BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22851_g1_i1 len=1496 path=[1770:0-372 3695:373-373 @2308@!:374-671
@2606@!:672-1336 3361:1337-1495]

Length=1496
                                                                      Score     E

ref|XP_009783126.1|  PREDICTED: uncharacterized protein LOC104231...    366   4e-117   
ref|XP_009612130.1|  PREDICTED: uncharacterized protein LOC104105...    357   4e-116   
ref|XP_006358484.1|  PREDICTED: uncharacterized protein LOC102593...    360   6e-115   
ref|XP_004230386.1|  PREDICTED: uncharacterized protein LOC101247758    359   9e-115   
ref|XP_009783127.1|  PREDICTED: uncharacterized protein LOC104231...    357   9e-114   
ref|XP_009612138.1|  PREDICTED: uncharacterized protein LOC104105...    347   2e-112   
ref|XP_011092235.1|  PREDICTED: uncharacterized protein LOC105172486    347   1e-109   
emb|CDP17763.1|  unnamed protein product                                327   6e-103   
ref|XP_011009424.1|  PREDICTED: uncharacterized protein LOC105114...    312   2e-96    
gb|KHG17286.1|  DNA-3-methyladenine glycosylase 1                       307   4e-95    
gb|KDO53849.1|  hypothetical protein CISIN_1g014334mg                   306   5e-95    
ref|XP_002304112.2|  hypothetical protein POPTR_0003s03710g             308   5e-95    Populus trichocarpa [western balsam poplar]
ref|XP_006470786.1|  PREDICTED: uncharacterized protein LOC102629...    307   7e-95    
ref|XP_002519384.1|  conserved hypothetical protein                     306   1e-94    Ricinus communis
ref|XP_006431360.1|  hypothetical protein CICLE_v10001110mg             306   2e-94    
ref|XP_011009421.1|  PREDICTED: uncharacterized protein LOC105114...    306   2e-94    
gb|KDP32457.1|  hypothetical protein JCGZ_13382                         301   2e-92    
ref|XP_007023216.1|  Uncharacterized protein isoform 1                  298   2e-91    
gb|KCW62544.1|  hypothetical protein EUGRSUZ_G00036                     293   3e-90    
ref|XP_010065201.1|  PREDICTED: uncharacterized protein LOC104452431    293   5e-89    
ref|XP_010104208.1|  hypothetical protein L484_002408                   290   2e-88    
gb|EYU33314.1|  hypothetical protein MIMGU_mgv1a019757mg                279   9e-86    
ref|XP_007023217.1|  Uncharacterized protein isoform 2                  278   6e-84    
ref|XP_010252239.1|  PREDICTED: uncharacterized protein LOC104593879    278   2e-83    
ref|XP_010533227.1|  PREDICTED: uncharacterized protein LOC104809...    264   1e-81    
ref|XP_007147543.1|  hypothetical protein PHAVU_006G133500g             271   7e-81    
ref|XP_010682181.1|  PREDICTED: uncharacterized protein LOC104897...    261   7e-77    
ref|XP_010682180.1|  PREDICTED: uncharacterized protein LOC104897...    259   9e-76    
ref|XP_010682182.1|  PREDICTED: uncharacterized protein LOC104897...    249   8e-74    
gb|KDO53850.1|  hypothetical protein CISIN_1g014334mg                   249   1e-73    
ref|XP_011009425.1|  PREDICTED: uncharacterized protein LOC105114...    251   2e-73    
ref|XP_006470787.1|  PREDICTED: uncharacterized protein LOC102629...    249   2e-73    
ref|XP_007023218.1|  Uncharacterized protein isoform 3                  240   7e-70    
ref|XP_003534756.2|  PREDICTED: uncharacterized protein LOC100781827    239   3e-69    
gb|KHN40743.1|  hypothetical protein glysoja_015110                     238   8e-69    
ref|XP_010926998.1|  PREDICTED: uncharacterized protein LOC105049133    229   3e-65    
gb|EEC82605.1|  hypothetical protein OsI_27177                          228   7e-65    Oryza sativa Indica Group [Indian rice]
ref|XP_010533228.1|  PREDICTED: uncharacterized protein LOC104809...    219   1e-64    
ref|XP_004959865.1|  PREDICTED: uncharacterized protein LOC101766322    227   3e-64    
dbj|BAC15471.1|  hypothetical protein                                   227   6e-64    Oryza sativa Japonica Group [Japonica rice]
gb|EMT03969.1|  hypothetical protein F775_22747                         220   3e-63    
ref|XP_006853038.1|  hypothetical protein AMTR_s00038p00020700          223   6e-63    
ref|XP_007023219.1|  Uncharacterized protein isoform 4                  215   2e-60    
ref|XP_009387466.1|  PREDICTED: uncharacterized protein LOC103974377    215   7e-60    
gb|EEE67737.1|  hypothetical protein OsJ_25428                          211   2e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006470788.1|  PREDICTED: uncharacterized protein LOC102629...    208   5e-58    
ref|XP_007022707.1|  Uncharacterized protein TCM_033523                 176   4e-46    
gb|KDP47043.1|  hypothetical protein JCGZ_10770                         156   5e-41    
ref|NP_001060514.2|  Os07g0657600                                       160   7e-40    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008227745.1|  PREDICTED: uncharacterized protein LOC103327233    155   1e-38    
ref|XP_009347279.1|  PREDICTED: uncharacterized protein LOC103938951    150   3e-38    
gb|KHN34477.1|  hypothetical protein glysoja_038896                     152   1e-37    
ref|XP_002514394.1|  conserved hypothetical protein                     154   1e-37    Ricinus communis
ref|XP_010046014.1|  PREDICTED: uncharacterized protein LOC104434857    143   2e-36    
ref|XP_006593886.1|  PREDICTED: uncharacterized protein LOC102669626    147   3e-36    
ref|XP_010468777.1|  PREDICTED: uncharacterized protein LOC104748896    145   2e-35    
ref|XP_006299074.1|  hypothetical protein CARUB_v10015214mg             145   3e-35    
ref|XP_006405890.1|  hypothetical protein EUTSA_v10028036mg             140   1e-33    
ref|XP_010247913.1|  PREDICTED: uncharacterized protein LOC104590857    139   3e-33    
emb|CDX82716.1|  BnaC07g01500D                                          139   4e-33    
ref|XP_008460619.1|  PREDICTED: uncharacterized protein LOC103499397    133   4e-33    
ref|XP_008385650.1|  PREDICTED: uncharacterized protein LOC103448172    133   7e-32    
ref|XP_005842500.1|  hypothetical protein GUITHDRAFT_160483             131   1e-30    
gb|KFK33320.1|  hypothetical protein AALP_AA6G359700                    130   4e-30    
ref|XP_009593372.1|  PREDICTED: uncharacterized protein LOC104090039    124   5e-30    
ref|XP_007213368.1|  hypothetical protein PRUPE_ppa026718mg             129   5e-30    
ref|XP_005646705.1|  DNA glycosylase                                    129   2e-29    
ref|XP_006423927.1|  hypothetical protein CICLE_v10030405mg             125   1e-28    
ref|XP_010046025.1|  PREDICTED: uncharacterized protein LOC104434869    120   2e-28    
ref|XP_009804252.1|  PREDICTED: uncharacterized protein LOC104249510    122   2e-27    
ref|XP_006350375.1|  PREDICTED: uncharacterized protein LOC102593362    112   6e-24    
ref|XP_010315535.1|  PREDICTED: uncharacterized protein LOC101254250    110   2e-23    
emb|CBI35315.3|  unnamed protein product                                107   8e-23    
ref|XP_010490265.1|  PREDICTED: uncharacterized protein LOC104768014    106   3e-22    
emb|CBN77855.1|  conserved unknown protein                              102   1e-20    
ref|XP_010256879.1|  PREDICTED: uncharacterized protein LOC104597156  88.2    3e-17    
ref|XP_004342630.1|  hypothetical protein CAOG_08029                  93.6    5e-17    
emb|CDP17259.1|  unnamed protein product                              90.9    6e-17    
gb|KCW84808.1|  hypothetical protein EUGRSUZ_B01611                   85.1    8e-16    
ref|WP_014437765.1|  hypothetical protein                             85.5    6e-15    
gb|KCW84783.1|  hypothetical protein EUGRSUZ_B01586                   84.3    9e-15    
ref|XP_010533318.1|  PREDICTED: uncharacterized protein LOC104809120  82.8    2e-14    
ref|XP_007146019.1|  hypothetical protein PHAVU_006G006000g           82.0    5e-14    
emb|CEI83200.1|  DNA-3-methyladenine glycosylase                      79.7    4e-13    
ref|XP_003883854.1|  conserved hypothetical protein                   80.1    2e-12    
ref|WP_027725341.1|  hypothetical protein                             76.3    5e-12    
gb|KFH16636.1|  hypothetical protein TGMAS_270750                     77.0    2e-11    
ref|XP_008882441.1|  hypothetical protein HHA_270750                  76.3    4e-11    
gb|KFG61636.1|  hypothetical protein TGRUB_270750                     74.3    1e-10    
gb|ESS36255.1|  hypothetical protein TGVEG_270750                     73.6    2e-10    
gb|KFH05928.1|  hypothetical protein TGVAND_270750                    73.6    2e-10    
gb|KFG52135.1|  hypothetical protein TGP89_270750                     73.2    2e-10    
gb|EPR64782.1|  hypothetical protein TGGT1_270750                     73.2    3e-10    
ref|XP_002365741.1|  hypothetical protein TGME49_070750               73.2    3e-10    Toxoplasma gondii ME49
gb|KFG54358.1|  hypothetical protein TGFOU_270750                     72.8    3e-10    
ref|WP_011419796.1|  iron-sulfur cluster assembly protein HesB        69.7    9e-10    
ref|WP_037494541.1|  hypothetical protein                             67.4    2e-09    
ref|WP_035393015.1|  hypothetical protein                             66.6    2e-09    
dbj|GAF20538.1|  HhH-GPD family protein                               66.6    3e-09    
ref|XP_006405889.1|  hypothetical protein EUTSA_v10028065mg           63.2    3e-08    
ref|WP_037411630.1|  hypothetical protein                             63.5    4e-08    
ref|WP_038476336.1|  hypothetical protein                             63.9    6e-08    
ref|XP_009626386.1|  PREDICTED: uncharacterized protein LOC104117102  62.0    7e-08    
gb|KDP47044.1|  hypothetical protein JCGZ_10771                       61.6    9e-08    
ref|XP_009124647.1|  PREDICTED: uncharacterized protein LOC103849671  61.2    1e-07    
ref|WP_011985101.1|  iron-sulfur cluster assembly protein HesB        62.0    4e-07    
emb|CDY11690.1|  BnaC06g12980D                                        60.1    5e-07    
ref|WP_028243959.1|  hypothetical protein                             60.8    5e-07    
ref|WP_012632149.1|  iron-sulfur cluster assembly protein HesB        60.8    9e-07    
ref|WP_015549452.1|  3-methyladenine DNA glycosylase/8-oxoguanine...  57.0    1e-05    
ref|WP_027831953.1|  hypothetical protein                             57.0    1e-05    
ref|WP_006836275.1|  DNA-3-methyladenine glycosylase                  55.5    4e-05    
ref|WP_035109549.1|  8-oxoguanine DNA glycosylase                     55.1    6e-05    
gb|EFH92663.1|  8-oxoguanine DNA-glycosylase (ogg)                    55.1    6e-05    
ref|WP_036207075.1|  hypothetical protein                             54.7    7e-05    
ref|WP_028246747.1|  hypothetical protein                             54.3    1e-04    
ref|WP_002841813.1|  8-oxoguanine DNA glycosylase                     53.5    2e-04    
ref|WP_002837958.1|  8-oxoguanine DNA glycosylase                     53.5    2e-04    
ref|WP_012290689.1|  8-oxoguanine DNA glycosylase                     53.5    2e-04    
gb|AIZ57281.1|  hypothetical protein Mpt1_c14250                      53.1    2e-04    
ref|WP_002839100.1|  8-oxoguanine DNA glycosylase                     53.1    2e-04    
ref|WP_035112658.1|  8-oxoguanine DNA glycosylase                     53.1    2e-04    
ref|WP_003516777.1|  8-oxoguanine DNA glycosylase                     53.1    2e-04    
ref|XP_009102171.1|  PREDICTED: uncharacterized protein LOC103828315  51.2    3e-04    
ref|WP_015505530.1|  8-oxoguanine-DNA-glycosylase                     52.0    4e-04    
ref|WP_003514139.1|  8-oxoguanine DNA glycosylase                     52.4    4e-04    
ref|WP_022532573.1|  dNA-(Apurinic or apyrimidinic site) lyase        52.0    4e-04    
ref|WP_015247805.1|  3-methyladenine DNA glycosylase                  51.6    7e-04    
ref|WP_028236501.1|  hypothetical protein                             51.6    8e-04    
ref|WP_020468712.1|  hypothetical protein                             51.6    8e-04    



>ref|XP_009783126.1| PREDICTED: uncharacterized protein LOC104231771 isoform X1 [Nicotiana 
sylvestris]
Length=502

 Score =   366 bits (939),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 189/331 (57%), Positives = 227/331 (69%), Gaps = 28/331 (8%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSV------------ESDHFIPKTPAAKEKWKKA  519
             WSRTLSMA+ALCELQLEL+       LS             +S+HF PKTPA KE  K+A
Sbjct  181   WSRTLSMAEALCELQLELNRPSSAVLLSAADNLNQFKGVTAKSEHFSPKTPAGKESRKRA  240

Query  520   GVHKCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGC  699
             GV+ C +NL  RL E +   +E      G A++   P    G          KE  L   
Sbjct  241   GVYGCCRNLLERLTEVEEIVDE------GKADVSVKPAFSDG----------KEAVLQIT  284

Query  700   DISQTPSNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYR  879
             D  Q  + +C  +  +  +   +   EL++ N +GNFPSP+ELA L+ESFLAKRC LGYR
Sbjct  285   DAFQATTEVCEVSTSAPFNADPSVDRELSSFNQIGNFPSPKELAGLDESFLAKRCGLGYR  344

Query  880   AARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGY  1059
             A RII LA+G+VEGRI LKE+EE C  P+LSNYD++A QL+EIDGFGPFTCANVLMCLGY
Sbjct  345   AGRIIKLAKGIVEGRISLKELEEACCNPSLSNYDKMAEQLREIDGFGPFTCANVLMCLGY  404

Query  1060  YHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGK  1239
              HVIPTDSETIRHLKQVHA++SS   VQKDVE IY KYAPFQFL YWSE+WHFYEEWFGK
Sbjct  405   CHVIPTDSETIRHLKQVHARTSSIQKVQKDVEKIYAKYAPFQFLAYWSEVWHFYEEWFGK  464

Query  1240  LSEMPQSGYNRITASNMRPKRNAKSKRIKTS  1332
             +SEMP S Y  ITA+NMRPKR+ K K++K +
Sbjct  465   VSEMPHSDYKLITAANMRPKRSGKCKKLKIT  495


 Score =   131 bits (330),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 83/118 (70%), Gaps = 6/118 (5%)
 Frame = +3

Query  21   FIPTVLSPKMQHTGETTISGDARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWD  200
             IPT ++ KMQ+  E       RR  VVVELPLGD + T +LEKAVCSHGLFMMAPNHWD
Sbjct  14   LIPTAITSKMQYRQEID-----RRHSVVVELPLGDGA-TCDLEKAVCSHGLFMMAPNHWD  67

Query  201  PLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
             L+KTLERPLRLS + +  DHE S  VR+S P DSP SL L VFGTD LS    +SL+
Sbjct  68   YLSKTLERPLRLSGNINDDDHEKSHLVRISQPPDSPHSLHLRVFGTDSLSPLHQRSLL  125



>ref|XP_009612130.1| PREDICTED: uncharacterized protein LOC104105510 isoform X1 [Nicotiana 
tomentosiformis]
Length=316

 Score =   357 bits (915),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 221/325 (68%), Gaps = 28/325 (9%)
 Frame = +1

Query  394   MAKALCELQLELSSSDKKFSLSV------------ESDHFIPKTPAAKEKWKKAGVHKCS  537
             MA+ALCELQLEL+      SLS             ES+HF PKTPA KE  K AGV+ C 
Sbjct  1     MAEALCELQLELNCPSSAVSLSAADNLNQLKGVTAESEHFSPKTPAGKESRKTAGVYGCC  60

Query  538   KNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTP  717
             +NL  RL E +   +E      G A++   P    G          KE  L   D  Q  
Sbjct  61    RNLLERLTEVEEIVDE------GKADVSVKPAFSDG----------KEAVLEITDSFQAT  104

Query  718   SNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIIN  897
             + +C  N  +  +   +E  EL++ N + NFPSP+ELA L+ESFLAKRC LGYRA RII 
Sbjct  105   TEVCEVNISAPFNPDPSEDRELSSFNQIRNFPSPKELAGLDESFLAKRCGLGYRAGRIIK  164

Query  898   LARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPT  1077
             LA+G+VEGRI LKE+EE    P+LSNYD++A QL+EIDGFGPFTCANVLMCLGYYHVIPT
Sbjct  165   LAKGIVEGRIQLKELEEAYSNPSLSNYDKMAEQLREIDGFGPFTCANVLMCLGYYHVIPT  224

Query  1078  DSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQ  1257
             DSETIRHLKQVHA++SS   VQKDVE IY KYAPFQFL YWSE+WHFYEEWFGK+SEMP 
Sbjct  225   DSETIRHLKQVHARTSSIQKVQKDVENIYAKYAPFQFLAYWSEVWHFYEEWFGKVSEMPH  284

Query  1258  SGYNRITASNMRPKRNAKSKRIKTS  1332
             S Y  ITA+NMRPKR+ K K++K +
Sbjct  285   SDYKLITAANMRPKRSGKCKKLKIT  309



>ref|XP_006358484.1| PREDICTED: uncharacterized protein LOC102593287 isoform X1 [Solanum 
tuberosum]
 ref|XP_006358485.1| PREDICTED: uncharacterized protein LOC102593287 isoform X2 [Solanum 
tuberosum]
Length=485

 Score =   360 bits (923),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 230/332 (69%), Gaps = 29/332 (9%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELS--SSDKKF----------SLSVESDHFIPKTPAAKEKWKKA  519
             WSRTLSMA+ALCELQLEL+  SS   F           ++ +S+HF P+TPA KE  K+A
Sbjct  165   WSRTLSMAEALCELQLELNCPSSAASFPDPDNQNQLKGVTFKSEHFTPRTPAGKESRKRA  224

Query  520   GVHKCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGC  699
             G + CS+ L  RL      TE + ++  G   +   P    G           E+ L   
Sbjct  225   GAYGCSRKLLERL------TEVEEIIDIGKPGVTVTPAFSVG-----------EEVLKKS  267

Query  700   DISQTPSNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYR  879
             ++ +  + +C     +  +L  +E  +L++ N +GNFPSP+ELA L+ESFLAKRC LGYR
Sbjct  268   NLCRDTTEVCDVGTSAPFNLDPSEDRKLSSFNQLGNFPSPKELASLDESFLAKRCGLGYR  327

Query  880   AARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGY  1059
             A RII LA+G+VEG I LKE+EE C  P+LS+YD++A QL+EIDGFGPFTCANVLMCLGY
Sbjct  328   AGRIIKLAKGIVEGSIQLKELEEACSNPSLSDYDKMAEQLREIDGFGPFTCANVLMCLGY  387

Query  1060  YHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGK  1239
             YHVIPTDSETIRHLKQVHA++S+   VQ+DVE IYGKYAPFQFL YWSE+WHFYEE FGK
Sbjct  388   YHVIPTDSETIRHLKQVHARTSTIQNVQRDVENIYGKYAPFQFLAYWSEVWHFYEERFGK  447

Query  1240  LSEMPQSGYNRITASNMRPKRNAKSKRIKTSA  1335
             LSEMP S Y  ITA+NMR KRN K K++K ++
Sbjct  448   LSEMPHSEYKLITAANMRRKRNGKCKKLKITS  479


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 77/114 (68%), Gaps = 10/114 (9%)
 Frame = +3

Query  48   MQHTGETTISGDARRGMVVVELPLGDAS-----STFNLEKAVCSHGLFMMAPNHWDPLTK  212
            MQH  E       R   VVVELPLGD       +TF+LEKAVCSHGLFMMAPN WD L+K
Sbjct  1    MQHRQEID-----RHRSVVVELPLGDGDGDGGCATFDLEKAVCSHGLFMMAPNRWDSLSK  55

Query  213  TLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
            TLERPL LS++ +  DHE SV V+++ PSDSP SL L VFGT  LS    +SL+
Sbjct  56   TLERPLHLSENINDDDHEQSVLVQINQPSDSPHSLLLRVFGTASLSTIHQRSLL  109



>ref|XP_004230386.1| PREDICTED: uncharacterized protein LOC101247758 [Solanum lycopersicum]
Length=483

 Score =   359 bits (922),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 189/345 (55%), Positives = 229/345 (66%), Gaps = 55/345 (16%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELS--SSDKKF----------SLSVESDHFIPKTPAAKEKWKKA  519
             WSRTLSMA+ALCELQLEL+  SS   F           ++ +S+HF P+TPA KE  K+A
Sbjct  163   WSRTLSMAEALCELQLELNCPSSAASFPDPDNQNQLKGVTSKSEHFTPRTPAGKELRKRA  222

Query  520   GVHKCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGC  699
             G + CS+NL  RL E +   + D    T +                         F +G 
Sbjct  223   GAYGCSRNLLERLNEVEEIVDIDKPGVTVTP-----------------------AFSVGE  259

Query  700   DISQTPSNLCSD-------------NPCSSSDLHSAEAVELNALNGVGNFPSPRELAELN  840
             ++ Q  SNLC D             NP  S D       +L++ N +GNFPSP++LA L+
Sbjct  260   EVLQK-SNLCQDTTEVWEVSVSAPLNPDPSEDR------KLSSFNQLGNFPSPKQLASLD  312

Query  841   ESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFG  1020
             ESFLAKRC LGYRA RII LA+G+VEG I L E+EE C  P+LSNYD++A QL+EIDGFG
Sbjct  313   ESFLAKRCGLGYRAGRIIKLAKGIVEGSIQLNELEEACSNPSLSNYDKMAEQLREIDGFG  372

Query  1021  PFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYW  1200
             PFTCANVLMCLGYYHVIPTDSETIRHLKQVHA++S+   VQ+DVE IYGKYAPFQFL YW
Sbjct  373   PFTCANVLMCLGYYHVIPTDSETIRHLKQVHARTSTIQNVQRDVENIYGKYAPFQFLAYW  432

Query  1201  SEIWHFYEEWFGKLSEMPQSGYNRITASNMRPKRNAKSKRIKTSA  1335
             SE+WHFYEE FGKLSEMP S Y  ITA+NMRPKRN K K++K ++
Sbjct  433   SEVWHFYEERFGKLSEMPHSEYKLITAANMRPKRNGKCKKLKIAS  477


 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 76/112 (68%), Gaps = 8/112 (7%)
 Frame = +3

Query  48   MQHTGETTISGDARRGMVVVELPLGDAS---STFNLEKAVCSHGLFMMAPNHWDPLTKTL  218
            MQH  E       R   VVVELPL D +   ++F+LEKAVCSHGLFMMAPN WD L+KTL
Sbjct  1    MQHRQEID-----RHRSVVVELPLEDGNGYCASFDLEKAVCSHGLFMMAPNRWDTLSKTL  55

