175



>ref|XP_008362215.1| PREDICTED: uncharacterized protein LOC103425895 [Malus domestica]
Length=257

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 121/168 (72%), Gaps = 6/168 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             M W      L   L   T +        P+AV+VGTVYCDTCF  DFS  SHFISGASV 
Sbjct  1     MXWFLTVIFLVTTLXFHTPSEAXYEEIQPSAVVVGTVYCDTCFQEDFSNTSHFISGASVG  60

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   +   PSF  +VKT+ HG+F+VHLPFSVSK VKKI+GCSVKLI SSEP+CAVAS+
Sbjct  61    VECXDGTSTKPSFNAQVKTNSHGQFKVHLPFSVSKDVKKIEGCSVKLIRSSEPYCAVASS  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKIN  1018
             ATSSS+HLK  K+G +IFSAGFFTFKPL QP LCNQKPSI    KK+N
Sbjct  121   ATSSSLHLKATKQGTYIFSAGFFTFKPLKQPSLCNQKPSIQNS-KKLN  167



>ref|XP_009373766.1| PREDICTED: protein app1-like [Pyrus x bretschneideri]
Length=370

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 125/168 (74%), Gaps = 6/168 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW      L   L   T +     +  P+AV+VGTVYCDTCF  DFS  SHFISGASV 
Sbjct  6     MSWFLTVIFLVATLTFHTPSEASQEKNHPSAVVVGTVYCDTCFQEDFSHPSHFISGASVG  65

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   S    SF+ +VKT+ HG+F+V LPFSVSKHVKKI+GCSVKLI+SSEP+CAVAS+
Sbjct  66    VECKDGSSTEQSFKAQVKTNSHGQFKVLLPFSVSKHVKKIEGCSVKLISSSEPYCAVASS  125

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKIN  1018
             ATSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPSI    KK+N
Sbjct  126   ATSSSLHLKARKQGTHIFSAGFFTFKPLKQPTLCNQKPSIQNS-KKLN  172



>ref|XP_003554935.1| PREDICTED: proline-rich protein 4-like [Glycine max]
Length=257

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 120/175 (69%), Gaps = 2/175 (1%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             M W  +   L       +EA   +  P+A++VG VYCDTCF  +FS  SHFISGASVAV+
Sbjct  1     MCWFLLIVFLSLTYGSLSEASYDKKLPSAIVVGIVYCDTCFQQNFSSRSHFISGASVAVK  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C   ++ PSF KEVKTDD+GEF+V LPF V K VK+IK C+ KLI+S+EP C+VAS  TS
Sbjct  61    CKVGKSVPSFNKEVKTDDNGEFKVQLPFKVWKQVKRIKRCTFKLISSNEPHCSVASVDTS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPN  988
             SS++LK  K+G+HIFSAG F+FKP+ +P  CNQKPS+     ++     P  DP+
Sbjct  121   SSVNLKAIKQGEHIFSAGLFSFKPIKKPNFCNQKPSVPNSKARVKNEFLPNIDPS  175



>ref|XP_009378268.1| PREDICTED: collagen and calcium-binding EGF domain-containing 
protein 1-like [Pyrus x bretschneideri]
Length=288

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 123/181 (68%), Gaps = 19/181 (10%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW      L   L   T +        P+AV+VGTVYCDTCF  DFS  SHFISGAS+ 
Sbjct  1     MSWFLTVIFLVTTLTFHTPSEASYEEIQPSAVIVGTVYCDTCFQEDFSNTSHFISGASIG  60

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVA--  1168
             VEC   +   PSF  +VKT+ HG+F+VHLPFSVSK VKKI+GCSVKLI SSEP+CAVA  
Sbjct  61    VECKDGTSTKPSFNAQVKTNSHGQFKVHLPFSVSKDVKKIEGCSVKLIRSSEPYCAVASS  120

Query  1167  -----------STATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKI  1021
                        S+ATSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKP+I    KK+
Sbjct  121   TTSSSLHCAVASSATSSSLHLKARKQGTHIFSAGFFTFKPLKQPSLCNQKPNIQNS-KKL  179

Query  1020  N  1018
             N
Sbjct  180   N  180



>gb|KHG25921.1| Major pollen allergen Lig v 1 [Gossypium arboreum]
Length=224

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -3

Query  1431  AAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLP  1252
             +AV+ GTVYCD CF  DFS+A HFISGASVAVEC    + PSFR+  KT++ GEF+V LP
Sbjct  29    SAVVSGTVYCDICFQQDFSKAHHFISGASVAVECKDGESRPSFRQVAKTNEQGEFKVRLP  88

Query  1251  FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQ  1072
             FSV+KHVKKIKGCSVKL+ SSEP+CAVAS++TSSS+HLK  K+G  +FSAGF +FKPL  
Sbjct  89    FSVTKHVKKIKGCSVKLVRSSEPYCAVASSSTSSSLHLKSTKQGTKVFSAGFLSFKPLKL  148

Query  1071  PELCNQKPSIHGGFKKINGADS-PITDPNNPAFLPPIRD  958
             P LCN+KPS+    K+ N   +     PN P F PP+ D
Sbjct  149   PNLCNRKPSVVADSKEYNTPHTLDFEQPNYPIFPPPLED  187



>gb|KHN29757.1| hypothetical protein glysoja_035443 [Glycine soja]
Length=257

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 121/175 (69%), Gaps = 2/175 (1%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             M W  +   L       +EA   +  P+A++VGTVYCDTCF  +FS  SHFISGASVAV+
Sbjct  1     MCWFLLIVFLSLTYGSLSEASYDKKLPSAIVVGTVYCDTCFQQNFSLRSHFISGASVAVK  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C   ++ PSF KEVKT+++GEF+V LPF V K VK+IKGC+ KLI+S+EP C+VAS  TS
Sbjct  61    CKVGKSVPSFNKEVKTNENGEFKVQLPFKVWKQVKRIKGCTFKLISSNEPHCSVASVDTS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPN  988
             SS++LK  K+G+HIFSAG F+FKP+ +P  CNQKPS+      +     P  DP+
Sbjct  121   SSVNLKAIKQGEHIFSAGLFSFKPIKKPNFCNQKPSVPNSKAHVKNEFLPNIDPS  175



>ref|XP_003554939.1| PREDICTED: pollen-specific protein-like At4g18596-like, partial 
[Glycine max]
Length=161

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             M W  +   L       ++A   +  P+A++VGTVYCDTCF H+FS  SHFISGASVAV+
Sbjct  1     MCWFLLIVFLSLTYGSLSKASYDKKLPSAIVVGTVYCDTCFQHNFSLRSHFISGASVAVK  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C   ++ PSF KEVKT+++GEF+V LPF V K VK+IKGC+ KLI+S+E  C++AS  TS
Sbjct  61    CKVGKSVPSFNKEVKTNENGEFKVQLPFKVWKQVKRIKGCTFKLISSNESHCSIASVDTS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSI  1042
             SS++LK  K+G+HIFSAG F+FKP+ +P  CNQKPS+
Sbjct  121   SSVNLKAIKQGEHIFSAGLFSFKPIKKPNFCNQKPSV  157



>ref|XP_008459405.1| PREDICTED: major pollen allergen Lol p 11 [Cucumis melo]
Length=197

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = -3

Query  1455  TEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTD  1282
             +EAR  R  P+AV++GTV+CDTCF   FS+ SHFISGA+VAVECG     PSFR+EVKTD
Sbjct  18    SEARHHRKLPSAVIIGTVFCDTCFQEKFSKTSHFISGATVAVECGNRGRKPSFREEVKTD  77

Query  1281  DHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSA  1102
               GEF+V+LP  VSKHV+KI+ C V+ I SSEP+C VA+TA SSS+ LK +K+  H FSA
Sbjct  78    KRGEFKVNLPVLVSKHVEKIEECYVESIKSSEPYCDVAATAKSSSLQLKSKKQNTHTFSA  137

Query  1101  GFFTFKPLNQPELCNQKP  1048
             GFFTFKPL QP LCNQKP
Sbjct  138   GFFTFKPLKQPNLCNQKP  155



>ref|XP_004304196.1| PREDICTED: uncharacterized protein LOC101309654 [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 126/168 (75%), Gaps = 6/168 (4%)
 Frame = -3

Query  1506  MSW-VRITFLLCFVLNGFTEA---RRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW + I FL+   L+  +EA   ++  PA V++G VYC+TCF    S++SHFISGASV 
Sbjct  1     MSWFLTIFFLISLTLSTPSEASQEKKLQPA-VVIGKVYCETCFQDGISKSSHFISGASVG  59

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   + + PSF+ +VKTD+ G F+V LPFSVSKHVKKI+GCSVKLI SSEP+CAVAS 
Sbjct  60    VECKDVTSSKPSFQAQVKTDNQGVFKVQLPFSVSKHVKKIEGCSVKLIRSSEPYCAVASA  119

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKIN  1018
             A SSS+HL  RK+G HIFSAGFFTFKPL QP LCNQKPS+    K++ 
Sbjct  120   AASSSLHLTSRKQGTHIFSAGFFTFKPLKQPNLCNQKPSLIRNTKEVT  167



>ref|XP_003554938.1| PREDICTED: uncharacterized protein LOC100779028 [Glycine max]
Length=257

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 119/175 (68%), Gaps = 2/175 (1%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             M W  +   L       +E    +  P+A++VGTVYCD CF  +FS  SHFISGASVAV+
Sbjct  1     MCWFLLFVFLSLTYGSLSETSYDKKLPSAIVVGTVYCDACFQQNFSSRSHFISGASVAVK  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C   ++ PSF KEVKT+++GEF+V LPF V K VK+IKGC+ KLI+S+EP C+VAS  TS
Sbjct  61    CKVGKSVPSFNKEVKTNENGEFKVQLPFKVWKQVKRIKGCTFKLISSNEPHCSVASVDTS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPN  988
             SS++LK  K+G+HIFSAG F+FKP+ +P  CNQKPS+      +     P  DP+
Sbjct  121   SSVNLKAIKQGEHIFSAGLFSFKPIKKPNFCNQKPSVPNSKAHVKNEFLPNIDPS  175



>ref|XP_008342050.1| PREDICTED: vegetative cell wall protein gp1-like [Malus domestica]
Length=390

 Score =   187 bits (475),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 121/168 (72%), Gaps = 6/168 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR----RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             M W      L   L   T +     +  P+AV+VGTVYCDTCF  DFS  SHFISGASV 
Sbjct  1     MYWFLTVIFLVATLTFHTPSEASHEKNHPSAVVVGTVYCDTCFQEDFSHTSHFISGASVG  60

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   S    SF+ +VKT+ HG+F+V LPFSVS HVKKI+GCSVK I+SS+P+CAVAS+
Sbjct  61    VECKDGSSTEQSFKAQVKTNSHGQFKVLLPFSVSXHVKKIEGCSVKJISSSZPYCAVASS  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKIN  1018
             ATSSS+HLK RK+G HIFSAGFFTFKPL QP LCNQKPSI    KK N
Sbjct  121   ATSSSLHLKARKQGTHIFSAGFFTFKPLKQPTLCNQKPSIQNS-KKXN  167



>ref|XP_010936428.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=276

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = -3

Query  1434  PAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHL  1255
             P+A++VGTVYCDTCFH +FS+ S FI+GASVAVECG       FRKEVKT+  GEFRV L
Sbjct  31    PSAMVVGTVYCDTCFHKEFSKPSQFIAGASVAVECGDGATKLGFRKEVKTNRRGEFRVRL  90

Query  1254  PFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFTFKPLN  1075
             P  + KH+K I+ CSVKLI S+EPFC++AS+ATS+ + LK R+ G  ++SAGFFTF+PLN
Sbjct  91    PLDIGKHIKLIESCSVKLIRSNEPFCSMASSATSAGLRLKSRRNGVPVYSAGFFTFRPLN  150

Query  1074  QPELCNQKPSI  1042
             QPELC QKP +
Sbjct  151   QPELCYQKPVL  161



>ref|XP_006593706.1| PREDICTED: uncharacterized protein LOC100808822 [Glycine max]
 gb|KHN02646.1| hypothetical protein glysoja_042809 [Glycine soja]
Length=250

 Score =   180 bits (456),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             M W  +   L  +     EA   +   +AV+VG+VYCDTCF  +FS  +HFISGA+VAVE
Sbjct  1     MCWFLVILFLSLIYASLLEASHDKKLLSAVVVGSVYCDTCFQQNFSTRNHFISGAAVAVE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C   ++ PSF+KEVKT+ HGEF+V LPF V KH K+IKGC+ KLI+SSEP C+VAS ATS
Sbjct  61    CKFGKSVPSFKKEVKTNYHGEFKVKLPFKVWKHAKRIKGCTFKLISSSEPHCSVASLATS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSI  1042
             S + LK  K+G+HIFSAG F+FKP  +P  CN K S+
Sbjct  121   SLVSLKAMKQGEHIFSAGLFSFKPTKKPNFCNHKQSV  157



>ref|XP_009415140.1| PREDICTED: steroidogenic factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009415141.1| PREDICTED: steroidogenic factor 1 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 111/156 (71%), Gaps = 0/156 (0%)
 Frame = -3

Query  1503  SWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQ  1324
             S V   F +    +   +AR   P+AV+VGTVYCDTCFH +FS+ SH ISGASVAVECG 
Sbjct  8     SLVLSLFFIFLCSSAARDARDQSPSAVVVGTVYCDTCFHQEFSKFSHLISGASVAVECGD  67

Query  1323  SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSI  1144
             + +G  +RK V T+  G F V LP  +SKHV  I+ CSVKL+ S+EPFCAVASTAT++ +
Sbjct  68    AASGRGYRKVVTTNRRGVFGVRLPPRISKHVHLIEACSVKLLESNEPFCAVASTATAAGL  127

Query  1143  HLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHG  1036
              LK R+ G H++S GFF+FKPLN+PELC QKP +  
Sbjct  128   RLKSRRRGVHVYSVGFFSFKPLNEPELCYQKPVLEA  163



>ref|XP_008785745.1| PREDICTED: proline-rich protein 4-like [Phoenix dactylifera]
Length=274

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -3

Query  1449  ARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGE  1270
             A    P+AV+VGTVYCDTCF  +FS+ SHFI+GASVAVECG +   PSFRKEVKT+  G 
Sbjct  32    AENRLPSAVVVGTVYCDTCFQKEFSKPSHFIAGASVAVECGNAATKPSFRKEVKTNGRGV  91

Query  1269  FRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFT  1090
             FRV LP  +S+ VK I+ CSV+LI S+ PFC+VAS+A S+ + LK  + G H+FSAGFFT
Sbjct  92    FRVRLPLEISEDVKLIESCSVELIRSNLPFCSVASSAISAGLRLKSIRNGVHVFSAGFFT  151

Query  1089  FKPLNQPELCNQK  1051
             F+P  QPELC+QK
Sbjct  152   FRPSKQPELCDQK  164



>emb|CDX69501.1| BnaA10g18500D [Brassica napus]
Length=360

 Score =   175 bits (444),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 131/192 (68%), Gaps = 15/192 (8%)
 Frame = -3

Query  1500  WVRITFLLCFVLNGFTE------ARRYPPAAVLVGTVYCDTCFHHDFSEA-SHFISGASV  1342
             W  +   L   +NG          ++   +AV+VGTVYCDTCF+  FS++ +H I GA V
Sbjct  10    WFTLMIFLGISINGGLSQGHQHLVKKTRSSAVVVGTVYCDTCFNGAFSKSHNHLIPGAVV  69

Query  1341  AVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             AVEC    + PSFR+EVKTD+HG+F+  LPF+VSKHVKKIK CSVKL++SS+P+C++A++
Sbjct  70    AVECIDENSKPSFRQEVKTDEHGQFKAKLPFTVSKHVKKIKRCSVKLLSSSQPYCSIAAS  129

Query  1161  ATSSSI-HLKERKEGKH--IFSAGFFTFKPLNQPELCNQKPSIHGGFKKI---NGADSPI  1000
             ATS+S+  LK  K G++  +FSAGFFTFKP NQPE+C+QKP    G K +        PI
Sbjct  130   ATSTSLKRLKSSKHGENTRVFSAGFFTFKPENQPEICSQKPINLRGSKPLLPDPAFPQPI  189

Query  999   TD--PNNPAFLP  970
              D  PNNP+ LP
Sbjct  190   QDPVPNNPSPLP  201



>ref|XP_003554983.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like [Glycine 
max]
Length=340

 Score =   174 bits (442),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             MSW  +   L       +E    +  P+AV+VGTV+CDTC   +F+  SHFISGASVAVE
Sbjct  1     MSWFLVILFLSITHGSASETSHDKKLPSAVVVGTVFCDTCSQQEFTIGSHFISGASVAVE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C    + P F+KEVKTD++GEF++ LPF V KHV++IKGC+ KL++S++P C+VAS +T 
Sbjct  61    CKDGNSIPRFKKEVKTDEYGEFKLQLPFKVRKHVRRIKGCTFKLLSSTDPHCSVASISTF  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQK  1051
             S++ LK RK+G+ IFSAGFF+FKP+ +P  CN+K
Sbjct  121   STVSLKTRKQGELIFSAGFFSFKPIEKPNFCNKK  154



>gb|KHN29763.1| Major cell-surface adhesin PAc [Glycine soja]
Length=354

 Score =   174 bits (442),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             MSW  +   L       +E    +  P+AV+VGTV+CDTC   +F+  SHFISGASVAVE
Sbjct  1     MSWFLVILFLSITHGSASETSHDKKLPSAVVVGTVFCDTCSQQEFTIGSHFISGASVAVE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C    + P F+KEVKTD++GEF++ LPF V KHV++IKGC+ KL++S++P C+VAS +T 
Sbjct  61    CKDGNSIPRFKKEVKTDEYGEFKLQLPFKVRKHVRRIKGCTFKLLSSTDPHCSVASISTF  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQK  1051
             S++ LK RK+G+ IFSAGFF+FKP+ +P  CN+K
Sbjct  121   STVSLKTRKQGELIFSAGFFSFKPIEKPNFCNKK  154



>ref|XP_007151392.1| hypothetical protein PHAVU_004G042600g [Phaseolus vulgaris]
 gb|ESW23386.1| hypothetical protein PHAVU_004G042600g [Phaseolus vulgaris]
Length=343

 Score =   171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             MSW+ +   L       +EA   +  P+A +VGTVYCDTCF  DFS  SHFISGASV VE
Sbjct  1     MSWILVILFLSLTYGCVSEANHDKKLPSASVVGTVYCDTCFQLDFSRGSHFISGASVGVE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C    + P F+KEVKT++ GEF+V LPF V KHV++IKGC++KLINSSEP CAVAS +TS
Sbjct  61    CKDGNSVPRFKKEVKTNEQGEFKVQLPFKVRKHVRRIKGCTIKLINSSEPHCAVASVSTS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQK  1051
             SS+ LK R + + +FSAG F+FKP+ +P  CNQK
Sbjct  121   SSMSLKTRNQREDVFSAGLFSFKPIEKPNFCNQK  154



>ref|XP_006363256.1| PREDICTED: 36.4 kDa proline-rich protein-like [Solanum tuberosum]
Length=334

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 124/182 (68%), Gaps = 7/182 (4%)
 Frame = -3

Query  1500  WVRITFL-LCFVLNGFTEARR---YPPAAVLVGTVYCDTC-FHHDFSEASHFISGASVAV  1336
             W+ + FL L F     +E R    + P A++VG V+CD C ++ D S+ASHFISGA VAV
Sbjct  5     WMILVFLGLVFCNLSASEGRHISSHHPTALVVGKVFCDVCHYYQDLSKASHFISGAIVAV  64

Query  1335  ECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVA-STA  1159
             EC  S     F +EVKT+ HGEF VHLPF+V KHVK + GCS +LI+SSEP CA A +T 
Sbjct  65    ECANSGKNSRFYQEVKTNMHGEFSVHLPFNVDKHVKHVIGCSARLISSSEPQCAEASTTT  124

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNPA  979
             TSSS  LK +K+G HIFSAGFFTFKP+NQP+LCNQKPSIH    K    D PI  P+   
Sbjct  125   TSSSFQLKSKKKGTHIFSAGFFTFKPVNQPKLCNQKPSIHSTNNKEAYPD-PILTPSVSR  183

Query  978   FL  973
             F+
Sbjct  184   FV  185



>ref|XP_009121547.1| PREDICTED: WAS/WASL-interacting protein family member 3 [Brassica 
rapa]
Length=356

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 121/162 (75%), Gaps = 17/162 (10%)
 Frame = -3

Query  1431  AAVLVGTVYCDTCFHHDFSEA-SHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHL  1255
             +AV+VGTVYCDTCF+  FS++ +H I GA VAVEC    + PSFR+EVKTD+HG+F+  L
Sbjct  39    SAVVVGTVYCDTCFNGAFSKSHNHLIPGAVVAVECIDENSKPSFRQEVKTDEHGQFKAKL  98

Query  1254  PFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSI-HLKERKEGKH--IFSAGFFTFK  1084
             PF+VSKHVKKIK CSVKL++SS+P+C++A++ATS+S+  L+  K G++  +FSAGFFTFK
Sbjct  99    PFTVSKHVKKIKRCSVKLLSSSQPYCSIAASATSTSLKRLRSSKHGENTRVFSAGFFTFK  158

Query  1083  PLNQPELCNQKPSIHGGFKKINGADSPITDPNNPAFLPPIRD  958
             P NQPE+C+QK           G+   + D   PAF PPI+D
Sbjct  159   PENQPEICSQK----------RGSKPLLPD---PAFPPPIQD  187



>ref|XP_009393071.1| PREDICTED: proline-rich protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=260

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = -3

Query  1482  LLCFVL--NGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP  1309
             LLC  L  +    AR   P+A++VGTV+CDTCF  + +E+S+FISGASVAVECG + N  
Sbjct  13    LLCIFLCSSASGGAREQLPSALVVGTVFCDTCFRQELAESSYFISGASVAVECGDAANQL  72

Query  1308  SFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKER  1129
              +RK   TD  G F V LP  +S+++  ++ CSVKL+ S+EPFCAVA++AT++ + L+ R
Sbjct  73    GYRKVATTDRRGVFGVRLPPRISRNLGLVEACSVKLLRSNEPFCAVAASATTAGLRLQSR  132

Query  1128  KEGKHIFSAGFFTFKPLNQPELCNQKPSI  1042
             + G  ++SAGFF+FK LNQPELC+QKP +
Sbjct  133   RNGVRVYSAGFFSFKLLNQPELCHQKPQL  161



>ref|XP_006593705.1| PREDICTED: vegetative cell wall protein gp1-like [Glycine max]
 gb|KHN08357.1| Cell surface antigen I/II [Glycine soja]
Length=354

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             MSW+ I   L      F+E    +  P AV+VGTVYCDTC   +FS  SHFISGASV  E
Sbjct  1     MSWLLIILFLSLTHGSFSETSHDKKLPYAVVVGTVYCDTCSQQEFSIGSHFISGASVVAE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C    +  SF+KEVKT++HGEF+V LPF V KHV++IKGC+ KL++SSEP C+VAS +TS
Sbjct  61    CKDGNSIQSFKKEVKTNEHGEFKVQLPFRVRKHVRRIKGCTFKLLSSSEPHCSVASVSTS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQ  1054
             S   LK RK+G+H FSAG F+FKPL +P +CNQ
Sbjct  121   SVS-LKTRKQGEHTFSAGLFSFKPLQKPNVCNQ  152



>ref|XP_010549968.1| PREDICTED: cyclin-dependent kinase 12 [Tarenaya hassleriana]
Length=331

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 126/190 (66%), Gaps = 15/190 (8%)
 Frame = -3

Query  1509  KMSWVRITFLLCFVLNGFTEARRYP--------PAAVLVGTVYCDTCFHHDFSEAS-HFI  1357
             K  W+ +   L  V  G +E   +          +AV+VGTVYCDTCF   FS++S HFI
Sbjct  6     KRVWLVLVICLGIVDGGLSEKHHHQQQPMNKKRSSAVVVGTVYCDTCFMDVFSKSSSHFI  65

Query  1356  SGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFC  1177
             SGASV V+C    + PSFR+EVKTD+ G+FRV LPFSVSKHVK IK CSVKL+ SSEP+C
Sbjct  66    SGASVEVQCIDEYSKPSFRQEVKTDEDGKFRVKLPFSVSKHVKNIKRCSVKLLTSSEPYC  125

Query  1176  AVASTATSSSI-HLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPI  1000
             ++AS+A+SSS+  LK R     +FSAGFFTFKP N+PE+C+QKP    G K  N   S +
Sbjct  126   SIASSASSSSLRRLKYRHHETRVFSAGFFTFKPENRPEICSQKPI---GLK--NSETSSL  180

Query  999   TDPNNPAFLP  970
              DP  P  LP
Sbjct  181   PDPAFPPALP  190