Query  219  ERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
            ERPLRLS++ +  DHE SV V+++ PSD P SL L V  TD LS    +SL+
Sbjct  56   ERPLRLSENINDDDHEQSVLVQITQPSDYPHSLLLRVLDTDSLSTIHQRSLL  107



>ref|XP_009783127.1| PREDICTED: uncharacterized protein LOC104231771 isoform X2 [Nicotiana 
sylvestris]
Length=480

 Score =   357 bits (915),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 184/333 (55%), Positives = 221/333 (66%), Gaps = 54/333 (16%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSV------------ESDHFIPKTPAAKEKWKKA  519
             WSRTLSMA+ALCELQLEL+       LS             +S+HF PKTPA KE  K+A
Sbjct  181   WSRTLSMAEALCELQLELNRPSSAVLLSAADNLNQFKGVTAKSEHFSPKTPAGKESRKRA  240

Query  520   GVHKCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGC  699
             GV+ C +NL  RL E +   +E     T                               C
Sbjct  241   GVYGCCRNLLERLTEVEEIVDEGKADATTEV----------------------------C  272

Query  700   DISQTPSNLCSDNPCSSSDLHSAEAV--ELNALNGVGNFPSPRELAELNESFLAKRCNLG  873
             ++S            +S+  ++  +V  EL++ N +GNFPSP+ELA L+ESFLAKRC LG
Sbjct  273   EVS------------TSAPFNADPSVDRELSSFNQIGNFPSPKELAGLDESFLAKRCGLG  320

Query  874   YRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCL  1053
             YRA RII LA+G+VEGRI LKE+EE C  P+LSNYD++A QL+EIDGFGPFTCANVLMCL
Sbjct  321   YRAGRIIKLAKGIVEGRISLKELEEACCNPSLSNYDKMAEQLREIDGFGPFTCANVLMCL  380

Query  1054  GYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWF  1233
             GY HVIPTDSETIRHLKQVHA++SS   VQKDVE IY KYAPFQFL YWSE+WHFYEEWF
Sbjct  381   GYCHVIPTDSETIRHLKQVHARTSSIQKVQKDVEKIYAKYAPFQFLAYWSEVWHFYEEWF  440

Query  1234  GKLSEMPQSGYNRITASNMRPKRNAKSKRIKTS  1332
             GK+SEMP S Y  ITA+NMRPKR+ K K++K +
Sbjct  441   GKVSEMPHSDYKLITAANMRPKRSGKCKKLKIT  473


 Score =   131 bits (329),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 83/118 (70%), Gaps = 6/118 (5%)
 Frame = +3

Query  21   FIPTVLSPKMQHTGETTISGDARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWD  200
             IPT ++ KMQ+  E       RR  VVVELPLGD + T +LEKAVCSHGLFMMAPNHWD
Sbjct  14   LIPTAITSKMQYRQEID-----RRHSVVVELPLGDGA-TCDLEKAVCSHGLFMMAPNHWD  67

Query  201  PLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
             L+KTLERPLRLS + +  DHE S  VR+S P DSP SL L VFGTD LS    +SL+
Sbjct  68   YLSKTLERPLRLSGNINDDDHEKSHLVRISQPPDSPHSLHLRVFGTDSLSPLHQRSLL  125



>ref|XP_009612138.1| PREDICTED: uncharacterized protein LOC104105510 isoform X2 [Nicotiana 
tomentosiformis]
Length=294

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 178/325 (55%), Positives = 211/325 (65%), Gaps = 50/325 (15%)
 Frame = +1

Query  394   MAKALCELQLELSSSDKKFSLSV------------ESDHFIPKTPAAKEKWKKAGVHKCS  537
             MA+ALCELQLEL+      SLS             ES+HF PKTPA KE  K AGV+ C 
Sbjct  1     MAEALCELQLELNCPSSAVSLSAADNLNQLKGVTAESEHFSPKTPAGKESRKTAGVYGCC  60

Query  538   KNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTP  717
             +NL  RL E +   +E     T                                      
Sbjct  61    RNLLERLTEVEEIVDEGKADAT--------------------------------------  82

Query  718   SNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIIN  897
             + +C  N  +  +   +E  EL++ N + NFPSP+ELA L+ESFLAKRC LGYRA RII 
Sbjct  83    TEVCEVNISAPFNPDPSEDRELSSFNQIRNFPSPKELAGLDESFLAKRCGLGYRAGRIIK  142

Query  898   LARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPT  1077
             LA+G+VEGRI LKE+EE    P+LSNYD++A QL+EIDGFGPFTCANVLMCLGYYHVIPT
Sbjct  143   LAKGIVEGRIQLKELEEAYSNPSLSNYDKMAEQLREIDGFGPFTCANVLMCLGYYHVIPT  202

Query  1078  DSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQ  1257
             DSETIRHLKQVHA++SS   VQKDVE IY KYAPFQFL YWSE+WHFYEEWFGK+SEMP 
Sbjct  203   DSETIRHLKQVHARTSSIQKVQKDVENIYAKYAPFQFLAYWSEVWHFYEEWFGKVSEMPH  262

Query  1258  SGYNRITASNMRPKRNAKSKRIKTS  1332
             S Y  ITA+NMRPKR+ K K++K +
Sbjct  263   SDYKLITAANMRPKRSGKCKKLKIT  287



>ref|XP_011092235.1| PREDICTED: uncharacterized protein LOC105172486 [Sesamum indicum]
Length=503

 Score =   347 bits (889),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 229/342 (67%), Gaps = 24/342 (7%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLEL----SSSDKKFS--------LSVESDHFIPKTPAAKEKWKKA  519
             WSRTLSMA+ALCELQLEL    SS+    +         + E  HF+PKTPA KE  ++ 
Sbjct  155   WSRTLSMAQALCELQLELQHPLSSAANAMAENGTISSCQTTEMKHFVPKTPAVKESKRRL  214

Query  520   GVHKCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGC  699
             GV KCS NL +  A+  A    +    T SAEI +C  +  G  +   +S   +DFL   
Sbjct  215   GVRKCSINLESGYADILAVEAAER--KTSSAEISECSQE-TGKLTPTFTSPDVKDFLQKS  271

Query  700   DISQTPSN--LCSDNPCSSSD------LHSAEAVELNALNGVGNFPSPRELAELNESFLA  855
             D  QT ++  L  + P    D      L +    E  A   +GNFPSPRELA L+  FLA
Sbjct  272   DSWQTSTSDLLPLEGPEGKPDSSFVPVLQTLVETEGYAGTAIGNFPSPRELAGLDVKFLA  331

Query  856   KRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCA  1035
             +RC+LGYRAAR+INLA+ V+EGRIPL E+E  C   NLS YD+LA +L+ IDGFGPFTCA
Sbjct  332   RRCSLGYRAARVINLAQQVIEGRIPLTELEYACDTLNLSKYDKLAEKLRAIDGFGPFTCA  391

Query  1036  NVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWH  1215
             NVLMC+G+YHV+PTDSETIRHLKQVHAKSS+  TVQ DVE IYGKYAPFQFL YWSEIWH
Sbjct  392   NVLMCMGFYHVVPTDSETIRHLKQVHAKSSTIQTVQGDVEKIYGKYAPFQFLAYWSEIWH  451

Query  1216  FYEEWFGKLSEMPQSGYNRITASNMRPKRNAKSKRIKTSA*D  1341
             FYEEWFG LSEM  S Y  ITA+NMRPK N +SKR+K S  D
Sbjct  452   FYEEWFGNLSEMHHSSYKLITAANMRPKTN-RSKRMKLSPKD  492


 Score =   104 bits (260),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +3

Query  99   VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVT  278
            V+VELPLGDA+S F+LEKAVCSHGLFMMAPN WDP +KTL RPLRL+ D      E S+ 
Sbjct  12   VLVELPLGDAASNFSLEKAVCSHGLFMMAPNRWDPHSKTLRRPLRLNPD----GDETSLM  67

Query  279  VRVSHPSDSPQSLRLHVFGT  338
            V +SHP+ S  +L L VFGT
Sbjct  68   VHISHPTHSADALHLRVFGT  87



>emb|CDP17763.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   327 bits (838),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 173/329 (53%), Positives = 208/329 (63%), Gaps = 35/329 (11%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELS---SSDKKF------SLSVESDHFIPKTPAAKEKWKKAGVH  528
             W R+LSMA ALCELQ EL    S DK        S + +S+HFIPKTPA KE  +K  V 
Sbjct  122   WPRSLSMATALCELQWELQYPLSRDKVHNDTDSRSQTADSEHFIPKTPAGKETKRKMEVQ  181

Query  529   KCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDIS  708
             KC +NL+ +  +A A  EE +V       ++ C  K  G           +     C   
Sbjct  182   KCPENLANKFTDANAVGEEVSVFKMACDHVLHCS-KMVGDGRLINFPQLDD---FSCSDG  237

Query  709   QTPSNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAAR  888
               P N C                       +GNFPSP ELA L+ES LA+RCNLGYRA+R
Sbjct  238   SEPYNCCR----------------------IGNFPSPNELASLDESVLARRCNLGYRASR  275

Query  889   IINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHV  1068
             I+ LA+ VV+G I L E+EE  RQP LS+Y+ LA QLKEIDGFGPFTCANVLMC+G+YHV
Sbjct  276   ILKLAQLVVQGGIKLGELEETGRQPTLSSYNILAEQLKEIDGFGPFTCANVLMCMGFYHV  335

Query  1069  IPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSE  1248
             IP+DSETIRH+KQVHA+ ++   V  D+E IYGKYAPFQFL YWSE+W FYE+WFGK SE
Sbjct  336   IPSDSETIRHMKQVHARQTTIKAVDGDLEIIYGKYAPFQFLAYWSEVWSFYEDWFGKPSE  395

Query  1249  MPQSGYNRITASNMRPKRNAKSKRIKTSA  1335
             MP + Y  ITA+NMRPKRNAK KR K S 
Sbjct  396   MPPTNYKLITATNMRPKRNAKCKRKKISV  424


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  177  MMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQ  356
            MMAPN WDP +KTL+RPLRLS   +  DH+ SVTV++S      QSL+L VFGTD LS+Q
Sbjct  1    MMAPNFWDPKSKTLQRPLRLSLSLNDPDHQKSVTVKISQSCPPSQSLKLQVFGTDSLSSQ  60

Query  357  QHQSLM  374
            Q  SL+
Sbjct  61   QQHSLL  66



>ref|XP_011009424.1| PREDICTED: uncharacterized protein LOC105114550 isoform X2 [Populus 
euphratica]
Length=483

 Score =   312 bits (799),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 169/330 (51%), Positives = 208/330 (63%), Gaps = 30/330 (9%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELS------------SSDKKFSLSVESDHFIPKTPAAKEKWKKA  519
             W RTLSMA+ALCELQ EL             ++  K   +  + +FIP T A KE  +  
Sbjct  169   WPRTLSMARALCELQCELQCKSSGVFVAQAVNATVKNKCNDTAHNFIPNTSAGKESKRNI  228

Query  520   GVHKCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGC  699
                K SKNL++++ E     E D  L T SA I        G  + +   +      + C
Sbjct  229   RESKVSKNLASKIVETGTLLEADANLKTDSAHI--------GRETLESVENDSCARCISC  280

Query  700   DISQTPSNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYR  879
               S +         C+   L S   ++      + NFPSPRELA L+ESFLAKRCNLGYR
Sbjct  281   HGSDS---------CAPDSLQSQHGIQPGVNKMICNFPSPRELANLDESFLAKRCNLGYR  331

Query  880   AARIINLARGVVEGRIPLKEIEE-CCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLG  1056
             A RII LA+ +VEGRIPL+EIEE C    + S Y++LA Q ++IDGFGPFTCANVLMCLG
Sbjct  332   AIRIIKLAQSIVEGRIPLREIEEGCANGASSSCYNKLADQFRQIDGFGPFTCANVLMCLG  391

Query  1057  YYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFG  1236
             +YH+IPTDSET+RHLKQVHAK S+  TVQ+DVE IYG YAPFQFL YW+E+WHFYE+ FG
Sbjct  392   FYHIIPTDSETVRHLKQVHAKKSTIQTVQRDVEEIYGNYAPFQFLAYWAELWHFYEKRFG  451

Query  1237  KLSEMPQSGYNRITASNMRPKRNAKSKRIK  1326
             KLSE+P S Y  ITASNMR K   K+KR K
Sbjct  452   KLSEIPISDYKLITASNMRSKGGHKNKRTK  481


 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +3

Query  99   VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLS---DDHHCADHEI  269
            VV+E+PLGDA+ TFNLEKAVCSHGLFMM+PN WDPL+ T  RPLRLS    D   +    
Sbjct  15   VVLEIPLGDAADTFNLEKAVCSHGLFMMSPNLWDPLSLTFSRPLRLSLSDSDPQVSTPTT  74

Query  270  SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMV  377
            S+ V +SHP   P+SL + V+GT  LS +  +SL+ 
Sbjct  75   SLFVSISHPPHLPRSLSVRVYGTRFLSPKHQESLVA  110



>gb|KHG17286.1| DNA-3-methyladenine glycosylase 1 [Gossypium arboreum]
Length=451

 Score =   307 bits (787),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 205/320 (64%), Gaps = 59/320 (18%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKEKWKKAGVHKCSKNLSAR  555
             +SRTLSMAKALCELQ E+       S     D FIPKTPA KE  +K  V K S  L ++
Sbjct  189   FSRTLSMAKALCELQFEIQHQIS--SSKAAEDDFIPKTPAGKESKRKLRVSKVSIRLESK  246

Query  556   LAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPSNLCSD  735
             L E++                                                      D
Sbjct  247   LTESKV-----------------------------------------------------D  253

Query  736   NPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVV  915
             N  S SDL  ++  EL+   G+G+FPSP ELA+L+ESFLAKRCNLGYRA+RI+ LA+GVV
Sbjct  254   N--SVSDLQLSQ--ELHDFVGMGSFPSPEELAKLDESFLAKRCNLGYRASRILKLAQGVV  309

Query  916   EGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIR  1095
             +G I L ++EE C++ +LS+YD+L+++L++IDGFGPFTCANVLMC+G+YHVIP DSETIR
Sbjct  310   QGNIQLTQLEEDCKETSLSSYDKLSQRLRQIDGFGPFTCANVLMCMGFYHVIPADSETIR  369

Query  1096  HLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRI  1275
             HLKQVH+KS +  TV +DVE IY KYAPFQFL YW+E+WHFY + FGKLSE+P S Y  I
Sbjct  370   HLKQVHSKSCTVQTVGRDVELIYAKYAPFQFLAYWAEMWHFYGQRFGKLSELPVSDYKLI  429

Query  1276  TASNMRPKRNAKSKRIKTSA  1335
             TASNM+ K+ A  KR KTSA
Sbjct  430   TASNMKHKKIATRKRSKTSA  449


 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 7/93 (8%)
 Frame = +3

Query  99   VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVT  278
            +++ELPLG+A+  F LEKA+CSHGLFM+APNHWDP++++  RP RL+         ++VT
Sbjct  38   LLIELPLGEAAEGFELEKAICSHGLFMLAPNHWDPISRSFSRPFRLTSP------PLTVT  91

Query  279  VRV-SHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
            V +   P+ S  +L L V+G   LS     SL+
Sbjct  92   VGISQPPTSSSSTLYLRVYGASSLSPLHRHSLL  124



>gb|KDO53849.1| hypothetical protein CISIN_1g014334mg [Citrus sinensis]
Length=426

 Score =   306 bits (785),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 165/319 (52%), Positives = 213/319 (67%), Gaps = 34/319 (11%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKEKWKKAGVHKCSKNLSAR  555
             W RTLSMA+ALCELQ EL    +  S S+  D FIP+TPA KE  ++  V K +  L++R
Sbjct  138   WPRTLSMARALCELQWEL----QHCSPSISED-FIPQTPAGKESKRRQKVSKVASKLTSR  192

Query  556   LAEAQATTEEDNVLTTGSAEIVD--CPPKFKGLsskdissdkkedFLLGCDISQTPSNLC  729
             +AE++A++E+   L    A +++    P F                      +   S+L 
Sbjct  193   IAESKASSEDYMNLKLDCAGVLEENVQPSFPQ--------------------NDIESDLH  232

Query  730   SDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARG  909
               N  S++D  SA        + +GNFPSPRELA L+ESFLAKRCNLGYRA RI+ LARG
Sbjct  233   GLNELSTTDPPSAR-------DRIGNFPSPRELANLDESFLAKRCNLGYRAGRILKLARG  285

Query  910   VVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSET  1089
             +V+G+I L+E+E+ C + +L+ Y +LA QL +I+GFGPFT  NVL+C+G+YHVIPTDSET
Sbjct  286   IVDGQIQLRELEDMCNEASLTAYVKLAEQLSQINGFGPFTRNNVLVCIGFYHVIPTDSET  345

Query  1090  IRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYN  1269
             IRHLKQVHA++ ++ TVQ   E+IYGKYAPFQFL YWSE+WHFYE+ FGKLSEMP S Y 
Sbjct  346   IRHLKQVHARNCTSKTVQMIAESIYGKYAPFQFLAYWSELWHFYEKRFGKLSEMPYSDYK  405

Query  1270  RITASNMRPKRNAKSKRIK  1326
              ITASNM  K   K KR K
Sbjct  406   LITASNMGIKNIRKVKRTK  424



>ref|XP_002304112.2| hypothetical protein POPTR_0003s03710g [Populus trichocarpa]
 gb|EEE79091.2| hypothetical protein POPTR_0003s03710g [Populus trichocarpa]
Length=489

 Score =   308 bits (790),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 209/338 (62%), Gaps = 46/338 (14%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELS------------SSDKKFSLSVESDHFIPKTPAAKEKWKKA  519
             W RTLSMA+ALCELQ EL             ++  K   +  + +FIP T A KE  +  
Sbjct  175   WPRTLSMARALCELQCELQCKSSGVFVAQAVNATVKNKCNDTAHNFIPNTSAGKESKRNI  234

Query  520   GVHKCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGC  699
                K +KNL++++ E +   E D  L T SA I                         G 
Sbjct  235   RASKVTKNLASKIVETETLLEADANLKTDSAHI-------------------------GR  269

Query  700   DISQTPSN----LCSDNPCSSS----DLHSAEAVELNALNGVGNFPSPRELAELNESFLA  855
             +  ++  N     CS    S S     L S   ++      + NFPSPRELA L+ESFLA
Sbjct  270   ETLESVENDSCARCSSRHGSDSWAPDSLQSQHGIQPGVNKMICNFPSPRELANLDESFLA  329

Query  856   KRCNLGYRAARIINLARGVVEGRIPLKEIEE-CCRQPNLSNYDELARQLKEIDGFGPFTC  1032
             KRCNLGYRA RII LA+ +VEGRIPL+E+EE C    + S Y++LA Q ++IDGFGPFTC
Sbjct  330   KRCNLGYRAIRIIKLAQSIVEGRIPLREVEEDCANGASSSCYNKLADQFRQIDGFGPFTC  389

Query  1033  ANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIW  1212
             ANVLMC+G+YH+IPTDSET+RHLKQVHAK S+  TVQ+DVE IYGKYAPFQFL YW+E+W
Sbjct  390   ANVLMCMGFYHIIPTDSETVRHLKQVHAKKSTIQTVQRDVEEIYGKYAPFQFLAYWAELW  449

Query  1213  HFYEEWFGKLSEMPQSGYNRITASNMRPKRNAKSKRIK  1326
             HFYE+ FGKLSE+P S Y  ITASNMR K   K+KR K
Sbjct  450   HFYEKRFGKLSEIPTSDYKLITASNMRSKGGQKNKRTK  487


 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = +3

Query  99   VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLS---DDHHCADHEI  269
            VV E+PLGDA+ TFNLEKAVCSHGLFMM+PNHWDPL+ T  RPLRLS    D   +    
Sbjct  17   VVFEIPLGDAAETFNLEKAVCSHGLFMMSPNHWDPLSLTFSRPLRLSLSDSDPQVSTPTT  76

Query  270  SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMV  377
            S+ V +SHP   P+SL + V+GT CLS +  +SL+ 
Sbjct  77   SLFVSISHPPHLPRSLSVRVYGTRCLSPKHQESLVA  112



>ref|XP_006470786.1| PREDICTED: uncharacterized protein LOC102629917 isoform X1 [Citrus 
sinensis]
Length=454

 Score =   307 bits (786),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 163/321 (51%), Positives = 211/321 (66%), Gaps = 34/321 (11%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKEKWKKAGVHKCSKNLSAR  555
             W RTLSMA+ALCELQ EL       S     + FIP+TPA KE  ++  V K +  L++R
Sbjct  166   WPRTLSMARALCELQWELQHCSPSIS-----EDFIPQTPAGKESKRRQKVSKVASKLTSR  220

Query  556   LAEAQATTEEDNVLTTGSAEIVD--CPPKFKGLsskdissdkkedFLLGCDISQTPSNLC  729
             +AE++A++E+   L    A +++    P F                      +   S+L 
Sbjct  221   IAESKASSEDYMNLKLDCAGVLEENVQPSFPQ--------------------NDIESDLH  260

Query  730   SDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARG  909
               N  S++D  SA        + +GNFPSPRELA L+ESFLAKRCNLGYRA RI+ LARG
Sbjct  261   GLNELSTTDPPSAR-------DRIGNFPSPRELANLDESFLAKRCNLGYRAGRILKLARG  313

Query  910   VVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSET  1089
             +V+G+I L+E+E+ C + +L+ Y +LA QL +I+GFGPFT  NVL+C+G+YHVIPTDSET
Sbjct  314   IVDGQIQLRELEDMCNEASLTAYVKLAEQLSQINGFGPFTRNNVLVCIGFYHVIPTDSET  373

Query  1090  IRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYN  1269
             IRHLKQVHA++ ++ TVQ   E+IYGKYAPFQFL YWSE+WHFYE+ FGKLSEMP S Y 
Sbjct  374   IRHLKQVHARNCTSKTVQMIAESIYGKYAPFQFLAYWSELWHFYEKRFGKLSEMPYSDYK  433

Query  1270  RITASNMRPKRNAKSKRIKTS  1332
              ITASNM  K   + KR K S
Sbjct  434   LITASNMGIKNIRQVKRTKIS  454


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = +3

Query  102  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH-EISVT  278
            +++LPL +   TFNLE AVCSHGLFMM+PN WDPL+++L RPL LS+     D   +SV 
Sbjct  7    LLKLPLAE---TFNLETAVCSHGLFMMSPNRWDPLSRSLSRPLHLSNSLDNTDIPSVSVD  63

Query  279  VRVSHPSDSPQSLRLHVFGTD-----CLSAQQHQSLMV  377
            V +  P   P SLR+ V  +       LS +Q  +L+ 
Sbjct  64   VTICQPQQDPHSLRIEVRNSASGSAPSLSQEQQDALLA  101



>ref|XP_002519384.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43001.1| conserved hypothetical protein [Ricinus communis]
Length=458

 Score =   306 bits (784),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 165/323 (51%), Positives = 207/323 (64%), Gaps = 21/323 (7%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKEKWKKAGVHKC-SKNLSA  552
             WSRTLSMA ALC+ Q+EL S   +   +   +HFIP TP  KE  +K  + K  ++++  
Sbjct  156   WSRTLSMADALCKFQIELHSQSPQQKHAF--NHFIPNTPVKKEPKRKIRLSKVPTESMDL  213

Query  553   RLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPSNLCS  732
               A+   TT++  +  + S   VD    F  L                C  S T     S
Sbjct  214   EAADTCLTTDDSQMKISNSLNCVD-DGSFDNLK--------------SCQGSNT---FYS  255