>gb|ABD96850.1| hypothetical protein [Cleome spinosa]
Length=328

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 126/190 (66%), Gaps = 15/190 (8%)
 Frame = -3

Query  1509  KMSWVRITFLLCFVLNGFTEARRYP--------PAAVLVGTVYCDTCFHHDFSEAS-HFI  1357
             K  W+ +   L  V  G +E   +          +AV+VGTVYCDTCF   FS++S HFI
Sbjct  3     KRVWLVLVICLGIVDGGLSEKHHHQQQPMNKKRSSAVVVGTVYCDTCFMDVFSKSSSHFI  62

Query  1356  SGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFC  1177
             SGASV V+C    + PSFR+EVKTD+ G+FRV LPFSVSKHVK IK CSVKL+ SSEP+C
Sbjct  63    SGASVEVQCIDEYSKPSFRQEVKTDEDGKFRVKLPFSVSKHVKNIKRCSVKLLTSSEPYC  122

Query  1176  AVASTATSSSI-HLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPI  1000
             ++AS+A+SSS+  LK R     +FSAGFFTFKP N+PE+C+QKP    G K  N   S +
Sbjct  123   SIASSASSSSLRRLKYRHHETRVFSAGFFTFKPENRPEICSQKPI---GLK--NSETSSL  177

Query  999   TDPNNPAFLP  970
              DP  P  LP
Sbjct  178   PDPAFPPALP  187



>gb|KEH25152.1| pollen Ole e I family allergen [Medicago truncatula]
Length=346

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = -3

Query  1506  MSW-VRITFLLCFVLNGFTEA----RRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASV  1342
             MSW + I FL       F+EA    ++  P+ V+VGTVYCDTCF   FS  SHFISGAS+
Sbjct  1     MSWFLTILFLSLTFGTNFSEANHDNKKLLPSPVVVGTVYCDTCFQQAFSLNSHFISGASI  60

Query  1341  AVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             AVEC   +  P F KEVKT++HGEF+V LPF V KHVK+IKGC+ KL++S+EP CA+AST
Sbjct  61    AVECKIGKTKPRFYKEVKTNEHGEFKVKLPFLVKKHVKRIKGCNFKLLSSNEPNCAIAST  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHG  1036
             +TSSS+ LK++ + +HIFSAG F+FKP+ +P+ C++K SIH 
Sbjct  121   STSSSLSLKKKLQQEHIFSAGIFSFKPIKKPKFCDKKHSIHN  162



>gb|AFK48758.1| unknown [Lotus japonicus]
Length=330

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 118/160 (74%), Gaps = 3/160 (2%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFT--EARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             MSW  +  LL    +  +  ++++  P+AV+VGTV CDTC    FS  SHFISGASVAVE
Sbjct  1     MSWFLVILLLSLTCSEASSHDSKKLLPSAVVVGTVCCDTCSQQAFSMGSHFISGASVAVE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAV-ASTAT  1156
             C    + P F+KEVKT++HGEF+V LPF V KHV++IKGC+ KL++SS P CAV ++ ++
Sbjct  61    CKVGNSKPRFKKEVKTNEHGEFKVQLPFHVRKHVRRIKGCTFKLLSSSGPHCAVASAASS  120

Query  1155  SSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHG  1036
             SSS+ LK RK+G+HIFSAGFF+FKP+ +P LC+QK S  G
Sbjct  121   SSSLSLKSRKQGEHIFSAGFFSFKPVKKPNLCSQKQSSSG  160



>gb|KHN29761.1| hypothetical protein glysoja_035447, partial [Glycine soja]
Length=220

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -3

Query  1401  DTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKI  1222
             D CF  +FS  SHFISGASVAV+C   ++ PSF KEVKT+++GEF+V LPF V K VK+I
Sbjct  1     DACFQQNFSSRSHFISGASVAVKCKVGKSVPSFNKEVKTNENGEFKVQLPFKVWKQVKRI  60

Query  1221  KGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSI  1042
             KGC+ KLI+S+EP C+VAS  TSSS++LK  K+G+HIFSAG F+FKP+ +P  CNQKPS+
Sbjct  61    KGCTFKLISSNEPHCSVASVDTSSSVNLKAIKQGEHIFSAGLFSFKPIKKPNFCNQKPSV  120

Query  1041  HGGFKKINGADSPITDP  991
                   +     P  DP
Sbjct  121   PNSKAHVKNEFLPNIDP  137



>emb|CDX85534.1| BnaA02g02790D [Brassica napus]
Length=346

 Score =   164 bits (414),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 129/191 (68%), Gaps = 19/191 (10%)
 Frame = -3

Query  1500  WVRITFLLCFVLNGFTE------ARRYPPAAVLVGTVYCDTCFHHDFSEA-SHFISGASV  1342
             W  +   L   +NG          ++    AV+VGTVYCDTCF+  FS++ +H ISGA V
Sbjct  10    WFILMIFLGISINGGLSQGQQHIMKKTRSVAVVVGTVYCDTCFNGAFSKSPNHLISGAVV  69

Query  1341  AVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             AVEC    + PSFR+EVKTD+HGEF+  LPFS+SKHVKKIK CSVKL++SS+P+C++A++
Sbjct  70    AVECIDENSNPSFRQEVKTDEHGEFKAKLPFSISKHVKKIKRCSVKLLSSSQPYCSIAAS  129

Query  1161  ATSSSI-HLKERKEGK--HIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDP  991
             ATSSS+  LK  K G+   +FSAGFFTFKP NQPE+C+QKP        IN   S    P
Sbjct  130   ATSSSLKRLKSNKHGETTRVFSAGFFTFKPENQPEICSQKP--------INLRGSKPLFP  181

Query  990   NNPAFLPPIRD  958
              +P F PPI+D
Sbjct  182   -DPTFPPPIQD  191



>ref|XP_007151393.1| hypothetical protein PHAVU_004G042700g [Phaseolus vulgaris]
 gb|ESW23387.1| hypothetical protein PHAVU_004G042700g [Phaseolus vulgaris]
Length=265

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 100/138 (72%), Gaps = 0/138 (0%)
 Frame = -3

Query  1455  TEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDH  1276
              +  ++  A V+ GTV+CDTC  HDF+  +HFISGA V VEC    + PSF+KEV TD +
Sbjct  7     VQDNKFSSAVVVGGTVFCDTCSQHDFNPKTHFISGAKVGVECKVGHSIPSFKKEVVTDKY  66

Query  1275  GEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSAGF  1096
             GEF+V LPF V +H K IKGC+ KLI+SSEP C V + +TSSS+ L   K+G+HIFSAGF
Sbjct  67    GEFKVKLPFKVRRHAKTIKGCTFKLISSSEPHCDVPALSTSSSVSLIATKQGEHIFSAGF  126

Query  1095  FTFKPLNQPELCNQKPSI  1042
             F+FKP+ +P  CNQK S+
Sbjct  127   FSFKPIRKPSFCNQKQSV  144



>ref|XP_010317827.1| PREDICTED: formin-like protein 3 [Solanum lycopersicum]
Length=333

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 115/168 (68%), Gaps = 14/168 (8%)
 Frame = -3

Query  1506  MSWVRITFL---LCFVLNGFTEARR---YPPAAVLVGTVYCDTC-FHHDFSEASHFISGA  1348
             M W  + F+   L F     +E R    + P A++VG V+CD C +H D S+ASHFISGA
Sbjct  1     MCWFWMIFVFLGLVFCNLSPSEGRHISSHHPTALVVGKVFCDVCHYHQDLSKASHFISGA  60

Query  1347  SVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVA  1168
              VAVEC  SR    F +EVKT+ HGEF VHLPF ++KHV    GCS +LI+SSEP CA A
Sbjct  61    IVAVECANSR----FYQEVKTNMHGEFSVHLPFKLNKHVI---GCSARLISSSEPHCAEA  113

Query  1167  STATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKK  1024
             ST T++S  LK +K+G HIFSAGFFTFKP+NQP+LCNQKPS H    K
Sbjct  114   STTTTTSFQLKSKKKGTHIFSAGFFTFKPVNQPKLCNQKPSTHSTNNK  161



>emb|CDX90973.1| BnaC02g06240D [Brassica napus]
Length=343

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 133/190 (70%), Gaps = 18/190 (9%)
 Frame = -3

Query  1500  WVRITFLLCFVLNGFTEARRY-----PPAAVLVGTVYCDTCFHHDFSEA-SHFISGASVA  1339
             ++ +TFL   +  G ++ +++       AAV+VGTVYCDTCF+  FS++ +H ISGA VA
Sbjct  11    FILLTFLGISINGGLSQGQQHLMKKTRSAAVVVGTVYCDTCFNGAFSKSPNHLISGALVA  70

Query  1338  VECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             VEC    + PSFR+EVKTD+HGEF+  LPFSVSKHVKKIK CSVKL++SS+P+C++A++A
Sbjct  71    VECPDENSKPSFRQEVKTDEHGEFKAKLPFSVSKHVKKIKRCSVKLLSSSQPYCSIAASA  130

Query  1158  TSSSIHLKERK---EGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPN  988
             TSSS+   +     E   +FSAGFFTFKP NQPE+C+QKP        IN   S    P 
Sbjct  131   TSSSLKRLKSSKHGETTRVFSAGFFTFKPENQPEICSQKP--------INLRGSKTLFP-  181

Query  987   NPAFLPPIRD  958
             +P+F PPI+D
Sbjct  182   DPSFPPPIQD  191



>ref|XP_009126068.1| PREDICTED: proline-rich extensin-like protein EPR1 [Brassica 
rapa]
Length=337

 Score =   162 bits (409),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 126/191 (66%), Gaps = 19/191 (10%)
 Frame = -3

Query  1500  WVRITFLLCFVLNGFTE------ARRYPPAAVLVGTVYCDTCFHHDFSEA-SHFISGASV  1342
             W  +  LL   +NG          ++    AV+VGTVYCDTCF+  FS++ +H ISGA V
Sbjct  10    WFILMTLLGISINGGLSQGQQHLMKKTRSVAVVVGTVYCDTCFNSAFSKSPNHLISGAVV  69

Query  1341  AVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             AVEC    + PSFR+EVKTD+HGEF+ +LPFSVSKHVKKIK CSVKL++SS+P+C++A++
Sbjct  70    AVECIDENSNPSFRQEVKTDEHGEFKANLPFSVSKHVKKIKRCSVKLLSSSQPYCSIAAS  129

Query  1161  ATSSSIHLKERK---EGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDP  991
             ATSSS+         E   +FSAGFFTFKP NQPE+C+QKP    G K +          
Sbjct  130   ATSSSLKRLRSSKHGENTRVFSAGFFTFKPENQPEICSQKPINLRGSKPLFP--------  181

Query  990   NNPAFLPPIRD  958
              +P F PPI+D
Sbjct  182   -DPTFPPPIQD  191



>ref|XP_003554940.2| PREDICTED: splicing factor 3A subunit 1-like [Glycine max]
Length=277

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 118/176 (67%), Gaps = 5/176 (3%)
 Frame = -3

Query  1506  MSWVRITFL-LCF--VLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             M W  + FL L +  VL+      +  P+ V+VGTVYCDTCF H FS  SHFISGA VAV
Sbjct  4     MYWFLVLFLNLTYGSVLDA--SHGKTLPSTVVVGTVYCDTCFQHTFSTRSHFISGALVAV  61

Query  1335  ECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTAT  1156
             EC    + PSF KEVKT++HGEF+V +P  V KH K+IKGC+ KLI+SSEP C+VAS AT
Sbjct  62    ECKVGDSVPSFNKEVKTNEHGEFKVEVPLKVWKHAKRIKGCTFKLISSSEPHCSVASVAT  121

Query  1155  SSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPN  988
             SSS+ LK R++G+ IFSAG F+FKP  +P  CN K S+      +     P T+P+
Sbjct  122   SSSVSLKTREQGELIFSAGLFSFKPTKKPNFCNHKQSVPNSKAHVKNEFPPNTNPS  177



>gb|KHN29755.1| hypothetical protein glysoja_035441, partial [Glycine soja]
Length=276

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 118/176 (67%), Gaps = 5/176 (3%)
 Frame = -3

Query  1506  MSWVRITFL-LCF--VLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             M W  + FL L +  VL+      +  P+ V+VGTVYCDTCF H FS  SHFISGA VAV
Sbjct  4     MYWFLVLFLNLTYGSVLDA--SHGKTLPSTVVVGTVYCDTCFQHTFSTRSHFISGALVAV  61

Query  1335  ECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTAT  1156
             EC    + PSF KEVKT++HGEF+V +P  V KH K+IKGC+ KLI+SSEP C+VAS AT
Sbjct  62    ECKVGDSVPSFNKEVKTNEHGEFKVEVPLKVWKHAKRIKGCTFKLISSSEPHCSVASVAT  121

Query  1155  SSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPN  988
             SSS+ LK R++G+ IFSAG F+FKP  +P  CN K S+      +     P T+P+
Sbjct  122   SSSVSLKTREQGELIFSAGLFSFKPTKKPNFCNHKQSVPNSKAHVKNEFPPNTNPS  177



>emb|CDX85533.1| BnaA02g02800D [Brassica napus]
Length=346

 Score =   161 bits (408),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 131/190 (69%), Gaps = 18/190 (9%)
 Frame = -3

Query  1500  WVRITFLLCFVLNGFTEARRY-----PPAAVLVGTVYCDTCFHHDFSEA-SHFISGASVA  1339
             ++ +TFL   +  G ++ +++       AAV+VGTVYCDTCF+  FS++ +H ISGA VA
Sbjct  11    FILLTFLGISINGGLSQGQQHLMKKTRSAAVVVGTVYCDTCFNGAFSKSPNHLISGALVA  70

Query  1338  VECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             VEC    + PSFR+EVKTD+HGEF+  LPFSVSKHVKKIK CSVKL++SS+P+C++A++A
Sbjct  71    VECPDENSKPSFRQEVKTDEHGEFKAKLPFSVSKHVKKIKRCSVKLLSSSQPYCSIAASA  130

Query  1158  TSSSIHLKERK---EGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPN  988
             TSSS+   +     E   +FSAGFFTFKP NQPE+C+QKP    G K +           
Sbjct  131   TSSSLKRLKSSKHGETTRVFSAGFFTFKPENQPEICSQKPINLRGSKPLFP---------  181

Query  987   NPAFLPPIRD  958
             +P F PPI+D
Sbjct  182   DPTFPPPIQD  191



>ref|XP_006400102.1| hypothetical protein EUTSA_v10013771mg [Eutrema salsugineum]
 gb|ESQ41555.1| hypothetical protein EUTSA_v10013771mg [Eutrema salsugineum]
Length=389

 Score =   162 bits (410),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 131/192 (68%), Gaps = 20/192 (10%)
 Frame = -3

Query  1500  WVRITFLLCFVLNG-FTEARRY-----PPAAVLVGTVYCDTCFHHDFSEA-SHFISGASV  1342
             W  +T  +   +NG F+E +++       +AV+VGTVYCDTCF+  FS++ +H I GA V
Sbjct  10    WFILTIFIGISINGGFSEGQQHLTKKTRSSAVVVGTVYCDTCFNGAFSKSPNHLIPGALV  69

Query  1341  AVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             AVEC    + PSFR+EVKTD+HGEF+  LPFSVSKHVK+IK CSVKL+ SS+P+C+VA++
Sbjct  70    AVECIDENSKPSFRQEVKTDEHGEFKAKLPFSVSKHVKRIKRCSVKLLASSKPYCSVAAS  129

Query  1161  ATSSSIHL----KERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITD  994
             ATSSS+      K+  +   +FSAGFFTFKP NQPE+C+QKP        + G    + D
Sbjct  130   ATSSSLKRIKTSKQHGDNTRVFSAGFFTFKPENQPEICSQKPI------NLRGTKPLLPD  183

Query  993   PNNPAFLPPIRD  958
                PAF PPI+D
Sbjct  184   ---PAFPPPIQD  192



>ref|XP_004304197.1| PREDICTED: collagen alpha-2(IV) chain-like [Fragaria vesca subsp. 
vesca]
Length=397

 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 107/158 (68%), Gaps = 5/158 (3%)
 Frame = -3

Query  1506  MSWVRITFLL---CFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             MSW    FLL    F           P + V+VG VYCDTCF   F + SHFISGASV V
Sbjct  1     MSWFLTIFLLSTLAFATPSVANHEELPQSGVVVGKVYCDTCFQDGFVKTSHFISGASVGV  60

Query  1335  ECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             EC   S + PSF+ + KTD+ G F+V LPFSVSKHVK I+GCSVKLI+SSEP CAVASTA
Sbjct  61    ECKDGSSSKPSFQAQAKTDNQGVFKVPLPFSVSKHVKGIEGCSVKLISSSEPHCAVASTA  120

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPS  1045
              SSS+ LK RK+G HIFSAG F FKP  Q  LCNQK S
Sbjct  121   ASSSLPLKSRKQGTHIFSAGLFAFKP-KQGNLCNQKLS  157



>ref|XP_004507286.1| PREDICTED: proline-rich protein 4-like [Cicer arietinum]
Length=332

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 114/163 (70%), Gaps = 8/163 (5%)
 Frame = -3

Query  1506  MSWV-RITFLLCFVLNGFTEA-------RRYPPAAVLVGTVYCDTCFHHDFSEASHFISG  1351
             MSW   I FL        +E+       ++  P++ +VGT+YCDTC    FS+ SHFISG
Sbjct  1     MSWFFTILFLTLTFGTNLSESNHDKYNKKKLLPSSFVVGTIYCDTCSQQAFSQESHFISG  60

Query  1350  ASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAV  1171
             AS+A+EC   +    F +EVKT++HGEF+V LPF V KHVK+IKGC+ KLI+S+EP C++
Sbjct  61    ASIAIECKMEKTKQIFYEEVKTNEHGEFKVKLPFIVKKHVKRIKGCNFKLISSNEPHCSI  120

Query  1170  ASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSI  1042
             AST+TS S+ LK++ + +HIFSAG F+FKP+  P+ CN+K SI
Sbjct  121   ASTSTSFSLSLKKKMQKEHIFSAGIFSFKPIKNPKFCNKKYSI  163



>ref|XP_009392504.1| PREDICTED: splicing factor 3A subunit 2-like [Musa acuminata 
subsp. malaccensis]
Length=267

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 96/136 (71%), Gaps = 5/136 (4%)
 Frame = -3

Query  1449  ARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGE  1270
              R+  P A++VGTVYCDTCFH + S+ +HFIS     VECG   N  S+R    T+  G 
Sbjct  27    VRKQLPYALVVGTVYCDTCFHRELSKPTHFIS-----VECGDGANKFSYRTVATTNQRGV  81

Query  1269  FRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFT  1090
             FRV LP  +SKH+  I+ CSVKL+ S EPFCAVAS+AT++ + LK    G H++SAGFF 
Sbjct  82    FRVPLPPRISKHLHLIQACSVKLMKSEEPFCAVASSATTAGLRLKSWSHGVHVYSAGFFK  141

Query  1089  FKPLNQPELCNQKPSI  1042
             FKPL+QPELC++KP++
Sbjct  142   FKPLDQPELCHRKPAL  157



>ref|NP_197082.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 emb|CAC01777.1| proline-rich protein [Arabidopsis thaliana]
 gb|AAO00788.1| proline-rich protein [Arabidopsis thaliana]
 gb|AAU94434.1| At5g15780 [Arabidopsis thaliana]
 gb|AED92204.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=401

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 117/161 (73%), Gaps = 10/161 (6%)
 Frame = -3

Query  1500  WVRITFLLCFVLNGFTE------ARRYPPAAVLVGTVYCDTCFHHDFSEA-SHFISGASV  1342
             W  +   L   +NG          ++   +AV+VGTVYCDTCF+  FS++ +H ISGA V
Sbjct  10    WFSLMIFLGISINGGLSQGQQHVMKKTRSSAVVVGTVYCDTCFNGAFSKSPNHLISGALV  69

Query  1341  AVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             AVEC    + PSFR+EVKTD  GEF+V LPFSVSKHVKKIK CSVKL++SS+P+C++AS+
Sbjct  70    AVECIDENSKPSFRQEVKTDKRGEFKVKLPFSVSKHVKKIKRCSVKLLSSSQPYCSIASS  129

Query  1161  ATSSSI-HLKERKEGKH--IFSAGFFTFKPLNQPELCNQKP  1048
             ATSSS+  LK    G++  +FSAGFFTF+P NQPE+C+QKP
Sbjct  130   ATSSSLKRLKSNHHGENTRVFSAGFFTFRPENQPEICSQKP  170



>gb|KHG10418.1| Major pollen allergen Pla l 1 [Gossypium arboreum]
Length=348

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 98/141 (70%), Gaps = 2/141 (1%)
 Frame = -3

Query  1431  AAVLVGTVYCDT-CFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHL  1255
             +AV+VG+VYCDT C   +FS  SH ISGASVAVEC +  + P F +EVKT++HGEF + L
Sbjct  33    SAVVVGSVYCDTTCSQEEFSRTSHSISGASVAVECKEGTSRPGFVQEVKTNEHGEFELRL  92

Query  1254  PFSVSKHVKKIKGCSVKLINSSEPFC-AVASTATSSSIHLKERKEGKHIFSAGFFTFKPL  1078
             PFSVS+ VKKI GCSVKLI SSEP C  VAS   SS++ L   K G  +FSAG F+FKPL
Sbjct  93    PFSVSRRVKKINGCSVKLIKSSEPDCNVVASIPASSALRLVSGKHGTRVFSAGTFSFKPL  152

Query  1077  NQPELCNQKPSIHGGFKKING  1015
              QP LC  KP    G K + G
Sbjct  153   KQPNLCRTKPKEANGEKAVLG  173



>ref|XP_010029417.1| PREDICTED: proline-rich protein 4-like [Eucalyptus grandis]
Length=342

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 101/156 (65%), Gaps = 3/156 (2%)
 Frame = -3

Query  1512  LKMSWVRITF-LLCFVLNGFTEA--RRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASV  1342
             + M W  IT  LL   ++  +EA      P+A++VGTV+CDTCF  +FS  SHFISGA V
Sbjct  1     MPMPWFLITLVLLSLRISDVSEAVHEEKVPSALVVGTVFCDTCFKQEFSRTSHFISGAYV  60

Query  1341  AVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             ++ECG S +  SFR+E +T+ HG+F+V LP S+ K  + I+GC+VKLI S +P C   S 
Sbjct  61    SIECGNSSSSLSFRQEARTNRHGKFKVLLPASMGKDAEGIEGCAVKLIKSGDPGCRAVSL  120

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQ  1054
               SSS+ LK ++ G H+FSAG   FKPL QP  C  
Sbjct  121   GISSSLRLKSKRHGLHVFSAGLLAFKPLKQPSRCTD  156



>gb|KFK25802.1| hypothetical protein AALP_AA8G163000 [Arabis alpina]
Length=449

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 127/190 (67%), Gaps = 18/190 (9%)
 Frame = -3

Query  1500  WVRITFLLCFVLNGFTEARRYP-----PAAVLVGTVYCDTCFHHDFSEA-SHFISGASVA  1339
             W  +   L   ++G  E +++       +AV+VGTVYCDTCF+  FS++ +H I GA VA
Sbjct  10    WFLLMIFLVISISGSGEGQQHVMKKTRSSAVVVGTVYCDTCFNGAFSKSPNHLIPGALVA  69

Query  1338  VECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             VEC    + PSFR++VKTD+HG+F+  LPFSVSKHVKKIK CSVKL++SS+P+C++A++A
Sbjct  70    VECLDENSKPSFRQDVKTDEHGQFKAKLPFSVSKHVKKIKRCSVKLLSSSQPYCSIAASA  129

Query  1158  TSSSIHLKERK---EGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPN  988
             TSSS+         E   +FSAGFFTFKP NQPE+C+Q        K IN  D+    P 
Sbjct  130   TSSSLKRLRSSNHGEKTQVFSAGFFTFKPQNQPEICSQ--------KTINLHDTKPLLP-  180

Query  987   NPAFLPPIRD  958
             +P F PP++D
Sbjct  181   DPTFPPPLQD  190



>ref|XP_010420252.1| PREDICTED: WAS/WASL-interacting protein family member 3-like 
[Camelina sativa]
Length=365

 Score =   154 bits (389),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 116/161 (72%), Gaps = 10/161 (6%)
 Frame = -3

Query  1500  WVRITFLLCFVLNGFTE------ARRYPPAAVLVGTVYCDTCFHHDFSEA-SHFISGASV  1342
             W  +   L   +NG          ++   +AV+VGTVYCDTCF+  FS++ +H I GA V
Sbjct  10    WFSLMVFLGISINGGLSQGQQHVMKKTRSSAVVVGTVYCDTCFNGAFSKSPNHLIPGALV  69

Query  1341  AVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             AVEC    + PSFR+EVKTD  GEF+V LPFSVSKHVKKIK CSVKL++SS+P+C++AS+
Sbjct  70    AVECIDENSKPSFRQEVKTDARGEFKVKLPFSVSKHVKKIKRCSVKLLSSSQPYCSIASS  129

Query  1161  ATSSSI-HLKERKEGKH--IFSAGFFTFKPLNQPELCNQKP  1048
             ATSSS+  LK    G++  +FSAGFFTFKP NQPE+C+QKP
Sbjct  130   ATSSSLKRLKSNHHGENTRVFSAGFFTFKPENQPEICSQKP  170



>ref|XP_002873741.1| hypothetical protein ARALYDRAFT_488422 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50000.1| hypothetical protein ARALYDRAFT_488422 [Arabidopsis lyrata subsp. 
lyrata]
Length=363

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 116/161 (72%), Gaps = 10/161 (6%)
 Frame = -3

Query  1500  WVRITFLLCFVLNGFTE------ARRYPPAAVLVGTVYCDTCFHHDFSEA-SHFISGASV  1342
             W  +   L   +NG          ++   +AV+VGTVYCDTCF+  FS++ +H I GA V
Sbjct  10    WFSLMIFLGISINGGLSQGQQHVMKKTRSSAVVVGTVYCDTCFNGAFSKSHNHLIPGALV  69

Query  1341  AVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             AVEC    + PSFR+EVKTD  GEF+V LPFSVSKHVKKIK CSVKL++SS+P+C++AS+
Sbjct  70    AVECIDENSKPSFRQEVKTDKRGEFKVKLPFSVSKHVKKIKRCSVKLLSSSQPYCSIASS  129

Query  1161  ATSSSI-HLKERKEGKH--IFSAGFFTFKPLNQPELCNQKP  1048
             ATSSS+  LK    G++  +FSAGFFTF+P NQPE+C+QKP
Sbjct  130   ATSSSLKRLKSNHHGENTRVFSAGFFTFRPENQPEICSQKP  170



>ref|XP_010492425.1| PREDICTED: vegetative cell wall protein gp1-like [Camelina sativa]
Length=415

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 12/162 (7%)
 Frame = -3

Query  1500  WVR---ITFLLCFVLNGFTEARRY-----PPAAVLVGTVYCDTCFHHDFSEA-SHFISGA  1348
             WV    + FL  FV  G ++ +++       +AV+VGTVYCDTCF+  FS++ +H I GA
Sbjct  8     WVWFSLMIFLSIFVSGGLSQGQQHVVKKTRSSAVVVGTVYCDTCFNGAFSKSPNHLIPGA  67

Query  1347  SVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVA  1168
              VAVEC    + PSFR+EVKTD  GEF+V LPFSVSKHVKKIK CSVKL++SS+P+C++A
Sbjct  68    LVAVECIDENSKPSFRQEVKTDARGEFKVKLPFSVSKHVKKIKRCSVKLLSSSQPYCSIA  127

Query  1167  STATSSSI-HLKERKEGKH--IFSAGFFTFKPLNQPELCNQK  1051
             S+ATSSS+  LK  + G++  +FSAGFFTFKP  QPE+C+QK
Sbjct  128   SSATSSSLKRLKSNRHGENTRVFSAGFFTFKPETQPEICSQK  169



>ref|XP_004137142.1| PREDICTED: uncharacterized protein LOC101209177 [Cucumis sativus]
 ref|XP_004154728.1| PREDICTED: uncharacterized protein LOC101226951 [Cucumis sativus]
 gb|KGN53773.1| hypothetical protein Csa_4G126430 [Cucumis sativus]
Length=292

 Score =   151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 101/129 (78%), Gaps = 3/129 (2%)
 Frame = -3

Query  1428  AVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNG-PSFRKEVKTDDHGEFRVHLP  1252
             AV+VGTV+CDTCF    S + HFISGA V VEC   +    SF+++VKT+ +G+F+V LP
Sbjct  36    AVVVGTVFCDTCFQQHLSNSHHFISGARVEVECRDEKTPEASFKQQVKTNKNGKFKVVLP  95

Query  1251  FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLK--ERKEGKHIFSAGFFTFKPL  1078
             FS++KHVKKI+ CSVKLI SSEPFC+VAS+A+SSS+ LK  + K G  IFSAGFFTFKPL
Sbjct  96    FSIAKHVKKIESCSVKLIKSSEPFCSVASSASSSSLQLKNSKNKNGVRIFSAGFFTFKPL  155

Query  1077  NQPELCNQK  1051
              QP LCNQK
Sbjct  156   QQPTLCNQK  164



>ref|XP_010453723.1| PREDICTED: vegetative cell wall protein gp1-like [Camelina sativa]
Length=366

 Score =   151 bits (381),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 114/161 (71%), Gaps = 10/161 (6%)
 Frame = -3

Query  1500  WVRITFLLCFVLNGFTE------ARRYPPAAVLVGTVYCDTCFHHDFSEA-SHFISGASV  1342
             W  +   L   +NG          ++   +AV+VGTVYCDTCF+  FS++ +H I GA V
Sbjct  10    WFSLMVFLGISINGGLSQGQQHVVKKTRSSAVVVGTVYCDTCFNGAFSKSPNHLIPGALV  69

Query  1341  AVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             AVEC    + PSFR+EVKTD  GEF+V LPFSVSKHVKKIK CSVKL++SS+P+C++AS+
Sbjct  70    AVECIDENSKPSFRQEVKTDARGEFKVKLPFSVSKHVKKIKRCSVKLLSSSQPYCSIASS  129

Query  1161  ATSSSI-HLKERKEGK--HIFSAGFFTFKPLNQPELCNQKP  1048
             ATSSS+  +K    G+   +FSAGFFTFKP  QPE+C+QKP
Sbjct  130   ATSSSLRRIKSNHHGEDTRVFSAGFFTFKPETQPEICSQKP  170



>ref|XP_006287924.1| hypothetical protein CARUB_v10001160mg [Capsella rubella]
 gb|EOA20822.1| hypothetical protein CARUB_v10001160mg [Capsella rubella]
Length=385

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 113/160 (71%), Gaps = 10/160 (6%)
 Frame = -3

Query  1500  WVRITFLL-CFVLNGFTE-----ARRYPPAAVLVGTVYCDTCFHHDFSEA-SHFISGASV  1342
             W  + F L  F   G ++      ++   +AV+VGTVYCDTCF+  FS++ +H I GA V
Sbjct  10    WFSLMFFLGIFSTGGLSQRQQHVVKKTRSSAVVVGTVYCDTCFNGAFSKSPNHLIPGALV  69

Query  1341  AVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             AVEC    + PSFR+EVKTD  GEF+V LPFSVSKHVKKIK CSVKL++SS+P+C++AS+
Sbjct  70    AVECIDENSKPSFRQEVKTDARGEFKVKLPFSVSKHVKKIKRCSVKLLSSSQPYCSIASS  129

Query  1161  ATSSS---IHLKERKEGKHIFSAGFFTFKPLNQPELCNQK  1051
             ATSSS   +      E   +FSAGFFTFKP NQPE+C+QK
Sbjct  130   ATSSSFKRLRSNHHGENTRVFSAGFFTFKPENQPEICSQK  169



>ref|XP_008455556.1| PREDICTED: formin-like protein 7 [Cucumis melo]
Length=291

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 100/130 (77%), Gaps = 5/130 (4%)
 Frame = -3

Query  1428  AVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP--SFRKEVKTDDHGEFRVHL  1255
             AV+VGTV+CDTCF    S + HFISGA + VEC +  N P  SF+++VKT+ +G+FRV L
Sbjct  36    AVVVGTVFCDTCFQQHLSGSHHFISGARIEVEC-RDENNPIASFKQQVKTNKNGKFRVVL  94

Query  1254  PFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLK--ERKEGKHIFSAGFFTFKP  1081
             PFS++KH+KKI+ CSVKLI SSEPFC+V S+A+SS +  K  + K G  IFSAGFFTFKP
Sbjct  95    PFSIAKHIKKIERCSVKLIKSSEPFCSVVSSASSSFLKFKNSKNKNGVRIFSAGFFTFKP  154

Query  1080  LNQPELCNQK  1051
             L QP LCNQK
Sbjct  155   LQQPTLCNQK  164



>ref|XP_007151394.1| hypothetical protein PHAVU_004G042800g [Phaseolus vulgaris]
 gb|ESW23388.1| hypothetical protein PHAVU_004G042800g [Phaseolus vulgaris]
Length=365

 Score =   150 bits (379),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             M W     L   +    +E    ++    V+ G V CD C  HDF+  +HFISGA V VE
Sbjct  1     MGWFLAILLFSLISGSVSEVEDNKFSSDVVVGGIVICDICSEHDFTPKTHFISGAKVGVE  60

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
             C    + PSF++EV+TD +GEF+V LPF V +H K I GC+ KLI+SSEP C V   +TS
Sbjct  61    CKVEHSTPSFKEEVETDKYGEFKVKLPFKVRRHAKIINGCTFKLISSSEPHCDVPVLSTS  120

Query  1152  SSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSI  1042
             SS+     KEG+ IFSAGFF+FKP  +P  CN+K S+
Sbjct  121   SSVSFITTKEGERIFSAGFFSFKPKKKPSFCNKKLSV  157



>ref|XP_010939464.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Elaeis 
guineensis]
Length=331

 Score =   147 bits (370),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 116/172 (67%), Gaps = 9/172 (5%)
 Frame = -3

Query  1503  SWVRITFLL----CFVLNGFTEA---RRYPPAAVLVGTVYCDTCFHHDFSEASHFISGAS  1345
             +W R+  LL    C++ +    A   R   P+AV+VGTVYCD CF  +FS+  HFI GAS
Sbjct  3     TWARLQILLILSFCYLFHCSLAANHPRNQLPSAVVVGTVYCDVCFQKEFSKPIHFIPGAS  62

Query  1344  VAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAS  1165
             VAVEC  +    SF+KEVKT+  G F   LP  +S+ +K I+ CSVKLI S+ P C+V+S
Sbjct  63    VAVECEDAATKLSFQKEVKTNRRGVFTARLPLEISREIKLIESCSVKLIRSNVPSCSVSS  122

Query  1164  TATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGAD  1009
             +ATS+S+ LK  + G HIFSAGFFTF+PL Q ELCNQK ++  G +K++ ++
Sbjct  123   SATSASLRLKSVRNGVHIFSAGFFTFRPLRQLELCNQKTNV--GNQKLDHSE  172



>ref|XP_008357923.1| PREDICTED: uncharacterized protein LOC103421656 [Malus domestica]
Length=215

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 92/116 (79%), Gaps = 2/116 (2%)
 Frame = -3

Query  1362  FISGASVAVECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSE  1186
             F + ASV VEC   +   PSF   VKT+ HG+F+V+LPFSVSK VKKI+GCSVKLI SSE
Sbjct  14    FCAEASVGVECKDGTSTKPSFNVXVKTNSHGQFKVNLPFSVSKDVKKIEGCSVKLIRSSE  73

Query  1185  PFCAVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKIN  1018
             P+CAVAS+ATSSS+HLK R +G HIFSAGFFTFKPL QP LCNQKPSI    KK+N
Sbjct  74    PYCAVASSATSSSLHLKARXQGTHIFSAGFFTFKPLKQPSLCNQKPSIQNS-KKLN  128



>ref|XP_008342051.1| PREDICTED: formin-like protein 3 [Malus domestica]
Length=305

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 93/114 (82%), Gaps = 2/114 (2%)
 Frame = -3

Query  1356  SGASVAVECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPF  1180
             +GASV VEC   S    SF+ +VKT+ HG+F+V LPFSVSKHVKKI+GCSVKLI+SSEP+
Sbjct  58    AGASVGVECKDGSSTEQSFKAQVKTNSHGQFKVLLPFSVSKHVKKIEGCSVKLISSSEPY  117

Query  1179  CAVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKIN  1018
             CAVAS+ATSSS+HLK RK+G HIFSAGFFTFKPL QP LCN KPSI    KK N
Sbjct  118   CAVASSATSSSLHLKARKQGTHIFSAGFFTFKPLKQPTLCNHKPSIQNS-KKXN  170



>ref|XP_009378267.1| PREDICTED: major pollen allergen Lig v 1-like, partial [Pyrus 
x bretschneideri]
Length=132

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 91/127 (72%), Gaps = 5/127 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFT--EA--RRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW      L   L   T  EA   +  P+AV+VGTVYCDTCF  DFS  SHFISGASV 
Sbjct  6     MSWFFTVIFLVTALTFHTPSEASHEKNDPSAVVVGTVYCDTCFQEDFSHTSHFISGASVG  65

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   +   PSF  +VKT+ HG+F+VHLPF+VS  VKKI+GCSVKLI SSEP+CAVAS+
Sbjct  66    VECKDGTSTKPSFNAQVKTNSHGQFKVHLPFTVSNDVKKIEGCSVKLIRSSEPYCAVASS  125

Query  1161  ATSSSIH  1141
             ATSSS+H
Sbjct  126   ATSSSLH  132



>ref|XP_008348265.1| PREDICTED: isoprenylcysteine alpha-carbonyl methylesterase ICME-like 
[Malus domestica]
Length=338

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 92/129 (71%), Gaps = 5/129 (4%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFT--EA--RRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             MSW      L   L   T  EA      P+AV+VGTVYCDTCF  DFS  SHFISGASV 
Sbjct  1     MSWFLTVIFLVTTLTFHTPSEASYEEIQPSAVVVGTVYCDTCFQEDFSNTSHFISGASVG  60

Query  1338  VECGQ-SRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAST  1162
             VEC   +    SF  +VKT+ HG+F+VHLPFSVSK VKKI+GCSVKLI SSEP+CAVAS+
Sbjct  61    VECKDGTLTKQSFNAQVKTNSHGQFKVHLPFSVSKDVKKIEGCSVKLIRSSEPYCAVASS  120

Query  1161  ATSSSIHLK  1135
             ATSSS+HLK
Sbjct  121   ATSSSLHLK  129



>ref|XP_007215966.1| hypothetical protein PRUPE_ppa011450mg [Prunus persica]
 gb|EMJ17165.1| hypothetical protein PRUPE_ppa011450mg [Prunus persica]
Length=210

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = +2

Query  1070  G*LRGLNVKNPAENICFPSFLSLRWMEDEVAVEATAQNGSLLLISFTEQPLIFLTCLLTE  1249
             G  RGL VK PAENI  P  L LR  EDEVAVE TAQ GSLLLI+FTE P IFLT LLTE
Sbjct  113   GCFRGLKVKKPAENIYVPCSLDLRCSEDEVAVEDTAQYGSLLLINFTEHPSIFLTRLLTE  172

Query  1250  KGKCTLNSP*SSVFTSFLKLGPFLDCPHSTATDAPEMK  1363
             KGK TLN+P  SVFTS  KLG  L   HST T+AP  K
Sbjct  173   KGKWTLNTPWLSVFTSVWKLGFELPSLHSTPTEAPAEK  210



>gb|ACN41080.1| unknown [Picea sitchensis]
Length=310

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 81/147 (55%), Gaps = 2/147 (1%)
 Frame = -3

Query  1485  FLLCFVLNGFTE--ARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNG  1312
             FL C  L G +    +    + V+VG V+CDTC  H  SE S+FISGAS+AVECG +R  
Sbjct  17    FLCCLSLVGASTFAGQEKDSSVVVVGKVFCDTCLEHRLSENSYFISGASIAVECGLNRKT  76

Query  1311  PSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKE  1132
              +     +TD++GEFRV LP ++ +   ++  C V   NS    C + ST+  S + L+ 
Sbjct  77    MTLSIIGETDENGEFRVELPSNILQSADQLNKCWVSPRNSPLRSCKIPSTSAPSKLTLQS  136

Query  1131  RKEGKHIFSAGFFTFKPLNQPELCNQK  1051
                G   +SAG F+++    P  C ++
Sbjct  137   VSNGVVTYSAGSFSYRHETVPPSCYRE  163



>gb|ABK26139.1| unknown [Picea sitchensis]
Length=310

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 81/147 (55%), Gaps = 2/147 (1%)
 Frame = -3

Query  1485  FLLCFVLNGFTE--ARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNG  1312
             FL C  L G +    +    + V+VG V+CDTC  H  SE S+FISGAS+AVECG +R  
Sbjct  17    FLCCLSLVGASTFAGQEKDSSVVVVGKVFCDTCLEHRLSENSYFISGASIAVECGLNRKT  76

Query  1311  PSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKE  1132
              +     +TD++GEFRV LP ++ +   ++  C V   NS    C + ST+  S + L+ 
Sbjct  77    MTLSIIGETDENGEFRVELPSNILQSADQLNKCWVSPRNSPLRSCKIPSTSAPSKLTLQS  136

Query  1131  RKEGKHIFSAGFFTFKPLNQPELCNQK  1051
                G   +SAG F+++    P  C ++
Sbjct  137   VSNGVVTYSAGSFSYRHETVPPSCYRE  163



>gb|ABK24101.1| unknown [Picea sitchensis]
Length=326

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 78/153 (51%), Gaps = 4/153 (3%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNG----FTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             +S   + FLL ++  G    +    +   + V+VG V+CDTC  +  SE  + ISGAS+A
Sbjct  9     ISITVLGFLLSYLALGAASNYANQEKISESVVVVGKVFCDTCLENRLSENGYVISGASIA  68

Query  1338  VECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTA  1159
             VEC  +R G S     +T+ +GEF+V +P ++     ++  C V+  +S    C + S  
Sbjct  69    VECALNRKGMSVSVTGETNQNGEFKVEIPSNIFHLADQMNKCWVRPRSSPLVSCKIPSMP  128

Query  1158  TSSSIHLKERKEGKHIFSAGFFTFKPLNQPELC  1060
               S + L+    G   +SAG F+++    P  C
Sbjct  129   APSKLKLQSNSNGVLTYSAGSFSYRHETVPASC  161



>ref|XP_010030796.1| PREDICTED: uncharacterized protein LOC104420701 [Eucalyptus grandis]
Length=106

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 45/103 (44%), Positives = 60/103 (58%), Gaps = 6/103 (6%)
 Frame = -3

Query  1353  GASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCA  1174
             GASV VEC +      FRKEV T   G+F V LP S S+  ++++GC VKLI SS+P C 
Sbjct  5     GASVLVECTEL----GFRKEVTTAKGGKFEVRLPPSTSEDAEEMQGCMVKLIRSSDPACD  60

Query  1173  VASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPS  1045
               S  + +S+ LK  ++G  + S G   F P  QP  C QKP+
Sbjct  61    AVS--SRASLRLKLNRQGAQVLSVGVLAFTPWEQPSSCTQKPT  101



>gb|ABN09049.1| hypothetical protein MtrDRAFT_AC172742g21v1 [Medicago truncatula]
Length=89

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -3

Query  1299  KEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEG  1120
             K+VKT++HGEF++ LPFSV KHVK+IKGC VKL++S+EPFC++AS A+SSS+HLK   +G
Sbjct  25    KQVKTNEHGEFKIQLPFSVRKHVKRIKGCVVKLVSSNEPFCSIASAASSSSLHLKSMIQG  84

Query  1119  KHI  1111
               I
Sbjct  85    NQI  87



>gb|EPS70189.1| hypothetical protein M569_04566 [Genlisea aurea]
Length=1006

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 72/133 (54%), Gaps = 20/133 (15%)
 Frame = -3

Query  1443  RYPPAAVLVGTVYCDTCFHHDFSEASHFISGAS--VAVECGQSRNGPSFRKEVKTDDHGE  1270
             R   +AV+VG VYC        + AS F++GAS  VAVEC +S     FR  VKTD+ GE
Sbjct  769   RATTSAVVVGAVYCTPP-----NAASTFVAGASATVAVECKES----GFRDVVKTDNRGE  819

Query  1269  FRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFT  1090
             F+VHLP SVSK V  I  CS  LIN   P CAV   +         +    H   AGFFT
Sbjct  820   FQVHLPLSVSKRVDGIPNCSASLING--PNCAVVMKSPL-------KHHHHHHRHAGFFT  870

Query  1089  FKPLNQPELCNQK  1051
             FKPL Q    NQK
Sbjct  871   FKPLKQQPDRNQK  883



>ref|XP_003621580.1| hypothetical protein MTR_7g017350 [Medicago truncatula]
Length=68

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -3

Query  1299  KEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEG  1120
             K+VKT++HGEF++ LPFSV KHVK+IKGC VKL++S+EPFC++AS A+SSS+HLK   +G
Sbjct  4     KQVKTNEHGEFKIQLPFSVRKHVKRIKGCVVKLVSSNEPFCSIASAASSSSLHLKSMIQG  63

Query  1119  KHI  1111
               I
Sbjct  64    NQI  66



>ref|XP_010528432.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 isoform X1 [Tarenaya hassleriana]
Length=338

 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -3

Query  1485  FLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPS  1306
             F    V N  +EA+  P   V+VGTVYC+T         S+ ISG+ V VEC   R+ PS
Sbjct  24    FFTITVSNLSSEAKNLP-LLVVVGTVYCNT---------SYLISGSPVEVECRDRRSRPS  73

Query  1305  FRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS---IHLK  1135
             FR+E  TD  GEFRV  PF   K +K+IK CSVKL+  S    A +++A+SSS   + LK
Sbjct  74    FRQETVTDGRGEFRVQCPFPAKKCLKRIKRCSVKLLADSCCASASSTSASSSSFLPVRLK  133

Query  1134  ERKEGKHIFSAGFF  1093
              RK G  I  AG F
Sbjct  134   SRK-GDQILFAGIF  146



>ref|XP_010528433.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Tarenaya hassleriana]
Length=304

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 54/93 (58%), Gaps = 10/93 (11%)
 Frame = -3

Query  1485  FLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPS  1306
             F    V N  +EA+  P   V+VGTVYC+T         S+ ISG+ V VEC   R+ PS
Sbjct  24    FFTITVSNLSSEAKNLP-LLVVVGTVYCNT---------SYLISGSPVEVECRDRRSRPS  73

Query  1305  FRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSV  1207
             FR+E  TD  GEFRV  PF   K +K+IK CS+
Sbjct  74    FRQETVTDGRGEFRVQCPFPAKKCLKRIKRCSI  106



>ref|XP_009336449.1| PREDICTED: formin-1-like [Pyrus x bretschneideri]
Length=302

 Score = 72.8 bits (177),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 78/156 (50%), Gaps = 19/156 (12%)
 Frame = -3

Query  1449  ARRYPPAA--VLVGTVYCDTCFHHDFSEASHFISGASVAVEC---GQSRNGPS---FRKE  1294
             AR  PP A   +VG VYCDTC  + FS +S+F+ G  V ++C    +SR   S   F+  
Sbjct  23    ARSTPPTARITVVGAVYCDTCLSNSFSRSSYFLPGVDVLIKCKFGAKSRKTASQMNFQVN  82

Query  1293  VKTDDHGEFRVHLPFSVSKHVKKIKG------CSVKLINSSEPFCAV-ASTATSSSIHLK  1135
               TD +G +++ +P SV   V  I G      C   LI SS   C V A T T+  I +K
Sbjct  83    KTTDKYGVYKLEIP-SV-DGVNCISGFAMKSMCQATLIGSSSSACNVPALTTTADEISVK  140

Query  1134  ERKEGKHIFSAGFFTFKPLNQP-ELCNQKPSIHGGF  1030
              +++   I+S    +F+P  +   LC  +  + GG 
Sbjct  141   SKQDNLCIYSMNALSFRPRKKNLTLCGNR-KVEGGL  175



>ref|XP_008389918.1| PREDICTED: leucine-rich repeat extensin-like protein 1 [Malus 
domestica]
Length=302

 Score = 70.5 bits (171),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 71/138 (51%), Gaps = 17/138 (12%)
 Frame = -3

Query  1449  ARRYPPAA--VLVGTVYCDTCFHHDFSEASHFISGASVAVECG------QSRNGPSFRKE  1294
             AR  PP A   +VG VYCDTC  + FS +S+F+ G  V ++C       ++ +  SF+  
Sbjct  23    ARSTPPTARITVVGAVYCDTCLSNSFSRSSYFLPGVDVLIKCKFGAKSHKTASQMSFQVN  82

Query  1293  VKTDDHGEFRVHLPFSVSKHVKKIKG------CSVKLINSSEPFCAV-ASTATSSSIHLK  1135
               TD +G +++ +P SV   V  I G      C   LI SS   C V A T T+  I +K
Sbjct  83    KTTDKYGVYKLEIP-SV-DGVNCISGIAMKSMCQATLIGSSSSDCNVPALTTTADEISVK  140

Query  1134  ERKEGKHIFSAGFFTFKP  1081
              +++   I+S    +F+P
Sbjct  141   SKQDNLCIYSMNALSFRP  158



>ref|XP_004983237.1| PREDICTED: proline-rich protein 4-like [Setaria italica]
Length=257

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 65/143 (45%), Gaps = 20/143 (14%)
 Frame = -3