Query  733   DNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGV  912
               P ++SD+ S    +  A    GNFPSPRELA L+E FLAKRC LGYRA RII LA+G+
Sbjct  256   TGPYATSDIQSHLVTQHCAKKTTGNFPSPRELANLDERFLAKRCGLGYRAGRIIKLAQGI  315

Query  913   VEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETI  1092
             VEGRIPL+E E+     +LS Y +L  QL+EI+GFGPFT ANVLMC+G+YHVIPTDSET+
Sbjct  316   VEGRIPLREFEQVSNGGSLSTYSKLTDQLREIEGFGPFTRANVLMCMGFYHVIPTDSETV  375

Query  1093  RHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNR  1272
             RH KQVHAK+S+  TVQ + E IY K+APFQFLVYW+E+WHFYE+ FGKLSEMP S Y  
Sbjct  376   RHFKQVHAKNSTIKTVQSEAEEIYRKFAPFQFLVYWAELWHFYEQRFGKLSEMPCSNYKL  435

Query  1273  ITASNMRPKRNAKSKRIKTSA*D  1341
             ITASN+R K + K+KR K S  D
Sbjct  436   ITASNLRNKGHHKAKRAKISRAD  458


 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 68/98 (69%), Gaps = 8/98 (8%)
 Frame = +3

Query  87   RRGMVVVELPLG-DASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH  263
            R G+V  E+ +G +A+ TF+LEK VCSHGLFM++PNHWDPL++T  RPLRL+DD    D+
Sbjct  4    REGVVEFEVAVGGEAADTFDLEKTVCSHGLFMLSPNHWDPLSRTFSRPLRLNDD---TDN  60

Query  264  EISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMV  377
             + V++   H S   +SL + V+G   LS +  +SL+V
Sbjct  61   SLMVSIS-QHLS---KSLLVRVYGNRSLSPKHQESLLV  94



>ref|XP_006431360.1| hypothetical protein CICLE_v10001110mg [Citrus clementina]
 gb|ESR44600.1| hypothetical protein CICLE_v10001110mg [Citrus clementina]
Length=454

 Score =   306 bits (783),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 165/320 (52%), Positives = 216/320 (68%), Gaps = 36/320 (11%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKEKWKKAGVHKCSKNLSAR  555
             W RTL+MA+ALCELQ EL    +  S S+  D FIP+TPA KE  ++  V K +  L++R
Sbjct  166   WPRTLNMARALCELQWEL----QHCSPSISED-FIPQTPAGKESKRRQKVSKVASKLTSR  220

Query  556   LAEAQATTEEDNVLT---TGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPSNL  726
             +AE++A++E+D  L    TG+ E  +  P F                      +   S+L
Sbjct  221   IAESKASSEDDMNLKLDCTGALE-ENVQPSFPR--------------------NDIESDL  259

Query  727   CSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLAR  906
                N  S++D  S       A + +GNFPSPRELA L+ESFLAKRCNLGYRA RI+ LA+
Sbjct  260   HGLNELSTTDPPS-------ACDRIGNFPSPRELANLDESFLAKRCNLGYRAGRILKLAQ  312

Query  907   GVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSE  1086
             G+V+G+I L+E+E+ C + +L+ Y++LA QL +I+GFGPFT  NVL+C+G+YHVIPTDSE
Sbjct  313   GIVDGQIQLRELEDTCNEASLTTYNKLAEQLSQINGFGPFTRNNVLVCIGFYHVIPTDSE  372

Query  1087  TIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGY  1266
             TIRHLKQVHA++ ++ TVQ   E+IYGKY+PFQFL YWSE+WHFYE+ FGKLSEMP S Y
Sbjct  373   TIRHLKQVHARNCTSKTVQIIAESIYGKYSPFQFLAYWSELWHFYEKRFGKLSEMPYSDY  432

Query  1267  NRITASNMRPKRNAKSKRIK  1326
               ITASNM  K   K KR K
Sbjct  433   KLITASNMGIKNIRKVKRTK  452


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = +3

Query  102  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH-EISVT  278
            V++LPL +   TFNLE AVCSHGLFMM+PN WDPL+++L RPL LS+     D   +SV 
Sbjct  7    VLKLPLAE---TFNLEAAVCSHGLFMMSPNRWDPLSRSLSRPLHLSNSLDNTDIPSVSVD  63

Query  279  VRVSHPSDSPQSLRLHVFGTD-----CLSAQQHQSLMV  377
            V +  P   P SLR+ V  +       LS +Q  +L+ 
Sbjct  64   VTICQPQQDPHSLRIEVRNSASGSAPSLSQEQQDALLA  101



>ref|XP_011009421.1| PREDICTED: uncharacterized protein LOC105114550 isoform X1 [Populus 
euphratica]
 ref|XP_011009422.1| PREDICTED: uncharacterized protein LOC105114550 isoform X1 [Populus 
euphratica]
Length=487

 Score =   306 bits (785),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 169/334 (51%), Positives = 208/334 (62%), Gaps = 34/334 (10%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELS------------SSDKKFSLSVESDHFIPKTPAAKEKWKKA  519
             W RTLSMA+ALCELQ EL             ++  K   +  + +FIP T A KE  +  
Sbjct  169   WPRTLSMARALCELQCELQCKSSGVFVAQAVNATVKNKCNDTAHNFIPNTSAGKESKRNI  228

Query  520   GVHKCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGC  699
                K SKNL++++ E     E D  L T SA I        G  + +   +      + C
Sbjct  229   RESKVSKNLASKIVETGTLLEADANLKTDSAHI--------GRETLESVENDSCARCISC  280

Query  700   DISQTPSNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYR  879
               S +         C+   L S   ++      + NFPSPRELA L+ESFLAKRCNLGYR
Sbjct  281   HGSDS---------CAPDSLQSQHGIQPGVNKMICNFPSPRELANLDESFLAKRCNLGYR  331

Query  880   AARIINLARGVVEGRIPLKEIEE-CCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLG  1056
             A RII LA+ +VEGRIPL+EIEE C    + S Y++LA Q ++IDGFGPFTCANVLMCLG
Sbjct  332   AIRIIKLAQSIVEGRIPLREIEEGCANGASSSCYNKLADQFRQIDGFGPFTCANVLMCLG  391

Query  1057  YYHVIPTDSETIRHLKQ----VHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYE  1224
             +YH+IPTDSET+RHLKQ    VHAK S+  TVQ+DVE IYG YAPFQFL YW+E+WHFYE
Sbjct  392   FYHIIPTDSETVRHLKQLSIQVHAKKSTIQTVQRDVEEIYGNYAPFQFLAYWAELWHFYE  451

Query  1225  EWFGKLSEMPQSGYNRITASNMRPKRNAKSKRIK  1326
             + FGKLSE+P S Y  ITASNMR K   K+KR K
Sbjct  452   KRFGKLSEIPISDYKLITASNMRSKGGHKNKRTK  485


 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +3

Query  99   VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLS---DDHHCADHEI  269
            VV+E+PLGDA+ TFNLEKAVCSHGLFMM+PN WDPL+ T  RPLRLS    D   +    
Sbjct  15   VVLEIPLGDAADTFNLEKAVCSHGLFMMSPNLWDPLSLTFSRPLRLSLSDSDPQVSTPTT  74

Query  270  SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMV  377
            S+ V +SHP   P+SL + V+GT  LS +  +SL+ 
Sbjct  75   SLFVSISHPPHLPRSLSVRVYGTRFLSPKHQESLVA  110



>gb|KDP32457.1| hypothetical protein JCGZ_13382 [Jatropha curcas]
Length=481

 Score =   301 bits (772),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 167/330 (51%), Positives = 209/330 (63%), Gaps = 37/330 (11%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESD--HFIPKTPAAKEKWKKAG-VHKCSKNL  546
             WSRTLSMA+ALCELQLEL       + + ++D  +FIPKTP  KE  K+ G V   S NL
Sbjct  178   WSRTLSMARALCELQLELQFHSSSCTKAQQTDMNNFIPKTPVGKESQKRKGRVSSASSNL  237

Query  547   SARLAEAQATTEE-DNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPS-  720
             S +L   +   +E D  LT     +VD   K + L                     TP+ 
Sbjct  238   STKLLVTKMDWDEVDTCLT-----MVDTRIKRENL---------------------TPNF  271

Query  721   --NLCSDNPC----SSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRA  882
               N   DN C    S       ++++      + NFPSP ELA L+E FL+KRC LGYRA
Sbjct  272   SINSIEDNSCGICKSCVGPSGIQSLQQTQCKRIWNFPSPWELANLDERFLSKRCGLGYRA  331

Query  883   ARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYY  1062
              RII L++G+VEGRIP++E+E+ C   +L++Y+ELA QLKEIDGFGPFT ANVLMC+G+Y
Sbjct  332   GRIIKLSQGIVEGRIPMRELEQVCNGGSLNSYNELADQLKEIDGFGPFTRANVLMCMGFY  391

Query  1063  HVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKL  1242
             HVIP DSET+RH+KQVHAK+S+  TV K +E IYGKY P QFL YW+E+WHFYE+ FGK 
Sbjct  392   HVIPADSETVRHIKQVHAKNSTIQTVHKHIEEIYGKYTPLQFLAYWTELWHFYEQRFGKF  451

Query  1243  SEMPQSGYNRITASNMRPKRNAKSKRIKTS  1332
              EMP S Y  ITASNMR K + K KR K S
Sbjct  452   YEMPCSEYKLITASNMRNKGSCKIKRAKIS  481


 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 65/95 (68%), Gaps = 6/95 (6%)
 Frame = +3

Query  99   VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHE---I  269
            V++E+PLG A+ TF+ +K VCSHGLF M+PN WDPL+ T  RPLRL   HH +D E    
Sbjct  24   VILEIPLGIAAETFDFKKTVCSHGLFAMSPNQWDPLSYTFSRPLRLR--HH-SDSESDFT  80

Query  270  SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
            SV V +SHPS+ P SL + V GT  L+ Q  +SL+
Sbjct  81   SVMVSISHPSNLPHSLLVRVHGTRSLTPQNRESLV  115



>ref|XP_007023216.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY25838.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=467

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 166/321 (52%), Positives = 202/321 (63%), Gaps = 62/321 (19%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFS-LSVESDHFIPKTPAAKEKWKKAGVHKCSKNLSA  552
             +SRTLSMAKALCELQ E   + + FS +    D FIPKTPA  E  +K  V K    +S 
Sbjct  204   FSRTLSMAKALCELQFE---TQRPFSGVRAAEDDFIPKTPAGNELKRKLRVSK----VSM  256

Query  553   RLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPSNLCS  732
             RL    A    D+                                               
Sbjct  257   RLEGKFAEPRADH-----------------------------------------------  269

Query  733   DNPCSSSDLH-SAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARG  909
                 S SDL  S E  E +A  G+G+FPSP ELA L+ESFLAKRCNLGYRA+RI+ LA+G
Sbjct  270   ----SKSDLQPSQELDEPHAYKGMGSFPSPEELANLDESFLAKRCNLGYRASRILKLAKG  325

Query  910   VVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSET  1089
             +V+G I L ++EE C++ +LS+Y++LA QL++IDGFGPFTCANVLMC+G+YHVIP DSET
Sbjct  326   IVQGIIQLMQLEEGCKEISLSSYNKLAEQLRQIDGFGPFTCANVLMCMGFYHVIPADSET  385

Query  1090  IRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYN  1269
             IRHLKQVH+KSS+  TV +DVE IY KYAPFQFL YW+E+WH+YE+ FGKLSEMP  GY 
Sbjct  386   IRHLKQVHSKSSTMQTVGRDVEGIYAKYAPFQFLAYWAELWHYYEQRFGKLSEMPFCGYK  445

Query  1270  RITASNMRPKRNAKSKRIKTS  1332
              ITASNM+ K  A SKR K S
Sbjct  446   LITASNMKMK--ATSKRTKVS  464


 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 10/97 (10%)
 Frame = +3

Query  99   VVVELPLGDASST-----FNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH  263
            V++ELP+G+A++      FNLEKAVCSHGLFMMAPN WDP++++L RPLRL D H     
Sbjct  47   VLIELPVGEAAAAEGAGPFNLEKAVCSHGLFMMAPNQWDPISRSLSRPLRLLDHH---SP  103

Query  264  EISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
             ++V VR+S P+ S  +L L V+GT CLS Q   SL+
Sbjct  104  PLTVQVRISQPTAS--TLHLRVYGTRCLSPQHRHSLL  138



>gb|KCW62544.1| hypothetical protein EUGRSUZ_G00036 [Eucalyptus grandis]
Length=395

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 168/344 (49%), Positives = 210/344 (61%), Gaps = 30/344 (9%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSS-----DKKFSLSVE---SDHFIPKTPAAKEKWKKAGVHK  531
             WSRTLSMA+ALCELQLEL  +     DK    ++    + H  P TPA KE  +K G  K
Sbjct  58    WSRTLSMAQALCELQLELQRNSSCMEDKDGIRNINKGVASHLAPTTPAPKEAKRKRGGCK  117

Query  532   CSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLL----GC  699
                NL  +  +    T E  V T+   E V       G+    I  + +    L    GC
Sbjct  118   TRTNLMTKFTDV---TPEAEVATSTRMETVTLGI---GIHENGIHENGQLTSGLSSSDGC  171

Query  700   DIS-QTPSNLCSDNPC-SSSDLHSAEAVELNAL----------NGVGNFPSPRELAELNE  843
              +     S L SD  C +S ++H   A +   +          + VGNFPSPRELA L+E
Sbjct  172   SLHCDRQSRLASDETCETSEEVHERGACQEPIVQIAHEEECWWDVVGNFPSPRELASLDE  231

Query  844   SFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGP  1023
              FLAKRCNLGYRA RI+ L++G VEGRI L ++EE C    LS+Y +L  +L++IDGFGP
Sbjct  232   GFLAKRCNLGYRAGRIVKLSQGTVEGRINLSQLEEICDTQCLSSYADLTERLRQIDGFGP  291

Query  1024  FTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWS  1203
             FTCANVLMC+G+YH IPTDSETIRHLKQVH K+S+  T Q DVE IYG+YAPFQFL YW+
Sbjct  292   FTCANVLMCMGFYHAIPTDSETIRHLKQVHGKNSTIQTAQSDVEDIYGQYAPFQFLAYWA  351

Query  1204  EIWHFYEEWFGKLSEMPQSGYNRITASNMRPKRNAKSKRIKTSA  1335
             E+W+FY E FG LS MP S Y  ITA+NM+ K +   KR K S+
Sbjct  352   ELWNFYGERFGNLSAMPLSNYKLITATNMKEKGSRGKKRTKRSS  395



>ref|XP_010065201.1| PREDICTED: uncharacterized protein LOC104452431 [Eucalyptus grandis]
Length=499

 Score =   293 bits (750),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 166/342 (49%), Positives = 207/342 (61%), Gaps = 26/342 (8%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSS-----DKKFSLSVE---SDHFIPKTPAAKEKWKKAGVHK  531
             WSRTLSMA+ALCELQLEL  +     DK    ++    + H  P TPA KE  +K G  K
Sbjct  162   WSRTLSMAQALCELQLELQRNSSCMEDKDGIRNINKGVASHLAPTTPAPKEAKRKRGGCK  221

Query  532   CSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKF--KGLsskdissdkkedFLLGCDI  705
                NL  +  +    T E  V T+   E V         G+      +        GC +
Sbjct  222   TRTNLMTKFTD---VTPEAEVATSTRMETVTLGIGIHENGIHENGQLTSGLSSS-DGCSL  277

Query  706   S-QTPSNLCSDNPC-SSSDLHSAEAVELNAL----------NGVGNFPSPRELAELNESF  849
                  S L SD  C +S ++H   A +   +          + VGNFPSPRELA L+E F
Sbjct  278   HCDRQSRLASDETCETSEEVHERGACQEPIVQIAHEEECWWDVVGNFPSPRELASLDEGF  337

Query  850   LAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFT  1029
             LAKRCNLGYRA RI+ L++G VEGRI L ++EE C    LS+Y +L  +L++IDGFGPFT
Sbjct  338   LAKRCNLGYRAGRIVKLSQGTVEGRINLSQLEEICDTQCLSSYADLTERLRQIDGFGPFT  397

Query  1030  CANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEI  1209
             CANVLMC+G+YH IPTDSETIRHLKQVH K+S+  T Q DVE IYG+YAPFQFL YW+E+
Sbjct  398   CANVLMCMGFYHAIPTDSETIRHLKQVHGKNSTIQTAQSDVEDIYGQYAPFQFLAYWAEL  457

Query  1210  WHFYEEWFGKLSEMPQSGYNRITASNMRPKRNAKSKRIKTSA  1335
             W+FY E FG LS MP S Y  ITA+NM+ K +   KR K S+
Sbjct  458   WNFYGERFGNLSAMPLSNYKLITATNMKEKGSRGKKRTKRSS  499


 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +3

Query  105  VELPLGDASS-TFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRL-SDDHHCADHEISVT  278
            VE+ LG+A++ TF LEKAVCSHGLFMM+PN WDPL+ +L RPLRL SDD       + V 
Sbjct  9    VEVGLGEAAAATFRLEKAVCSHGLFMMSPNRWDPLSLSLSRPLRLPSDDGDDDAAPVPVA  68

Query  279  VRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
            VR+SHP  S  SLRL V G   LS  QH+SL+
Sbjct  69   VRISHPPRSA-SLRLLVRGVSALSPSQHRSLL  99



>ref|XP_010104208.1| hypothetical protein L484_002408 [Morus notabilis]
 gb|EXC47697.1| hypothetical protein L484_002408 [Morus notabilis]
Length=472

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/319 (49%), Positives = 208/319 (65%), Gaps = 16/319 (5%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKEKWKKAGVHKCSKNLSAR  555
             W RTLSMA+ALC+LQ EL       S+  ++  F+PKTPA KE  +K    K S  L+++
Sbjct  153   WPRTLSMAQALCDLQRELQLQ----SVPSKTVDFVPKTPAGKEPKRKVEKLKASTCLTSQ  208

Query  556   LAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPSNLCSD  735
               +AQ+    ++     S +I    P  + LS   + S   E+           ++LC  
Sbjct  209   F-DAQSNEGLESHSNDLSIDISQPTPSAQNLSPSSLLSVPMENVTCEESYGVDSASLC--  265

Query  736   NPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVV  915
             NP         + +      G G+FP+P ELA+L+E FLAKRC LGYRA RI+ LARG+V
Sbjct  266   NP---------QILRDREFEGTGDFPTPTELAKLDEKFLAKRCKLGYRAGRILKLARGIV  316

Query  916   EGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIR  1095
             EGRI L+E+EE C + +L +Y +LA QL++IDGFGPFTCANVLMC+G+YHVIP+DSETIR
Sbjct  317   EGRIQLRELEETCMERSLCSYSKLAVQLRQIDGFGPFTCANVLMCMGFYHVIPSDSETIR  376

Query  1096  HLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRI  1275
             HL+QVH ++S+  T+++DV+ IY KY PFQFL YWSE+WHFYE+ FGK+SEMP S Y   
Sbjct  377   HLQQVHGRNSTVRTIERDVQQIYAKYEPFQFLAYWSELWHFYEKKFGKISEMPCSAYKLF  436

Query  1276  TASNMRPKRNAKSKRIKTS  1332
             TASNM+ K    + R KT+
Sbjct  437   TASNMKTKAERPNNRKKTA  455


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 65/98 (66%), Gaps = 5/98 (5%)
 Frame = +3

Query  99   VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHH----CADHE  266
            V +ELPLGDA++TF LE AVCSHGLFMMAPN WDPL+KTL RPLRL+  HH        +
Sbjct  3    VSLELPLGDAAATFRLETAVCSHGLFMMAPNQWDPLSKTLLRPLRLTLHHHHWNPQQQQD  62

Query  267  ISVTVRVSHPSDSPQSLRLHV-FGTDCLSAQQHQSLMV  377
             SV  R+S P D    LR+ V  GT  L++   Q+L+ 
Sbjct  63   DSVMARISQPHDRLHCLRVLVHAGTRSLTSDNKQALLA  100



>gb|EYU33314.1| hypothetical protein MIMGU_mgv1a019757mg, partial [Erythranthe 
guttata]
Length=338

 Score =   279 bits (714),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 149/184 (81%), Gaps = 3/184 (2%)
 Frame = +1

Query  784   NALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQ-  960
             N    + NFPSP ELA L   FLAKRCNLGYRA+R+INLARGV+EG + L EIE  C   
Sbjct  155   NCHTTIANFPSPSELANLEVEFLAKRCNLGYRASRVINLARGVIEGSVKLTEIEFACEYD  214

Query  961   --PNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTL  1134
                NLS+YD+LA +L+ IDGFGPFTCANVLMC+GYYHVIPTDSETIRHLKQVHAK+S+  
Sbjct  215   TVSNLSDYDKLAEKLRVIDGFGPFTCANVLMCIGYYHVIPTDSETIRHLKQVHAKTSTKK  274

Query  1135  TVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNMRPKRNAKS  1314
             T+++D+E IYGKYAPFQFL YWSE+W FYEEWFG LSEMP+S Y  ITA+NMRPK+ + S
Sbjct  275   TIERDLEDIYGKYAPFQFLAYWSEVWRFYEEWFGNLSEMPRSSYKLITAANMRPKKASGS  334

Query  1315  KRIK  1326
             KR K
Sbjct  335   KRTK  338


 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = +3

Query  84   ARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH  263
            A  G V+VELPLGDA+  FNLEKAVCSHGLFMMAPN WDP +KTL+RPLRL+        
Sbjct  9    AAHGGVLVELPLGDAAPDFNLEKAVCSHGLFMMAPNQWDPHSKTLKRPLRLN---LAGGE  65

Query  264  EISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
              S+ V VSHP+ S  +L L VFGT  LS QQ QSL+
Sbjct  66   TFSLMVHVSHPTHSSHALHLRVFGTRALSPQQQQSLL  102



>ref|XP_007023217.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY25839.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=426

 Score =   278 bits (710),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 161/197 (82%), Gaps = 3/197 (2%)
 Frame = +1

Query  745   SSSDLH-SAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEG  921
             S SDL  S E  E +A  G+G+FPSP ELA L+ESFLAKRCNLGYRA+RI+ LA+G+V+G
Sbjct  229   SKSDLQPSQELDEPHAYKGMGSFPSPEELANLDESFLAKRCNLGYRASRILKLAKGIVQG  288

Query  922   RIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHL  1101
              I L ++EE C++ +LS+Y++LA QL++IDGFGPFTCANVLMC+G+YHVIP DSETIRHL
Sbjct  289   IIQLMQLEEGCKEISLSSYNKLAEQLRQIDGFGPFTCANVLMCMGFYHVIPADSETIRHL  348

Query  1102  KQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITA  1281
             KQVH+KSS+  TV +DVE IY KYAPFQFL YW+E+WH+YE+ FGKLSEMP  GY  ITA
Sbjct  349   KQVHSKSSTMQTVGRDVEGIYAKYAPFQFLAYWAELWHYYEQRFGKLSEMPFCGYKLITA  408

Query  1282  SNMRPKRNAKSKRIKTS  1332
             SNM+ K  A SKR K S
Sbjct  409   SNMKMK--ATSKRTKVS  423


 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 10/97 (10%)
 Frame = +3

Query  99   VVVELPLGDASST-----FNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH  263
            V++ELP+G+A++      FNLEKAVCSHGLFMMAPN WDP++++L RPLRL D H     
Sbjct  32   VLIELPVGEAAAAEGAGPFNLEKAVCSHGLFMMAPNQWDPISRSLSRPLRLLDHH---SP  88