Query  1464  NGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKT  1285
             +G   AR    AAV++G+V       H  SE +  ISG  VAV C        F+KE  T
Sbjct  31    HGRKHARPPLTAAVVIGSVV------HSGSEPTKAISGTLVAVRCHDGYGRTVFQKEAVT  84

Query  1284  DDHGEFRVHLPFSVSKHVKKIKGCSVKLINSS--EPFCAVASTATSSSIHL---KERKEG  1120
             D  G F V LP   S  ++ +  CSV L   S   P CA      +  +HL   K    G
Sbjct  85    DRRGTFHVQLPHEASSRLRSVTACSVHLQQPSGNAPPCA------ARGLHLVGPKRHGGG  138

Query  1119  KHIFSAGFFTFKPLNQPELCNQK  1051
               IFSAG F  +    PELC QK
Sbjct  139   ARIFSAGTFAVR---TPELCGQK  158



>gb|ABK21071.1| unknown [Picea sitchensis]
Length=277

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 86/179 (48%), Gaps = 24/179 (13%)
 Frame = -3

Query  1497  VRITFLLCFVL-----NGFTEARRYPPAAVLVGTVYCDTCF--HHDFSEASHFISGASVA  1339
             V    LLC V      +  + A++ P + VL G+V C  C     +FS+A + ISGA VA
Sbjct  7     VVCAILLCIVYTCSSASANSGAQQKPISVVLKGSVVCHACSLDEENFSDAGYIISGAVVA  66

Query  1338  VEC--GQSR--NGPSFRKEVKTDDHGEFRVHLP-----------FSVSKHVKKIKG-CSV  1207
             VEC  G +R  N      E KTD +GEF+V LP            S   H   +KG CS 
Sbjct  67    VECRAGLNRKTNAGLVSIEGKTDKNGEFKVELPGSIISSILLCSSSSDDHNPTLKGYCSA  126

Query  1206  KLIN-SSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGG  1033
             +L++ S +  C V S+ TSSS  L    +G  I +  F +    +  +LC+   S+  G
Sbjct  127   RLLSISPQEKCNVPSSTTSSSDRLIFTSDGNGIRTFTFPSLSYHSGSKLCSDHESLQAG  185



>gb|ABK25840.1| unknown [Picea sitchensis]
Length=303

 Score = 67.0 bits (162),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 84/173 (49%), Gaps = 24/173 (14%)
 Frame = -3

Query  1497  VRITFLLCFVL-----NGFTEARRYPPAAVLVGTVYCDTCF--HHDFSEASHFISGASVA  1339
             V    LLC V      +  + A++ P + VL G V C  C     +FS+A + ISGA VA
Sbjct  7     VVCAILLCIVYTCSSASANSGAQQKPISVVLKGRVVCHACSLDEENFSDAGYIISGAVVA  66

Query  1338  VEC--GQSR--NGPSFRKEVKTDDHGEFRVHLP-----------FSVSKHVKKIKG-CSV  1207
             VEC  G +R  N      E KTD +GEF+V LP            S   H   +KG CS 
Sbjct  67    VECRAGLNRKTNAGLVSIEGKTDKNGEFKVELPGSIISSILLCSSSSDDHNPTLKGYCSA  126

Query  1206  KLINSS-EPFCAVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQK  1051
             +L++SS +  C V S+ TSSS  L    +G  I +  F +    +  +LC+ K
Sbjct  127   RLLSSSPQEKCNVPSSTTSSSDQLIFTSDGNGIRTFTFPSLSYHSGSKLCSHK  179



>ref|XP_010090678.1| hypothetical protein L484_017484 [Morus notabilis]
 gb|EXB40342.1| hypothetical protein L484_017484 [Morus notabilis]
Length=278

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 67/140 (48%), Gaps = 11/140 (8%)
 Frame = -3

Query  1467  LNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK  1288
             L G + A R+     +VG VYCDTC  + F+  S+F+ G  V + C    N P   ++V 
Sbjct  26    LRGRSIAARHSSRISVVGAVYCDTCSSNAFTRHSYFLPGVDVQIRCKFKVNSPKSTEQVN  85

Query  1287  ------TDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS-IH  1141
                   TD +G +++ +P     +    +  +  C   LI SS   C V S  T+S+ I 
Sbjct  86    YAVNRTTDRYGVYKLDIPSVDGVNCINGLALVSMCQANLIGSSSSACNVPSIRTASNEIS  145

Query  1140  LKERKEGKHIFSAGFFTFKP  1081
             +K  ++   I+S    ++KP
Sbjct  146   IKSEQDNLCIYSLNALSYKP  165



>gb|ABK26099.1| unknown [Picea sitchensis]
Length=277

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 85/179 (47%), Gaps = 24/179 (13%)
 Frame = -3

Query  1497  VRITFLLCFVL-----NGFTEARRYPPAAVLVGTVYCDTCF--HHDFSEASHFISGASVA  1339
             V    LLC V      +  + A++ P + VL G V C  C     +FS+A + ISGA VA
Sbjct  7     VVCAILLCIVYTCSSASANSGAQQKPISVVLNGRVVCHACSLDEENFSDAGYIISGAVVA  66

Query  1338  VEC--GQSR--NGPSFRKEVKTDDHGEFRVHLP-----------FSVSKHVKKIKG-CSV  1207
             VEC  G +R  N      E KTD +GEF+V LP            S   H   +KG CS 
Sbjct  67    VECRTGLNRKTNAGLVSIEGKTDKNGEFKVELPGSIISSILLCSSSSDDHNPTLKGYCSA  126

Query  1206  KLIN-SSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGG  1033
             +L++ S +  C V S+ TSSS  L    +G  I +  F +    +  +LC+   S+  G
Sbjct  127   RLLSISPQEKCNVPSSTTSSSDRLIFTSDGNGIRTFTFPSLSYHSGSKLCSDHESLQAG  185



>ref|XP_007226510.1| hypothetical protein PRUPE_ppa025866mg [Prunus persica]
 gb|EMJ27709.1| hypothetical protein PRUPE_ppa025866mg [Prunus persica]
Length=303

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 70/146 (48%), Gaps = 17/146 (12%)
 Frame = -3

Query  1443  RYPPAAV-LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKT  1285
             R P A + +VG VYCDTC  + FS +S+F+ G  V ++C    N P      +F     T
Sbjct  26    RTPKARITVVGAVYCDTCSTNTFSRSSYFLPGVDVLIKCKFRGNSPRTAEDINFEVNRTT  85

Query  1284  DDHGEFRVHLPFSVSKHVKKIKG------CSVKLINSSEPFCAVASTATSSS-IHLKERK  1126
             D +G +++ +P  V   V  I G      C   LI SS   C V    T++  I +K ++
Sbjct  86    DKYGVYKLEIP--VVDGVNCIDGFAMKSMCQANLIGSSSSACNVPGLKTTADEISVKSKQ  143

Query  1125  EGKHIFSAGFFTFKPLNQP-ELCNQK  1051
             +   I+S    +F+P  +   LC  K
Sbjct  144   DNLCIYSMNALSFRPSKKNVSLCGDK  169



>ref|XP_008222217.1| PREDICTED: proline-rich protein 4 [Prunus mume]
Length=307

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 71/146 (49%), Gaps = 17/146 (12%)
 Frame = -3

Query  1443  RYPPAAV-LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------T  1285
             R P A + +VG VYCDTC  + FS +S+F+ G  V ++C    N P   +++       T
Sbjct  30    RTPKARITVVGAVYCDTCSTNTFSRSSYFLPGVDVLIKCKFRGNSPKTAEDINFEVNRTT  89

Query  1284  DDHGEFRVHLPFSVSKHVKKIKG------CSVKLINSSEPFCAVASTATSSS-IHLKERK  1126
             D +G +++ +P  V   V  I G      C   LI SS   C V    T++  I +K ++
Sbjct  90    DKYGVYKLEIP--VVDGVNCIDGFAMKSMCQANLIGSSSSACNVPGLKTTADEISVKSKQ  147

Query  1125  EGKHIFSAGFFTFKPLNQP-ELCNQK  1051
             +   I+S    +F+P  +   LC  K
Sbjct  148   DNLCIYSMNALSFRPSKKNVSLCGDK  173



>ref|XP_003576722.2| PREDICTED: uncharacterized protein LOC100821140 [Brachypodium 
distachyon]
Length=255

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 79/181 (44%), Gaps = 24/181 (13%)
 Frame = -3

Query  1455  TEARRYPPAAV-LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP-----SFRKE  1294
              EAR + P  + +VG+VYCD C ++ FS+ S F+ GA V ++C    N       S   E
Sbjct  33    AEARPFLPNNITVVGSVYCDACSNNTFSKHSFFLKGARVLIQCSFKANSTLSEMISLEAE  92

Query  1293  VKTDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERK  1126
               TD HG +++ +P    F   +  +    C   L+ SS   CAV     SS  H+  R 
Sbjct  93    RMTDQHGVYKLDVPPVEGFECREGHELRSSCRATLLRSSSSACAVPGLRGSSQ-HIALRG  151

Query  1125  EGKHIFSAGFFTFKPLN------QPELCNQKPSIHGGFKKINGADSPITDPNNPAFLPPI  964
               ++  S+ F     LN         LC  + S +GGF      +S    P  P   PP 
Sbjct  152   RPRNGASSCFLNLNALNFRPAKRDATLC--RGSGNGGF-----GESLFFWPLMPLLWPPF  204

Query  963   R  961
             R
Sbjct  205   R  205



>ref|XP_006856325.1| hypothetical protein AMTR_s00047p00152060 [Amborella trichopoda]
 gb|ERN17792.1| hypothetical protein AMTR_s00047p00152060 [Amborella trichopoda]
Length=286

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPS  1045
             A SSS+HLK ++ G HI+SAGFFTFKPL QP+LCNQKP+
Sbjct  2     AESSSLHLKSKRAGLHIYSAGFFTFKPLKQPDLCNQKPN  40



>ref|NP_001140928.1| hypothetical protein precursor [Zea mays]
 gb|ACF84984.1| unknown [Zea mays]
 tpg|DAA62155.1| TPA: hypothetical protein ZEAMMB73_608085 [Zea mays]
Length=250

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 82/194 (42%), Gaps = 18/194 (9%)
 Frame = -3

Query  1506  MSWVRITFL-LCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVEC  1330
             M+   ++FL +  +L    EA+  P    +VG+VYCD C ++ FS+ S F+ GA V ++C
Sbjct  4     MAPAAVSFLAMALLLLSDAEAKFLPNNITVVGSVYCDACSNNTFSKHSFFLKGARVLIKC  63

Query  1329  GQSRNGP-----SFRKEVKTDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFC  1177
                 N       S   E  TD HG +++ +P    F   +  +    C   L+ SS   C
Sbjct  64    SFKVNSTSSEELSLEAERTTDQHGVYKLDVPPVDGFECREGHELRSACRATLVRSSSAAC  123

Query  1176  AVASTATSSS-IHLKERKEGKHIFSAGFFTFKPLNQP-ELCNQKPSIHGGFKKINGADSP  1003
              V     S+  I L+ R       +     F+P  +   LC+ +    GG        S 
Sbjct  124   NVPGLGASTQHIELRSRATSACFLNLNALNFRPAKRDGALCHAQ----GGDDAFG--SSL  177

Query  1002  ITDPNNPAFLPPIR  961
                P  P F PP R
Sbjct  178   FFWPFLPLFWPPFR  191



>ref|XP_004140544.1| PREDICTED: uncharacterized protein LOC101219402 [Cucumis sativus]
 gb|KGN46433.1| hypothetical protein Csa_6G092550 [Cucumis sativus]
Length=398

 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 66/137 (48%), Gaps = 12/137 (9%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEV------KTDDHGEFR  1264
              +VG VYCDTC  +  S+ S+F+ G  V ++C      P   +++       TD +G +R
Sbjct  38    TIVGAVYCDTCLSNSVSKHSYFLPGVDVHLQCKFRAIAPKMAEQMAFSVNRTTDKYGVYR  97

Query  1263  VHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSS-SIHLKERKEGKHIFSAG  1099
             + +P     + +  +     C   LI SS   C V    T+S  I +K +++   IFS  
Sbjct  98    LEIPSVDGINCADGMTMQSFCQASLIGSSSEVCNVPGLRTTSEEISVKSKQDNLCIFSLN  157

Query  1098  FFTFKPLNQPE-LCNQK  1051
               +++P+ + E LC  K
Sbjct  158   ALSYRPMKKNESLCGSK  174



>ref|XP_009600627.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana tomentosiformis]
Length=162

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 75/157 (48%), Gaps = 14/157 (9%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVEC-  1330
             M+ +   F++CF++     +  +    ++VG VYCDTC     + AS +++G+ V +EC 
Sbjct  1     MAKLVALFVVCFLVFASIASAHFMDTFLVVGKVYCDTCRCGFETSASKYLAGSRVRIECK  60

Query  1329  GQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSS  1150
              +  N  S+  E  T+  GE+++ +       V     C V LI SS+P CAV +     
Sbjct  61    NRDTNDISYTIEGVTNSKGEYKILVYSDRGDEV-----CDVVLIRSSDPMCAVPNAGRDR  115

Query  1149  SIHLKERKEG-----KHIFSAGFFTFKPLNQPELCNQ  1054
             +  +  R  G     +   S GF + +PL     CNQ
Sbjct  116   ARVVLTRNNGMVSNTRFANSIGFLSNEPLAS---CNQ  149



>ref|XP_002964293.1| hypothetical protein SELMODRAFT_438958 [Selaginella moellendorffii]
 gb|EFJ34626.1| hypothetical protein SELMODRAFT_438958 [Selaginella moellendorffii]
Length=387

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 63/125 (50%), Gaps = 10/125 (8%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFS  1246
             ++VG V+CD C    FSE + F+ GA VA+EC Q   G     E  TD  G F + +   
Sbjct  35    LVVGRVFCDRCIEGRFSEYAIFVKGAKVALECTQQDGG-IHVVEAVTDSAGAFAIPV---  90

Query  1245  VSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPE  1066
                  +    C+VKL+++  P C +A+   + +++   R +   I+  G  +F+P     
Sbjct  91    ----DEPGSSCAVKLLSTPTPQCNIAAK-HAQTLNANMRTKDNVIY-VGLLSFRPEEPLP  144

Query  1065  LCNQK  1051
             +C+Q+
Sbjct  145   ICSQR  149



>ref|XP_009797814.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana sylvestris]
Length=161

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 74/157 (47%), Gaps = 14/157 (9%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVEC-  1330
             M+ +   F++CF++     +  +    ++VG VYCDTC     + AS +++G+ V +EC 
Sbjct  1     MAKLVALFVVCFLVFASIASAHFMDTFLVVGKVYCDTCRCGFETSASKYLAGSRVRIECK  60

Query  1329  GQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSS  1150
              +  N  S+  E  T+  GE+++ +       V     C V LI SS+P CA  +     
Sbjct  61    KRDTNDVSYTIEGVTNSKGEYKILVYSDRGDEV-----CDVVLIRSSDPMCATPAAGRDR  115

Query  1149  SIHLKERKEG-----KHIFSAGFFTFKPLNQPELCNQ  1054
             +  +  R  G     +   S GF + +PL     CNQ
Sbjct  116   ARVVLTRNNGMISNTRFANSIGFLSDEPLAS---CNQ  149



>ref|XP_004492161.1| PREDICTED: major pollen allergen Ole e 1-like [Cicer arietinum]
Length=173

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (50%), Gaps = 12/133 (9%)
 Frame = -3

Query  1443  RYPPAAV-LVGTVYCDTCFHHDFSEASHFISGASVAVEC------GQSRNGPSFRKEVKT  1285
             +YP + + ++G VYCD C ++ FS  S+F+ GA V V+C       ++    +      T
Sbjct  31    KYPISQISVMGFVYCDFCSNNSFSRHSYFLPGAEVKVDCMFKALSAKTSEQITLSVNRTT  90

Query  1284  DDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEG  1120
             + +G +R+ +P       ++  + +  C   LI SS   C V    +TS+ I +K R+  
Sbjct  91    NKYGMYRLEIPSVDGVRCAEGSEILSSCQANLIGSSTSSCNVPGYKSTSNVIAVKARRTN  150

Query  1119  KHIFSAGFFTFKP  1081
               I+S    TFKP
Sbjct  151   LCIYSLNALTFKP  163



>ref|XP_002966791.1| hypothetical protein SELMODRAFT_439721 [Selaginella moellendorffii]
 gb|EFJ32818.1| hypothetical protein SELMODRAFT_439721 [Selaginella moellendorffii]
Length=409

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 63/125 (50%), Gaps = 10/125 (8%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFS  1246
             ++VG V+CD C    FSE + F+ GA VA+EC Q   G     E  TD  G F + +   
Sbjct  35    LVVGRVFCDRCIEGRFSEYAIFVKGAKVALECTQQDGG-IHVVEALTDSAGAFAIPV---  90

Query  1245  VSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPE  1066
                  +    C+VKL+++  P C +A+   + +++   R +   I+  G  +F+P     
Sbjct  91    ----DEPGSSCAVKLLSTPTPQCNIAAK-HAQTLNANMRTKDNVIY-VGLLSFRPEEPLP  144

Query  1065  LCNQK  1051
             +C+Q+
Sbjct  145   ICSQR  149



>ref|XP_004170598.1| PREDICTED: uncharacterized protein LOC101229108, partial [Cucumis 
sativus]
Length=314

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 66/136 (49%), Gaps = 12/136 (9%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEV------KTDDHGEFRV  1261
             +VG VYCDTC  +  S+ S+F+ G  V ++C      P   +++       TD +G +R+
Sbjct  39    IVGAVYCDTCLSNSVSKHSYFLPGVDVHLQCKFRAIAPKMAEQMAFSVNRTTDKYGVYRL  98

Query  1260  HLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSS-SIHLKERKEGKHIFSAGF  1096
              +P     + +  +     C   LI SS   C V    T+S  I +K +++   IFS   
Sbjct  99    EIPSVDGINCADGMTMQSFCQASLIGSSSEVCNVPGLRTTSEEISVKSKQDNLCIFSLNA  158

Query  1095  FTFKPLNQPE-LCNQK  1051
              +++P+ + E LC  K
Sbjct  159   LSYRPMKKNESLCGSK  174



>ref|XP_008459888.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Cucumis 
melo]
Length=390

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 64/137 (47%), Gaps = 12/137 (9%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEV------KTDDHGEFR  1264
              +VG VYCDTC  +  S+ S+F+ G  V ++C      P   +++       TD +G +R
Sbjct  36    TIVGAVYCDTCLSNSVSKHSYFLPGVDVHLQCKFRAIAPKMAEQMAFSVNRTTDKYGVYR  95

Query  1263  VHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSS-SIHLKERKEGKHIFSAG  1099
             + +P     +    +     C   LI S    C V    T+S  I +K +++   IFS  
Sbjct  96    LEIPSVDGINCVDGMTMQSFCQASLIGSPSEVCNVPGLRTTSEEISVKSKQDNLCIFSLN  155

Query  1098  FFTFKPLNQPE-LCNQK  1051
               +++P+ + E LC  K
Sbjct  156   ALSYRPMKKNESLCGSK  172



>gb|KHF98099.1| Major pollen allergen Lol p 11 [Gossypium arboreum]
Length=165

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (45%), Gaps = 13/155 (8%)
 Frame = -3

Query  1482  LLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECG------QS  1321
             L    L+  TE  +     +++G VYCD C ++ FS  S+F+ GA V ++C       ++
Sbjct  12    LFIMTLSLQTEPAKNNAQIIVMGLVYCDVCTNNSFSRHSYFLPGAEVQIDCNFRAYVPKT  71

Query  1320  RNGPSFRKEVKTDDHGEFRVHLPFSVS----KHVKKIKGCSVKLINSSEPFCAV-ASTAT  1156
             +   SF     TD HG + V +P SV             C   L+ S+   C +   ++T
Sbjct  72    KEQVSFSVNRTTDKHGVYMVEIP-SVDGIECAEADTASTCQASLVGSTSASCNIPGYSST  130

Query  1155  SSSIHLKERKEGKHIFSAGFFTFKPLNQ-PELCNQ  1054
             +  + +K R     I+      F+PL +   LC +
Sbjct  131   TDEMAIKSRHPNLCIYGLAAMNFRPLKRNARLCGK  165



>ref|XP_009412767.1| PREDICTED: proline-rich protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=276

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 74/160 (46%), Gaps = 13/160 (8%)
 Frame = -3

Query  1434  PAAVLVGTVYCDTCFHHDFSEASHFISGASVAVEC-----GQSRNGPSFRKEVKTDDHGE  1270
             P   ++G VYCDTC +++FS+ S+F+ GA V ++C       SR   S   +  TD  G 
Sbjct  28    PHITVLGAVYCDTCAYNNFSKNSYFLRGAEVQIDCKFVANSTSREAMSITADRTTDRFGV  87

Query  1269  FRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHIFS  1105
             +++ +P    F   +  +    C   L  SS   C VA   +S++ + +K+R+     F+
Sbjct  88    YKLEIPPVDGFECREGREIKSMCRASLSKSSSRRCDVAGFRSSTAHVAVKDRESNVCYFN  147

Query  1104  AGFFTFKPL--NQPELCNQKPSIHGGFKKINGADSPITDP  991
                 +++P   N P  C  K +    F   +    PI  P
Sbjct  148   LNALSYRPARRNVPR-CGAKEAAMSSFATSSFIFWPILPP  186



>ref|XP_002968741.1| hypothetical protein SELMODRAFT_409806 [Selaginella moellendorffii]
 gb|EFJ29857.1| hypothetical protein SELMODRAFT_409806 [Selaginella moellendorffii]
Length=349

 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 2/117 (2%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFS  1246
             +++G   CDTC+    +  S  +   + AVEC  +     FR+   TD+ G FRV LPF 
Sbjct  38    LVLGYAICDTCWEMQITANSISLPNVTAAVECFDAGGRIIFRETSSTDNTGAFRVELPFQ  97

Query  1245  VSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERK--EGKHIFSAGFFTFKP  1081
             ++  V  +  C+ +++            A + +  L  R   +G+ ++  G F F+P
Sbjct  98    IADSVSMLSTCTSRVVRGPLNHLCTYPLAHAYNPFLSPRSLPDGRQVYGVGPFVFRP  154



>ref|XP_006447015.1| hypothetical protein CICLE_v10016966mg [Citrus clementina]
 ref|XP_006470105.1| PREDICTED: uncharacterized protein LOC102620235 [Citrus sinensis]
 gb|ESR60255.1| hypothetical protein CICLE_v10016966mg [Citrus clementina]
 gb|KDO63870.1| hypothetical protein CISIN_1g030883mg [Citrus sinensis]
Length=170

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 59/124 (48%), Gaps = 10/124 (8%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFRV  1261
             ++G VYCD C ++ FS  S+F+ GA V V+C      P  R+++       T+ +G +++
Sbjct  37    VMGFVYCDICSNNSFSRHSYFLPGAEVKVDCKIRAISPRIREQISFTVNRTTNRYGIYKL  96

Query  1260  HLPFS---VSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAGFF  1093
              +P               C   L+ SS   C V A   T++ I +K RK    I+S    
Sbjct  97    EIPSVEGIACAEAAIASSCQASLMWSSSTSCNVPAYRTTTNQIAIKSRKPNLCIYSLNAL  156

Query  1092  TFKP  1081
             TF+P
Sbjct  157   TFRP  160



>ref|XP_002299330.2| hypothetical protein POPTR_0001s13450g [Populus trichocarpa]
 gb|EEE84135.2| hypothetical protein POPTR_0001s13450g [Populus trichocarpa]
Length=254

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 62/125 (50%), Gaps = 11/125 (9%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFRV  1261
             +VG VYCDTC  + FS  S+F+ GA V ++C  + N P  R++++      TD +G +++
Sbjct  38    VVGVVYCDTCSTNTFSRHSYFLPGADVHIQCIFNANSPKTREKIEFSVNRTTDRYGIYKL  97

Query  1260  HLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHIFSAGF  1096
              +P        +       C   LI SS   C V     S++ I +K ++    I+S   
Sbjct  98    EVPEVDGVDCEEGFAIESVCQANLIGSSSRVCNVPGLRISTNEISVKSKQNNLCIYSLNA  157

Query  1095  FTFKP  1081
              +++P
Sbjct  158   LSYRP  162



>ref|XP_011036125.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Populus 
euphratica]
Length=326

 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 63/125 (50%), Gaps = 11/125 (9%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFRV  1261
             +VG VYCDTC  + FS  S+F+ GA V ++C  + N P  R++++      T+ +G +++
Sbjct  38    VVGVVYCDTCSTNTFSRHSYFLPGADVHIQCIFNANSPKTREKIEFSVNRTTNRYGTYKL  97

Query  1260  HLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHIFSAGF  1096
              +P        +       C   LI SS P C V     S++ I +K ++    I++   
Sbjct  98    EVPEVDGVDCEEGFAIESVCQASLIGSSSPVCNVPGLKISTNEISVKSKQNNLCIYNLNA  157