Query  264  EISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
             ++V VR+S P+ S  +L L V+GT CLS Q   SL+
Sbjct  89   PLTVQVRISQPTAS--TLHLRVYGTRCLSPQHRHSLL  123



>ref|XP_010252239.1| PREDICTED: uncharacterized protein LOC104593879 [Nelumbo nucifera]
Length=493

 Score =   278 bits (712),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 164/334 (49%), Positives = 207/334 (62%), Gaps = 33/334 (10%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLEL------------SSSDKKFSLSVESDHFIPKTPAAKEKWKKA  519
             W RTL+MAKAL ELQ +L            SS D + S +   D F PKTP  ++  K+ 
Sbjct  168   WPRTLAMAKALFELQSDLKCNSLGCSDSQGSSLDSRCSKAKYED-FFPKTPIGRDSKKRR  226

Query  520   GVHKCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGC  699
              VHK S NL ++  +A+   E D    T S     C      L  K+  S      L G 
Sbjct  227   AVHKISLNLDSKFKKAENELEADVYGKTNSDHPTQC------LQLKEKISATLASPLEG-  279

Query  700   DISQTP----SNLCSD-----NPCSSSDLHSAEAVELNALNG-VGNFPSPRELAELNESF  849
             D SQ        LC+      NP  + DL  +E  +++  NG +GNFP+PRE+A LNE+ 
Sbjct  280   DESQEHCCYNKQLCTKVKVDANP--ALDLQFSED-KVSGTNGKIGNFPNPREIAGLNEAL  336

Query  850   LAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFT  1029
             LAKRCNLGYRA+RI+ LA+ +V+G++ L+E+EE C   + S Y  L  + +EIDGFGPFT
Sbjct  337   LAKRCNLGYRASRILKLAQSIVQGKLQLRELEEDCNGESSSLYAMLFNKFREIDGFGPFT  396

Query  1030  CANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEI  1209
             CANVLMC+G+Y +IP DSETIRHLKQVHA+ S+  +V +DVE IYG YAPFQFL YWSE+
Sbjct  397   CANVLMCMGFYEMIPVDSETIRHLKQVHARQSTIQSVHRDVEKIYGGYAPFQFLAYWSEL  456

Query  1210  WHFYEEWFGKLSEMPQSGYNRITASNMRPKRNAK  1311
             WHFY   FGKLSEM  S Y+ ITASNMR KR  K
Sbjct  457   WHFYGARFGKLSEMLPSEYHLITASNMRTKRTNK  490


 Score = 99.0 bits (245),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 64/92 (70%), Gaps = 7/92 (8%)
 Frame = +3

Query  102  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTV  281
            ++ LPLG++ STF+LE AVCSHGLFMMAPN WDP TKT +RPLRLSD+        S+ V
Sbjct  29   LLTLPLGESVSTFSLENAVCSHGLFMMAPNQWDPSTKTFQRPLRLSDE------TTSILV  82

Query  282  RVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMV  377
            R+SHP +SP SL + V GT  LS    + L+ 
Sbjct  83   RISHPPNSP-SLHVRVLGTAFLSPDDQRVLLA  113



>ref|XP_010533227.1| PREDICTED: uncharacterized protein LOC104809040 isoform X1 [Tarenaya 
hassleriana]
Length=214

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = +1

Query  769   EAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEE  948
             E +E +    +GNFP P+ELA L E FLA+RCNLGYRA+RI+ L+RG++EG I L+E+E+
Sbjct  27    EVLEDHCCTQLGNFPGPKELAFLEEDFLARRCNLGYRASRILKLSRGIIEGEIQLRELEK  86

Query  949   CCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSS  1128
              C +PNLS YD L  QL+ +DGFGPFTCANVLMC G+YHVIP DSETIRHLKQVHAK+SS
Sbjct  87    ACVEPNLSTYDSLLEQLRRLDGFGPFTCANVLMCAGFYHVIPADSETIRHLKQVHAKASS  146

Query  1129  TLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNMRPKRNA  1308
               TV   V+A+YGKY PFQFL YW+E+WH Y + FGKLSEMP++ Y  ITASNM+ +   
Sbjct  147   IQTVTDVVQAVYGKYHPFQFLAYWAEVWHIYGQRFGKLSEMPRTDYRLITASNMKSEDPR  206

Query  1309  KSKRIKTS  1332
             + K+IK+S
Sbjct  207   RKKKIKSS  214



>ref|XP_007147543.1| hypothetical protein PHAVU_006G133500g [Phaseolus vulgaris]
 gb|ESW19537.1| hypothetical protein PHAVU_006G133500g [Phaseolus vulgaris]
Length=474

 Score =   271 bits (693),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 197/328 (60%), Gaps = 43/328 (13%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSS-----DKKFSLSVESDHFIPKTPAAKEKWKKA----GVH  528
             W RTLSMA+ALCELQ  L +      +   +  VE++ F+PKTPA+KE  +K     GV 
Sbjct  177   WPRTLSMAQALCELQSGLQNGLPCAVEGSGNPKVEAEEFVPKTPASKENRRKKAPTKGVL  236

Query  529   KCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDIS  708
                K       E     + D++  + S                          LLG D+ 
Sbjct  237   LKKKLELELEMEVDGNLQMDHMFASSSDTT-----------------------LLG-DLE  272

Query  709   QTPSNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAAR  888
                  L SD+ C           E    +  GNFPSP ELA L+ESFLAKRC LGYRA  
Sbjct  273   V----LRSDDSCCQF------PNEGEYFDHTGNFPSPIELANLSESFLAKRCKLGYRAGY  322

Query  889   IINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHV  1068
             I+ LA+G+VEG+I L+++EE  +  +LS Y +L  QLK I GFGPFT ANVLMCLGYYHV
Sbjct  323   ILELAQGIVEGKIQLEQLEELSKDASLSCYKQLGDQLKPIKGFGPFTRANVLMCLGYYHV  382

Query  1069  IPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSE  1248
             IP DSET+RHLKQVH+K++S+ T+++D+E IYGKY P+QFL +WSEIW FYE  FGK++E
Sbjct  383   IPWDSETVRHLKQVHSKNTSSKTIERDLEEIYGKYEPYQFLAFWSEIWDFYETRFGKMNE  442

Query  1249  MPQSGYNRITASNMRPKRNAKSKRIKTS  1332
             M  S Y RITASNMR  R A +KR + S
Sbjct  443   MHSSEYKRITASNMRSTRKATNKRKRPS  470


 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 2/41 (5%)
 Frame = +3

Query  105  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERP  227
            +ELP    +  F L++AVCSHG FMMAPNHWDPL+KTL RP
Sbjct  37   MELP--SETEPFQLDQAVCSHGFFMMAPNHWDPLSKTLTRP  75



>ref|XP_010682181.1| PREDICTED: uncharacterized protein LOC104897071 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=481

 Score =   261 bits (666),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 148/343 (43%), Positives = 200/343 (58%), Gaps = 53/343 (15%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSV-----------ESDHFIPKTPAAKEKWKKAG  522
             W RTLSMAKALC+LQLEL       S++V           + + F P TPA KE  +K  
Sbjct  166   WPRTLSMAKALCDLQLELQCHSSIESVNVLGVTTSEVATNKPESFTPGTPAVKESDRKRK  225

Query  523   VHK------------CSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdis  666
             + +            C  +L+AR+  A        V+  G    +    KF    S    
Sbjct  226   MQEVVSRENAEVVDGCKADLNARMNSA--------VIVNG----IQLKKKFTTFVS----  269

Query  667   sdkkedFLLGCDISQTPSNLCSDNPC--SSSDLHSAEAVELNALNGVGNFPSPRELAELN  840
                         IS    N  + + C   SS   S E + + +   +GNFPSP E+A L+
Sbjct  270   -----------SISDENVNEPNASQCFNESSRAVSEERI-IYSTQKMGNFPSPIEIASLD  317

Query  841   ESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFG  1020
             E +LAKRC LGYR ARI+ LA+GV+EGRI L ++EE C + +LSNY+++  +LK+I+G+G
Sbjct  318   EKYLAKRCGLGYRGARILKLAQGVIEGRIQLDQLEELCLEASLSNYNKVDEKLKQIEGYG  377

Query  1021  PFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYW  1200
             PFT  NVLMCLG+Y+V+P+DSETIRHLKQVH K+++   VQ+ VE +Y +Y P+QFL YW
Sbjct  378   PFTRGNVLMCLGFYNVVPSDSETIRHLKQVHGKTTTIQKVQQVVEEMYRRYEPYQFLAYW  437

Query  1201  SEIWHFYEEWFGKLSEMPQSGYNRITASNMRPKRNAKSKRIKT  1329
              E+W FYEE FGK SEMP S Y  +TASNMR K+   + R  +
Sbjct  438   WELWSFYEERFGKFSEMPSSDYKLVTASNMRTKKTNATVRFTS  480


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  111  LPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTK  212
            +PL + +STFN E A+CSHGLF+MAPN WDP TK
Sbjct  28   IPLQNPTSTFNFETAICSHGLFLMAPNEWDPHTK  61



>ref|XP_010682180.1| PREDICTED: uncharacterized protein LOC104897071 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=523

 Score =   259 bits (661),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 144/332 (43%), Positives = 199/332 (60%), Gaps = 49/332 (15%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSV-----------ESDHFIPKTPAAKEKWKKAG  522
             W RTLSMAKALC+LQLEL       S++V           + + F P TPA KE  +K  
Sbjct  166   WPRTLSMAKALCDLQLELQCHSSIESVNVLGVTTSEVATNKPESFTPGTPAVKESDRKRK  225

Query  523   VHK------------CSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdis  666
             + +            C  +L+AR+  A        V+  G    +    KF    S    
Sbjct  226   MQEVVSRENAEVVDGCKADLNARMNSA--------VIVNG----IQLKKKFTTFVSSISD  273

Query  667   sdkkedFLLGCDISQTPSNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNES  846
                        ++++  ++ C +    SS   S E + + +   +GNFPSP E+A L+E 
Sbjct  274   E----------NVNEPNASQCFNE---SSRAVSEERI-IYSTQKMGNFPSPIEIASLDEK  319

Query  847   FLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPF  1026
             +LAKRC LGYR ARI+ LA+GV+EGRI L ++EE C + +LSNY+++  +LK+I+G+GPF
Sbjct  320   YLAKRCGLGYRGARILKLAQGVIEGRIQLDQLEELCLEASLSNYNKVDEKLKQIEGYGPF  379

Query  1027  TCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSE  1206
             T  NVLMCLG+Y+V+P+DSETIRHLKQVH K+++   VQ+ VE +Y +Y P+QFL YW E
Sbjct  380   TRGNVLMCLGFYNVVPSDSETIRHLKQVHGKTTTIQKVQQVVEEMYRRYEPYQFLAYWWE  439

Query  1207  IWHFYEEWFGKLSEMPQSGYNRITASNMRPKR  1302
             +W FYEE FGK SEMP S Y  +TASNMR K+
Sbjct  440   LWSFYEERFGKFSEMPSSDYKLVTASNMRTKK  471


 Score = 58.9 bits (141),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  111  LPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTK  212
            +PL + +STFN E A+CSHGLF+MAPN WDP TK
Sbjct  28   IPLQNPTSTFNFETAICSHGLFLMAPNEWDPHTK  61



>ref|XP_010682182.1| PREDICTED: uncharacterized protein LOC104897071 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=352

 Score =   249 bits (635),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 139/326 (43%), Positives = 194/326 (60%), Gaps = 49/326 (15%)
 Frame = +1

Query  394   MAKALCELQLELSSSDKKFSLSV-----------ESDHFIPKTPAAKEKWKKAGVHK---  531
             MAKALC+LQLEL       S++V           + + F P TPA KE  +K  + +   
Sbjct  1     MAKALCDLQLELQCHSSIESVNVLGVTTSEVATNKPESFTPGTPAVKESDRKRKMQEVVS  60

Query  532   ---------CSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkked  684
                      C  +L+AR+  A        V+  G    +    KF    S          
Sbjct  61    RENAEVVDGCKADLNARMNSA--------VIVNG----IQLKKKFTTFVSSISDE-----  103

Query  685   FLLGCDISQTPSNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRC  864
                  ++++  ++ C +    SS   S E + + +   +GNFPSP E+A L+E +LAKRC
Sbjct  104   -----NVNEPNASQCFN---ESSRAVSEERI-IYSTQKMGNFPSPIEIASLDEKYLAKRC  154

Query  865   NLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVL  1044
              LGYR ARI+ LA+GV+EGRI L ++EE C + +LSNY+++  +LK+I+G+GPFT  NVL
Sbjct  155   GLGYRGARILKLAQGVIEGRIQLDQLEELCLEASLSNYNKVDEKLKQIEGYGPFTRGNVL  214

Query  1045  MCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYE  1224
             MCLG+Y+V+P+DSETIRHLKQVH K+++   VQ+ VE +Y +Y P+QFL YW E+W FYE
Sbjct  215   MCLGFYNVVPSDSETIRHLKQVHGKTTTIQKVQQVVEEMYRRYEPYQFLAYWWELWSFYE  274

Query  1225  EWFGKLSEMPQSGYNRITASNMRPKR  1302
             E FGK SEMP S Y  +TASNMR K+
Sbjct  275   ERFGKFSEMPSSDYKLVTASNMRTKK  300



>gb|KDO53850.1| hypothetical protein CISIN_1g014334mg [Citrus sinensis]
Length=381

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/276 (49%), Positives = 182/276 (66%), Gaps = 34/276 (12%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKEKWKKAGVHKCSKNLSAR  555
             W RTLSMA+ALCELQ EL    +  S S+  D FIP+TPA KE  ++  V K +  L++R
Sbjct  138   WPRTLSMARALCELQWEL----QHCSPSISED-FIPQTPAGKESKRRQKVSKVASKLTSR  192

Query  556   LAEAQATTEEDNVLTTGSAEIV--DCPPKFKGLsskdissdkkedFLLGCDISQTPSNLC  729
             +AE++A++E+   L    A ++  +  P F                      +   S+L 
Sbjct  193   IAESKASSEDYMNLKLDCAGVLEENVQPSFPQ--------------------NDIESDLH  232

Query  730   SDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARG  909
               N  S++D  SA        + +GNFPSPRELA L+ESFLAKRCNLGYRA RI+ LARG
Sbjct  233   GLNELSTTDPPSAR-------DRIGNFPSPRELANLDESFLAKRCNLGYRAGRILKLARG  285

Query  910   VVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSET  1089
             +V+G+I L+E+E+ C + +L+ Y +LA QL +I+GFGPFT  NVL+C+G+YHVIPTDSET
Sbjct  286   IVDGQIQLRELEDMCNEASLTAYVKLAEQLSQINGFGPFTRNNVLVCIGFYHVIPTDSET  345

Query  1090  IRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVY  1197
             IRHLKQVHA++ ++ TVQ   E+IYGKYAPFQFL Y
Sbjct  346   IRHLKQVHARNCTSKTVQMIAESIYGKYAPFQFLAY  381



>ref|XP_011009425.1| PREDICTED: uncharacterized protein LOC105114550 isoform X3 [Populus 
euphratica]
 ref|XP_011009426.1| PREDICTED: uncharacterized protein LOC105114550 isoform X3 [Populus 
euphratica]
Length=470

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/292 (49%), Positives = 176/292 (60%), Gaps = 34/292 (12%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELS------------SSDKKFSLSVESDHFIPKTPAAKEKWKKA  519
             W RTLSMA+ALCELQ EL             ++  K   +  + +FIP T A KE  +  
Sbjct  169   WPRTLSMARALCELQCELQCKSSGVFVAQAVNATVKNKCNDTAHNFIPNTSAGKESKRNI  228

Query  520   GVHKCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGC  699
                K SKNL++++ E     E D  L T SA I        G  + +   +      + C
Sbjct  229   RESKVSKNLASKIVETGTLLEADANLKTDSAHI--------GRETLESVENDSCARCISC  280

Query  700   DISQTPSNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYR  879
               S +         C+   L S   ++      + NFPSPRELA L+ESFLAKRCNLGYR
Sbjct  281   HGSDS---------CAPDSLQSQHGIQPGVNKMICNFPSPRELANLDESFLAKRCNLGYR  331

Query  880   AARIINLARGVVEGRIPLKEIEE-CCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLG  1056
             A RII LA+ +VEGRIPL+EIEE C    + S Y++LA Q ++IDGFGPFTCANVLMCLG
Sbjct  332   AIRIIKLAQSIVEGRIPLREIEEGCANGASSSCYNKLADQFRQIDGFGPFTCANVLMCLG  391

Query  1057  YYHVIPTDSETIRHLK----QVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYW  1200
             +YH+IPTDSET+RHLK    QVHAK S+  TVQ+DVE IYG YAPFQFL YW
Sbjct  392   FYHIIPTDSETVRHLKQLSIQVHAKKSTIQTVQRDVEEIYGNYAPFQFLAYW  443


 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = +3

Query  99   VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLS---DDHHCADHEI  269
            VV+E+PLGDA+ TFNLEKAVCSHGLFMM+PN WDPL+ T  RPLRLS    D   +    
Sbjct  15   VVLEIPLGDAADTFNLEKAVCSHGLFMMSPNLWDPLSLTFSRPLRLSLSDSDPQVSTPTT  74

Query  270  SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
            S+ V +SHP   P+SL + V+GT  LS +  +SL+
Sbjct  75   SLFVSISHPPHLPRSLSVRVYGTRFLSPKHQESLV  109



>ref|XP_006470787.1| PREDICTED: uncharacterized protein LOC102629917 isoform X2 [Citrus 
sinensis]
Length=409

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/276 (49%), Positives = 182/276 (66%), Gaps = 34/276 (12%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKEKWKKAGVHKCSKNLSAR  555
             W RTLSMA+ALCELQ EL    +  S S+  D FIP+TPA KE  ++  V K +  L++R
Sbjct  166   WPRTLSMARALCELQWEL----QHCSPSISED-FIPQTPAGKESKRRQKVSKVASKLTSR  220

Query  556   LAEAQATTEEDNVLTTGSAEIVD--CPPKFKGLsskdissdkkedFLLGCDISQTPSNLC  729
             +AE++A++E+   L    A +++    P F                      +   S+L 
Sbjct  221   IAESKASSEDYMNLKLDCAGVLEENVQPSFPQ--------------------NDIESDLH  260

Query  730   SDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARG  909
               N  S++D  SA        + +GNFPSPRELA L+ESFLAKRCNLGYRA RI+ LARG
Sbjct  261   GLNELSTTDPPSAR-------DRIGNFPSPRELANLDESFLAKRCNLGYRAGRILKLARG  313

Query  910   VVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSET  1089
             +V+G+I L+E+E+ C + +L+ Y +LA QL +I+GFGPFT  NVL+C+G+YHVIPTDSET
Sbjct  314   IVDGQIQLRELEDMCNEASLTAYVKLAEQLSQINGFGPFTRNNVLVCIGFYHVIPTDSET  373

Query  1090  IRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVY  1197
             IRHLKQVHA++ ++ TVQ   E+IYGKYAPFQFL Y
Sbjct  374   IRHLKQVHARNCTSKTVQMIAESIYGKYAPFQFLAY  409


 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = +3

Query  102  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH-EISVT  278
            +++LPL +   TFNLE AVCSHGLFMM+PN WDPL+++L RPL LS+     D   +SV 
Sbjct  7    LLKLPLAE---TFNLETAVCSHGLFMMSPNRWDPLSRSLSRPLHLSNSLDNTDIPSVSVD  63

Query  279  VRVSHPSDSPQSLRLHVFGTD-----CLSAQQHQSLMV  377
            V +  P   P SLR+ V  +       LS +Q  +L+ 
Sbjct  64   VTICQPQQDPHSLRIEVRNSASGSAPSLSQEQQDALLA  101



>ref|XP_007023218.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY25840.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=421

 Score =   240 bits (613),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 137/276 (50%), Positives = 168/276 (61%), Gaps = 60/276 (22%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFS-LSVESDHFIPKTPAAKEKWKKAGVHKCSKNLSA  552
             +SRTLSMAKALCELQ E   + + FS +    D FIPKTPA  E  +K  V K    +S 
Sbjct  204   FSRTLSMAKALCELQFE---TQRPFSGVRAAEDDFIPKTPAGNELKRKLRVSK----VSM  256

Query  553   RLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPSNLCS  732
             RL    A    D+                                               
Sbjct  257   RLEGKFAEPRADH-----------------------------------------------  269

Query  733   DNPCSSSDLH-SAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARG  909
                 S SDL  S E  E +A  G+G+FPSP ELA L+ESFLAKRCNLGYRA+RI+ LA+G
Sbjct  270   ----SKSDLQPSQELDEPHAYKGMGSFPSPEELANLDESFLAKRCNLGYRASRILKLAKG  325

Query  910   VVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSET  1089
             +V+G I L ++EE C++ +LS+Y++LA QL++IDGFGPFTCANVLMC+G+YHVIP DSET
Sbjct  326   IVQGIIQLMQLEEGCKEISLSSYNKLAEQLRQIDGFGPFTCANVLMCMGFYHVIPADSET  385

Query  1090  IRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVY  1197
             IRHLKQVH+KSS+  TV +DVE IY KYAPFQFL Y
Sbjct  386   IRHLKQVHSKSSTMQTVGRDVEGIYAKYAPFQFLAY  421


 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 10/97 (10%)
 Frame = +3

Query  99   VVVELPLGDASST-----FNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH  263
            V++ELP+G+A++      FNLEKAVCSHGLFMMAPN WDP++++L RPLRL D H     
Sbjct  47   VLIELPVGEAAAAEGAGPFNLEKAVCSHGLFMMAPNQWDPISRSLSRPLRLLDHH---SP  103

Query  264  EISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
             ++V VR+S P+ S  +L L V+GT CLS Q   SL+
Sbjct  104  PLTVQVRISQPTAS--TLHLRVYGTRCLSPQHRHSLL  138



>ref|XP_003534756.2| PREDICTED: uncharacterized protein LOC100781827 [Glycine max]
Length=443

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = +1

Query  799   VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNY  978
              GNFPSP ELA L+ESFLAKRC LGYRA  II LAR +VEG+I L ++EE  +  +LSNY
Sbjct  264   TGNFPSPSELANLDESFLAKRCGLGYRAGYIIELARAIVEGKIQLGQLEELSKDASLSNY  323

Query  979   DELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEA  1158
              +L  QLK+I G+GPFT ANVLMCLGYYHVIPTDSET+RHLKQVH++ +++ T+++++E 
Sbjct  324   KQLDDQLKQIRGYGPFTRANVLMCLGYYHVIPTDSETVRHLKQVHSRYTTSKTIERELEE  383

Query  1159  IYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNMRPKRNAKSK  1317
             IYGKY P+QFL +WSE+W FYE  FGKL+EM  S Y  ITA NMR   N + +
Sbjct  384   IYGKYEPYQFLAFWSEVWDFYETRFGKLNEMHSSDYKLITACNMRSTTNKRKR  436


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 50/86 (58%), Gaps = 16/86 (19%)
 Frame = +3

Query  105  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  284
            +ELP     S F LE+AVCSHGLFMM PNHWDPL+KTL RPLR S          S  V 
Sbjct  18   MELP-----SPFQLEQAVCSHGLFMMPPNHWDPLSKTLIRPLRSSPS--------SFLVS  64

Query  285  VSHPSDSPQSLRLHVFGTDCLSAQQH  362
            +S  S   QSL + V  T  LS QQ 
Sbjct  65   LSQHS---QSLAVRVHATHALSPQQQ  87



>gb|KHN40743.1| hypothetical protein glysoja_015110 [Glycine soja]
Length=443

 Score =   238 bits (608),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 134/173 (77%), Gaps = 0/173 (0%)
 Frame = +1

Query  799   VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNY  978
              GNFPSP ELA L+ESFLAKRC LGYRA  II LAR +VEG+I L ++EE  +   LSNY
Sbjct  264   TGNFPSPSELANLDESFLAKRCGLGYRAGYIIELARAIVEGKIQLGQLEELSKDACLSNY  323

Query  979   DELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEA  1158
              +L  QLK+I G+GPFT ANVLMCLGYYHVIPTDSET+RHLKQVH++ +++ T+++++E 
Sbjct  324   KQLDDQLKQIRGYGPFTRANVLMCLGYYHVIPTDSETVRHLKQVHSRYTTSKTIERELEE  383

Query  1159  IYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNMRPKRNAKSK  1317
             IYGKY P+QFL +WSEIW FYE  FGKL+EM  S Y  ITA NMR   N + +
Sbjct  384   IYGKYEPYQFLAFWSEIWDFYETRFGKLNEMHSSDYKLITACNMRSTTNKRKR  436


 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 52/91 (57%), Gaps = 16/91 (18%)
 Frame = +3

Query  105  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  284
            +ELP     S F LE+AVCSHGLFMM PNHWDPL+KTL RPLR S          S  V 
Sbjct  18   MELP-----SPFQLEQAVCSHGLFMMPPNHWDPLSKTLIRPLRSSPS--------SFLVS  64

Query  285  VSHPSDSPQSLRLHVFGTDCLSAQQHQSLMV  377
            +S  S   QSL + V  T  LS QQ   +M 
Sbjct  65   LSQHS---QSLAVRVHATHALSPQQQNHIMA  92



>ref|XP_010926998.1| PREDICTED: uncharacterized protein LOC105049133 [Elaeis guineensis]
Length=459

 Score =   229 bits (584),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 191/321 (60%), Gaps = 48/321 (15%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKE-KWKKAGVHKCSKNLSA  552
             W RTLSMA++LCELQLEL        L    + F PKTP AKE K +K    K    L  
Sbjct  157   WPRTLSMARSLCELQLELK-------LRTSHEDFHPKTPEAKELKRRKGKKKKIMVKLET  209

Query  553   RLAEAQATTEEDNVLTTGSAEI--VDCPPKFKGLsskdissdkkedFLLGCDISQTP---  717
             +L E +A + E      G++EI   + P   +G  +                 S TP   
Sbjct  210   KLIEDKAESAEG-----GNSEINHDNQPNNSQGKETP----------------SSTPLCM  248

Query  718   ---SNLCSDNPCSSSDLHSAEAVELNALNG--------VGNFPSPRELAELNESFLAKRC  864
                SNLC +    +S+  S  +  L+ L+G        +G+FPSP +LA L+  +LA RC
Sbjct  249   EEISNLCMEE---TSNKLSTVSTPLHDLSGDTSCPSKQIGDFPSPEDLAMLDVDYLAMRC  305

Query  865   NLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVL  1044
              LGYRA RI++LA+ +VE ++ L+++EE C    LS+Y E+ ++L  I GFGPFTCANVL
Sbjct  306   KLGYRAQRIVSLAQNIVECKLQLRKLEEACGGFTLSSYAEVDKELSGICGFGPFTCANVL  365

Query  1045  MCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYE  1224
             MC+G+YH IP D+ETIRHLK+ HA +S+  +V++DVE+IY KYAPFQFL YW E+W  YE
Sbjct  366   MCMGFYHKIPADTETIRHLKKFHAINSTIHSVKRDVESIYRKYAPFQFLAYWFELWDDYE  425

Query  1225  EWFGKLSEMPQSGYNRITASN  1287
               FGK SEM  S Y  IT++N
Sbjct  426   NIFGKTSEMLPSDYGLITSTN  446


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 66/111 (59%), Gaps = 11/111 (10%)
 Frame = +3

Query  60   GETTISGDARR--GMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLR  233
             E    G A R  G+V ++LPL D    FNLE AVCSHGLFMMAPN WDP +K+L RPLR
Sbjct  3    AEEANGGQADRSTGVVHLQLPLNDPG--FNLETAVCSHGLFMMAPNRWDPASKSLHRPLR  60

Query  234  LSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQ-QHQSLMVVK  383
            L           S+ VR+SHPS S   L + VFG   LS+Q QH  L  V+
Sbjct  61   LPTSSS------SLPVRISHPSPSHPLLLVSVFGASSLSSQDQHAILAQVR  105



>gb|EEC82605.1| hypothetical protein OsI_27177 [Oryza sativa Indica Group]
Length=463

 Score =   228 bits (582),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 133/319 (42%), Positives = 178/319 (56%), Gaps = 43/319 (13%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKE-KWKKAGVHKCSKNLSA  552
             W+RTLSM+ ALCELQLEL SS         +++F  +TP  +E K K++        L  
Sbjct  169   WTRTLSMSTALCELQLELRSSSS-------TENFQSRTPPIRECKRKRSNKRNVRVKLET  221

Query  553   RLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPSNLCS  732
             +  E +    ED  L T +A +      F                         PS    
Sbjct  222   KFNEDKLVCLEDPNLATDTANLQTYENSF-----------------------NLPSAASG  258

Query  733   DNPCSSSDLHSAEAVELNAL---NGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLA  903
                 S   L  +E    N     +  G+FP+P ELA L+E FLAKRCNLGYRA RI+ LA
Sbjct  259   TGNTSEVSLDHSELKLRNEPCLEDCGGDFPTPEELANLDEDFLAKRCNLGYRARRIVMLA  318

Query  904   RGVVEGRIPLKEIEECCRQ--PNL-------SNYDELARQLKEIDGFGPFTCANVLMCLG  1056
             R +VEG+I L+++EE  +   P +       S YD L  +L  I GFGPFT ANVLMC+G
Sbjct  319   RSIVEGKICLQKLEEIRKMSVPTVEGLSTTPSTYDRLNEELSTISGFGPFTRANVLMCMG  378

Query  1057  YYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFG  1236
             ++H+IP D+ETIRHLKQ H ++S+  +VQK+++ IYGKYAPFQFL YW E+W FY + FG
Sbjct  379   FFHMIPADTETIRHLKQFHKRASTISSVQKELDNIYGKYAPFQFLAYWCELWGFYNKQFG  438

Query  1237  KLSEMPQSGYNRITASNMR  1293
             K+S+M    Y   TAS ++
Sbjct  439   KISDMEPINYRLFTASKLK  457


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 64/107 (60%), Gaps = 15/107 (14%)
 Frame = +3

Query  84   ARRGMVVVEL--PLGDA-----SSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSD  242
            ARR  V +EL  PLG A     ++ F+LE AVCSHGLFMMAPN WDP ++ L RPLRL+ 
Sbjct  12   ARRVAVELELELPLGGAPPYPGAAPFDLEAAVCSHGLFMMAPNRWDPASRALVRPLRLA-  70

Query  243  DHHCADHEISVTVRVS-HPSDSPQSLRLHVFGT--DCLSAQQHQSLM  374
                +D   SV VRVS HP+    +L + V G   D LS     S++
Sbjct  71   ----SDRAASVAVRVSRHPARPSDALLVSVLGAPGDALSPPDQTSIL  113



>ref|XP_010533228.1| PREDICTED: uncharacterized protein LOC104809040 isoform X2 [Tarenaya 
hassleriana]
Length=191

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 130/188 (69%), Gaps = 23/188 (12%)
 Frame = +1

Query  769   EAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEE  948
             E +E +    +GNFP P+ELA L E FLA+RCNLGYRA+RI+ L+RG++EG I L+E+E+
Sbjct  27    EVLEDHCCTQLGNFPGPKELAFLEEDFLARRCNLGYRASRILKLSRGIIEGEIQLRELEK  86

Query  949   CCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSS  1128
              C +PNLS YD L  QL+ +DGFGPFTCANVLMC G+YHVIP DSETIRHLKQVHAK+SS
Sbjct  87    ACVEPNLSTYDSLLEQLRRLDGFGPFTCANVLMCAGFYHVIPADSETIRHLKQVHAKASS  146

Query  1129  TLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNMRPKRNA  1308
               TV   V+A+YGKY PFQFL YW                        ITASNM+ +   
Sbjct  147   IQTVTDVVQAVYGKYHPFQFLAYWL-----------------------ITASNMKSEDPR  183

Query  1309  KSKRIKTS  1332
             + K+IK+S
Sbjct  184   RKKKIKSS  191



>ref|XP_004959865.1| PREDICTED: uncharacterized protein LOC101766322 [Setaria italica]
Length=461

 Score =   227 bits (578),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 194/320 (61%), Gaps = 34/320 (11%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKEKWKKAGVHKCSK-NLSA  552
             W+RTLSMA ALCE+QLEL     K S SVE   F  +TP  +E+ +K    +  +  L  
Sbjct  166   WTRTLSMATALCEIQLEL-----KCSSSVED--FQSRTPPIRERKRKRSKRQSVRIKLET  218

Query  553   RLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPSNLCS  732
             R AE +    E   + +G++  +  P   + LSS    + +       CD    PS    
Sbjct  219   RFAEDKL---EGPTIASGTSNDLTHPETNEYLSSLASVASETGS---ACD--SLPS---L  267

Query  733   DNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGV  912
             DN  S   L++A  +E    + +G+FP+P ELA L+E FLAKRCNLGYRA RI+ LARGV
Sbjct  268   DN--SELSLNNAPGLE----DCIGDFPTPEELANLDEGFLAKRCNLGYRAKRIVMLARGV  321

Query  913   VEGRIPLKEIEECCR---------QPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYH  1065
             VEG++ L+++EE CR             S  + L ++L  I GFGPFT ANVLMC+G+ H
Sbjct  322   VEGKVCLQKLEEMCRISVPAAEEVSTIESACERLNKELSAISGFGPFTRANVLMCMGFNH  381

Query  1066  VIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLS  1245
              IP D+ETIRHLKQVH ++S+  +V ++++ IYGKYAPFQFL YW E+W FY + FGK+ 
Sbjct  382   TIPADTETIRHLKQVHKRASTISSVHQELDKIYGKYAPFQFLAYWFELWGFYNKQFGKIC  441

Query  1246  EMPQSGYNRITASNMRPKRN  1305
             EM  S Y   TAS+++  +N
Sbjct  442   EMEPSNYRLFTASHLKKAKN  461


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 54/87 (62%), Gaps = 7/87 (8%)
 Frame = +3

Query  99   VVVELPLG-DASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISV  275
            V +ELPL    ++ F+L  AVCSHGLFMMAPN WDP  + L RPLRL+     +D   S+
Sbjct  22   VELELPLPPGGAAPFDLAAAVCSHGLFMMAPNRWDPAARALVRPLRLA-----SDRSASL  76

Query  276  TVRVS-HPSDSPQSLRLHVFGTDCLSA  353
              RVS HP+    +L + V G D LS+
Sbjct  77   LARVSAHPARPGTALLVAVEGADALSS  103



>dbj|BAC15471.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD31099.1| hypothetical protein [Oryza sativa Japonica Group]
Length=501

 Score =   227 bits (578),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 132/319 (41%), Positives = 179/319 (56%), Gaps = 47/319 (15%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKE-KWKKAGVHKCSKNLSA  552
             W+RTLSM+ ALCELQLEL SS         +++F  +TP  +E K K++        L  
Sbjct  212   WTRTLSMSTALCELQLELRSSSS-------TENFQSRTPPIRECKRKRSNKRNVRVKLET  264

Query  553   RLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPSNLCS  732
             +  E +    ED  L T +A                             ++   PS+   
Sbjct  265   KFNEDKMVCLEDPNLATNTANE---------------------------NLFSLPSSANE  297

Query  733   DNPCSSSDLHSAEA---VELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLA  903
                 S   L  +E     EL   +  G+FP+P ELA L+E FLAKRCNLGYRA RI+ LA
Sbjct  298   TGNTSEVSLDHSELKLRYELCLEDCGGDFPTPEELANLDEDFLAKRCNLGYRARRIVMLA  357

Query  904   RGVVEGRIPLKEIEECCRQ--PNL-------SNYDELARQLKEIDGFGPFTCANVLMCLG  1056
             R +VEG+I L+++EE  +   P +       S YD L  +L  I GFGPFT ANVLMC+G
Sbjct  358   RSIVEGKICLQKLEEIRKMSVPTVEGLSTTPSTYDRLNEELSTISGFGPFTRANVLMCMG  417

Query  1057  YYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFG  1236
             ++H+IP D+ETIRHLKQ H ++S+  +VQK+++ IYGKYAPFQFL YW E+W FY + FG
Sbjct  418   FFHMIPADTETIRHLKQFHKRASTISSVQKELDNIYGKYAPFQFLAYWCELWGFYNKQFG  477

Query  1237  KLSEMPQSGYNRITASNMR  1293
              +S+M    Y   TAS ++
Sbjct  478   IISDMEPINYRLFTASKLK  496


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 64/108 (59%), Gaps = 16/108 (15%)
 Frame = +3

Query  84   ARRGMVVVEL--PLGDA-----SSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSD  242
            ARR  V +EL  PLG A     ++ F+LE AVCSHGLFMMAPN WDP ++ L RPLRL+ 
Sbjct  12   ARRVAVELELELPLGGAPPYPGAAPFDLEAAVCSHGLFMMAPNRWDPASRALVRPLRLA-  70

Query  243  DHHCADHEISVTVRVS-HPSDSPQSLRLHVFGT---DCLSAQQHQSLM  374
                +D   SV VRVS HP+    +L + V G    D LS     S++
Sbjct  71   ----SDRAASVAVRVSRHPARPSDALLVSVLGAPDDDALSPLDQTSIL  114



>gb|EMT03969.1| hypothetical protein F775_22747 [Aegilops tauschii]
Length=333

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 184/335 (55%), Gaps = 56/335 (17%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKEKWKKAGVHKCSKNLSAR  555
             W+RTLSMA ALCELQLEL  S     L +       +TP  +E  +K      SKN + R
Sbjct  34    WTRTLSMATALCELQLELKCSAGTEDLQL-------RTPPIREHKRKR-----SKNQNVR  81

Query  556   ------------LAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGC  699
                         L + +  T +D  + TG+++++                          
Sbjct  82    VKLEKKFTELECLEDPRVETAQDTRVATGTSDVIT-----------------------HL  118

Query  700   DISQTPSNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYR  879
             +  +  ++L    P + S   S ++ EL+    +G+FP+P ELA L+E FLAKRC LGYR
Sbjct  119   EADEKLASLPQVAPETGSVCQSFDSSELSLEGCIGDFPTPEELANLDEDFLAKRCGLGYR  178

Query  880   AARIINLARGVVEGRIPLKEIEECCRQ--PNL-------SNYDELARQLKEIDGFGPFTC  1032
             A RI+ LAR +VEG++  + +EE  +   P         S Y+ L  +L  I GFGPFT 
Sbjct  179   AERIVLLARSIVEGKVCPQNLEEMQKMSLPATEELSTIPSTYERLNNELTTISGFGPFTR  238

Query  1033  ANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIW  1212
             ANVLMC+G++H+IP D+ETIRHLKQ H  +S+  +V  +++ IYG+YAPFQFL YW E+W
Sbjct  239   ANVLMCMGFFHMIPADTETIRHLKQCHEIASTIKSVHMELDKIYGEYAPFQFLAYWFELW  298

Query  1213  HFYEEWFGKLSEMPQSGYNRITASNMRPKRNAKSK  1317
              FY++ FGK++EM  S Y   TAS ++ +     K
Sbjct  299   GFYDKQFGKITEMDPSTYRLFTASALKKQHRLDRK  333



>ref|XP_006853038.1| hypothetical protein AMTR_s00038p00020700 [Amborella trichopoda]
 gb|ERN14505.1| hypothetical protein AMTR_s00038p00020700 [Amborella trichopoda]
Length=458

 Score =   223 bits (569),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 141/322 (44%), Positives = 180/322 (56%), Gaps = 26/322 (8%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLEL-------SSSDKKFSLSVESDHFIPKTPAAKE--KWKKAGVH  528
             W+RTLSMA+ALCELQLEL       S+ D  FS SV   +  P TP   E  K +K    
Sbjct  146   WTRTLSMARALCELQLELNGNSLRQSNKDTDFSKSV---NLSPVTPMQLEHKKRRKNPNQ  202

Query  529   KCSKNLSARLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDIS  708
                 NL  + +E +     D  L       +D    F   S    SS++  +  L  D  
Sbjct  203   NIIMNLMTKFSENETHLAADESLRP-----IDLAKDFSKNSPTMFSSEEGRNGKLNYD--  255

Query  709   QTPSNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAAR  888
             Q       D     + L   E   L+     GNFP P ELA L+E  L KRC +G+R+ R
Sbjct  256   QVSEEKLGDGAILDNQL--LENKTLSFFLEAGNFPCPEELANLDEKILEKRCKVGFRSKR  313

Query  889   IINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHV  1068
             I+ LA+ +VEG + L +IE   +Q  + + D L RQL  I G GP+ C NVLM +G Y  
Sbjct  314   IVKLAQSIVEGALDLGKIEVLSQQDPI-HLDGLMRQLLSIYGVGPYVCNNVLMSMGIYQR  372

Query  1069  IPTDSETIRHLKQVHAKSSSTL-TVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLS  1245
             IP D+ET+RHLKQ HA+   T+ T+QKD+E IYGK+ PFQFLVYWSE+W FYE+ FGKLS
Sbjct  373   IPADTETLRHLKQFHARKQCTIGTIQKDIEEIYGKHEPFQFLVYWSEMWEFYEKRFGKLS  432

Query  1246  EMPQSGYNRITASNMR---PKR  1302
             +MP S Y  ITA NM+   PKR
Sbjct  433   QMPPSDYELITAHNMKNNIPKR  454


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 55/92 (60%), Gaps = 11/92 (12%)
 Frame = +3

Query  102  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTV  281
            V+ LP+ +   +F LEKAVCSHG FMMAPN W   ++TL+RPLRL+D         SV V
Sbjct  9    VLTLPVNE---SFELEKAVCSHGFFMMAPNLWFSSSQTLQRPLRLTDRS-------SVPV  58

Query  282  RVSHPSDSPQ-SLRLHVFGTDCLSAQQHQSLM  374
            R++  S S Q SL++ V G   L     Q L+
Sbjct  59   RITQLSLSSQKSLQILVLGASKLYQHDQQYLL  90



>ref|XP_007023219.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY25841.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=406

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 126/263 (48%), Positives = 157/263 (60%), Gaps = 60/263 (23%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFS-LSVESDHFIPKTPAAKEKWKKAGVHKCSKNLSA  552
             +SRTLSMAKALCELQ E   + + FS +    D FIPKTPA  E  +K  V K    +S 
Sbjct  189   FSRTLSMAKALCELQFE---TQRPFSGVRAAEDDFIPKTPAGNELKRKLRVSK----VSM  241

Query  553   RLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPSNLCS  732
             RL    A    D+                                               
Sbjct  242   RLEGKFAEPRADH-----------------------------------------------  254

Query  733   DNPCSSSDLH-SAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARG  909
                 S SDL  S E  E +A  G+G+FPSP ELA L+ESFLAKRCNLGYRA+RI+ LA+G
Sbjct  255   ----SKSDLQPSQELDEPHAYKGMGSFPSPEELANLDESFLAKRCNLGYRASRILKLAKG  310

Query  910   VVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSET  1089
             +V+G I L ++EE C++ +LS+Y++LA QL++IDGFGPFTCANVLMC+G+YHVIP DSET
Sbjct  311   IVQGIIQLMQLEEGCKEISLSSYNKLAEQLRQIDGFGPFTCANVLMCMGFYHVIPADSET  370

Query  1090  IRHLKQVHAKSSSTLTVQKDVEA  1158
             IRHLKQVH+KSS+  TV +DVE 
Sbjct  371   IRHLKQVHSKSSTMQTVGRDVEG  393


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 10/97 (10%)
 Frame = +3

Query  99   VVVELPLGDASST-----FNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH  263
            V++ELP+G+A++      FNLEKAVCSHGLFMMAPN WDP++++L RPLRL D H     
Sbjct  32   VLIELPVGEAAAAEGAGPFNLEKAVCSHGLFMMAPNQWDPISRSLSRPLRLLDHH---SP  88

Query  264  EISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
             ++V VR+S P+ S  +L L V+GT CLS Q   SL+
Sbjct  89   PLTVQVRISQPTAS--TLHLRVYGTRCLSPQHRHSLL  123



>ref|XP_009387466.1| PREDICTED: uncharacterized protein LOC103974377 [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   215 bits (547),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 129/322 (40%), Positives = 177/322 (55%), Gaps = 48/322 (15%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKEKWKK--------AGVHK  531
             W RTLSMAKALCELQLEL         ++  D + PKTP  ++  +K        A    
Sbjct  148   WPRTLSMAKALCELQLELKCC------TISRDLY-PKTPQLRDFKRKRQNTMDVIAKSDD  200

Query  532   CSKNLSARLAEAQAT-------TEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFL  690
              S+   + LA+   +       +     + T +    D    F+GL             +
Sbjct  201   KSQENGSNLAQKAMSFFNHSNHSNNSQRMETSTVGETDSIYDFEGLP-----------II  249

Query  691   LGCDISQTPSNLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNL  870
                D S     L S   C                N  GNFPSP ELA ++ ++LA RC L
Sbjct  250   NKLDASSPVCQLSSGILCLP--------------NTQGNFPSPEELANVDVNYLASRCKL  295

Query  871   GYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMC  1050
             GYR+  I++LA+ +VE +I   ++EE C    L +YDEL ++L  I GFGPFT AN+LMC
Sbjct  296   GYRSQWIVSLAQDIVEHKIQFSKLEEICNGSTLYSYDELDKELSGIHGFGPFTRANILMC  355

Query  1051  LGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEE  1227
             +G+YH IP+DSETIRHLKQ H+ K+ +  + +K++EAIYGK+APFQFL YW E+W  YEE
Sbjct  356   MGFYHKIPSDSETIRHLKQFHSIKNCTVRSSRKNLEAIYGKFAPFQFLAYWFEMWTCYEE  415

Query  1228  WFGKLSEMPQSGYNRITASNMR  1293
              FGK+++MP S Y  +T  NM+
Sbjct  416   IFGKMTQMPPSKYQIVTGINMK  437


 Score = 77.8 bits (190),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 61/99 (62%), Gaps = 8/99 (8%)
 Frame = +3

Query  78   GDARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCA  257
            GD   G+VV++LP+ D   TF+L  AVC+HGLFMMAPN WDP T +L RPL L      +
Sbjct  2    GDGEEGVVVLQLPVKDP--TFDLANAVCNHGLFMMAPNGWDPDTASLRRPLHL------S  53

Query  258  DHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
                S+ VRVS PS  P  L + V+ T  LS+Q   +++
Sbjct  54   SSSASLCVRVSQPSPHPDHLLVSVYCTTFLSSQDQDAIL  92



>gb|EEE67737.1| hypothetical protein OsJ_25428 [Oryza sativa Japonica Group]
Length=442