Query  1095  FTFKP  1081
              +++P
Sbjct  158   LSYRP  162



>gb|EEE70019.1| hypothetical protein OsJ_29955 [Oryza sativa Japonica Group]
Length=249

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 72/183 (39%), Gaps = 11/183 (6%)
 Frame = -3

Query  1479  LCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP---  1309
             +  VL+G TEAR       +VG+VYCD C ++ FS+ S F+ GA V ++C    N     
Sbjct  7     MALVLSG-TEARFLSNNITVVGSVYCDACSNNTFSKHSFFLKGARVLIQCSFKVNSTMAE  65

Query  1308  --SFRKEVKTDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS  1147
               S   E  TD +G +++ +P    F   +       C   L+ SS   C V     S+ 
Sbjct  66    ELSLEAERTTDQNGVYKLDVPAAGGFDCREGHDLRSACRATLVRSSSAACNVPGLRGSTQ  125

Query  1146  -IHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNPAFLP  970
              I L+ R       +     F+P  +           G         S    P  P F P
Sbjct  126   HIALRSRATNACFLNLNALNFRPAKRDAALCHGGDGAGAGGGAAFGSSLFFWPFLPLFWP  185

Query  969   PIR  961
             P R
Sbjct  186   PYR  188



>gb|EEC84856.1| hypothetical protein OsI_31975 [Oryza sativa Indica Group]
Length=249

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 72/183 (39%), Gaps = 11/183 (6%)
 Frame = -3

Query  1479  LCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP---  1309
             +  VL+G TEAR       +VG+VYCD C ++ FS+ S F+ GA V ++C    N     
Sbjct  7     MALVLSG-TEARFLSNNITVVGSVYCDACSNNTFSKHSFFLKGARVLIQCSFKVNSTMAE  65

Query  1308  --SFRKEVKTDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS  1147
               S   E  TD +G +++ +P    F   +       C   L+ SS   C V     S+ 
Sbjct  66    ELSLEAERTTDQNGVYKLDVPAAGGFDCREGHDLRSACRATLVRSSSAACNVPGLRGSTQ  125

Query  1146  -IHLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNPAFLP  970
              I L+ R       +     F+P  +           G         S    P  P F P
Sbjct  126   HIALRSRATNACFLNLNALNFRPAKRDAALCHGGDGAGAGGGAAFGSSLFFWPFLPLFWP  185

Query  969   PIR  961
             P R
Sbjct  186   PYR  188



>ref|XP_003622081.1| hypothetical protein MTR_7g027020 [Medicago truncatula]
 gb|ACJ84631.1| unknown [Medicago truncatula]
 gb|AES78299.1| RALF-like protein [Medicago truncatula]
 gb|AFK46720.1| unknown [Medicago truncatula]
Length=173

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 65/133 (49%), Gaps = 12/133 (9%)
 Frame = -3

Query  1443  RYPPAAV-LVGTVYCDTCFHHDFSEASHFISGASVAVEC------GQSRNGPSFRKEVKT  1285
             R+P + + ++G VYCD C ++ FS  S+F+ GA V V+C       ++    +      T
Sbjct  31    RFPNSQISVMGFVYCDFCSNNSFSRHSYFLPGAEVKVDCMFKAISAKTTEQITLSVNRTT  90

Query  1284  DDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEG  1120
             + +G +R+ +P       ++  + +  C   LI SS   C V    +T++ I +K RK  
Sbjct  91    NKYGMYRIEVPSVDGVRCAEGTEVMSSCQANLIGSSTTACNVPGYKSTANVISVKARKTN  150

Query  1119  KHIFSAGFFTFKP  1081
               I+S     F+P
Sbjct  151   LCIYSLNALNFRP  163



>ref|XP_004231761.1| PREDICTED: pollen allergen Che a 1 [Solanum lycopersicum]
Length=168

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 69/145 (48%), Gaps = 13/145 (9%)
 Frame = -3

Query  1476  CFV-LNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECG----QSRNG  1312
             CF+ L+  + A+   P   ++G VYCD C ++ FS  S+F+ G  V +EC      +R  
Sbjct  14    CFLWLSLSSAAKVVNPQITVMGMVYCDICSNNSFSRHSYFMPGVEVKIECTFKAMATRTA  73

Query  1311  PSFRKEVK--TDDHGEFRVHLPF--SVSKHVKKIKG--CSVKLINSSEPFCAV--ASTAT  1156
                   V   T+ +G +R+ +P    +    +K  G  C   LI SS  FC V  ++  T
Sbjct  74    ELVSVSVNRTTNKYGVYRLEIPSVDGIECAAEKAVGNSCRASLIGSSSSFCNVPGSTRTT  133

Query  1155  SSSIHLKERKEGKHIFSAGFFTFKP  1081
             +  I +K ++    I+S     F+P
Sbjct  134   TDEITIKSKQANMCIYSLTALNFRP  158



>ref|XP_010103032.1| hypothetical protein L484_005787 [Morus notabilis]
 gb|EXB94630.1| hypothetical protein L484_005787 [Morus notabilis]
Length=166

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 9/115 (8%)
 Frame = -3

Query  1512  LKMSWVRITFLLCFV-LNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAV  1336
             +  S + I   LCF+ L GF  A    P  ++ G VYCDTC     ++ S++I GA V +
Sbjct  1     MTKSVIIIASALCFMSLLGF--AYCDTPHLIVEGRVYCDTCRAQFVTKVSNYIKGAKVRL  58

Query  1335  ECGQSRNGP-SFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCA  1174
             EC +S  G  ++  +  TD+ G +R+ +      H +++  C VKL+ SS P C+
Sbjct  59    ECRESEGGSVTYSNDGVTDESGTYRIAVD---GDHEEEV--CEVKLVKSSVPDCS  108



>ref|XP_006338717.1| PREDICTED: pollen allergen Che a 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006338718.1| PREDICTED: pollen allergen Che a 1-like isoform X2 [Solanum tuberosum]
Length=168

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 69/145 (48%), Gaps = 13/145 (9%)
 Frame = -3

Query  1476  CFV-LNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECG----QSRNG  1312
             CF+ L+  + A+   P   ++G VYCD C ++ FS  S+F+ G  V +EC      +R  
Sbjct  14    CFLWLSLSSAAKVVNPQITVMGMVYCDICSNNSFSRHSYFMPGVEVKIECTFKAMATRTA  73

Query  1311  PSFRKEVK--TDDHGEFRVHLPF--SVSKHVKKIKG--CSVKLINSSEPFCAV--ASTAT  1156
                   V   T+ +G +R+ +P    +    +K  G  C   LI SS  FC V  ++  T
Sbjct  74    ELVSVSVNRTTNKYGVYRLEIPSVDGIECAAEKAVGNSCRASLIGSSSSFCNVPGSTRTT  133

Query  1155  SSSIHLKERKEGKHIFSAGFFTFKP  1081
             +  I +K ++    I+S     F+P
Sbjct  134   TDEITIKSKQANMCIYSLTALNFRP  158



>ref|XP_004304541.1| PREDICTED: uncharacterized protein LOC101296410 [Fragaria vesca 
subsp. vesca]
Length=174

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 12/137 (9%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKTDDHGEFR  1264
             +++G VYCD C ++ FS  S+FISGA V ++C      P      SF     T+ +G ++
Sbjct  36    IVMGLVYCDICSNNTFSTHSYFISGAEVRIDCMFKAVSPRIAEHISFSANRTTNRYGVYK  95

Query  1263  VHLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAG  1099
             + +P       ++    +  C   L+ S  P C V    +TS  I +K ++    I+S  
Sbjct  96    LEIPSVEGIKCAEDSAIVSSCQASLMWSGTPACNVPGFKSTSDEIAVKSKQANLCIYSLN  155

Query  1098  FFTFKP-LNQPELCNQK  1051
                F+P   +  LC +K
Sbjct  156   ALNFRPSRREIGLCGKK  172



>ref|NP_001063620.1| Os09g0508200 [Oryza sativa Japonica Group]
 dbj|BAF25534.1| Os09g0508200 [Oryza sativa Japonica Group]
 dbj|BAG89164.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 71/181 (39%), Gaps = 11/181 (6%)
 Frame = -3

Query  1473  FVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP-----  1309
              VL+G TEAR       +VG+VYCD C ++ FS+ S F+ GA V ++C    N       
Sbjct  22    LVLSG-TEARFLSNNITVVGSVYCDACSNNTFSKHSFFLKGARVLIQCSFKVNSTMAEEL  80

Query  1308  SFRKEVKTDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS-I  1144
             S   E  TD +G +++ +P    F   +       C   L+ SS   C V     S+  I
Sbjct  81    SLEAERTTDQNGVYKLDVPAAGGFDCREGHDLRSACRATLVRSSSAACNVPGLRGSTQHI  140

Query  1143  HLKERKEGKHIFSAGFFTFKPLNQPELCNQKPSIHGGFKKINGADSPITDPNNPAFLPPI  964
              L+ R       +     F+P  +           G         S    P  P F PP 
Sbjct  141   ALRSRATNACFLNLNALNFRPAKRDAALCHGGDGAGAGGGAAFGSSLFFWPFLPLFWPPY  200

Query  963   R  961
             R
Sbjct  201   R  201



>ref|XP_007139104.1| hypothetical protein PHAVU_008G001600g [Phaseolus vulgaris]
 gb|ESW11098.1| hypothetical protein PHAVU_008G001600g [Phaseolus vulgaris]
Length=299

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 68/147 (46%), Gaps = 15/147 (10%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKTDDHGEFRV  1261
             +VG VYCDTC    FS+ S+F+ G  V ++C      P      SF     TD +G +++
Sbjct  35    VVGAVYCDTCSTSTFSKESYFLQGVEVHIQCRFRATSPKTNEQISFSVNRSTDQYGVYKL  94

Query  1260  HLP----FSVSKHVKKIKGCSVKLINSSEPFCAVA-STATSSSIHLKERKEGKHIFSAGF  1096
              +P     +       +  C   LI+SS   C V    +T+  I +K +++   +++   
Sbjct  95    EIPSVDGVNCMDGSAIVSLCQASLISSSNSTCNVPFLKSTTRQISVKSKQDNLCVYTLSG  154

Query  1095  FTFKPLNQ-PELC---NQKPSIHGGFK  1027
              ++KP  +   LC   NQ+P +   F 
Sbjct  155   LSYKPPQKNTTLCGHQNQQPPLPNSFN  181



>ref|XP_004957299.1| PREDICTED: uncharacterized protein LOC101775204 [Setaria italica]
Length=261

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 56/125 (45%), Gaps = 10/125 (8%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP-----SFRKEVKTDDHGEFRV  1261
              +VG+VYCD C ++ FS+ S F+ GA V ++C    N       S   E  TD HG +++
Sbjct  39    TVVGSVYCDACSNNTFSKHSFFLKGARVLIKCSFKVNSTSSEELSLEAERTTDQHGVYKL  98

Query  1260  HLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHIFSAGF  1096
              +P    F   +  +    C   L+ SS   C V     S+  I L+ R  G    +   
Sbjct  99    DVPPVDGFECREGHELRSACRATLVRSSSAACNVPGVGGSTQHIALRSRATGACFLNLNA  158

Query  1095  FTFKP  1081
               F+P
Sbjct  159   LNFRP  163



>ref|XP_011020818.1| PREDICTED: sulfated surface glycoprotein 185-like [Populus euphratica]
Length=311

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 15/128 (12%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFR  1264
             ++VG VYCDTC  + FS  S F+ GA V ++C      P   ++++      TD +G ++
Sbjct  37    IIVGVVYCDTCSTNTFSRYSCFLPGADVHIQCTFQAISPKTAEKIEFSANRTTDRYGIYK  96

Query  1263  VHLPFSVSKHVKKIKG------CSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHIFS  1105
             V +P      V  +KG      C   LI SS P C V     S+  I +K ++    I+S
Sbjct  97    VTVP--EVDGVDCVKGSTIELICLASLIRSSSPACNVPGLKMSTDEISVKSKQNNLCIYS  154

Query  1104  AGFFTFKP  1081
                 +++P
Sbjct  155   MSALSYRP  162



>ref|XP_002303768.2| hypothetical protein POPTR_0003s16550g [Populus trichocarpa]
 gb|EEE78747.2| hypothetical protein POPTR_0003s16550g [Populus trichocarpa]
Length=296

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 63/128 (49%), Gaps = 15/128 (12%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFR  1264
             ++VG VYCDTC  + FS  S F+ GA V ++C      P   ++++      TD +G ++
Sbjct  33    IIVGVVYCDTCSTNTFSRYSCFLPGADVHIQCTFQAISPKTTEKIQFSANRTTDRYGIYK  92

Query  1263  VHLP------FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHIFS  1105
             V +P       +V   ++ +  C   LI SS P C V     S+  I +K ++    I+S
Sbjct  93    VTVPEVDGVDCAVGSTIELV--CQASLIRSSYPACNVPGLKMSTDVISVKSKQNNLCIYS  150

Query  1104  AGFFTFKP  1081
                 +++P
Sbjct  151   MNALSYRP  158



>ref|XP_008341256.1| PREDICTED: uncharacterized protein LOC103404151 [Malus domestica]
Length=180

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 68/137 (50%), Gaps = 12/137 (9%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKTDDHGEFR  1264
             +++G VYCD C+++ FS+ S+F+ GA V ++C      P      SF     T+ +G ++
Sbjct  43    IVMGLVYCDICYNNTFSKHSYFLPGAEVKIDCIFQAVSPRTSEHISFSVNRTTNRYGVYK  102

Query  1263  VHLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAG  1099
             + +P       ++    +  C   L+ SS   C V    +TS+ I +K ++    I+S  
Sbjct  103   LEIPSVEGIKCAEDSAIVSSCQASLMWSSSSACNVPGYKSTSNEIAVKSKQANLCIYSLN  162

Query  1098  FFTFKPLNQP-ELCNQK  1051
                F+P  +  +LC +K
Sbjct  163   ALNFRPSKRDVKLCGKK  179



>ref|NP_001235830.1| uncharacterized protein LOC100500029 precursor [Glycine max]
 gb|ACU14658.1| unknown [Glycine max]
 gb|KHN15564.1| hypothetical protein glysoja_043228 [Glycine soja]
Length=173

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 64/133 (48%), Gaps = 12/133 (9%)
 Frame = -3

Query  1443  RYPPAAV-LVGTVYCDTCFHHDFSEASHFISGASVAVECG------QSRNGPSFRKEVKT  1285
             R+P + + ++G VYCD C ++ FS  S+F+ GA V V+C       ++    S      T
Sbjct  31    RFPISQISVMGFVYCDFCSNNSFSRHSYFLPGAEVKVDCMFKALSEKTSEQISLSVNRTT  90

Query  1284  DDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEG  1120
             + +G +++ +P       ++    +  C   LI SS   C V     TS+ I +K R+  
Sbjct  91    NKYGMYKLEIPSVDGVKCAEDSAVVSSCQASLIGSSSSACNVPGYKTTSNVIAIKARRAN  150

Query  1119  KHIFSAGFFTFKP  1081
               I+S    TF+P
Sbjct  151   LCIYSFNALTFRP  163



>ref|XP_008450135.1| PREDICTED: major pollen allergen Ole e 1-like [Cucumis melo]
Length=172

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 76/168 (45%), Gaps = 25/168 (15%)
 Frame = -3

Query  1491  ITFLLCFVLNGFT---------EARRYPPAAV-----LVGTVYCDTCFHHDFSEASHFIS  1354
             +  +L FVL              A  +PP  +     ++G VYCDTC ++ FS+ S+F+S
Sbjct  1     MNLILLFVLASLVPSSFLFEIQAAHSHPPRTIYSQITVMGLVYCDTCSNNTFSKHSYFLS  60

Query  1353  GASVAVECGQSRNGPSFRKEV------KTDDHGEFRVHLP----FSVSKHVKKIKGCSVK  1204
             GA V ++C      P   +++       T+ +G +++ +P       ++    +  C   
Sbjct  61    GAEVRIDCKLKAETPRTAEQIAFSVNRTTNKYGVYKLEIPSVDGIRCAEDSAMVSFCQAS  120

Query  1203  LINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPEL  1063
             L+ SS   C V    +TS  I +K R+    I+S     +KP  + ++
Sbjct  121   LMGSSSSSCNVPGYRSTSGEISIKSRQSNICIYSLNPLNYKPSTRDDI  168



>ref|XP_002300128.1| hypothetical protein POPTR_0001s33380g [Populus trichocarpa]
 gb|EEE84933.1| hypothetical protein POPTR_0001s33380g [Populus trichocarpa]
Length=169

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 67/137 (49%), Gaps = 12/137 (9%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFRV  1261
             ++G VYCD C ++ FS  S+F+ GA V ++C    + P  R+++       T+ HG +++
Sbjct  33    VMGLVYCDICSNNSFSRHSYFLPGAEVRIDCKFKASWPKTREQISFSVNRTTNKHGMYKL  92

Query  1260  HLPFS---VSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAGFF  1093
              +P               C   L++SS   C V    +T++ I +K +++   I+S    
Sbjct  93    EIPSVDGIACAQAAIDSSCEASLMSSSSKACNVPGYKSTTNEIAIKVKQQNLCIYSLNAL  152

Query  1092  TFKPLNQPE-LC-NQKP  1048
              F+P      LC N+KP
Sbjct  153   NFRPSKTDAGLCGNRKP  169



>ref|XP_003551861.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Glycine 
max]
Length=271

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 60/125 (48%), Gaps = 11/125 (9%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKTDDHGEFRV  1261
             +VG VYCDTC    FS+ S+F+ G  V ++C      P      SF     TD +G +++
Sbjct  35    VVGAVYCDTCSTSTFSKQSYFLQGVEVHIQCRFRATSPKTSEQISFSVNRTTDQYGVYKL  94

Query  1260  HLP----FSVSKHVKKIKGCSVKLINSSEPFCAVA-STATSSSIHLKERKEGKHIFSAGF  1096
              +P     +       +  C   LI+SS   C+V    +T+  I +K +++   +++   
Sbjct  95    EIPSVDGVNCMDGSAIVSLCQATLISSSTSTCSVPFLKSTTREISVKSKQDNLCVYTLSG  154

Query  1095  FTFKP  1081
              ++KP
Sbjct  155   LSYKP  159



>ref|XP_002514867.1| hydrolase, acting on ester bonds, putative [Ricinus communis]
 gb|EEF47421.1| hydrolase, acting on ester bonds, putative [Ricinus communis]
Length=341

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 59/125 (47%), Gaps = 21/125 (17%)
 Frame = -3

Query  1407  YCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFRVHLPFS  1246
             YCDTC  + FS  S+F+ G  V ++C    N P   +++       TD +G +++ +P  
Sbjct  39    YCDTCSTNSFSRHSYFLPGVDVQIQCTFKANAPKTAEQINISVNRTTDRYGTYKLEVP--  96

Query  1245  VSKHVKKIKG---------CSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAGF  1096
                HV  +           C   LI+SS P C V  S  T+  I +K +++   I+S   
Sbjct  97    ---HVDGVDCVDGSAIESVCQASLISSSTPACNVLGSKTTTDQISIKSKQDNHCIYSLNA  153

Query  1095  FTFKP  1081
              ++KP
Sbjct  154   LSYKP  158



>ref|XP_006442530.1| hypothetical protein CICLE_v10024378mg [Citrus clementina]
 gb|ESR55770.1| hypothetical protein CICLE_v10024378mg [Citrus clementina]
Length=163

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 69/131 (53%), Gaps = 13/131 (10%)
 Frame = -3

Query  1518  KKLKMSWVRITFLLCFV-LNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASV  1342
             K +K+  V  T L CF  L  F  A + P    + G VYCD+C     +E S +I+GA+V
Sbjct  3     KSMKLVAVVATAL-CFTSLLSFALAAKDPKT--VEGLVYCDSCRVKYKTELSDYIAGATV  59

Query  1341  AVECGQSRNGP-SFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCA--V  1171
             A+EC +S  G   + +EV +D  G +++ +    +K       C V+L+ S +P C+  V
Sbjct  60    ALECKESEGGEVVYSREVVSDQSGTYKIPIEGCHAKL------CQVRLVKSPKPECSEIV  113

Query  1170  ASTATSSSIHL  1138
             A   +S+ I L
Sbjct  114   ADGLSSARIDL  124



>ref|XP_008804096.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Phoenix 
dactylifera]
Length=270

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 68/156 (44%), Gaps = 15/156 (10%)
 Frame = -3

Query  1485  FLLCFVLNG----FTEARRYPPAAV-LVGTVYCDTCFHHDFSEASHFISGASVAVEC---  1330
             FL+ FV  G    + EA   P + + ++G V+CD C ++ FS+ S+FI GA V ++C   
Sbjct  5     FLIVFVALGTKFFYVEALPKPISNITVIGAVFCDVCSNNTFSKHSYFIKGAEVLIQCKFR  64

Query  1329  --GQSRNGPSFRKEVKTDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVA  1168
                 S    S   E  TD  G +++ +P        +  +    C   LI SS   C V 
Sbjct  65    ANSMSTEEISIMAERTTDRFGVYKLDIPPVDGLECREGREVKSSCRASLIKSSSSVCGVP  124

Query  1167  STATSSS-IHLKERKEGKHIFSAGFFTFKPLNQPEL  1063
                 S+  + +K R      F+     F+P N   L
Sbjct  125   GLRRSTEHVAIKSRDADICFFNLNALNFRPANMDTL  160



>ref|XP_007215048.1| hypothetical protein PRUPE_ppa012112mg [Prunus persica]
 gb|EMJ16247.1| hypothetical protein PRUPE_ppa012112mg [Prunus persica]
Length=183

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 64/137 (47%), Gaps = 12/137 (9%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKTDDHGEFR  1264
             +++G VYCD C ++ FS  S+FI GA V ++C      P      SF     T+ +G ++
Sbjct  46    IVMGLVYCDICSNNTFSRHSYFIPGAEVKIDCIFQAVSPRTSEHISFSVNRTTNKYGVYK  105

Query  1263  VHLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAG  1099
             + +P       ++    +  C   L+ SS   C V    +TS  I +K ++    I+S  
Sbjct  106   LEIPAVEGIKCAQDSAIVSSCQATLMWSSSSVCNVPGYKSTSDEITVKSKQANLCIYSLN  165

Query  1098  FFTFKPLNQP-ELCNQK  1051
                F+P  +   LC +K
Sbjct  166   ALNFRPSKREITLCGKK  182



>gb|KHF99541.1| Major pollen allergen Pla l 1 [Gossypium arboreum]
Length=133

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 55/123 (45%), Gaps = 10/123 (8%)
 Frame = -3

Query  1419  VGTVYCDTCFHHDFSEASHFISGASVAVECG------QSRNGPSFRKEVKTDDHGEFRVH  1258
             +G VYCD C ++ FS  S+F+ GA V + C       ++R   SF     TD HG +R+ 
Sbjct  1     MGLVYCDICSNNSFSRHSYFLPGAEVQIACNFRAFVPKTREQVSFSVNRTTDKHGVYRLE  60

Query  1257  LPFS---VSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAGFFT  1090
             +P               C   L+ +S   C +    +T+  I +K R     I+S    +
Sbjct  61    IPSVDGIACAEAAIASSCQASLVGTSSTSCNIPGHRSTTDQIAIKSRHPNLCIYSLTALS  120

Query  1089  FKP  1081
             F+P
Sbjct  121   FRP  123



>ref|XP_003549067.1| PREDICTED: major pollen allergen Ole e 1-like [Glycine max]
 gb|KHN28275.1| hypothetical protein glysoja_040155 [Glycine soja]
Length=173

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 12/133 (9%)
 Frame = -3

Query  1443  RYPPAAV-LVGTVYCDTCFHHDFSEASHFISGASVAVECG------QSRNGPSFRKEVKT  1285
             R+P + + ++G VYCD C +  FS  S+F+ GA V V+C       ++    S      T
Sbjct  31    RFPISQISVMGFVYCDFCSNSSFSRHSYFLPGAEVKVDCMFKALSEKTSEQISLSVNRTT  90

Query  1284  DDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEG  1120
             + +G +++ +P       ++    +  C   LI SS   C V     TS+ I +K R+  
Sbjct  91    NKYGMYKLEIPSVDGVKCAEDSAVVSSCQASLIGSSSSACNVPGYKTTSNVIAIKARRAN  150

Query  1119  KHIFSAGFFTFKP  1081
               I+S    TF+P
Sbjct  151   LCIYSFNALTFRP  163



>ref|XP_010530959.1| PREDICTED: uncharacterized protein LOC104807398 [Tarenaya hassleriana]
Length=293

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 60/126 (48%), Gaps = 11/126 (9%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFR  1264
              +VG VYCDTC  + FS  S+F+ G  V V C    N P   +E+       T+  G ++
Sbjct  74    TVVGVVYCDTCSSNTFSRQSYFLQGVEVHVSCKFKANSPETAEEMNISVNRTTNRSGVYK  133