 Score =   211 bits (537),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/310 (40%), Positives = 170/310 (55%), Gaps = 46/310 (15%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKE-KWKKAGVHKCSKNLSA  552
             W+RTLSM+ ALCELQLEL SS         +++F  +TP  +E K K++        L  
Sbjct  170   WTRTLSMSTALCELQLELRSSSS-------TENFQSRTPPIRECKRKRSNKRNVRVKLET  222

Query  553   RLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPSNLCS  732
             +  E +    ED  L T +A                             ++   PS+   
Sbjct  223   KFNEDKMVCLEDPNLATNTANE---------------------------NLFSLPSSANE  255

Query  733   DNPCSSSDLHSAEA---VELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLA  903
                 S   L  +E     EL   +  G+FP+P ELA L+E FLAKRCNLGYRA RI+ LA
Sbjct  256   TGNTSEVSLDHSELKLRYELCLEDCGGDFPTPEELANLDEDFLAKRCNLGYRARRIVMLA  315

Query  904   RGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDS  1083
             R +VEG+I L+++EE  +         L  +L  I G  PF   NVLMC+G++H+IP D+
Sbjct  316   RSIVEGKICLQKLEEIRKI--------LIEELSTISGIWPFHSCNVLMCMGFFHMIPADT  367

Query  1084  ETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSG  1263
             ETIRHLKQ H ++S+  +VQK+++ IYGKYAPFQFL YW E+W FY + FG +S+M    
Sbjct  368   ETIRHLKQFHKRASTISSVQKELDNIYGKYAPFQFLAYWCELWGFYNKQFGIISDMEPIN  427

Query  1264  YNRITASNMR  1293
             Y   TAS ++
Sbjct  428   YRLFTASKLK  437


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 64/108 (59%), Gaps = 16/108 (15%)
 Frame = +3

Query  84   ARRGMVVVEL--PLGDA-----SSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSD  242
            ARR  V +EL  PLG A     ++ F+LE AVCSHGLFMMAPN WDP ++ L RPLRL+ 
Sbjct  12   ARRVAVELELELPLGGAPPYPGAAPFDLEAAVCSHGLFMMAPNRWDPASRALVRPLRLA-  70

Query  243  DHHCADHEISVTVRVS-HPSDSPQSLRLHVFGT---DCLSAQQHQSLM  374
                +D   SV VRVS HP+    +L + V G    D LS     S++
Sbjct  71   ----SDRAASVAVRVSRHPARPSDALLVSVLGAPDDDALSPLDQTSIL  114



>ref|XP_006470788.1| PREDICTED: uncharacterized protein LOC102629917 isoform X3 [Citrus 
sinensis]
Length=382

 Score =   208 bits (529),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 158/246 (64%), Gaps = 34/246 (14%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKEKWKKAGVHKCSKNLSAR  555
             W RTLSMA+ALCELQ EL    +  S S+  D FIP+TPA KE  ++  V K +  L++R
Sbjct  166   WPRTLSMARALCELQWEL----QHCSPSISED-FIPQTPAGKESKRRQKVSKVASKLTSR  220

Query  556   LAEAQATTEEDNVLTTGSAEIVD--CPPKFKGLsskdissdkkedFLLGCDISQTPSNLC  729
             +AE++A++E+   L    A +++    P F                      +   S+L 
Sbjct  221   IAESKASSEDYMNLKLDCAGVLEENVQPSFPQ--------------------NDIESDLH  260

Query  730   SDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARG  909
               N  S++D  SA        + +GNFPSPRELA L+ESFLAKRCNLGYRA RI+ LARG
Sbjct  261   GLNELSTTDPPSAR-------DRIGNFPSPRELANLDESFLAKRCNLGYRAGRILKLARG  313

Query  910   VVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSET  1089
             +V+G+I L+E+E+ C + +L+ Y +LA QL +I+GFGPFT  NVL+C+G+YHVIPTDSET
Sbjct  314   IVDGQIQLRELEDMCNEASLTAYVKLAEQLSQINGFGPFTRNNVLVCIGFYHVIPTDSET  373

Query  1090  IRHLKQ  1107
             IRHLKQ
Sbjct  374   IRHLKQ  379


 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = +3

Query  102  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCAD-HEISVT  278
            +++LPL +   TFNLE AVCSHGLFMM+PN WDPL+++L RPL LS+     D   +SV 
Sbjct  7    LLKLPLAE---TFNLETAVCSHGLFMMSPNRWDPLSRSLSRPLHLSNSLDNTDIPSVSVD  63

Query  279  VRVSHPSDSPQSLRLHVFGTD-----CLSAQQHQSLMV  377
            V +  P   P SLR+ V  +       LS +Q  +L+ 
Sbjct  64   VTICQPQQDPHSLRIEVRNSASGSAPSLSQEQQDALLA  101



>ref|XP_007022707.1| Uncharacterized protein TCM_033523 [Theobroma cacao]
 gb|EOY14232.1| Uncharacterized protein TCM_033523 [Theobroma cacao]
Length=374

 Score =   176 bits (445),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 112/163 (69%), Gaps = 4/163 (2%)
 Frame = +1

Query  799   VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNY  978
             +GNFP+  ELA L+E +L +RCNLGYRA  I+ LAR V  G + L ++EE     + ++Y
Sbjct  210   IGNFPTSTELACLDEKYLNERCNLGYRARCILQLARKVENGELELNKLEE---SSDTTSY  266

Query  979   DELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSS-STLTVQKDVE  1155
             +   ++L +I GFGPF C+N++MC+G+Y  IP DSETIRHLK VH K   S  T++KD+E
Sbjct  267   ERFYQKLMKIKGFGPFVCSNIMMCIGFYERIPFDSETIRHLKMVHGKGKCSRKTIEKDIE  326

Query  1156  AIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITAS  1284
              IYGKYAPFQ + YW E+   YE  FGKLSE+  S Y+  T S
Sbjct  327   EIYGKYAPFQCMAYWLELLDEYENKFGKLSELESSSYHLATGS  369


 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (69%), Gaps = 6/80 (8%)
 Frame = +3

Query  96   MVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISV  275
            ++ +++ LG+ SS+FN+EKAVC+HGLFMM+PN W P TK+L RPLRL      AD   SV
Sbjct  4    LIELQVALGECSSSFNMEKAVCNHGLFMMSPNVWIPSTKSLRRPLRL------ADSSGSV  57

Query  276  TVRVSHPSDSPQSLRLHVFG  335
             V +SHP+ +   L + V G
Sbjct  58   YVTISHPAPNHPFLVIQVNG  77



>gb|KDP47043.1| hypothetical protein JCGZ_10770 [Jatropha curcas]
Length=189

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 117/176 (66%), Gaps = 7/176 (4%)
 Frame = +1

Query  778   ELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCR  957
             ++ A N V NFPS RELA+++E FL KRCN+G+RA  II+L   +   R+ L + E    
Sbjct  10    KIEANNVVANFPSARELAKVDEEFLKKRCNVGHRAKTIISLVNAIESERLKLDDFENAL-  68

Query  958   QPNLSN-YDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSS-ST  1131
                LSN Y+++  ++ +I G GPFTCAN+LMC+G+Y  IP DSETIR +K++H + + S 
Sbjct  69    ---LSNSYEQIRSEILKIKGIGPFTCANILMCIGHYIDIPIDSETIRLVKKIHGRENCSR  125

Query  1132  LTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNMRPK  1299
              T+ KDV+ IYG Y P+Q L YW ++   YE  +GKLSE+  S Y+ ++  ++ PK
Sbjct  126   STIAKDVKEIYGGYEPYQCLAYWFDLVKDYESRYGKLSELSPSSYHFVSG-HIDPK  180



>ref|NP_001060514.2| Os07g0657600 [Oryza sativa Japonica Group]
 dbj|BAF22428.2| Os07g0657600, partial [Oryza sativa Japonica Group]
Length=465

 Score =   160 bits (405),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 141/270 (52%), Gaps = 47/270 (17%)
 Frame = +1

Query  376   WSRTLSMAKALCELQLELSSSDKKFSLSVESDHFIPKTPAAKE-KWKKAGVHKCSKNLSA  552
             W+RTLSM+ ALCELQLEL SS         +++F  +TP  +E K K++        L  
Sbjct  197   WTRTLSMSTALCELQLELRSSSS-------TENFQSRTPPIRECKRKRSNKRNVRVKLET  249

Query  553   RLAEAQATTEEDNVLTTGSAEIVDCPPKFKGLsskdissdkkedFLLGCDISQTPSNLCS  732
             +  E +    ED  L T +A                             ++   PS+   
Sbjct  250   KFNEDKMVCLEDPNLATNTANE---------------------------NLFSLPSSANE  282

Query  733   DNPCSSSDLHSAEA---VELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLA  903
                 S   L  +E     EL   +  G+FP+P ELA L+E FLAKRCNLGYRA RI+ LA
Sbjct  283   TGNTSEVSLDHSELKLRYELCLEDCGGDFPTPEELANLDEDFLAKRCNLGYRARRIVMLA  342

Query  904   RGVVEGRIPLKEIEECCRQ--PNL-------SNYDELARQLKEIDGFGPFTCANVLMCLG  1056
             R +VEG+I L+++EE  +   P +       S YD L  +L  I GFGPFT ANVLMC+G
Sbjct  343   RSIVEGKICLQKLEEIRKMSVPTVEGLSTTPSTYDRLNEELSTISGFGPFTRANVLMCMG  402

Query  1057  YYHVIPTDSETIRHLKQVHAKSSSTLTVQK  1146
             ++H+IP D+ETIRHLKQV+    S   + K
Sbjct  403   FFHMIPADTETIRHLKQVYFLLVSCFEISK  432


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 14/99 (14%)
 Frame = +3

Query  105  VELPLGDA-----SSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEI  269
            +ELPLG A     ++ F+LE AVCSHGLFMMAPN WDP ++ L RPLRL+     +D   
Sbjct  6    LELPLGGAPPYPGAAPFDLEAAVCSHGLFMMAPNRWDPASRALVRPLRLA-----SDRAA  60

Query  270  SVTVRVS-HPSDSPQSLRLHVFGT---DCLSAQQHQSLM  374
            SV VRVS HP+    +L + V G    D LS     S++
Sbjct  61   SVAVRVSRHPARPSDALLVSVLGAPDDDALSPLDQTSIL  99



>ref|XP_008227745.1| PREDICTED: uncharacterized protein LOC103327233 [Prunus mume]
Length=369

 Score =   155 bits (391),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 110/172 (64%), Gaps = 5/172 (3%)
 Frame = +1

Query  781   LNALNG--VGNFPSPRELAELNESFLAKRCN-LGYRAARIINLARGVVEGRIPLKEIEEC  951
             +N ++G  +GNFP+ +ELA L+E+ L      LGYRA  I+ LAR V  G I L E E+ 
Sbjct  186   MNQMDGGILGNFPTSKELAGLDENTLINDHKVLGYRAKLILKLARDVERGTIRLHEFEKA  245

Query  952   CRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSS  1128
                 +  N D++ R+LK+I GFG + CAN LMC+GYY  +P D+ETIRHL++V   K+  
Sbjct  246   LDDMSF-NQDQVFRRLKKIKGFGSYACANALMCIGYYQHVPLDTETIRHLQEVRGRKNCD  304

Query  1129  TLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITAS  1284
               T +K V  IY KYAP+Q L YW E+  FYE  FGKLSE+P S Y  ++ S
Sbjct  305   KKTARKYVAEIYDKYAPYQCLAYWLELLDFYESKFGKLSELPSSSYETVSGS  356


 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 7/62 (11%)
 Frame = +3

Query  111  LPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVS  290
            LPLG ++S+FNLEKAVC+HG FMMAPN W P +KTL+RPLRL+D   C      VTV + 
Sbjct  8    LPLG-SNSSFNLEKAVCNHGFFMMAPNRWIPSSKTLQRPLRLADSTTC------VTVSIL  60

Query  291  HP  296
            HP
Sbjct  61   HP  62



>ref|XP_009347279.1| PREDICTED: uncharacterized protein LOC103938951 [Pyrus x bretschneideri]
 ref|XP_009347280.1| PREDICTED: uncharacterized protein LOC103938952 [Pyrus x bretschneideri]
Length=225

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 113/179 (63%), Gaps = 16/179 (9%)
 Frame = +1

Query  802   GNFPSPRELAELNESFLAKRCN---LGYRAARIINLARGV-VEGRIPLKEIEECCRQPNL  969
             GNFPS +ELAEL+   L + C+   LGYRA  I+ LA+ + ++  +  +E  +       
Sbjct  56    GNFPSAQELAELDLDTL-QNCSTSVLGYRANTILKLAKIMRLDAELGFQESLDI------  108

Query  970   SNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQK  1146
                D+L ++LKEI GFG F+CAN LMC+GYYH +PTD+ETIRHL+QVH  K     +  K
Sbjct  109   -GVDDLFQKLKEIKGFGSFSCANALMCMGYYHKVPTDTETIRHLQQVHGRKDCDKTSAGK  167

Query  1147  DVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNMRPKRNAKSKRI  1323
              VE IYGKYAPFQ L Y SE+   YE  FGKLSE+P S Y+ I+    R +R  + K +
Sbjct  168   HVEEIYGKYAPFQCLAYLSELLDSYEGKFGKLSELPASSYHIISG---RLERKGEQKTM  223



>gb|KHN34477.1| hypothetical protein glysoja_038896 [Glycine soja]
Length=365

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 104/166 (63%), Gaps = 6/166 (4%)
 Frame = +1

Query  793   NGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLS  972
             +G+GNFP+ +EL +  E+ L +RC +GYRA  II LA+ V +G + L+++E  C   NL 
Sbjct  196   HGIGNFPNSKELVKFGETILRERCKVGYRAQFIIKLAQSVEKGTLVLEKLEMEC---NLW  252

Query  973   NYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDV  1152
             +Y  + R+L E+ GFGPF  A +LMC+G Y  +P DSET RHL Q H  SS       DV
Sbjct  253   SYKVVHRKLSELKGFGPFVVATILMCMGCYEKVPVDSETKRHLNQAHGISSCN---SLDV  309

Query  1153  EAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNM  1290
             E  Y  YAPFQ + +W E+   YE+  GKLSE+ +S Y +IT S  
Sbjct  310   EEFYKTYAPFQCIAFWFELLQSYEKDHGKLSELDESDYPKITGSQF  355


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 62/95 (65%), Gaps = 7/95 (7%)
 Frame = +3

Query  90   RGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEI  269
            +   ++ LPLG   S+FNLEK VC+HG FMMAPN W   TK+L+RPLRL+D   C+    
Sbjct  7    KSKCLLYLPLGSCKSSFNLEKTVCNHGFFMMAPNKWISSTKSLQRPLRLAD--QCS----  60

Query  270  SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
            SV V +SH  +S  +++++V   + +S +  Q+++
Sbjct  61   SVIVTISHLPESA-NIQIYVHDMEGVSLKSEQAIL  94



>ref|XP_002514394.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47990.1| conserved hypothetical protein [Ricinus communis]
Length=457

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 111/166 (67%), Gaps = 5/166 (3%)
 Frame = +1

Query  790   LNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNL  969
             L+   NFP+ +ELA ++E +L ++CNLG+RA  II+L R +  G++ L + +    Q  L
Sbjct  285   LDSTTNFPTLKELAMVDEDYLKEQCNLGHRAKSIIDLVRCIENGKLELNKFD----QDPL  340

Query  970   SNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSST-LTVQK  1146
              +Y+ L++QL ++ G G F  AN+LMCLG+Y  IP DSET+R ++ VHA+   T  T++K
Sbjct  341   PSYEILSKQLLKVKGVGRFASANILMCLGFYRQIPADSETVRLVRTVHAREICTSKTIEK  400

Query  1147  DVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITAS  1284
             DV+ IY KY PFQ L YW E+ + YE+  GKLS++P S Y  +T S
Sbjct  401   DVKEIYDKYEPFQCLAYWLELLNDYEKRVGKLSKLPYSSYQMVTGS  446


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 8/82 (10%)
 Frame = +3

Query  129  SSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSP  308
            S +F+LEK VC+HG FMMAPN W P TKTL+RPLR+ +D        SV + +S P +  
Sbjct  15   SESFDLEKVVCNHGFFMMAPNRWLPETKTLQRPLRIREDTK------SVLISISQPLN--  66

Query  309  QSLRLHVFGTDCLSAQQHQSLM  374
              LR+       L+++  Q+++
Sbjct  67   HHLRIVAHDIQNLTSEDRQTML  88



>ref|XP_010046014.1| PREDICTED: uncharacterized protein LOC104434857 [Eucalyptus grandis]
Length=176

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 104/170 (61%), Gaps = 7/170 (4%)
 Frame = +1

Query  799   VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNY  978
             +GNFPSP+ELA L+  +L  +C LGYR   I+ LA  + EG++ +   E       + + 
Sbjct  8     LGNFPSPKELANLDADYLQSKCKLGYRTNYILKLAMEIEEGKLKIDGYE------GVQDA  61

Query  979   DELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTL-TVQKDVE  1155
                   +K I G G F  A+VLMCLG+Y  +P DSETI+ LK VHA+   T  T++ D++
Sbjct  62    ASCRILIKGISGVGSFARASVLMCLGFYDEVPWDSETIKFLKHVHAREGCTKKTIKSDLK  121

Query  1156  AIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNMRPKRN  1305
              IY KYAPFQ L YW E+  FYE  FGKLSE+  + Y+++++S    + N
Sbjct  122   EIYDKYAPFQCLAYWFELLEFYERRFGKLSELSHTMYHKVSSSTQMREFN  171



>ref|XP_006593886.1| PREDICTED: uncharacterized protein LOC102669626 [Glycine max]
Length=343

 Score =   147 bits (372),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 106/176 (60%), Gaps = 13/176 (7%)
 Frame = +1

Query  793   NGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLS  972
             +G+GNFP+ +EL +  E+ L +RC +GYRA  II LA+ V +G + L+++E  C   NL 
Sbjct  161   HGIGNFPNSKELVKFGETILRERCKVGYRAQFIIKLAQSVEKGTLVLEKLEMEC---NLW  217

Query  973   NYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQK--  1146
             +Y  + R+L E+ GFGPF  A +LMC+G Y  +P DSET RHL QV   S +   + +  
Sbjct  218   SYKVVHRKLSELKGFGPFVVATILMCMGCYEKVPVDSETKRHLNQVPVDSETKRHLNQAH  277

Query  1147  --------DVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNM  1290
                     DVE  Y  YAPFQ + +W E+   YE+  GKLSE+ +S Y +IT S  
Sbjct  278   GISSCNSLDVEEFYKTYAPFQCIAFWFELLQSYEKDHGKLSELDESDYPKITGSQF  333



>ref|XP_010468777.1| PREDICTED: uncharacterized protein LOC104748896 [Camelina sativa]
Length=348

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 107/161 (66%), Gaps = 6/161 (4%)
 Frame = +1

Query  802   GNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYD  981
             GNFPS +E+A L++  + + C LGYRA +I+NLA+ V  G + L+++E+   +      D
Sbjct  183   GNFPSAKEIASLDKDVINEHCKLGYRANQIVNLAKKVENGSLNLEKMEKGEME-----VD  237

Query  982   ELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSS-STLTVQKDVEA  1158
             E+  +LK++ GFGPF  A VLMC+GYYH++P+D+ET+R L++VH     S  T++K  ++
Sbjct  238   EVVGKLKKLKGFGPFASATVLMCMGYYHLVPSDTETLRLLREVHENEECSKETLEKAAQS  297

Query  1159  IYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITA  1281
              Y +++PFQ L YW ++   YE   GKLS++  S YN ++ 
Sbjct  298   FYDRFSPFQCLAYWFDLIQNYETKLGKLSKLSPSDYNSVSG  338


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 7/65 (11%)
 Frame = +3

Query  105  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  284
            + L LG+   TF++EKAVC+HG FMMAPN W+P +K+L RPL LSD         S  V 
Sbjct  3    LRLHLGEMKETFDMEKAVCNHGFFMMAPNVWNPSSKSLHRPLTLSDSS-------STDVT  55

Query  285  VSHPS  299
            +SHPS
Sbjct  56   ISHPS  60



>ref|XP_006299074.1| hypothetical protein CARUB_v10015214mg [Capsella rubella]
 gb|EOA31972.1| hypothetical protein CARUB_v10015214mg [Capsella rubella]
Length=350

 Score =   145 bits (365),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 108/161 (67%), Gaps = 6/161 (4%)
 Frame = +1

Query  802   GNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYD  981
             GNFPS +E+A L++  + + C LGYRA +I+NLA+ V  G + L+++E    +      D
Sbjct  183   GNFPSAKEIASLDKDVINEHCKLGYRANQIVNLAKKVANGSLNLEKMEMGEME-----VD  237

Query  982   ELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVH-AKSSSTLTVQKDVEA  1158
             E+  +LK++ GFGPF  A VLMC+GYYH++P+D+ET+R L++VH  +  S  T++K  ++
Sbjct  238   EVVGKLKKLKGFGPFASATVLMCMGYYHLVPSDTETLRLLREVHEMEECSKETLEKTAQS  297

Query  1159  IYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITA  1281
              Y +++PFQ L YW ++   YE   GKLS++  + YN +++
Sbjct  298   FYDRFSPFQCLAYWYDLIQNYETKLGKLSKLSPTDYNSVSS  338


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 7/65 (11%)
 Frame = +3

Query  105  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  284
            + L LG+   TF++EKAVC+HG FMMAPN W+P TK+L RPL LSD         S  V 
Sbjct  3    LRLHLGEKKGTFDMEKAVCNHGFFMMAPNVWNPSTKSLHRPLTLSDSS-------STDVT  55

Query  285  VSHPS  299
            +SHPS
Sbjct  56   ISHPS  60



>ref|XP_006405890.1| hypothetical protein EUTSA_v10028036mg [Eutrema salsugineum]
 gb|ESQ47343.1| hypothetical protein EUTSA_v10028036mg [Eutrema salsugineum]
Length=355

 Score =   140 bits (354),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 102/159 (64%), Gaps = 6/159 (4%)
 Frame = +1

Query  802   GNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYD  981
             GNFPS +ELA L +  + + C LGYRA  I+ LA+ VV G++ L+E+E    +      +
Sbjct  185   GNFPSAKELASLTKELINEHCKLGYRANWIVRLAKMVVSGKLNLEEMESREMEA-----E  239

Query  982   ELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSS-STLTVQKDVEA  1158
             ++ ++L  + GFG F  A VLMCLGYYH++P+D+ET+R L++VH +   S  T++K  ++
Sbjct  240   QVIKKLMNLKGFGSFVTATVLMCLGYYHLVPSDTETLRLLREVHGEEEYSKETLEKAAQS  299

Query  1159  IYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRI  1275
              Y K++PFQ L YW ++   YE   GKLSE+ Q  Y  +
Sbjct  300   FYDKFSPFQSLAYWFDLIQSYETKLGKLSELSQCDYKSV  338


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 7/64 (11%)
 Frame = +3

Query  105  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  284
            + L L +   +F++EKAVC+HG FMMAPN W+P TK+L RPL +S+         SV V 
Sbjct  3    LRLYLREFEKSFDMEKAVCNHGFFMMAPNIWNPKTKSLSRPLTVSNSS-------SVNVT  55

Query  285  VSHP  296
            +SHP
Sbjct  56   ISHP  59



>ref|XP_010247913.1| PREDICTED: uncharacterized protein LOC104590857 [Nelumbo nucifera]
Length=350

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 108/170 (64%), Gaps = 9/170 (5%)
 Frame = +1

Query  781   LNALNG-VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCR  957
             +N +N  +G+FPS +ELA LN++FL  R  LGYRA +I+ LA+GV  G I    +E+   
Sbjct  178   VNVVNTTIGDFPSSKELASLNDNFLNDRLKLGYRARQILKLAQGVEAGII---RLEKLEG  234

Query  958   QPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTL-  1134
             +   + Y +L R    I+G G FTCA +LM +G+Y  IP D+ET+ H +++H +   T+ 
Sbjct  235   EEEEAVYKKLMR----IEGIGSFTCATILMSIGFYDKIPADTETVSHFQELHGRKDCTIK  290

Query  1135  TVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITAS  1284
             TV K  + IYGK++PFQ L YW E+   YE+  GKLS++P S Y ++  S
Sbjct  291   TVNKYAKEIYGKFSPFQCLAYWFELLQVYEKKVGKLSKLPPSSYYKVNCS  340


 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 55/82 (67%), Gaps = 7/82 (9%)
 Frame = +3

Query  129  SSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSP  308
            +S+FNLEKAVC+HG FMMAPN W P TKTL+RPLRL      AD   SVTVR+SHP    
Sbjct  2    ASSFNLEKAVCNHGFFMMAPNLWIPSTKTLQRPLRL------ADSITSVTVRISHPPKH-  54

Query  309  QSLRLHVFGTDCLSAQQHQSLM  374
             S+ + V  T  LS+   Q+L+
Sbjct  55   HSIHVLVLDTKALSSPDQQALL  76



>emb|CDX82716.1| BnaC07g01500D [Brassica napus]
Length=347

 Score =   139 bits (349),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 107/166 (64%), Gaps = 7/166 (4%)
 Frame = +1

Query  802   GNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYD  981
             GNFPS +E+A L++  + + C LGYRA  I+ LA+ V  G++ L+E+E    +      +
Sbjct  182   GNFPSAKEIASLDKELINEHCKLGYRANWIVKLAKMVESGKLNLEEMESRDMEA-----E  236

Query  982   ELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSS-STLTVQKDVEA  1158
             E++ +LK++ GFGPF  A VLMC+GYYH++P+D+ET+R  ++VH     S  T++   ++
Sbjct  237   EVSEKLKKLKGFGPFLTATVLMCIGYYHLVPSDTETLRLFREVHVNVECSKETLETAAQS  296

Query  1159  IYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITA-SNMR  1293
              Y +++PFQ L YW ++   YE   GKLSE+ Q  Y  ++  S+M+
Sbjct  297   FYDRFSPFQSLAYWFDLIQNYETKLGKLSELNQLDYKSVSGCSHMK  342


 Score = 67.0 bits (162),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 7/64 (11%)
 Frame = +3

Query  105  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  284
            + L L +    F++EKAVC+HG FMMAPN WDP +K+L RPL LS+         SV+V 
Sbjct  3    LRLYLKEFERKFDMEKAVCNHGFFMMAPNVWDPKSKSLTRPLTLSNSS-------SVSVT  55

Query  285  VSHP  296
            +SHP
Sbjct  56   ISHP  59



>ref|XP_008460619.1| PREDICTED: uncharacterized protein LOC103499397 [Cucumis melo]
Length=144

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 94/149 (63%), Gaps = 11/149 (7%)
 Frame = +1

Query  850   LAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFT  1029
             L K   LGYRA  I++ AR V  G+I L+ +E   + PN            +I GFGPF 
Sbjct  5     LLKEHCLGYRAGYIVDFARRVKNGKIDLQRLE--VQNPNYY--------FPKIKGFGPFA  54

Query  1030  CANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDVEAIYGKYAPFQFLVYWSE  1206
              AN+LMCLG+Y  +P D+ETIRHLKQVH  +  +  TV++DV+ IY KYAPFQ L YW E
Sbjct  55    TANILMCLGFYRQLPIDTETIRHLKQVHGIQFCNNKTVREDVKLIYDKYAPFQCLAYWLE  114

Query  1207  IWHFYEEWFGKLSEMPQSGYNRITASNMR  1293
             +  FYE  FGKLSE+    Y++I+ + ++
Sbjct  115   LVEFYESKFGKLSELCSLDYHKISGTTLQ  143



>ref|XP_008385650.1| PREDICTED: uncharacterized protein LOC103448172 [Malus domestica]
Length=263

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 100/163 (61%), Gaps = 12/163 (7%)
 Frame = +1

Query  808   FPSPRELAELNESFLAKRCN---LGYRAARIINLARGVVEGRIPLKEIEECCRQPNLS-N  975
             F SP    +L +  L    N   LGYRA  I+ LA+        ++  +E   Q +L+  
Sbjct  95    FRSPTLFEDLVKCILLCNTNTSVLGYRANTILKLAK-------IMRLDDELGFQESLNIG  147

Query  976   YDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDV  1152
             ++++ ++LKEI GFG F+CAN LMC+GYYH +PTD+ETIRHL+QVH  K     +  KD 
Sbjct  148   FNDMFQKLKEIKGFGSFSCANALMCMGYYHKVPTDTETIRHLQQVHGRKDCDKTSAGKDA  207

Query  1153  EAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITA  1281
             E IY KYAPFQ L Y SE+   YE  FGKLSE+P S Y+ I+ 
Sbjct  208   EEIYDKYAPFQCLXYLSELLDSYEGKFGKLSELPASSYHIISG  250



>ref|XP_005842500.1| hypothetical protein GUITHDRAFT_160483 [Guillardia theta CCMP2712]
 gb|EKX55520.1| hypothetical protein GUITHDRAFT_160483 [Guillardia theta CCMP2712]
Length=322

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 107/178 (60%), Gaps = 7/178 (4%)
 Frame = +1

Query  790   LNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEEC--CRQP  963
             ++  G FP+P EL+  +   L + C +GYRAAR+I+LAR  VE     +  +    CR P
Sbjct  146   VSSCGGFPTPLELSSWDPEDLKRECGVGYRAARLISLARRAVESEELEELEKLARRCRSP  205

Query  964   NL--SNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA--KSSST  1131
             ++  +   EL  +L  ++GFGP+   N+LM LG Y+ I  DSET+RHLK +H   + S+ 
Sbjct  206   SVGEAQQGELRAKLLALEGFGPYATDNMLMLLGIYNNIAIDSETLRHLKSLHGVDEKSAA  265

Query  1132  LTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNMRPKRN  1305
               VQK V  IY +Y P+QFLVYW E+W  YE   G L  +P S Y+ + A++M+  R+
Sbjct  266   RAVQK-VSKIYDRYCPYQFLVYWRELWKDYERLCGPLHLLPSSRYSMLCANHMKKIRS  322



>gb|KFK33320.1| hypothetical protein AALP_AA6G359700 [Arabis alpina]
Length=388

 Score =   130 bits (328),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 102/160 (64%), Gaps = 6/160 (4%)
 Frame = +1

Query  802   GNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYD  981
             GNFPS +E+A L++ F+ + C LGYRA  I+ LA+ V  G + L+EIE+    P     +
Sbjct  88    GNFPSVKEIASLDKEFINEHCKLGYRAKWIVALAKKVERGTLDLEEIEKREIGP-----E  142

Query  982   ELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAI  1161
             ++  +LK   GFG F  A VLMC+GYYHV+P+D+ET+R L+++H     + T  ++ + +
Sbjct  143   QVIGKLKPSKGFGVFVTATVLMCIGYYHVVPSDTETLRLLREMHGMEECS-TQGREAQQL  201

Query  1162  YGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITA  1281
             Y +++PFQ L YW ++   YE   GKLSE+    YN++ +
Sbjct  202   YDRFSPFQSLAYWFDMVKNYETKHGKLSELSPLYYNKVAS  241



>ref|XP_009593372.1| PREDICTED: uncharacterized protein LOC104090039 [Nicotiana tomentosiformis]
Length=158

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +3

Query  87   RRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHE  266
            RR  VVVELPLGD + T +LEKAVCSHGLFMMAPNHWD L+KTLERPLRLS++ +  DHE
Sbjct  9    RRHSVVVELPLGDGA-TCDLEKAVCSHGLFMMAPNHWDSLSKTLERPLRLSENINDDDHE  67

Query  267  ISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLM  374
             S  VR+S PSDSP SL L VFGTD LS    +SL+
Sbjct  68   KSHLVRISQPSDSPHSLHLRVFGTDSLSPLHQRSLL  103



>ref|XP_007213368.1| hypothetical protein PRUPE_ppa026718mg [Prunus persica]
 gb|EMJ14567.1| hypothetical protein PRUPE_ppa026718mg [Prunus persica]
Length=311

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 94/144 (65%), Gaps = 5/144 (3%)
 Frame = +1

Query  781   LNALNG--VGNFPSPRELAELNE-SFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEEC  951
             +N ++G  +GNFP+ +ELA L+E + +++   LGYRA  I+ LAR V  G I L E EE 
Sbjct  159   INQMDGGILGNFPTSKELAGLDENTLVSEHKVLGYRAKLILKLARDVERGTIRLHEFEEA  218

Query  952   CRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSS  1128
                 +  N D++ R+L +I GFG + CAN LMC+GYY  +P D+ETIRHL++VH  K+  
Sbjct  219   LDDMSF-NQDQVFRRLMKIKGFGSYACANALMCIGYYQHVPLDTETIRHLQEVHGRKNCH  277

Query  1129  TLTVQKDVEAIYGKYAPFQFLVYW  1200
               T +K V  IY KYAP+Q L YW
Sbjct  278   KKTARKYVAEIYDKYAPYQCLAYW  301



>ref|XP_005646705.1| DNA glycosylase [Coccomyxa subellipsoidea C-169]
 gb|EIE22161.1| DNA glycosylase [Coccomyxa subellipsoidea C-169]
Length=406

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 95/167 (57%), Gaps = 6/167 (4%)
 Frame = +1

Query  796   GVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSN  975
             G G FP+P ++A      L  RC +GYR   I  LA+  ++G +    +EE    P + +
Sbjct  172   GGGAFPTPAQVAAAGVEALQSRCGVGYRGKTIHGLAQQFLDGTVSGLALEE----PGM-D  226

Query  976   YDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSS-STLTVQKDV  1152
                L ++L  + G GPFT ANVL  LG++  IP D+ET RHLK  H  S  S  T+Q+  
Sbjct  227   ASALYKKLLPLSGMGPFTAANVLQLLGHFERIPADTETARHLKHRHKLSGLSPRTLQEAA  286

Query  1153  EAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNMR  1293
             + +Y KYAP+QFLVYW E+   YE+ FG L++M    Y + T   MR
Sbjct  287   QKVYEKYAPYQFLVYWFELRQGYEDLFGSLADMDPDDYAKATGHIMR  333



>ref|XP_006423927.1| hypothetical protein CICLE_v10030405mg, partial [Citrus clementina]
 gb|ESR37167.1| hypothetical protein CICLE_v10030405mg, partial [Citrus clementina]
Length=332

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 88/136 (65%), Gaps = 9/136 (7%)
 Frame = +1

Query  796   GVGNFPSPRELAELNESFLAK--RCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNL  969
              V NFP+ REL  L    L +  R NLGYRA  I+  AR +  G++ ++ +EE       
Sbjct  152   SVENFPTSRELTNLMNKDLMRELRNNLGYRADYILKFARKIERGQLNIQFLEE-------  204

Query  970   SNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKD  1149
             + ++++ + L +  GFGPF CANVL C+G+YH +PTD+ETIRHL++ H+  S+  TV KD
Sbjct  205   APWEQVYKLLMKNKGFGPFVCANVLACIGFYHKVPTDTETIRHLQEAHSMKSNRKTVGKD  264

Query  1150  VEAIYGKYAPFQFLVY  1197
             V+ +Y +YAPFQ L Y
Sbjct  265   VKEVYDQYAPFQSLAY  280



>ref|XP_010046025.1| PREDICTED: uncharacterized protein LOC104434869 [Eucalyptus grandis]
Length=172

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 99/172 (58%), Gaps = 15/172 (9%)
 Frame = +1

Query  799   VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNY  978
             +GNFPSP+ELA L+  +L  +C LGYR   I+ LA  + EG++ +   E       + + 
Sbjct  8     LGNFPSPKELANLDADYLQSKCKLGYRTNYILKLAMEIEEGKLKIDGYE------GVQDA  61

Query  979   DELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHL--KQVHAKSSSTL-TVQKD  1149
                   +K I G G F  A+VLMCLG+Y       E ++    ++VHA+   T  T++ D
Sbjct  62    ASCRILIKGISGVGSFARASVLMCLGFY------DEMMQSFLWQKVHAREGCTKKTIKSD  115

Query  1150  VEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRITASNMRPKRN  1305
             ++ IY KYAPFQ L YW E+  FYE  FGKLSE+  + Y+++++S    + N
Sbjct  116   LKEIYDKYAPFQCLAYWFELLEFYERQFGKLSELSHTMYHKVSSSTQMREFN  167



>ref|XP_009804252.1| PREDICTED: uncharacterized protein LOC104249510 [Nicotiana sylvestris]
Length=346

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 101/181 (56%), Gaps = 18/181 (10%)
 Frame = +1

Query  790   LNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEE--CCRQP  963
             ++  G+FP+  ELA  +E  L  + N GYRA  +I LA+ VV+G I L + E+     +P
Sbjct  172   ISSYGDFPNAEELASFSEKELKGKGNFGYRARELIMLAKQVVDGEIYLSKFEKDHIGTEP  231

Query  964   NLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-------KS  1122
             N S          +I+G GPFT   ++MC GYY  IP DSET+RH+ + H        + 
Sbjct  232   NWSKL--------KINGAGPFTIKTIMMCAGYYSYIPIDSETMRHMDEFHGLKVHKRKRG  283

Query  1123  SSTLTVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGK-LSEMPQSGYNRITASNMRPK  1299
             S  L ++  ++ IY +Y PFQ L YW E+ + YE   GK LSE+  S Y+ +T +  + K
Sbjct  284   SINLQIRDKIQQIYKRYDPFQSLAYWFELVNSYETELGKELSELLPSEYHHVTGNYEKEK  343

Query  1300  R  1302
             +
Sbjct  344   K  344


 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 8/71 (11%)
 Frame = +3

Query  135  TFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQS  314
            TF +EKA+C+HG FMMAPN W+P TK+  RPLRL+D         SV   +S P      
Sbjct  18   TFTIEKAMCNHGFFMMAPNCWEPSTKSFSRPLRLADS-------TSVMTFISQPPGKDH-  69

Query  315  LRLHVFGTDCL  347
            L + V+G   L
Sbjct  70   LVIKVYGASIL  80



>ref|XP_006350375.1| PREDICTED: uncharacterized protein LOC102593362 [Solanum tuberosum]
Length=336

 Score =   112 bits (279),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 91/170 (54%), Gaps = 20/170 (12%)
 Frame = +1

Query  799   VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNY  978
             +G+F SPRELA   E  L  +   GYRA  +I LA+ V  G+I     +E        +Y
Sbjct  176   IGDFLSPRELASFREEELNDKGKFGYRAGDLIKLAKQVANGKIKFDSADE-------GHY  228

Query  979   DELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-------KSSSTLT  1137
              +L     +I+G GPFT   ++MC+G+YH IP D+ET+RH+K+ H        K   ++ 
Sbjct  229   SKL-----KINGAGPFTTNTIMMCIGHYHNIPIDTETLRHMKEFHGLNMRKRKKGPISVE  283

Query  1138  VQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGK-LSEMPQSGYNRITAS  1284
              +  ++  Y  Y PF+ L YW E+ + YE   GK L E+  S Y+  T S
Sbjct  284   TKAKIQEFYKIYHPFESLAYWFELANSYEIKLGKTLGELLPSEYHHATGS  333


 Score = 70.9 bits (172),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 46/83 (55%), Gaps = 7/83 (8%)
 Frame = +3

Query  123  DASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSD  302
            D    FNLEKAVC+HG FMMAPNHWDP TKT  RPLRL D         S    +S P  
Sbjct  16   DKFPRFNLEKAVCNHGFFMMAPNHWDPSTKTFSRPLRLDDSIR------SALTFISQPPG  69

Query  303  SPQSLRLHVFGTDCLSAQQHQSL  371
                L + V+G   LS++   ++
Sbjct  70   EDH-LVITVYGATILSSKDEGAI  91



>ref|XP_010315535.1| PREDICTED: uncharacterized protein LOC101254250 [Solanum lycopersicum]
Length=335

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 91/170 (54%), Gaps = 21/170 (12%)
 Frame = +1

Query  799   VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNY  978
             +G+FPSPRELA   E  L K    GYRA  +I LA+ VV+ +I            NL   
Sbjct  176   IGDFPSPRELASFREKEL-KDKGFGYRARDLIKLAKQVVDEKI------------NLDGV  222

Query  979   DELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-------KSSSTLT  1137
             DE      +I+G GPFT   ++MC+G+YH IP D+ET+RH+K+ H          S ++ 
Sbjct  223   DEGFYSNLKINGAGPFTINTIMMCIGHYHHIPIDTETLRHMKEFHGFNMGKRKNGSISVE  282

Query  1138  VQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGK-LSEMPQSGYNRITAS  1284
              +  ++  Y  Y PF+ L +W E+ + YE   GK L E+  S Y+  T S
Sbjct  283   TKAKIQESYKIYHPFESLAFWFELVNTYETKLGKTLGELLPSEYHHATGS  332


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 7/83 (8%)
 Frame = +3

Query  123  DASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSD  302
            D    FNLEKAVC+HG FMMAPN WDP TK   RPLRL       D+ I  T+       
Sbjct  16   DKFPRFNLEKAVCNHGFFMMAPNQWDPSTKIFSRPLRL-------DNSIRSTLTFISQPP  68

Query  303  SPQSLRLHVFGTDCLSAQQHQSL  371
                L + V+G   LS++   ++
Sbjct  69   GEDHLVITVYGAIILSSKDEGAI  91



>emb|CBI35315.3| unnamed protein product [Vitis vinifera]
Length=257

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 78/126 (62%), Gaps = 11/126 (9%)
 Frame = +1

Query  736   NPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVV  915
             NP S +  +SA+ V+      +GNFP+  EL  L+E  L KRCNLGYRA  I+ LA  + 
Sbjct  142   NPRSKAK-NSADEVQ-----SIGNFPNSMELNILDEETLKKRCNLGYRAKIILELATSIE  195

Query  916   EGRIPLKEIEECCRQPNLSN-YDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETI  1092
              G + L+  E+     ++   YD L ++     GFGPF CAN+LMC+GYY  IPTDSET 
Sbjct  196   NGEVKLQNFEKALDAESMEKIYDMLNKK----KGFGPFACANILMCIGYYQRIPTDSETF  251

Query  1093  RHLKQV  1110
             RH+K+V
Sbjct  252   RHVKEV  257



>ref|XP_010490265.1| PREDICTED: uncharacterized protein LOC104768014 [Camelina sativa]
Length=282

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 74/105 (70%), Gaps = 5/105 (5%)
 Frame = +1

Query  802   GNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYD  981
             GNFPS +E+A L++  + + C LGYRA +I+NLA+ V  G + L+++E    +      D
Sbjct  183   GNFPSAKEIASLDKDVINEHCKLGYRANQIVNLAKKVENGSLNLEKMEMGEME-----VD  237

Query  982   ELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA  1116
             E+  +LK++ GFGPF  A VLMC+GYYH++P+D+ET+R L++V+ 
Sbjct  238   EVVGKLKKLKGFGPFASATVLMCMGYYHLVPSDTETLRLLREVYT  282


 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 7/65 (11%)
 Frame = +3

Query  105  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  284
            + L LG+   TF++EKAVC+HG FMMAPN W+P +K+L RPL LSD         S  V 
Sbjct  3    LRLHLGEMKETFDMEKAVCNHGFFMMAPNVWNPSSKSLHRPLTLSDSS-------STDVT  55

Query  285  VSHPS  299
            +SHPS
Sbjct  56   ISHPS  60



>emb|CBN77855.1| conserved unknown protein [Ectocarpus siliculosus]
Length=366

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 78/141 (55%), Gaps = 8/141 (6%)
 Frame = +1

Query  802   GNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYD  981
             G FP+P +L  + E  L ++  +GYRA RI+ LA    +G +    +E   R       +
Sbjct  213   GAFPTPEDLENVQEEDLKEKAKVGYRAGRILRLAESFRDGSVDPAWLEAPER-----TRE  267

Query  982   ELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLT-VQKDVEA  1158
             E+ + +K + GFG +   NV M LG+Y  IP DSET+RH K  H  ++  +  V   V+ 
Sbjct  268   EVLKFVKALYGFGDYAAGNVAMLLGFYEDIPMDSETVRHFKDYHGVTTKNVKEVAPRVKK  327

Query  1159  IYGKYAPFQFLVYWSEI--WH  1215
              Y KYAP+QFL YW E+  WH
Sbjct  328   EYEKYAPYQFLQYWYEMITWH  348



>ref|XP_010256879.1| PREDICTED: uncharacterized protein LOC104597156 [Nelumbo nucifera]
Length=122

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 6/65 (9%)
 Frame = +3

Query  102  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTV  281
            ++ LPLG++ STF+LEKAVCSHGLFMMAPN WDP TKT +RPLRLSD+        ++ V
Sbjct  29   LLTLPLGESVSTFSLEKAVCSHGLFMMAPNQWDPSTKTFQRPLRLSDE------TTAILV  82

Query  282  RVSHP  296
            R+SHP
Sbjct  83   RISHP  87



>ref|XP_004342630.1| hypothetical protein CAOG_08029 [Capsaspora owczarzaki ATCC 30864]
 gb|EFW42897.1| hypothetical protein CAOG_08029 [Capsaspora owczarzaki ATCC 30864]
Length=507

 Score = 93.6 bits (231),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 83/158 (53%), Gaps = 5/158 (3%)
 Frame = +1

Query  799   VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNY  978
             V +FP+P E+  L    L ++C +GYRA  I+ LA  +V     L  IE+     + ++ 
Sbjct  351   VYSFPTPLEVLNLGLEGLKEQCRVGYRAESILQLAEAIVNNPSTLSSIEKLVN--SNADI  408

Query  979   DELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDVE  1155
             D + +++++  G GP+ CA ++ CLG +  +P D+  ++H +  H  +      V+   +
Sbjct  409   DLIKKRVQQFRGIGPYACATIMTCLGVFTHLPVDTVFVKHFRDFHGCRDKDAKLVEVAGK  468

Query  1156  AIYGKYAPFQFLVYWSEIW--HFYEEWFGKLSEMPQSG  1263
               Y  + PFQ+LVYW E+W  H     + ++  + Q G
Sbjct  469   RHYDSFHPFQYLVYWCEVWTSHRKSMTYEQMVALSQRG  506



>emb|CDP17259.1| unnamed protein product [Coffea canephora]
Length=292

 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 67/111 (60%), Gaps = 6/111 (5%)
 Frame = +1

Query  793   NGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLS  972
             N V NFPS +ELA ++   L   C LG RA  I   A+    GR  L+  E+C      +
Sbjct  174   NSVRNFPSAKELAGIDVEILKDHCKLGLRAKHIHEFAKDYHRGRYRLRNFEKC------A  227

Query  973   NYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSS  1125
             +++EL ++L +I G G +   NVLMCLG+Y  +P D+ET+RHL++V  ++S
Sbjct  228   SHEELYQKLMKIKGCGAYVSNNVLMCLGFYEKVPIDTETVRHLQEVCMQAS  278


 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 55/98 (56%), Gaps = 15/98 (15%)
 Frame = +3