Query  1263  VHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHIFSAG  1099
             V +P          +     C  +L+ +S+  C +    TS++ I +K +++   I+S  
Sbjct  134   VEIPHVDGVDCVDGIAIASQCQARLLGTSDRACNIPVFQTSTNEISVKSKQDKLCIYSLT  193

Query  1098  FFTFKP  1081
               ++KP
Sbjct  194   ALSYKP  199



>ref|XP_003530903.1| PREDICTED: actin cytoskeleton-regulatory complex protein PAN1-like 
[Glycine max]
Length=251

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 11/125 (9%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKTDDHGEFRV  1261
             +VG VYCDTC    FS+ S+F+ G  V ++C      P      SF     TD +G +++
Sbjct  36    VVGAVYCDTCSTSTFSKQSYFLQGVEVHIQCRFRATSPKTSEQISFSVNRTTDQYGVYKL  95

Query  1260  HLP----FSVSKHVKKIKGCSVKLINSSEPFCAVA-STATSSSIHLKERKEGKHIFSAGF  1096
              +P     +       +  C   LI+SS   C V    +T+  I +K +++   +++   
Sbjct  96    DIPSVDGVNCMDGSTIVSLCQATLISSSTSTCNVPFLKSTTRQISVKSKQDNLCVYTLSG  155

Query  1095  FTFKP  1081
              ++KP
Sbjct  156   LSYKP  160



>gb|KHN24972.1| Olee1-like protein [Glycine soja]
Length=251

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 11/125 (9%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKTDDHGEFRV  1261
             +VG VYCDTC    FS+ S+F+ G  V ++C      P      SF     TD +G +++
Sbjct  36    VVGAVYCDTCSTSTFSKQSYFLQGVEVHIQCRFRATSPKTSEQISFSVNRTTDQYGVYKL  95

Query  1260  HLP----FSVSKHVKKIKGCSVKLINSSEPFCAVA-STATSSSIHLKERKEGKHIFSAGF  1096
              +P     +       +  C   LI+SS   C V    +T+  I +K +++   +++   
Sbjct  96    DIPSVDGVNCMDGSTIVSLCQATLISSSTSTCNVPFLKSTTRQISVKSKQDNLCVYTLSG  155

Query  1095  FTFKP  1081
              ++KP
Sbjct  156   LSYKP  160



>emb|CDX91146.1| BnaC02g04510D [Brassica napus]
Length=269

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 74/171 (43%), Gaps = 25/171 (15%)
 Frame = -3

Query  1476  CFVLNGFTEARRYPPAAV---------LVGTVYCDTCFHHDFSEASHFISGASVAVECGQ  1324
             C     F   R  PP  V         +VG VYCDTC  + FS  S+F+ G  V V C  
Sbjct  14    CLTHQAFGRGRNRPPREVSSYPSSSITVVGVVYCDTCSSNTFSRQSYFLQGVDVHVSCRF  73

Query  1323  SRNGPSFRKEVK------TDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCA  1174
               + P   +EV       T+  G +++ +P     +    +     CS KLI +S+    
Sbjct  74    KASSPKTTEEVNISVNRTTNRSGVYKLEIPHVDGINCVDGIAIASQCSAKLIKTSDSNIG  133

Query  1173  ----VASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQ-PELCNQKPSIHG  1036
                 V  TAT + + +K +++   I+S    ++KP ++   LC+     HG
Sbjct  134   CNIPVFQTAT-NEVSIKSKQDRVCIYSLSALSYKPSHRNTTLCSGGKRHHG  183



>ref|XP_002990583.1| hypothetical protein SELMODRAFT_448085 [Selaginella moellendorffii]
 gb|EFJ08460.1| hypothetical protein SELMODRAFT_448085 [Selaginella moellendorffii]
Length=1449

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 61/127 (48%), Gaps = 7/127 (6%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFS  1246
             ++VG V+CD C    FS  + F+ GA VA+EC     G     E +TD  G F +  PF 
Sbjct  286   IVVGRVFCDRCVEGRFSRHAAFVKGAKVALECTGDDGGIHV-AEGETDMAGSFLI--PFD  342

Query  1245  VSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFTFKPLNQPE  1066
              SK       CSVKL+N+    C + S    + +   + K  K++  AG  +F+P     
Sbjct  343   TSK--INSHSCSVKLVNAPLSECNLVS--KPAQVLTPDMKLKKNVVYAGLLSFRPEEPLP  398

Query  1065  LCNQKPS  1045
              C+ + S
Sbjct  399   ACSSRKS  405



>ref|XP_009125887.1| PREDICTED: uncharacterized protein LOC103850845 [Brassica rapa]
 emb|CDX85670.1| BnaA02g01430D [Brassica napus]
Length=270

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 74/171 (43%), Gaps = 23/171 (13%)
 Frame = -3

Query  1476  CFVLNGFTEARRYPPAAV---------LVGTVYCDTCFHHDFSEASHFISGASVAVECGQ  1324
             C     F   R  PP  V         +VG VYCDTC  + FS  S+F+ G  V V C  
Sbjct  14    CLTHQAFGRGRNRPPREVSSYPSSSITVVGVVYCDTCSSNTFSRQSYFLQGVDVHVSCRF  73

Query  1323  SRNGPSFRKEVK------TDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPF--  1180
               + P   +EV       T+  G +++ +P          +     CS KLI +S+    
Sbjct  74    KASSPKTTEEVNISVNRTTNRSGVYKLEIPHVDGIDCVDGIAIASQCSAKLIKTSDSNIG  133

Query  1179  CAVASTATSSS-IHLKERKEGKHIFSAGFFTFKPLNQ-PELCNQKPSIHGG  1033
             C V    T+++ + +K +++   I+S    ++KP ++   LC+     H G
Sbjct  134   CNVPVFQTATNEVSIKSKQDRVCIYSLSALSYKPSHRNTTLCSSGGKRHHG  184



>ref|XP_007161686.1| hypothetical protein PHAVU_001G089800g [Phaseolus vulgaris]
 gb|ESW33680.1| hypothetical protein PHAVU_001G089800g [Phaseolus vulgaris]
Length=173

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 64/133 (48%), Gaps = 12/133 (9%)
 Frame = -3

Query  1443  RYPPAAV-LVGTVYCDTCFHHDFSEASHFISGASVAVECG------QSRNGPSFRKEVKT  1285
             R+P + + ++G VYCD C ++ FS  S+F+ GA V V+C       ++    S      T
Sbjct  31    RFPISQISVMGFVYCDFCSNNSFSRHSYFLPGAEVKVDCMFKALSEKTVEQISLSVNRTT  90

Query  1284  DDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEG  1120
             + +G +++ +P       ++    +  C   L+ SS   C V     TS+ I +K RK  
Sbjct  91    NKYGMYKLEIPSVDGVKCAEDSAVVSSCQASLVGSSSSACNVPGYKTTSNVIAIKARKAN  150

Query  1119  KHIFSAGFFTFKP  1081
               I+S    TF+P
Sbjct  151   LCIYSFYALTFRP  163



>ref|XP_011045748.1| PREDICTED: major pollen allergen Ole e 1 [Populus euphratica]
Length=166

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 65/124 (52%), Gaps = 10/124 (8%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFRV  1261
             ++G VYCD C ++ FS  S+F+ GA V ++C    + P  R+++       T+ +G +++
Sbjct  33    VMGLVYCDICSNNTFSRHSYFLPGAEVRIDCKFKASWPKTREQISFSVNRTTNRYGMYKL  92

Query  1260  HLPF--SVSKHVKKI-KGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAGFF  1093
              +P    ++  +  I   C   L++SS   C V    +T++ I +K +++   I+S    
Sbjct  93    EIPSVDGIACALAAIDSSCEASLMSSSSKACNVPGYKSTTNEISIKVKQQNLCIYSLNAL  152

Query  1092  TFKP  1081
              F+P
Sbjct  153   NFRP  156



>gb|KHN12588.1| Olee1-like protein [Glycine soja]
Length=271

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 70/154 (45%), Gaps = 15/154 (10%)
 Frame = -3

Query  1497  VRITFLLCFVLNGFTEARRYPPAAV----LVGTVYCDTCFHHDFSEASHFISGASVAVEC  1330
             +R+ F+   +   F    + P   +    +VG VYCD+C    FS+ S+F+ G  V ++C
Sbjct  6     IRLFFVTSLLCCPFLLIAQSPSPIISRISVVGAVYCDSCSTSTFSKQSYFLQGVEVHIQC  65

Query  1329  GQSRNGP------SFRKEVKTDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPF  1180
                   P      SF     TD +G +++ +P     +       +  C   LI+SS   
Sbjct  66    RFRATSPKTSEQISFSVNRTTDQYGVYKLEIPSVDGVNCMDGSAIVSLCQATLISSSTST  125

Query  1179  CAVA-STATSSSIHLKERKEGKHIFSAGFFTFKP  1081
             C+V    +T+  I +K +++   +++    ++KP
Sbjct  126   CSVPFLKSTTREISVKSKQDNLCVYTLSGLSYKP  159



>ref|XP_004148007.1| PREDICTED: major pollen allergen-like [Cucumis sativus]
 ref|XP_004161513.1| PREDICTED: major pollen allergen-like [Cucumis sativus]
 gb|KGN58156.1| hypothetical protein Csa_3G563290 [Cucumis sativus]
Length=172

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 70/153 (46%), Gaps = 16/153 (10%)
 Frame = -3

Query  1473  FVLNGFTEARRYPPAAV-----LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP  1309
             F L     A  +PP        ++G VYCDTC ++ FS+ S+F+SGA V ++C      P
Sbjct  16    FFLFEIKAAHSHPPRTTYSQITVMGLVYCDTCSNNTFSKHSYFLSGAEVRIDCKLKAETP  75

Query  1308  ------SFRKEVKTDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-AST  1162
                   +F     T+ +G +++ +P       ++    +  C   L+ SS   C V    
Sbjct  76    RTAEQIAFSVNRTTNKYGVYKLEIPSVDGIRCAEDSAMVSFCQASLMGSSSSSCNVPGYR  135

Query  1161  ATSSSIHLKERKEGKHIFSAGFFTFKPLNQPEL  1063
             +TS  I +K R+    I+S     ++P  + ++
Sbjct  136   STSGEISIKSRQSNICIYSLNPLNYRPSTRDDI  168



>gb|EAZ04111.1| hypothetical protein OsI_26257 [Oryza sativa Indica Group]
Length=215

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 55/111 (50%), Gaps = 12/111 (11%)
 Frame = -3

Query  1359  ISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLI--NSSE  1186
             +SGA VAV C        FR++  TD  GEFRVHLP      +  +  CSVKL+  N++ 
Sbjct  60    VSGAPVAVRCHDGNGRDVFRQQALTDRRGEFRVHLPPEAKSRLASVTSCSVKLLASNAAR  119

Query  1185  PF--CAVASTATSSSIHLKERK----EGKHIFSAGFFTFKPLNQPELCNQK  1051
             P    A  S AT+    L   K    +G  +F+AG F       PELC+ K
Sbjct  120   PCDDAAATSAATARGFRLAATKHNGGDGARVFNAGAFAV----HPELCDDK  166



>ref|XP_006373238.1| hypothetical protein POPTR_0017s09980g [Populus trichocarpa]
 gb|ABK93350.1| unknown [Populus trichocarpa]
 gb|ERP51035.1| hypothetical protein POPTR_0017s09980g [Populus trichocarpa]
Length=166

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 73/157 (46%), Gaps = 16/157 (10%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRYPPAAV-----LVGTVYCDTCFHHDFSEASHFISGASV  1342
             M+ + I FL    +N  + ++  PP  +     ++G VYCD C ++ FS  S+F+ GA V
Sbjct  1     MNQLIIFFLSSLFINSLS-SKAEPPKKISAHITVMGIVYCDICSNNSFSRHSYFLPGAEV  59

Query  1341  AVECGQSRNGPSFRKEVK------TDDHGEFRVHLPFS---VSKHVKKIKGCSVKLINSS  1189
              ++C    + P  R+++       T+ HG +++ +P               C   L+ SS
Sbjct  60    RMDCKFEASWPKTREQISFSVNRTTNRHGMYKLEIPSVDGIACAQAAIDSSCEASLMWSS  119

Query  1188  EPFCAVASTATSS-SIHLKERKEGKHIFSAGFFTFKP  1081
                C V    +S+  I +K +++   I+S     F+P
Sbjct  120   SKACNVPGYKSSTKEIAIKVKQQNICIYSLNALNFRP  156



>gb|KDP26854.1| hypothetical protein JCGZ_18012 [Jatropha curcas]
Length=346

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 68/150 (45%), Gaps = 23/150 (15%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFRV  1261
             +VG VYCDTC  + FS  S+F+ G  V + C      P   +++       TD +G +++
Sbjct  32    VVGVVYCDTCSTNSFSRNSYFLPGVDVHIRCTFKATSPKTAEQINFSVNRTTDKYGIYKL  91

Query  1260  HLPFSVSKHVKKIKG---------CSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHI  1111
              +P     HV  +           C   LI SS   C V    T+++ + +K +++   I
Sbjct  92    EIP-----HVDGVDCVDGSSIETLCQASLIESSSSACNVPGLKTTTNEVSVKSKQDNHCI  146

Query  1110  FSAGFFTFKPLNQP-ELC-NQKPSIHGGFK  1027
             +S    +++P+ +   LC N K  +   F 
Sbjct  147   YSLNALSYRPVKKNITLCGNYKEELSNSFN  176



>gb|AFK43957.1| unknown [Lotus japonicus]
Length=174

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 12/133 (9%)
 Frame = -3

Query  1443  RYPPAAV-LVGTVYCDTCFHHDFSEASHFISGASVAVECG------QSRNGPSFRKEVKT  1285
             R P + + ++G VYCD C ++ FS  S+F+ GA V V+C       ++    S      T
Sbjct  32    RLPISQISVMGFVYCDFCSNNSFSRHSYFLPGAEVRVDCMFKALSEKTTEQISLSVNRTT  91

Query  1284  DDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEG  1120
             D  G +R+ +P       ++  + +  C   LI SS   C V    +TS+ + +K RK  
Sbjct  92    DKFGLYRLEIPSVDGVRCAEDSEVVSSCKASLIGSSSSSCNVPGYKSTSNVMAVKARKAN  151

Query  1119  KHIFSAGFFTFKP  1081
               I+S    TF+P
Sbjct  152   LCIYSINALTFRP  164



>ref|XP_002462641.1| hypothetical protein SORBIDRAFT_02g029420 [Sorghum bicolor]
 gb|EER99162.1| hypothetical protein SORBIDRAFT_02g029420 [Sorghum bicolor]
Length=265

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 55/125 (44%), Gaps = 10/125 (8%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP-----SFRKEVKTDDHGEFRV  1261
              +VG+VYCD C ++ FS+ S F+ GA V ++C    N       S   E  TD HG +++
Sbjct  43    TVVGSVYCDACSNNTFSKHSFFLKGAKVLIKCSFKVNSTSSEELSLEAERTTDQHGVYKL  102

Query  1260  HLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHIFSAGF  1096
              +P    F   +  +    C   L+ SS   C V     S+  I L+ R       +   
Sbjct  103   DVPPVDGFECREGHEVRSACRATLVRSSSAACNVPGLGDSTQHIALRSRATSACFLNLNA  162

Query  1095  FTFKP  1081
               F+P
Sbjct  163   LNFRP  167



>ref|XP_008231068.1| PREDICTED: uncharacterized protein LOC103330298 [Prunus mume]
Length=175

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 59/126 (47%), Gaps = 11/126 (9%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKTDDHGEFR  1264
             +++G VYCD C ++ FS  S+FI GA V ++C      P      SF     T+ +G ++
Sbjct  38    IVMGLVYCDICSNNTFSRHSYFIPGAEVKIDCIFQAVSPRTSEHISFSVNRTTNKYGVYK  97

Query  1263  VHLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAG  1099
             + +P       ++    +  C   L+ SS   C V    +TS  I +K ++    I+S  
Sbjct  98    LEIPAVEGIKCAQDSAIVSSCQATLMWSSSSACNVPGYKSTSDEIAVKSKQANLCIYSLN  157

Query  1098  FFTFKP  1081
                F+P
Sbjct  158   SLNFRP  163



>ref|XP_004310230.1| PREDICTED: uncharacterized protein LOC101309608 [Fragaria vesca 
subsp. vesca]
Length=312

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 60/126 (48%), Gaps = 11/126 (9%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVEC------GQSRNGPSFRKEVKTDDHGEFR  1264
              +VG VYCDTC  + FS +S+F+ G  V ++C       ++    +F     T+ +G ++
Sbjct  38    TVVGAVYCDTCSSNTFSRSSYFLPGVDVVIQCKFRGSSTKASEDMNFSVNKTTNKYGVYK  97

Query  1263  VHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHIFSAG  1099
             + +P     +    V     C   LI SS   C V    T++  I +K +++   I+S  
Sbjct  98    LEIPSVDGVNCLSGVSIKSMCQASLIGSSSKSCNVPGLRTTADEISVKSKQDNICIYSMN  157

Query  1098  FFTFKP  1081
               +++P
Sbjct  158   ALSYRP  163



>ref|NP_001064312.1| Os10g0205700 [Oryza sativa Japonica Group]
 gb|AAL82653.1|AC092387_1 putative hydroxyproline-rich glycoprotein [Oryza sativa Japonica 
Group]
 gb|AAM18749.1|AC099325_5 putative proline-rich protein [Oryza sativa Japonica Group]
 gb|AAP52730.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF26226.1| Os10g0205700 [Oryza sativa Japonica Group]
 dbj|BAG87363.1| unnamed protein product [Oryza sativa Japonica Group]
Length=276

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 55/111 (50%), Gaps = 12/111 (11%)
 Frame = -3

Query  1359  ISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLI--NSSE  1186
             +SGA VAV C        FR++  TD  GEFRVHLP      +  +  CSVKL+  N++ 
Sbjct  60    VSGAPVAVRCHDGNGRDVFRQQALTDRRGEFRVHLPPEAKSRLASVTSCSVKLLASNAAR  119

Query  1185  PF--CAVASTATSSSIHLKERK----EGKHIFSAGFFTFKPLNQPELCNQK  1051
             P    A  S AT+    L   K    +G  +F+AG F       PELC+ K
Sbjct  120   PCDDAAATSAATARGFRLAATKHNGGDGARVFNAGAFAV----HPELCDDK  166



>ref|XP_009378008.1| PREDICTED: uncharacterized protein LOC103966560 [Pyrus x bretschneideri]
 ref|XP_009344214.1| PREDICTED: uncharacterized protein LOC103936105 [Pyrus x bretschneideri]
 ref|XP_009350710.1| PREDICTED: uncharacterized protein LOC103942241 [Pyrus x bretschneideri]
Length=179

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 67/137 (49%), Gaps = 12/137 (9%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKTDDHGEFR  1264
             +++G VYCD C ++ FS+ S+F+ GA V ++C      P      SF     T+ +G ++
Sbjct  42    IVMGLVYCDICSNNTFSKHSYFLPGAEVKIDCIFQAVSPRTSEHISFSVNRTTNRYGVYK  101

Query  1263  VHLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAG  1099
             + +P       ++    +  C   L+ SS   C V    +TS+ I +K ++    I+S  
Sbjct  102   LEIPSVEGIKCAEDSAIVSSCHASLMWSSSSACNVPGYKSTSNEIAVKSKQANLCIYSLN  161

Query  1098  FFTFKPLNQP-ELCNQK  1051
                F+P  +  +LC +K
Sbjct  162   ALNFRPSKRDVKLCGKK  178



>ref|XP_002977017.1| hypothetical protein SELMODRAFT_443385 [Selaginella moellendorffii]
 gb|EFJ22127.1| hypothetical protein SELMODRAFT_443385 [Selaginella moellendorffii]
Length=215

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 48/98 (49%), Gaps = 7/98 (7%)
 Frame = -3

Query  1416  GTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSK  1237
             GTVYCD+C     +  S   S A + +EC  SR  P     V T++ G+F+  +P     
Sbjct  53    GTVYCDSCLEARLTRNSIVFSEAEIQIECVGSRGNPDHSTVVSTNETGQFQAQIP-----  107

Query  1236  HVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKE  1123
                +   CSV+ ++ +   CA  + A ++S  L + ++
Sbjct  108   --PQFDACSVQFLSKALDSCATPAAAFATSASLDQPRD  143



>ref|XP_010682699.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Beta 
vulgaris subsp. vulgaris]
Length=338

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 67/127 (53%), Gaps = 15/127 (12%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKTDDHGEFRV  1261
             +VG VYCDTC    FS+ S+FI GA V ++C  + N P      SF     TD +G +++
Sbjct  38    VVGAVYCDTCLSDGFSKHSYFIPGADVHIQCRFNANVPKTSEMISFSVNRTTDIYGVYKL  97

Query  1260  HLPFSVSKHVKKIKG------CSVKLINSSEPFCAVAST-ATSSSIHLKERKEGKHIFSA  1102
              +P SV + V  + G      C   L+ SS   C V S  AT++ + +K ++E   ++S 
Sbjct  98    EIP-SV-EGVDCVDGPPIQSFCQASLLESSSSACNVPSLKATTTEVSVKSKQENLCVYSF  155

Query  1101  GFFTFKP  1081
                +F+P
Sbjct  156   TPLSFRP  162



>ref|XP_010024180.1| PREDICTED: major pollen allergen Ole e 1-like [Eucalyptus grandis]
 gb|KCW60631.1| hypothetical protein EUGRSUZ_H03355 [Eucalyptus grandis]
Length=169

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 58/125 (46%), Gaps = 11/125 (9%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKTDDHGEFRV  1261
             ++G VYCD CF++ FS  S+F+ GA V ++C      P      SF  +  T+ +G +++
Sbjct  34    VMGMVYCDICFNNTFSRHSYFLPGAEVKIDCKFEAVSPKTMEKISFSVKRTTNRYGVYKL  93

Query  1260  HLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAGF  1096
              +P       ++    +  C   L+ SS   C V     T+  I  K ++    I+S   
Sbjct  94    EIPAVDGIECARDSAIVSFCEASLMGSSSDSCNVPGYRTTTDQIAFKSKQANLCIYSLNA  153

Query  1095  FTFKP  1081
               ++P
Sbjct  154   LNYRP  158



>ref|XP_010656997.1| PREDICTED: extensin [Vitis vinifera]
Length=397

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 60/126 (48%), Gaps = 13/126 (10%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFRV  1261
             +VG V+CD C ++  S  S+F+ G  V ++C    N     +E+       T  HG +++
Sbjct  33    IVGAVFCDICSNNTLSRHSYFLPGVEVQIQCKLRVNSARTNEEINFSVNRTTGKHGVYKL  92

Query  1260  HLPF-----SVSKHVKKIKGCSVKLINSSEPFCAVAST-ATSSSIHLKERKEGKHIFSAG  1099
              +P       +  H  +   C  KLI SS   C V     T+++I +K +++   IF+  
Sbjct  93    EIPSVDGIDCIGGHTMQTL-CQAKLIGSSSSACNVPGLKTTTNAISVKSKQDNLCIFNLN  151

Query  1098  FFTFKP  1081
               +++P
Sbjct  152   ALSYRP  157



>ref|XP_010929590.1| PREDICTED: vegetative cell wall protein gp1-like [Elaeis guineensis]
Length=348

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 62/133 (47%), Gaps = 11/133 (8%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECG-----QSRNGPSFRKEVKTDDHGEFRV  1261
              ++GTV+CD C +  FS+ S+F+ G  V VEC       S+   S   +  TD +G +R+
Sbjct  31    TVMGTVFCDACSNSTFSKHSYFLQGVKVRVECNFIVNSTSKEDISIMVDRTTDKYGVYRL  90

Query  1260  HLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHIFSAGF  1096
              +P    F   +  +    C   L+ S    C V   ++S+  + +K R     +++   
Sbjct  91    DIPPVDGFECREGREMESFCRATLMGSPSSLCNVPGLSSSTEHVAIKSRDASLCVYNLNA  150

Query  1095  FTFKPLNQ-PELC  1060
               ++P  + P LC
Sbjct  151   LYYRPAKKDPTLC  163



>gb|EAY77967.1| hypothetical protein OsI_33013 [Oryza sativa Indica Group]
Length=276

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 55/111 (50%), Gaps = 12/111 (11%)
 Frame = -3

Query  1359  ISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLI--NSSE  1186
             +SGA VAV C        FR++  TD  GEFRVHLP      +  +  CSVKL+  N++ 
Sbjct  60    VSGAPVAVRCHDGNGRDVFRQQALTDCRGEFRVHLPPEAKSRLASVTSCSVKLLASNAAR  119

Query  1185  PF--CAVASTATSSSIHLKERK----EGKHIFSAGFFTFKPLNQPELCNQK  1051
             P    A  S AT+    L   K    +G  +F+AG F       PELC+ K
Sbjct  120   PCDDAAATSAATARGFRLAATKHNGGDGARVFNAGAFAV----HPELCDDK  166



>gb|ACU17694.1| unknown [Glycine max]
Length=173

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 63/133 (47%), Gaps = 12/133 (9%)
 Frame = -3

Query  1443  RYPPAAV-LVGTVYCDTCFHHDFSEASHFISGASVAVECG------QSRNGPSFRKEVKT  1285
             R+P + + ++G VYCD C +  FS  S+F+ GA V V+C       ++    S      T
Sbjct  31    RFPISQISVMGFVYCDFCSNSSFSRHSYFLPGAEVKVDCMSKALSEKTSEQISLSVNRTT  90

Query  1284  DDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATS-SSIHLKERKEG  1120
             + +G +++ +P       ++    +  C   LI SS   C V    T+ + I +K R+  
Sbjct  91    NKYGMYKLEIPSVDGVKCAEDSAVVSSCQASLIGSSSSACNVPGYKTTFNVIAIKARRAN  150

Query  1119  KHIFSAGFFTFKP  1081
               I+S    TF+P
Sbjct  151   LCIYSFNALTFRP  163



>gb|KHG27745.1| Pollen-specific C13 [Gossypium arboreum]
Length=172

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 70/156 (45%), Gaps = 19/156 (12%)
 Frame = -3

Query  1497  VRITFLLCFVLNGFTEARRYPPAAV----LVGTVYCDTCFHHDFSEASHFISGASVAVEC  1330
             +R+  LL         A   PP  +    +VG V+CD+C  +  S  S+F+ GA V +EC
Sbjct  5     IRLLLLLASSFMHLFSATAQPPNPISRITVVGVVFCDSCSSNTLSRHSYFLPGAEVNIEC  64

Query  1329  GQSRNGPSFRKEVK------TDDHGEFRVHLPFSVSKHVKKIKG------CSVKLINSSE  1186
                   P   +++       TD +G +++ +P      V  ++G      C   L+ S  
Sbjct  65    KFKAQSPKTTEQMSVSVNRTTDKYGVYKLEIPH--VDGVDCVEGLAIESLCQASLVGSKS  122

Query  1185  PFCAVASTATSSS-IHLKERKEGKHIFSAGFFTFKP  1081
               C V    TS++ I +K +++   I+S    +++P
Sbjct  123   KACDVPGLKTSTNQITVKSKQDNLCIYSLNALSYRP  158



>gb|ACJ83911.1| unknown [Medicago truncatula]
 gb|ACJ86228.1| unknown [Medicago truncatula]
 gb|AFK43996.1| unknown [Medicago truncatula]
 gb|KEH36588.1| pollen Ole e I family allergen [Medicago truncatula]
Length=168

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (53%), Gaps = 7/89 (8%)
 Frame = -3

Query  1512  LKMSWVRITFLLCFVL---NGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASV  1342
             +  S + + F LCF+    + ++++ R+     + G VYCDTC     +  + FI GA+V
Sbjct  1     MAKSTIPLVFTLCFLSFLGSAYSKSDRF----FVEGVVYCDTCRTQFITRLTEFIEGATV  56

Query  1341  AVECGQSRNGPSFRKEVKTDDHGEFRVHL  1255
              VEC +     +F KE  TD  G++ V +
Sbjct  57    RVECKEDNGTLTFNKEATTDKSGKYSVEI  85



>gb|AFK47865.1| unknown [Lotus japonicus]
Length=168

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 6/82 (7%)
 Frame = -3

Query  1416  GTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP-SFRKEVKTDDHGEFRVHLPFSVS  1240
             G VYCDTC     ++ S F+ GA+V VEC +  NG  +F KEV TD  G ++V +     
Sbjct  32    GVVYCDTCRTQFITKLSEFLEGATVRVECKEEGNGSVTFTKEVVTDAKGSYKVEVD---G  88

Query  1239  KHVKKIKGCSVKLINSSEPFCA  1174
              H +++  C V L+ S    C+
Sbjct  89    DHEEEL--CQVVLVKSPRSDCS  108



>ref|XP_010252764.1| PREDICTED: uncharacterized protein LOC104594245 [Nelumbo nucifera]
Length=208

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 58/121 (48%), Gaps = 5/121 (4%)
 Frame = -3

Query  1431  AAVLVGTVYCDTCFHHDFS-EASHF-ISGASVAVECGQSRNGPS-FRKEVKTDDHGEFRV  1261
             + ++ GT+ C+ C H +   E   + ISGA + V C  SR   S +    KTD++GEF +
Sbjct  57    SVLVTGTLLCEACLHGEMEPELRQWPISGAVIGVACKTSRRKMSKYWARGKTDEYGEFII  116

Query  1260  HLPFSVSKHVKKIKGCSVKLIN--SSEPFCAVASTATSSSIHLKERKEGKHIFSAGFFTF  1087
              LP  +    +  K CSVK++     +  C+ A    S  I L     G   ++AG   F
Sbjct  117   DLPSQLHAIPELDKACSVKVVALPKIKSACSRAFVGKSQGIRLSSVGNGIRTYTAGEIAF  176

Query  1086  K  1084
             +
Sbjct  177   Q  177



>gb|KDP41800.1| hypothetical protein JCGZ_26818 [Jatropha curcas]
Length=165

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/151 (26%), Positives = 66/151 (44%), Gaps = 14/151 (9%)
 Frame = -3

Query  1491  ITFLLCFVLNGFTEARRYPPAA----VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQ  1324
             I F+L F+      ++  P        ++G VYCD C ++ FS  S+F+ GA V ++C  
Sbjct  5     ILFVLSFLFIKSLSSKVVPSRTNAHITVMGFVYCDICSNNSFSRHSYFLPGAGVKIDCKF  64

Query  1323  SRNGPSFRKEV------KTDDHGEFRVHLPF---SVSKHVKKIKGCSVKLINSSEPFCAV  1171
                 P  R++V       T+ HG +++ +P               C   LI SS   C V
Sbjct  65    KAIAPKIREQVTFSVNRTTNRHGIYKLEIPAVDGMACAEAAIESACEASLIWSSSKSCNV  124

Query  1170  -ASTATSSSIHLKERKEGKHIFSAGFFTFKP  1081
                 +TS  I +K ++    ++S     ++P
Sbjct  125   PGYKSTSDQITIKAKQPNLCVYSLTALNYRP  155



>ref|XP_002980755.1| hypothetical protein SELMODRAFT_444621 [Selaginella moellendorffii]
 gb|EFJ18406.1| hypothetical protein SELMODRAFT_444621 [Selaginella moellendorffii]
Length=215

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 48/98 (49%), Gaps = 7/98 (7%)
 Frame = -3

Query  1416  GTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSK  1237
             GTVYCD+C     +  S   S A + +EC  +R  P     V T++ G+F+  +P     
Sbjct  53    GTVYCDSCLEARLTRNSIVFSEAEIQIECVGNRGNPDHSTVVSTNETGQFQAQIP-----  107

Query  1236  HVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKE  1123
                +   CSV+ ++ +   CA  + A ++S  L + ++
Sbjct  108   --PQFDACSVQFLSKALDSCATPAAAFATSASLDQPRD  143



>gb|AFK46977.1| unknown [Lotus japonicus]
Length=168

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 7/87 (8%)
 Frame = -3

Query  1416  GTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP--SFRKEVKTDDHGEFRVHLPFSV  1243
             GTVYCDTC     +  S F+SGA+V V C +   G   +F KE  TD +G + V +    
Sbjct  31    GTVYCDTCRTQFLTRVSEFMSGATVGVVCRERDAGAKVTFSKEAVTDANGMYSVAVD---  87

Query  1242  SKHVKKIKGCSVKLINSSEPFCAVAST  1162
               H  ++  C VKL+ SS   C+   T
Sbjct  88    GDHEDEV--CEVKLLKSSRADCSEVDT  112



>ref|XP_010492060.1| PREDICTED: uncharacterized protein LOC104769530 [Camelina sativa]
Length=271

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 68/155 (44%), Gaps = 23/155 (15%)
 Frame = -3

Query  1476  CFVLNGFTEAR-RYPPAA--------VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQ  1324
             CF        R R PP A         +VG VYCDTC  + FS  S+F+ G  V V C  
Sbjct  14    CFTDQALGRGRGRSPPDASVDPSSRITVVGVVYCDTCSINTFSRQSYFLQGVEVHVTCRF  73

Query  1323  SRNGPSFRKEVK------TDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEPF--  1180
               + P   +EV       TD  G +++ +P          +     CS KL+ +S     
Sbjct  74    KASSPKTAEEVNISVNRTTDRSGVYKLEIPHVDGIDCVDGIAIASQCSAKLLKTSSDNNG  133

Query  1179  -CAVASTATSSS-IHLKERKEGKHIFSAGFFTFKP  1081
              C++    T+++ + +K +++   I+S    ++KP
Sbjct  134   GCSIPVFQTATNEVSIKSKQDRVCIYSLSALSYKP  168



>ref|XP_010419879.1| PREDICTED: uncharacterized protein LOC104705560 [Camelina sativa]
Length=271

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 68/155 (44%), Gaps = 23/155 (15%)
 Frame = -3

Query  1476  CFVLNGFTEAR-RYPPAA--------VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQ  1324
             CF        R R PP A         +VG VYCDTC  + FS  S+F+ G  V V C  
Sbjct  14    CFTDQALGRGRGRSPPDASVDPSSRITVVGVVYCDTCSINTFSRQSYFLQGVEVHVTCRF  73

Query  1323  SRNGPSFRKEVK------TDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSSEP---  1183
               + P   +EV       TD  G +++ +P          +     CS KL+ +S     
Sbjct  74    KASSPKTAEEVNISVNRTTDRSGVYKLEIPHVDGIDCVDGIAIASQCSAKLLKTSSDNNG  133

Query  1182  FCAVASTATSSS-IHLKERKEGKHIFSAGFFTFKP  1081
              C++    T+++ + +K +++   I+S    ++KP
Sbjct  134   GCSIPVFQTATNEVSIKSKQDRVCIYSLSALSYKP  168



>ref|XP_006366520.1| PREDICTED: olee1-like protein-like [Solanum tuberosum]
Length=162

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 72/150 (48%), Gaps = 12/150 (8%)
 Frame = -3

Query  1506  MSWVRITFLLCFVL-NGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVEC  1330
             M+ +  +F++C VL      +  +    ++VG VYCDTC     + AS ++ G+ V +EC
Sbjct  1     MAKMITSFVVCLVLFASINVSANFMDTFLVVGKVYCDTCRCGFETSASMYLPGSRVRIEC  60

Query  1329  -GQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
               +  N  ++  E  T+  GE+++ +        ++ + C V LI SS+P CA  +T   
Sbjct  61    KNRDTNDLAYTVEGFTNSKGEYKILV-----NSDRRDEFCDVVLIRSSDPMCAEPNTGRD  115

Query  1152  SSIHLKERKEG-----KHIFSAGFFTFKPL  1078
              +  +     G     +   S GF + +PL
Sbjct  116   RARVVLTSNNGMVSNTRFANSMGFLSNEPL  145



>ref|XP_006856296.1| hypothetical protein AMTR_s00047p00112050 [Amborella trichopoda]
 gb|ERN17763.1| hypothetical protein AMTR_s00047p00112050 [Amborella trichopoda]
Length=191

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (47%), Gaps = 9/130 (7%)
 Frame = -3

Query  1431  AAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPS---FRKEVKTDDHGEFRV  1261
             + ++ GTV CD C     +  S F+SGA+VAV C Q+  G     FR   KTD++G+F +
Sbjct  56    SVLVTGTVTCDACRD---TGKSPFVSGATVAVRC-QTNGGKRSRHFRVRGKTDEYGDFMI  111

Query  1260  HLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGK--HIFSAGFFTF  1087
              +P  +    +    C V ++   E      + A   +  L+    G    +++AGF  F
Sbjct  112   DIPSHMHATPRLENTCHVTVVQIPENSDCRRNRAGRQAFRLRVSSVGNGIRVYTAGFLHF  171

Query  1086  KPLNQPELCN  1057
             +P     +C 
Sbjct  172   QPRGAAAICR  181



>ref|NP_001238557.1| uncharacterized protein LOC100527603 precursor [Glycine max]
 gb|ACU16720.1| unknown [Glycine max]
Length=95

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLN-GFTEAR--RYPPAAVLVGTVYCDTCFHHDFSEASHFISGA  1348
             MSW  +   L    +   +EA   +  P+AV+VGTVYCDTCF  D S  +HFISGA
Sbjct  1     MSWFLVILFLSLTFDITHSEASHDKKLPSAVVVGTVYCDTCFQQDLSTGNHFISGA  56



>emb|CDP13383.1| unnamed protein product [Coffea canephora]
Length=339

 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/134 (25%), Positives = 62/134 (46%), Gaps = 12/134 (9%)
 Frame = -3

Query  1416  GTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEV------KTDDHGEFRVHL  1255
             G+V+CD C+ + FS +S+F+ GA V ++C      P   +++       T+ HG + + +
Sbjct  50    GSVFCDACYDNTFSRSSYFLPGAQVHIQCRFRAISPGTTEQITFSVNGTTNRHGIYNLDI  109

Query  1254  P----FSVSKHVKKIKGCSVKLINSSEPFCAVAST-ATSSSIHLKERKEGKHIFSAGFFT  1090
             P       + H      C   L  S  P C+      T++ I +K ++  + I+S    +
Sbjct  110   PSVEGIDCTGHPDIQSFCEASLKGSLSPACSAPGLRRTTNEITIKSKQNNQCIYSLSALS  169

Query  1089  FKPLNQP-ELCNQK  1051
             ++P  +   LC  K
Sbjct  170   YRPFTRNVTLCGNK  183



>ref|XP_007208803.1| hypothetical protein PRUPE_ppa024703mg [Prunus persica]
 gb|EMJ10002.1| hypothetical protein PRUPE_ppa024703mg [Prunus persica]
Length=176

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 6/116 (5%)
 Frame = -3

Query  1509  KMSWVRITFLLCFV-LNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             K S   + F  CFV L  F  +        L G VYCD C     +E S  I GA V +E
Sbjct  4     KSSTTVLAFAFCFVSLLSFAYSNTTDDKIYLTGLVYCDNCQLKSMTEISKMIPGARVRLE  63

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAS  1165
             C +  N  S R+E +T+  G +     F + K  + +  C V +++S +P C +++
Sbjct  64    CREGGNIKS-RREGETNPLGMY----VFVLEKSKEPLDDCQVTVLHSPDPECKISN  114



>ref|XP_009134109.1| PREDICTED: pollen-specific protein C13 [Brassica rapa]
Length=159

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 54/115 (47%), Gaps = 6/115 (5%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECG  1327
             MS   +   LCF+      AR      V+ G VYCDTC     + AS FI GA V +EC 
Sbjct  1     MSKAILLVALCFLPALAMSARPNKNPFVVRGRVYCDTCLAGFETSASTFIPGAVVRLECK  60

Query  1326  QSRNGP-SFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAS  1165
               R    ++R E +TD  G +R+ +      H  +   C   L++SS+  C+  S
Sbjct  61    DRRTMELTYRHEARTDSTGSYRILVS---EDHEDQF--CDTMLVSSSQLRCSNVS  110



>ref|XP_007210061.1| hypothetical protein PRUPE_ppa018487mg [Prunus persica]
 gb|EMJ11260.1| hypothetical protein PRUPE_ppa018487mg [Prunus persica]
Length=176

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 54/115 (47%), Gaps = 6/115 (5%)
 Frame = -3

Query  1509  KMSWVRITFLLCFV-LNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVE  1333
             K S   + F  CF+ L  F  +        L G VYCD C     +E S  I GA V +E
Sbjct  4     KSSTTVLAFAFCFLSLLSFAYSNTTDDKIYLTGLVYCDNCQLKSMTEISKMIPGARVRLE  63

Query  1332  CGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVA  1168
             C +  N  S R+E +T+  G +     F + K  + +  C V +++S +P C ++
Sbjct  64    CREGENIKS-RREGETNPLGMY----VFVLEKSKEPLDDCQVTVLHSPDPECKIS  113



>ref|XP_002512897.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49400.1| conserved hypothetical protein [Ricinus communis]
Length=165

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 73/152 (48%), Gaps = 18/152 (12%)
 Frame = -3

Query  1482  LLCFVLNGF---TEARRYPPA-----AVLVGTVYCDTCFHHDFSEASHFISGASVAVECG  1327
             L+ F+L+     T + +  PA       ++G VYCD C ++ F+  S+F+ GA V ++C 
Sbjct  4     LILFILSSLFIKTISLKVEPAKTNAHITVMGFVYCDICSNNSFTRHSYFLPGAGVKIDCK  63

Query  1326  QSRNGPSFRKEVK------TDDHGEFRVHLPF--SVSKHVKKIK-GCSVKLINSSEPFCA  1174
                + P  +++V       T+ +G +++ +P    ++     I+  C   L+ SS   C 
Sbjct  64    FKASSPKVKEQVSFSVNRTTNRYGVYKLEIPSVDGIACAEAAIESSCEATLMWSSSKSCN  123

Query  1173  V-ASTATSSSIHLKERKEGKHIFSAGFFTFKP  1081
             V    +TS  I +K R+    I+S     ++P
Sbjct  124   VPGYKSTSDQISIKARRANLCIYSLNAMNYRP  155



>ref|XP_002974776.1| hypothetical protein SELMODRAFT_414879 [Selaginella moellendorffii]
 gb|EFJ24296.1| hypothetical protein SELMODRAFT_414879 [Selaginella moellendorffii]
Length=282

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 57/124 (46%), Gaps = 12/124 (10%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVEC---GQSRNGPSFRKEVKTDDHGEFRVHLP  1252
             ++G V CD C   + +  S F+SG +V++ C   G  R  P F  +  TD+ G F + +P
Sbjct  39    VMGYVVCDACREKNLTSNSVFLSGMTVSLTCKAVGGQR--PFFTAQQATDEQGRFSLDIP  96

Query  1251  FSVSKHVKKIKGCSV------KLINSSEPFCAVASTATS-SSIHLKERKEGKHIFSAGFF  1093
               +S      K C+       K I   +  C VA+   S SS+      EG  IFS G F
Sbjct  97    SQISGSGDGFKLCAASVAAGEKGITPLQRSCNVAAMEKSHSSLTPYTTIEGHRIFSTGPF  156

Query  1092  TFKP  1081
              + P
Sbjct  157   VYTP  160



>ref|XP_002963687.1| hypothetical protein SELMODRAFT_405039 [Selaginella moellendorffii]
 gb|EFJ35558.1| hypothetical protein SELMODRAFT_405039 [Selaginella moellendorffii]
Length=282

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 57/124 (46%), Gaps = 12/124 (10%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVEC---GQSRNGPSFRKEVKTDDHGEFRVHLP  1252
             ++G V CD C   + +  S F+SG +V++ C   G  R  P F  +  TD+ G F + +P
Sbjct  39    VMGYVVCDACREKNLTSNSVFLSGMTVSLTCKAVGGQR--PFFTAQQATDEQGRFSLDIP  96

Query  1251  FSVSKHVKKIKGCSV------KLINSSEPFCAVASTATS-SSIHLKERKEGKHIFSAGFF  1093
               +S      K C+       K I   +  C VA+   S SS+      EG  IFS G F
Sbjct  97    SQISGSGDGFKLCAASVAAGEKGITPLQRSCNVAAMEKSHSSLTPYTTIEGHRIFSTGPF  156

Query  1092  TFKP  1081
              + P
Sbjct  157   VYTP  160



>ref|XP_010321468.1| PREDICTED: LOW QUALITY PROTEIN: major pollen allergen Lol p 11-like 
[Solanum lycopersicum]
Length=162

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 58/113 (51%), Gaps = 7/113 (6%)
 Frame = -3

Query  1506  MSWVRITFLLCFVL-NGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVEC  1330
             M+ +   F++C VL      +  +    +++G VYCDTC     + AS ++ G+ V +EC
Sbjct  1     MAKMIFLFVVCLVLFASINVSANFMDTFLVIGKVYCDTCRCGYETSASKYLPGSRVRIEC  60

Query  1329  -GQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCA  1174
               +  N  ++  E  T+  GE+++ +        ++ + C V LI SS+P CA
Sbjct  61    KNRDTNDLAYTVEGVTNSKGEYKILV-----NSDRRDEFCDVVLIRSSDPMCA  108



>ref|XP_002268073.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CBI33037.3| unnamed protein product [Vitis vinifera]
Length=159

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 59/114 (52%), Gaps = 10/114 (9%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECG  1327
             M+ + ++  LC +L   +EAR      VL G VYCDTC     + A+ +I+GA V +EC 
Sbjct  1     MAKLLMSIALCLLLVYVSEARPMRKPFVLHGRVYCDTCRAGFETSATTYIAGARVRIEC-  59

Query  1326  QSRNGPSFRKEVK--TDDHGEFRVHLPFSVS-KHVKKIKGCSVKLINSSEPFCA  1174
             + RN       V+  TD  G ++    FS++  H  ++  C   L+ S +P CA
Sbjct  60    KDRNSLQLVYSVEGVTDSTGTYK----FSIADDHGDQM--CDAVLVKSPQPDCA  107



>gb|KFK25544.1| hypothetical protein AALP_AA8G128700 [Arabis alpina]
Length=274

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 63/131 (48%), Gaps = 14/131 (11%)
 Frame = -3

Query  1431  AAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGE  1270
             +  +VG VYCDTC  + FS+ S+F+ G  V V C    + P   +EV       T+ +G 
Sbjct  42    SITVVGVVYCDTCSINTFSKQSYFLPGVEVHVTCRFKASSPKTSEEVNISVNRTTNRNGV  101

Query  1269  FRVHLP----FSVSKHVKKIKGCSVKLINSSEPF---CAVASTATSSS-IHLKERKEGKH  1114
             + + +P          +     CS KLI +S+     C +    T+++ + +K +++   
Sbjct  102   YNLEIPHVDGLDCVDGIAVASQCSAKLIKTSDNNNLGCNIPVFQTATNEVSIKSKQDRLC  161

Query  1113  IFSAGFFTFKP  1081
             I+S    ++KP
Sbjct  162   IYSLSALSYKP  172



>ref|XP_009613032.1| PREDICTED: uncharacterized protein LOC104106240 [Nicotiana tomentosiformis]
 ref|XP_009613033.1| PREDICTED: uncharacterized protein LOC104106240 [Nicotiana tomentosiformis]
Length=177

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 63/137 (46%), Gaps = 12/137 (9%)
 Frame = -3

Query  1455  TEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVEC------GQSRNGPSFRKE  1294
             + A+   P   ++G VYCD C ++ FS  S+F+ G  V ++C       ++    S    
Sbjct  31    SAAKVANPQITVMGLVYCDICSNNSFSRHSYFMPGVEVKIDCTFKAMSARTAELVSVSVN  90

Query  1293  VKTDDHGEFRVHLPF--SVSKHVKKIKG--CSVKLINSSEPFCAV--ASTATSSSIHLKE  1132
               T+ +G +R+ +P    +    +K  G  C   LI +S   C V  ++  T+  I +K 
Sbjct  91    RTTNRYGVYRLEIPSVDGIECAAEKAIGNSCRASLIGTSSSSCNVPGSTRTTTDEITIKS  150

Query  1131  RKEGKHIFSAGFFTFKP  1081
             ++    I+S     F+P
Sbjct  151   KQANMCIYSLTALNFRP  167



>gb|ABO43960.1| unknown [Euphorbia pulcherrima]
Length=248

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFRV  1261
             +VG VYCDTC    FS+ S+F+ G  V ++C    N     +++       TD +G +++
Sbjct  33    VVGGVYCDTCSTKSFSKHSYFLPGVDVHIQCKFEANSARTAEQINFTVNRTTDKYGIYKL  92

Query  1260  HLPFSVSKHVKKIKG----CSVKLINSSEPFCAVASTATSS-SIHLKERKEGKHIFSAGF  1096
              +            G    C   ++N+S   C V    T+S  I +K +++   I+S   
Sbjct  93    EIGNVDGIDCVDSTGIAFLCQATVLNNSNSACKVPQLRTTSDQITVKSKQDNHCIYSLNA  152

Query  1095  FTFKPLN-QPELCNQK  1051
              ++KP      LC+QK
Sbjct  153   LSYKPRTINDSLCSQK  168



>emb|CAN77170.1| hypothetical protein VITISV_029841 [Vitis vinifera]
Length=1190

 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = -3

Query  1428  AVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPF  1249
              ++VGT  C  C H +   +  F SG  V +EC         R   + D+ GEF++ LP 
Sbjct  686   VMVVGTGECADCDHSNIKTSQAF-SGLGVTIECKLESGEFKTRAVGELDEEGEFKLPLPK  744

Query  1248  SVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFS-AGFFTFKPLN  1075
              + K  K  + C  +L ++S   C + +   +S I LK    GK +F+ AG   F P+ 
Sbjct  745   EIVKGGKLKEECFAQLHSASAKPCPIRNGPEASKIILKTTNNGKQVFAPAGKLKFSPVT  803



>ref|XP_010556297.1| PREDICTED: pollen allergen Che a 1 [Tarenaya hassleriana]
Length=168

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/168 (24%), Positives = 73/168 (43%), Gaps = 19/168 (11%)
 Frame = -3

Query  1497  VRITFLLCFVLNGFTEA--RRYPPA-----AVLVGTVYCDTCFHHDFSEASHFISGASVA  1339
             +++  L+C +   F  +  R++ PA       ++G VYCD C ++ FS  S+F+SG  V 
Sbjct  1     MKLIILMCSLSLLFINSLSRKHFPAKPNAEISVMGLVYCDVCSNNTFSRHSYFMSGVEVR  60

Query  1338  VEC------GQSRNGPSFRKEVKTDDHGEFRVHLP----FSVSKHVKKIKGCSVKLINSS  1189
             ++C       ++R    F     T++ G +R+ +      + S        C   LI SS
Sbjct  61    IDCRFKAAASKTREQIVFTANRTTNELGLYRLDITSLDGVACSDAGTLASSCQASLIGSS  120

Query  1188  EPFCAV-ASTATSSSIHLKERKEGKHIFSAGFFTFKPLN-QPELCNQK  1051
                C V     T+  +    ++    ++      F+PL   P LC ++
Sbjct  121   SDSCKVPGFKTTTDQVVFNSKRSNLCVYGFNALNFRPLKLDPALCGKQ  168



>ref|XP_010647219.1| PREDICTED: proline-rich protein 4-like [Vitis vinifera]
Length=559

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = -3

Query  1428  AVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPF  1249
              ++VGT  C  C H +   +  F SG  V +EC         R   + D+ GEF++ LP 
Sbjct  32    VMVVGTGECADCDHSNIKTSQAF-SGLGVTIECKLESGEFKTRAVGELDEEGEFKLPLPK  90

Query  1248  SVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEGKHIFS-AGFFTFKPLN  1075
              + K  K  + C  +L ++S   C + +   +S I LK    GK +F+ AG   F P+ 
Sbjct  91    EIVKGGKLKEECFAQLHSASAKPCPIRNGPEASKIILKTTNNGKQVFAPAGKLKFSPVT  149



>ref|XP_010679984.1| PREDICTED: pollen-specific protein-like At4g18596 [Beta vulgaris 
subsp. vulgaris]
Length=173

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 62/133 (47%), Gaps = 12/133 (9%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVEC------GQSRNGPSFRKEVKTDDHGEFRV  1261
             ++GTVYCD C ++ FS  S+F+ G  V V+C       ++    +F     T+++G +++
Sbjct  39    VIGTVYCDICSNNTFSRHSYFLPGVEVKVDCKFKATAARAAEEITFSVSRTTNEYGWYKL  98

Query  1260  HLP----FSVSKHVKKIKGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSAGF  1096
              +P       ++       C   L+ SS   C V   T T+  ++ K  ++   I+    
Sbjct  99    EIPSVDGIECARGATVESVCRASLVGSSTSKCNVPGYTTTTDVVYFKSSQQNICIYGLSA  158

Query  1095  FTFKPLNQ-PELC  1060
               F+P  +  +LC
Sbjct  159   LNFRPSRKNKDLC  171



>ref|XP_008225290.1| PREDICTED: olee1-like protein [Prunus mume]
Length=176

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 51/113 (45%), Gaps = 6/113 (5%)
 Frame = -3

Query  1503  SWVRITFLLCFV-LNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECG  1327
             S   + F  CF+ L  FT +        L G VYCD C     +E S  I GA V +EC 
Sbjct  6     STTILAFAFCFLSLLSFTYSNTTDDKIYLTGLVYCDNCQLKSMTEISKMIPGAKVRLECR  65

Query  1326  QSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVA  1168
             +  N     +E +T+  G +     F + K    +  C V L++S +P C ++
Sbjct  66    EGGN-IKLSEEGETNQLGLY----VFELEKTTGPLNDCQVTLLHSPDPECKIS  113



>ref|XP_007148052.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
 gb|ESW20046.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
Length=169

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 41/83 (49%), Gaps = 7/83 (8%)
 Frame = -3

Query  1416  GTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP--SFRKEVKTDDHGEFRVHLPFSV  1243
             GTVYCDTC     +  S F+ GA+V V C Q  N    +F KE  TD  G +++ +    
Sbjct  32    GTVYCDTCRVQFLTRMSEFLEGAAVRVMCSQVDNAKNVTFDKETVTDALGSYKMEVD---  88

Query  1242  SKHVKKIKGCSVKLINSSEPFCA  1174
               H +    C V L+ S  P C+
Sbjct  89    GDHEE--DNCQVTLVKSPRPDCS  109



>ref|XP_002450273.1| hypothetical protein SORBIDRAFT_05g003010 [Sorghum bicolor]
 gb|EES09261.1| hypothetical protein SORBIDRAFT_05g003010 [Sorghum bicolor]
Length=286

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 56/122 (46%), Gaps = 20/122 (16%)
 Frame = -3

Query  1374  EASHFISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHL----PFSVSKHVKKIKGCSV  1207
             EA+  +SG  V V C      P   K+V TD  G+F VHL    P S S+ ++ I  CSV
Sbjct  63    EATTAVSGTLVGVRCHDGNGRPVIHKDVVTDRSGKFHVHLERHEPSSSSQKLQSITSCSV  122

Query  1206  KLINSSEPFCAVASTATSSSIHLKERKE----------GKHIFSAGFFTFKPLNQPELCN  1057
              +     P C   +T ++  +HL               G  IFSAG F  +    PELC+
Sbjct  123   AVHLPQAPPC--VATTSARGLHLISHTNHNKHHHHGGGGARIFSAGAFAVR----PELCS  176

Query  1056  QK  1051
             QK
Sbjct  177   QK  178



>ref|XP_008450951.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=165

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 6/81 (7%)
 Frame = -3

Query  1416  GTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP-SFRKEVKTDDHGEFRVHLPFSVS  1240
             G VYCDTC    F++ S F+ GA+V +EC +   G  +  KE  TD  G++ +       
Sbjct  31    GKVYCDTCRVQFFTKVSKFLKGATVKLECKEIEGGSVTLNKEAVTDKSGKYSIEADGDHE  90

Query  1239  KHVKKIKGCSVKLINSSEPFC  1177
             + V     C V L+ S +P C
Sbjct  91    EEV-----CEVSLVKSVDPDC  106



>ref|XP_010926790.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Elaeis 
guineensis]
Length=273

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 56/126 (44%), Gaps = 14/126 (11%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP-----SFRKEVKTDDHGEFRVH  1258
             ++G V+CD C ++ FS+ S+FI G  V ++C    N       S   E  TD  G +++ 
Sbjct  31    VIGAVFCDVCSNNTFSKHSYFIKGVEVLIQCKFKANSMPTEEISIMAERTTDRFGVYKLD  90

Query  1257  LP------FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHIFSAG  1099
             +P          + VK +  C   LI SS   C+V     S+  + +K R      F+  
Sbjct  91    IPPVDGLECREGREVKSL--CRASLIKSSSSLCSVPGLRRSTEHVAIKSRDADICFFNLN  148

Query  1098  FFTFKP  1081
                F+P
Sbjct  149   ALNFRP  154



>emb|CDY05022.1| BnaC03g28200D [Brassica napus]
Length=159

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 54/115 (47%), Gaps = 6/115 (5%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECG  1327
             MS   +   LCF+      AR      V+ G VYCDTC     + AS FI GA V +EC 
Sbjct  1     MSKAILLVALCFLPALAMSARPNKNPFVVRGRVYCDTCLAGFETSASTFIPGAVVRLECK  60

Query  1326  QSRNGP-SFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAS  1165
               R    ++R E +TD  G +++ +      H  +   C   L++SS+  C+  S
Sbjct  61    DRRTMELTYRHEARTDSTGSYKILVS---EDHEDQF--CDTMLVSSSQLRCSNVS  110



>emb|CDY12288.1| BnaA09g24880D [Brassica napus]
 emb|CDX90693.1| BnaA03g23730D [Brassica napus]
Length=159

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 54/115 (47%), Gaps = 6/115 (5%)
 Frame = -3

Query  1506  MSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECG  1327
             MS   +   LCF+      AR      V+ G VYCDTC     + AS FI GA V +EC 
Sbjct  1     MSKAILLVALCFLPALAMSARPNKNPFVVRGRVYCDTCLAGFETSASTFIPGAVVRLECK  60

Query  1326  QSRNGP-SFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVAS  1165
               R    ++R E +TD  G +++ +      H  +   C   L++SS+  C+  S
Sbjct  61    DRRTMELTYRHEARTDSTGSYKILVS---EDHEDQF--CDTMLVSSSQLRCSNVS  110



>ref|XP_011090511.1| PREDICTED: major pollen allergen Lol p 11-like [Sesamum indicum]
Length=159

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 61/133 (46%), Gaps = 17/133 (13%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP-SFRKEVKTDDHGEFRVHLPFS  1246
             + G+VYCDTC     ++A+ +I+GA+V +EC    NG  ++ KE  TD  G + V     
Sbjct  29    VTGSVYCDTCRCGYETDATTYIAGATVRIECRNKDNGQLTYTKEAVTDSTGHYSV-----  83

Query  1245  VSKHVKKIKG---CSVKLINSSEPFCAVASTATSSSIHLKERKEG-----KHIFSAGFFT  1090
                 V+  +G   C   L+ S++P C+  +     +  +  R  G     +   + GF  
Sbjct  84    ---LVETDRGDDFCDAVLVKSADPECSTPNEGRDRARVILTRNNGMISNKRFANAMGFLK  140

Query  1089  FKPLNQPELCNQK  1051
               PL    +  QK
Sbjct  141   NTPLANCPMILQK  153



>ref|XP_010025282.1| PREDICTED: RNA-binding protein 12 [Eucalyptus grandis]
 gb|KCW61906.1| hypothetical protein EUGRSUZ_H04602 [Eucalyptus grandis]
Length=310

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 61/127 (48%), Gaps = 15/127 (12%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVECG------QSRNGPSFRKEVKTDDHGEFRV  1261
             +VG VYCD C    FS+ S+F+ G  V ++C       ++     F     T+ +G + +
Sbjct  40    VVGAVYCDVCHISSFSKYSYFLPGVDVNIQCKFKASTRETAEQIDFSVNRTTNRYGTYML  99

Query  1260  HLPFSVSKHVKKIKG------CSVKLINSSEPFCAVASTATSSS-IHLKERKEGKHIFSA  1102
              +P SV   V  + G      C V L+ SS   C+V    T++  + +K +++   I+S 
Sbjct  100   DVP-SVDG-VDCVDGQAIASMCQVSLMGSSSSACSVPGLRTTADEVTVKSKQDNLCIYSM  157

Query  1101  GFFTFKP  1081
                T++P
Sbjct  158   NALTYRP  164



>gb|EMS53826.1| hypothetical protein TRIUR3_00757 [Triticum urartu]
Length=104

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 6/74 (8%)
 Frame = -3

Query  1455  TEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKE  1294
              EAR+      +VG+VYCD C ++ FS+ S F+ GA V ++C    N        S   E
Sbjct  8     AEARKSGSNITVVGSVYCDACSNNTFSKHSFFLKGARVLIQCNFKVNSSAAPEEISLEAE  67

Query  1293  VKTDDHGEFRVHLP  1252
               TD HG +++ +P
Sbjct  68    RTTDQHGVYKLDVP  81



>ref|XP_009415871.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=310

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 60/127 (47%), Gaps = 13/127 (10%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVEC------GQSRNGPSFRKEVKTDDHGEFR  1264
              ++GTV+CD C ++ FSE S+F++G  V V+C        SR   S   +  TD  G ++
Sbjct  31    TVMGTVFCDACANNVFSEHSYFLAGVRVRVQCMLRVTNSTSREEMSITVDRTTDKFGVYK  90

Query  1263  VHLP----FSVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKER-KEGKH-IFSA  1102
             + +P    F   + V     C   L+ S    C V     SS+ H+  R  EGK  +++ 
Sbjct  91    LDIPPVEGFECREGVVMDSCCRASLLGSPSSLCDVPGL-NSSTGHVAVRGGEGKRCLYNL  149

Query  1101  GFFTFKP  1081
                 ++P
Sbjct  150   NALNYRP  156



>ref|XP_003546028.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN18912.1| Olee1-like protein [Glycine soja]
Length=169

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 53/114 (46%), Gaps = 9/114 (8%)
 Frame = -3

Query  1509  KMSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVEC  1330
             K + + +   LCF+   F  +       ++ GTVYCDTC     ++ S  + GA+V V C
Sbjct  3     KAAIIILASTLCFL--SFLGSAYARDRFMVEGTVYCDTCRVQFLTKLSEILEGATVRVTC  60

Query  1329  GQSRNGP--SFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCA  1174
              Q  N    +F KE  TD  G ++V +      H +    C V L+ S  P C+
Sbjct  61    SQVDNAKNVTFSKEAVTDASGSYKVEVE---GDHEEDT--CEVTLLKSPRPDCS  109



>gb|ACU23617.1| unknown [Glycine max]
Length=169

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 53/114 (46%), Gaps = 9/114 (8%)
 Frame = -3

Query  1509  KMSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVEC  1330
             K + + +   LCF+   F  +       ++ GTVYCDTC     ++ S  + GA+V V C
Sbjct  3     KAAIIILASTLCFL--SFLGSAYARDRFMVEGTVYCDTCRVQFLTKLSEILEGATVRVTC  60

Query  1329  GQSRNGP--SFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCA  1174
              Q  N    +F KE  TD  G ++V +      H +    C V L+ S  P C+
Sbjct  61    SQVDNAKNVTFSKEAVTDASGSYKVEVE---GDHEEDT--CEVTLLKSPRPDCS  109



>gb|EAZ15608.1| hypothetical protein OsJ_31017 [Oryza sativa Japonica Group]
Length=282

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = -3

Query  1359  ISGASVAVECGQSRNGPSFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSS  1189
             +SGA VAV C        FR++  TD  GEFRVHLP      +  +  CSVKL+ S+
Sbjct  60    VSGAPVAVRCHDGNGRDVFRQQALTDRRGEFRVHLPPEAKSRLASVTSCSVKLLASN  116



>ref|XP_010110924.1| hypothetical protein L484_005655 [Morus notabilis]
 gb|EXC29147.1| hypothetical protein L484_005655 [Morus notabilis]
Length=169

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 61/127 (48%), Gaps = 12/127 (9%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------SFRKEVKTDDHGEFR  1264
             +++G VYCD C ++ FS+ S+F+ GA V ++C      P      SF     T+ +G ++
Sbjct  31    IVMGFVYCDICSNNTFSKNSYFLPGAEVRIDCMFKAMSPRTSEQISFSVNRTTNKYGIYK  90

Query  1263  VHLP----FSVSKHVKKI-KGCSVKLINSSEPFCAV-ASTATSSSIHLKERKEGKHIFSA  1102
             + +P       ++   KI   C   L+ SS   C V     TS  I +K ++    I+S 
Sbjct  91    LEIPSVDGIKCAEESAKIASSCQASLMWSSSSSCNVPGYKDTSDQIAVKSKRANLCIYSL  150

Query  1101  GFFTFKP  1081
                +F+P
Sbjct  151   NALSFRP  157



>ref|XP_009785181.1| PREDICTED: uncharacterized protein LOC104233482 [Nicotiana sylvestris]
 ref|XP_009785182.1| PREDICTED: uncharacterized protein LOC104233482 [Nicotiana sylvestris]
 ref|XP_009785183.1| PREDICTED: uncharacterized protein LOC104233482 [Nicotiana sylvestris]
Length=178

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 59/126 (47%), Gaps = 12/126 (10%)
 Frame = -3

Query  1422  LVGTVYCDTCFHHDFSEASHFISGASVAVEC------GQSRNGPSFRKEVKTDDHGEFRV  1261
             ++G VYCD C ++ FS  S+F+ G  V ++C       ++    S      T+ +G +R+
Sbjct  43    VMGLVYCDICSNNSFSRHSYFMPGVEVKIDCTFKAMSARTAELVSVSVNRTTNRYGVYRL  102

Query  1260  HLPF--SVSKHVKKIKG--CSVKLINSSEPFCAV--ASTATSSSIHLKERKEGKHIFSAG  1099
              +P    +    +K  G  C   LI +S   C V  ++  T+  I +K ++    I+S  
Sbjct  103   EIPSVDGIECAAEKAIGNSCRASLIGTSSSSCNVPGSTRTTTDEITIKSKQANMCIYSLT  162

Query  1098  FFTFKP  1081
                FKP
Sbjct  163   ALNFKP  168



>gb|EMT06446.1| hypothetical protein F775_22336 [Aegilops tauschii]
Length=139

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 41/78 (53%), Gaps = 7/78 (9%)
 Frame = -3

Query  1467  LNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP------S  1306
             L G  EAR+     V VG+VYCD C ++ FS+ S F+ GA V ++C    N        S
Sbjct  28    LGGGAEARKSSNITV-VGSVYCDACANNTFSKHSFFLKGARVLIQCNFKVNSSAAPEEIS  86

Query  1305  FRKEVKTDDHGEFRVHLP  1252
                E  TD HG +++ +P
Sbjct  87    LEAERTTDQHGVYKLDVP  104



>ref|XP_007025385.1| Olee1-like protein [Theobroma cacao]
 gb|EOY28007.1| Olee1-like protein [Theobroma cacao]
Length=170

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 55/104 (53%), Gaps = 8/104 (8%)
 Frame = -3

Query  1479  LCFV-LNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP-S  1306
             LCF+ L G  +A+  P    + G VYCD C     ++ S +++GA V +EC     G  +
Sbjct  15    LCFLSLLGIVDAQA-PEQFFVEGKVYCDNCRAQFVTKISKYMAGAQVRLECRDREGGDIT  73

Query  1305  FRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCA  1174
             +  + +TD+ G + + +      H ++I  C V L+ SS+P C+
Sbjct  74    YSVDGETDESGTYHIKVE---GDHEEEI--CEVSLVQSSDPECS  112



>ref|XP_009421183.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 68/162 (42%), Gaps = 14/162 (9%)
 Frame = -3

Query  1509  KMSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVEC  1330
             K+  + +   LCF L G   A    P   + G VYCD C     + A+ +I GA V +EC
Sbjct  3     KLQLLPVVAALCFALAGVALAL---PTFRIQGRVYCDKCRAGFETSATDYIEGAKVKLEC  59

Query  1329  GQSRNGPSFRKEVK-TDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATS  1153
              Q   G   +     TD  G + + +      H ++I  C V L+ S  P C+   T   
Sbjct  60    RQYDTGVVEQTATAVTDASGTYTLEVE---DNHEEEI--CEVVLVESPRPGCSEIMTGRD  114

Query  1152  SSIHLKERKEG-----KHIFSAGFFTFKPLNQPELCNQKPSI  1042
              +  L   + G     ++  S GF    PL +  L  QK ++
Sbjct  115   RARVLISAESGLTTSVRYANSLGFLNAAPLPECGLLLQKYAL  156



>ref|XP_011088500.1| PREDICTED: extensin-like [Sesamum indicum]
Length=463

 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 16/119 (13%)
 Frame = -3

Query  1485  FLLCFVLN-GFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP  1309
             F +C +L   F+  +       + G ++C  C  HDFS +   + G  V++ C +SRN  
Sbjct  10    FSVCLLLTLSFSHGKNV--TVKVFGLMHCRECIRHDFSSSQESM-GIHVSISC-KSRN--  63

Query  1308  SFRKEVKT------DDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCAVASTATSS  1150
                +E K       D+ G+F V L   ++KH   + GC  KL ++S   C + S  T+S
Sbjct  64    ---RETKPQGNGAIDNEGKFYVMLSAEITKHGNPLDGCFAKLQSASAAPCPIQSAQTAS  119



>ref|XP_003541705.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN08444.1| Olee1-like protein [Glycine soja]
Length=169

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 53/114 (46%), Gaps = 9/114 (8%)
 Frame = -3

Query  1509  KMSWVRITFLLCFVLNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVEC  1330
             K + + +   LCF+   F  +       ++ GTVYCDTC     ++ S F+ GA+V V C
Sbjct  3     KTTIIILASTLCFL--SFLGSAYARDRFMVEGTVYCDTCRVQFLTKLSEFLEGATVRVVC  60

Query  1329  GQSRNGP--SFRKEVKTDDHGEFRVHLPFSVSKHVKKIKGCSVKLINSSEPFCA  1174
              Q  N    +F KE  TD  G ++V +      H +    C V L+ S    C+
Sbjct  61    SQVDNAKNVTFSKEAVTDASGSYKVEVD---GDHEEDT--CEVTLLKSPRADCS  109



>ref|XP_004144129.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004171680.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN66323.1| hypothetical protein Csa_1G597700 [Cucumis sativus]
Length=165

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 6/81 (7%)
 Frame = -3

Query  1416  GTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGP-SFRKEVKTDDHGEFRVHLPFSVS  1240
             G VYCDTC    F++ S F+ GA+V +EC +   G  +  KE  TD  G++ +       
Sbjct  31    GKVYCDTCRVQFFTKVSKFLEGATVKLECKEIEGGSVTLDKEAVTDKSGKYSIEADGDHE  90

Query  1239  KHVKKIKGCSVKLINSSEPFC  1177
             + V     C V L+ S +P C
Sbjct  91    EEV-----CEVSLMKSVDPDC  106



>ref|XP_010547621.1| PREDICTED: protein DOWNSTREAM OF FLC [Tarenaya hassleriana]
Length=166

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 64/141 (45%), Gaps = 17/141 (12%)
 Frame = -3

Query  1416  GTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKE----VKTDDHGEFRVHLPF  1249
             G VYCDTC     ++AS +I GA+V +EC   ++  + R E      TD  G +RV +  
Sbjct  34    GCVYCDTCRFGFETDASEYIPGATVKIEC---KDRVTLRSEEVAKAVTDKGGRYRVTV--  88

Query  1248  SVSKHVKKIKGCSVKLINSSEPFCAVASTATSSSIHLKERKEG----KHIFSA-GFFTFK  1084
                K  ++ + C  KL++S    C       SS+  +  R  G    +H  +A GF   +
Sbjct  89    ---KGDRQDQQCLAKLVDSPMSGCQEQDPGRSSATVILTRSNGAASNRHFANAMGFLRSQ  145

Query  1083  PLNQPELCNQKPSIHGGFKKI  1021
             PL       ++    G FK I
Sbjct  146   PLPGCAALRKRYLADGDFKSI  166



>ref|XP_002522879.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39479.1| conserved hypothetical protein [Ricinus communis]
Length=182

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/131 (26%), Positives = 59/131 (45%), Gaps = 8/131 (6%)
 Frame = -3

Query  1467  LNGFTEARRYPPAAVLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK  1288
             L G+ E +      ++ GTV CD          +  +SGA V + CG+     S   E  
Sbjct  54    LAGYGEEK--LSTVLITGTVLCD-----GTPLGASPVSGALVGINCGEWSQQSSAAAEAV  106

Query  1287  TDDHGEFRVHLPFSVSKHVKKIKGCSVKLINS-SEPFCAVASTATSSSIHLKERKEGKHI  1111
             TD++GEF++ LP  +   +   K CS+K++       C +A      ++ L   ++G  +
Sbjct  107   TDEYGEFQIDLPSQLHAILNLEKACSLKVLRMPKNSACKLAFGKEGKTLTLLLARDGVRV  166

Query  1110  FSAGFFTFKPL  1078
             ++AG      L
Sbjct  167   YTAGEIKLSSL  177



>ref|XP_009121794.1| PREDICTED: uncharacterized protein LOC103846599 [Brassica rapa]
Length=265

 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/139 (26%), Positives = 66/139 (47%), Gaps = 14/139 (10%)
 Frame = -3

Query  1425  VLVGTVYCDTCFHHDFSEASHFISGASVAVECGQSRNGPSFRKEVK------TDDHGEFR  1264
              +VG VYCDTC  + FS  S+F+ G  V V C    + P   +EV       T+ +G ++
Sbjct  40    TVVGVVYCDTCSINTFSRQSYFLQGVEVHVSCRFKASSPKTTEEVNISVNRTTNTNGVYK  99

Query  1263  VHLP----FSVSKHVKKIKGCSVKLINSSEPF--CAVASTATSSS-IHLKERKEGKHIFS  1105
             + +P          +     CS KL+  S+    C +    T+++ + +K ++    I+S
Sbjct  100   LEIPHVDGIDCVDGIAIASQCSAKLLKPSDNNVGCNIPVFQTAANEVSIKSKQNRVCIYS  159

Query  1104  AGFFTFKPLNQ-PELCNQK  1051
                 ++KP ++   LC ++
Sbjct  160   LSALSYKPSHKNTTLCEKR  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4164492915968