Query  57   TGETTISGDARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRL  236
            T +TTI          + +PL D   TFNLEKAVC+HG FMMAPN WDP TK   RPLRL
Sbjct  2    TKKTTICSK-------LYMPLKDYP-TFNLEKAVCNHGFFMMAPNVWDPSTKQFTRPLRL  53

Query  237  SDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLS  350
            +D  +      SV V +S P D    L + V   +C+S
Sbjct  54   ADSVN------SVKVTISQPHDC-SLLLIEVHDMECIS  84



>gb|KCW84808.1| hypothetical protein EUGRSUZ_B01611 [Eucalyptus grandis]
Length=140

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 61/104 (59%), Gaps = 6/104 (6%)
 Frame = +1

Query  799   VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNY  978
             +GNFPSP+ELA L+  +L  +C LGYR   I+ LA  + EG++ +   E       + + 
Sbjct  43    LGNFPSPKELANLDADYLQSKCKLGYRTNYILKLAMEIEEGKLKIDGYE------GVQDA  96

Query  979   DELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQV  1110
                   +K I G G F  A+VLMCLG+Y  +P DSETI+ LK V
Sbjct  97    ASCRILIKGISGVGSFARASVLMCLGFYDEVPWDSETIKFLKHV  140



>ref|WP_014437765.1| hypothetical protein [Phycisphaera mikurensis]
 ref|YP_005446449.1| hypothetical protein PSMK_23930 [Phycisphaera mikurensis NBRC 
102666]
 dbj|BAM04552.1| hypothetical protein PSMK_23930 [Phycisphaera mikurensis NBRC 
102666]
Length=327

 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 80/168 (48%), Gaps = 17/168 (10%)
 Frame = +1

Query  796   GVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSN  975
             G G FP+P +LA  +E+ L     +GYRA RI  LAR V +G + L  +++  R+P    
Sbjct  152   GGGAFPTPAQLAAASEAQLRAHARVGYRAGRIRELARRVADGELDLDALDD-PRRPT---  207

Query  976   YDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHL-------KQVHAKSSSTL  1134
              DEL      + G GP+   N+   +G Y  +  D+ET RH        +     +++  
Sbjct  208   -DELFASFAALPGIGPYAAGNLCHLVGRYDRLAIDTETRRHFCLRQGVDRPAPTDAAANR  266

Query  1135  TVQKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEMPQSGYNRIT  1278
             T+ + +   Y    PF F  +W+E+W  Y+   G     P   ++R T
Sbjct  267   TLDRRIAEHYAAADPFAFKYFWAELWADYQRRNG-----PAHAWDRAT  309


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  138  FNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSD  242
            F+L + VCS+G F++APN WDP   TL RPLRL D
Sbjct  12   FDLARTVCSYGYFLLAPNFWDPAAATLSRPLRLPD  46



>gb|KCW84783.1| hypothetical protein EUGRSUZ_B01586 [Eucalyptus grandis]
Length=268

 Score = 84.3 bits (207),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 61/104 (59%), Gaps = 6/104 (6%)
 Frame = +1

Query  799   VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNY  978
             +GNFPSP+ELA L+  +L  +C LGYR   I+ LA  + EG++ +   E       + + 
Sbjct  171   LGNFPSPKELANLDADYLQSKCKLGYRTNYILKLAMEIEEGKLKIDGYE------GVQDA  224

Query  979   DELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQV  1110
                   +K I G G F  A+VLMCLG+Y  +P DSETI+ LK V
Sbjct  225   ASCRILIKGISGVGSFARASVLMCLGFYDEVPWDSETIKFLKHV  268



>ref|XP_010533318.1| PREDICTED: uncharacterized protein LOC104809120 [Tarenaya hassleriana]
Length=248

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 63/111 (57%), Gaps = 10/111 (9%)
 Frame = +3

Query  72   ISGDARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRL-----  236
            I GD  +    VELPLG+A+  F+LEKAVCSHG FMM+PN WDPL+++L RPLR      
Sbjct  2    IDGDDLKISCSVELPLGEAAEAFDLEKAVCSHGFFMMSPNRWDPLSRSLFRPLRFPPLDF  61

Query  237  ---SDDHHCADHEI-SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMV  377
                D   C +    S  VR+S   + P  L + V G   LS  Q ++++ 
Sbjct  62   DGDFDGSDCGEAPYPSAVVRISQHPELP-CLSVRVCGVSSLSESQRRAIVA  111



>ref|XP_007146019.1| hypothetical protein PHAVU_006G006000g, partial [Phaseolus vulgaris]
 gb|ESW18013.1| hypothetical protein PHAVU_006G006000g, partial [Phaseolus vulgaris]
Length=276

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 62/106 (58%), Gaps = 11/106 (10%)
 Frame = +1

Query  799   VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLK-EIEECCRQPNLSN  975
             VGNFP+ +EL E+ E+ L K+C LG RA  I+ LA+ V +  +  K E E+ C       
Sbjct  173   VGNFPTSKELVEIGETNLQKQCRLGMRAGYIMKLAKKVEKNSVMEKLEKEKSCW------  226

Query  976   YDELARQ-LKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQV  1110
                LA   L E  GFGPF+ A  LMC+G Y  +PTD+ET   LKQV
Sbjct  227   ---LAYSILDEFKGFGPFSTATTLMCMGIYEKVPTDTETKALLKQV  269


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 58/91 (64%), Gaps = 9/91 (10%)
 Frame = +3

Query  111  LPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVS  290
            L +    STFNLEKAVC+HG FMMAPN W+P TK+L+RPLRL D   C     SV V +S
Sbjct  10   LSVEKYKSTFNLEKAVCNHGFFMMAPNKWNPSTKSLQRPLRLMD--QCC----SVMVTIS  63

Query  291  H-PSDSPQSLRLHVFGTDCLSAQQHQSLMVV  380
            H P ++  +L +HV     LS +  Q+++ +
Sbjct  64   HLPGEN--NLHVHVHDVQLLSLEDQQAILAL  92



>emb|CEI83200.1| DNA-3-methyladenine glycosylase [Oceanobacillus oncorhynchi]
Length=291

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 72/131 (55%), Gaps = 7/131 (5%)
 Frame = +1

Query  808   FPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDEL  987
             FP+P  + + +++FL K   LGYR+  I +LA  +  G   L+E+      P +   D +
Sbjct  165   FPAPEAVLKKDKTFLNKSIKLGYRSDYIYDLALNICNGVYDLEELT----NPEMPTED-V  219

Query  988   ARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYG  1167
               +LKEI G GP+  + +LM LG Y  +P DSE  +H+K  +   +  L  +  ++ +Y 
Sbjct  220   VHKLKEIRGVGPYALSIILMLLGRYDFLPVDSEFKKHVKNKYF--AGELPPKSQLQQLYK  277

Query  1168  KYAPFQFLVYW  1200
             ++  F+FL YW
Sbjct  278   EWGEFKFLAYW  288



>ref|XP_003883854.1| conserved hypothetical protein [Neospora caninum Liverpool]
 emb|CBZ53822.1| conserved hypothetical protein [Neospora caninum Liverpool]
Length=1064

 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = +1

Query  964   NLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLT-V  1140
              L   +   R L  I G GPF   N+L  +G+  V   DSET+RH+ +VH  +S  +  V
Sbjct  815   RLRRKEATQRTLLGIHGIGPFAAENILQLVGFTEVDAFDSETVRHMGEVHGVNSKNVKEV  874

Query  1141  QKDVEAIYGKYAPFQFLVYWSEIWHFYEEWFGKLSEM  1251
              +     + +Y+P+QF+ YW E+W +YE   G  S++
Sbjct  875   LEKARERFARYSPYQFIAYWHELWEYYERKVGDRSDV  911



>ref|WP_027725341.1| hypothetical protein [Tuberibacillus calidus]
Length=290

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 9/131 (7%)
 Frame = +1

Query  808   FPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDEL  987
             FP P    E  E++L +   LGYR+  +  LA  V  G + L       +  NL   ++L
Sbjct  164   FPKPSTFVEKGEAYLKEEIRLGYRSGYLYELALKVASGELDL------TKWKNLPT-EQL  216

Query  988   ARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYG  1167
              ++LK I G GP+  + +LM LG Y  +P DSE  +H++  + K        K   A+Y 
Sbjct  217   IKELKAIKGIGPYAQSTLLMILGSYSELPVDSEFRKHVENKYFKGKK--MTAKAASALYS  274

Query  1168  KYAPFQFLVYW  1200
             ++  +++L YW
Sbjct  275   EWGNYKYLAYW  285



>gb|KFH16636.1| hypothetical protein TGMAS_270750 [Toxoplasma gondii MAS]
Length=742

 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query  1006  IDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDVEAIYGKYAPF  1182
             I G G F   N+L  LG+  V   DSET+RH+ +VH+ KS+    V     A +  Y P+
Sbjct  506   IHGVGSFAAENILQLLGFTEVDAFDSETVRHMGEVHSVKSAKVKDVLDHARARFAAYRPY  565

Query  1183  QFLVYWSEIWHFYEEWFGKLSEM  1251
             QFL YW E+W FYE   G  S++
Sbjct  566   QFLAYWHELWEFYEAKTGGRSDV  588



>ref|XP_008882441.1| hypothetical protein HHA_270750 [Hammondia hammondi]
 gb|KEP66818.1| hypothetical protein HHA_270750 [Hammondia hammondi]
Length=1040

 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query  1006  IDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDVEAIYGKYAPF  1182
             I G GPF   N+L  +G+  V   DSET+RH+ +VH  K +    V     A +  Y+P+
Sbjct  804   IHGVGPFAAENILQLMGFTEVDAFDSETVRHMGEVHGVKRAKVKDVLDHARARFAVYSPY  863

Query  1183  QFLVYWSEIWHFYEEWFGKLSEM  1251
             QF+ YW E+W +YE   G  S++
Sbjct  864   QFIAYWHELWEYYEAKTGGRSDV  886



>gb|KFG61636.1| hypothetical protein TGRUB_270750 [Toxoplasma gondii RUB]
Length=1011

 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query  1006  IDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDVEAIYGKYAPF  1182
             I G G F   N+L  LG+  V   DSET+RH+ +VH+ KS+    V     A +  Y+P+
Sbjct  775   IHGVGSFAAENILQLLGFTEVDAFDSETVRHMGEVHSVKSAKVKDVLDHARARFAAYSPY  834

Query  1183  QFLVYWSEIWHFYEEWFGKLSEM  1251
             QFL YW E+W  YE   G  S++
Sbjct  835   QFLAYWHELWECYEAKTGSRSDV  857



>gb|ESS36255.1| hypothetical protein TGVEG_270750 [Toxoplasma gondii VEG]
Length=1011

 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +1

Query  1006  IDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDVEAIYGKYAPF  1182
             I G G F   N+L  LG+  V   DSET+RH+ +VH+ KS+    V     A +  Y P+
Sbjct  775   IHGVGSFAAENILQLLGFTEVDAFDSETVRHMGEVHSVKSAKVKDVLDHARARFAAYRPY  834

Query  1183  QFLVYWSEIWHFYEEWFGKLSEM  1251
             QFL YW E+W  YE   G  S++
Sbjct  835   QFLAYWHELWECYEAKTGSRSDV  857



>gb|KFH05928.1| hypothetical protein TGVAND_270750 [Toxoplasma gondii VAND]
Length=1011

 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +1

Query  1006  IDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDVEAIYGKYAPF  1182
             I G G F   N+L  LG+  V   DSET+RH+ +VH+ KS+    V     A +  Y P+
Sbjct  775   IHGVGSFAAENILQLLGFTEVDAFDSETVRHMGEVHSVKSAKVKDVLDHARARFAAYRPY  834

Query  1183  QFLVYWSEIWHFYEEWFGKLSEM  1251
             QFL YW E+W  YE   G  S++
Sbjct  835   QFLAYWHELWECYEAKTGSRSDV  857



>gb|KFG52135.1| hypothetical protein TGP89_270750, partial [Toxoplasma gondii 
p89]
Length=868

 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +1

Query  1006  IDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDVEAIYGKYAPF  1182
             I G G F   N+L  LG+  V   DSET+RH+ +VH+ KS+    V     A +  Y P+
Sbjct  632   IHGVGSFAAENILQLLGFTEVDAFDSETVRHMGEVHSVKSAKVKDVLDHARARFAAYRPY  691

Query  1183  QFLVYWSEIWHFYEEWFGKLSEM  1251
             QFL YW E+W  YE   G  S++
Sbjct  692   QFLAYWHELWECYEAKTGSRSDV  714



>gb|EPR64782.1| hypothetical protein TGGT1_270750 [Toxoplasma gondii GT1]
 gb|KFG43647.1| hypothetical protein TGDOM2_270750 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=1011

 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +1

Query  1006  IDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDVEAIYGKYAPF  1182
             I G G F   N+L  LG+  V   DSET+RH+ +VH+ KS+    V     A +  Y P+
Sbjct  775   IHGVGSFAAENILQLLGFTEVDAFDSETVRHMGEVHSVKSAKVKDVLDHARARFAAYRPY  834

Query  1183  QFLVYWSEIWHFYEEWFGKLSEM  1251
             QFL YW E+W  YE   G  S++
Sbjct  835   QFLAYWHELWECYEAKTGGRSDV  857



>ref|XP_002365741.1| hypothetical protein TGME49_070750 [Toxoplasma gondii ME49]
 gb|EPT28444.1| hypothetical protein TGME49_270750 [Toxoplasma gondii ME49]
Length=1011

 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +1

Query  1006  IDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDVEAIYGKYAPF  1182
             I G G F   N+L  LG+  V   DSET+RH+ +VH  KS+    V     A +  Y P+
Sbjct  775   IHGVGSFAAENILQLLGFTEVDAFDSETVRHMGEVHGVKSAKVKDVLDHARARFAAYRPY  834

Query  1183  QFLVYWSEIWHFYEEWFGKLSEM  1251
             QFL YW E+W  YE   G  S++
Sbjct  835   QFLAYWHELWECYEAKTGGRSDV  857



>gb|KFG54358.1| hypothetical protein TGFOU_270750, partial [Toxoplasma gondii 
FOU]
Length=854

 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +1

Query  1006  IDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHA-KSSSTLTVQKDVEAIYGKYAPF  1182
             I G G F   N+L  LG+  V   DSET+RH+ +VH+ KS+    V     A +  Y P+
Sbjct  618   IHGVGSFAAENILQLLGFTEVDAFDSETVRHMGEVHSVKSAKVKDVLDHARARFAAYRPY  677

Query  1183  QFLVYWSEIWHFYEEWFGKLSEM  1251
             QFL YW E+W  YE   G  S++
Sbjct  678   QFLAYWHELWECYEAKTGGRSDV  700



>ref|WP_011419796.1| iron-sulfur cluster assembly protein HesB [Anaeromyxobacter dehalogenans]
 ref|YP_463950.1| HhH-GPD [Anaeromyxobacter dehalogenans 2CP-C]
 gb|ABC80513.1| HhH-GPD [Anaeromyxobacter dehalogenans 2CP-C]
Length=309

 Score = 69.7 bits (169),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 76/173 (44%), Gaps = 16/173 (9%)
 Frame = +1

Query  721   NLCSDNPCSSSDLHSAEAVELNALN-----GVGNFPSPRELAELNESFLAKRCNLGYRAA  885
              LC+ N CS +   S       AL      G   FP+P  +A   E F       GYRA+
Sbjct  138   TLCTTN-CSWALTRSMVTRLCEALGEPGPLGTRTFPTPEAMAARTERFYRDEIRAGYRAS  196

Query  886   RIINLARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYH  1065
              ++ LARG  +G +   ++E   R P   + D L R++ E+ GFGP+   ++L  LG + 
Sbjct  197   YLLALARGAADGTL---DLEGLRRSP--LDTDALGRRISELKGFGPYATEHLLRLLGRHD  251

Query  1066  VIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVYWSEI---WH  1215
              +  DS T   L ++  K        + +   +  Y  +  L  W E+   WH
Sbjct  252   HLALDSWTRPKLARLRGKRRP--PADRTLRRWFAPYGRWAGLAMWLEVTADWH  302



>ref|WP_037494541.1| hypothetical protein, partial [Solirubrobacter soli]
Length=207

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 80/165 (48%), Gaps = 8/165 (5%)
 Frame = +1

Query  721   NLCSDNPCSSSDLHSAEAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINL  900
              +C+ N   S+ +    A+ +  L   G FP+P  +A   + F       GYR   + ++
Sbjct  49    TICTTNCTWSATVRMVTAL-VRELGVGGAFPTPAAMAVAGDDFYVGAAKTGYRGPYLRSI  107

Query  901   ARGVVEGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTD  1080
             A    EGR+ L+ + +    P LS+  E+  QL  + G GP+ CA+++M LG Y  +  D
Sbjct  108   AADAAEGRLDLEALAD----PELSD-AEVTEQLLALPGVGPYACAHMMMLLGRYRQLILD  162

Query  1081  SETIRHLKQVHAKSSST-LTVQKDVEAIYGKYAPFQFLVYWSEIW  1212
             S T    +++  +S  T + +QK     Y +YA   F +  ++ W
Sbjct  163   SWTRPTYRRLTGRSRITDVGIQKAFRR-YREYAGLAFWLKLTQDW  206



>ref|WP_035393015.1| hypothetical protein, partial [Bacillus sp. JCM 19047]
Length=169

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 67/132 (51%), Gaps = 15/132 (11%)
 Frame = +1

Query  805   NFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDE  984
             +FP+P ++    E+FL +    GYR+  I++ A   V+   P + +     QP+  N+  
Sbjct  51    SFPTPEKILSAGEAFLTEHVRTGYRSNYILDAAHKAVDN--PARYV-----QPSSINH--  101

Query  985   LARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIY  1164
                  +EI G GP+    + M +G Y  +P DSE  +H+  +    +     + D+E++Y
Sbjct  102   ----FREIKGIGPYAMNTLAMIVGRYDGVPVDSEYKKHV--IGTYFNGIAPSKSDLESVY  155

Query  1165  GKYAPFQFLVYW  1200
              K+  +++L YW
Sbjct  156   DKWGDYKYLAYW  167



>dbj|GAF20538.1| HhH-GPD family protein [Bacillus sp. JCM 19047]
Length=188

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 67/132 (51%), Gaps = 15/132 (11%)
 Frame = +1

Query  805   NFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDE  984
             +FP+P ++    E+FL +    GYR+  I++ A   V+   P + +     QP+  N+  
Sbjct  67    SFPTPEKILSAGEAFLTEHVRTGYRSNYILDAAHKAVDN--PARYV-----QPSSINH--  117

Query  985   LARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIY  1164
                  +EI G GP+    + M +G Y  +P DSE  +H+  +    +     + D+E++Y
Sbjct  118   ----FREIKGIGPYAMNTLAMIVGRYDGVPVDSEYKKHV--IGTYFNGIAPSKSDLESVY  171

Query  1165  GKYAPFQFLVYW  1200
              K+  +++L YW
Sbjct  172   DKWGDYKYLAYW  183



>ref|XP_006405889.1| hypothetical protein EUTSA_v10028065mg [Eutrema salsugineum]
 gb|ESQ47342.1| hypothetical protein EUTSA_v10028065mg [Eutrema salsugineum]
Length=158

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 7/64 (11%)
 Frame = +3

Query  105  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  284
            + L L +   +F++EKAVC+HG FMMAPN W+P T++L +PL +S+         SV V 
Sbjct  3    LRLYLKEFEESFDMEKAVCNHGFFMMAPNIWNPKTRSLSQPLTVSNSS-------SVNVT  55

Query  285  VSHP  296
            +SHP
Sbjct  56   ISHP  59



>ref|WP_037411630.1| hypothetical protein, partial [Solirubrobacter sp. URHD0082]
Length=214

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 65/135 (48%), Gaps = 8/135 (6%)
 Frame = +1

Query  796   GVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSN  975
             G   FPSP  +AE  + F       GYR   +  +A  V E R+ ++ + +    P L +
Sbjct  74    GRRTFPSPAAMAEAGDDFYTGIAKAGYRGPYLRAIAADVAERRLDVEALAD----PALPD  129

Query  976   YDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVE  1155
               E+A +L  + G GP+ CA+ +M LG Y  +  DS T    +++  +S  T    K +E
Sbjct  130   A-EVAERLLALPGVGPYACAHTMMLLGRYGQLVLDSWTRPTYRRLSGRSRVT---DKGIE  185

Query  1156  AIYGKYAPFQFLVYW  1200
               + +Y  +  L +W
Sbjct  186   KAFRRYREYAGLAFW  200



>ref|WP_038476336.1| hypothetical protein [Bacillus lehensis]
 gb|AIC92906.1| glycosylase [Bacillus lehensis G1]
Length=284

 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 66/132 (50%), Gaps = 15/132 (11%)
 Frame = +1

Query  805   NFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDE  984
             +FP+P+ +    E+FL +    GYR+  I+N A   V    P + +     QP+  N+  
Sbjct  163   SFPTPQTILSAGEAFLMEHVRTGYRSHYILNAAHKAVNN--PARYL-----QPSALNH--  213

Query  985   LARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIY  1164
                  +EI G GP+    + M +G Y  +P DSE  +H+  +    +     + ++E++Y
Sbjct  214   ----FREIKGIGPYAMNTLAMIVGRYDGLPVDSEYKKHV--IGTYFNGIAPSKSELESVY  267

Query  1165  GKYAPFQFLVYW  1200
              K+  +++L YW
Sbjct  268   DKWGDYKYLAYW  279



>ref|XP_009626386.1| PREDICTED: uncharacterized protein LOC104117102 [Nicotiana tomentosiformis]
Length=144

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 44/79 (56%), Gaps = 8/79 (10%)
 Frame = +3

Query  135  TFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQS  314
            TF +EKAVC+HG FMMAPN W+P  K+  RPLRL+D         SV   +S P      
Sbjct  18   TFIIEKAVCNHGFFMMAPNCWEPSFKSFSRPLRLADS-------TSVMTSISQPPGK-DH  69

Query  315  LRLHVFGTDCLSAQQHQSL  371
            L + V+G   LS +   ++
Sbjct  70   LAVKVYGASILSLKDELAI  88



>gb|KDP47044.1| hypothetical protein JCGZ_10771 [Jatropha curcas]
Length=140

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 54/98 (55%), Gaps = 11/98 (11%)
 Frame = +3

Query  78   GDARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCA  257
            G  RR  V     LG +   F+LE  +C+HG FMMAPN W   TKTL+RPLRL      A
Sbjct  2    GYTRRLRVF----LGHSQFGFDLETTICNHGFFMMAPNKWISETKTLQRPLRL------A  51

Query  258  DHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSL  371
            +   S+ V +SH  ++P  + +HV   + L+    +++
Sbjct  52   NGIDSLVVSISHTPENPH-VDVHVHDVEILTEDDEEAI  88



>ref|XP_009124647.1| PREDICTED: uncharacterized protein LOC103849671 [Brassica rapa]
Length=162

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 7/51 (14%)
 Frame = +3

Query  144  LEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHP  296
            +EKAVC+HG FMMAPN WDP +K+L RPL LS+         SV+V +SHP
Sbjct  1    MEKAVCNHGFFMMAPNVWDPKSKSLTRPLTLSNSS-------SVSVTISHP  44



>ref|WP_011985101.1| iron-sulfur cluster assembly protein HesB [Anaeromyxobacter sp. 
Fw109-5]
 ref|YP_001377979.1| HhH-GPD family protein [Anaeromyxobacter sp. Fw109-5]
 gb|ABS24995.1| HhH-GPD family protein [Anaeromyxobacter sp. Fw109-5]
Length=325

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 66/152 (43%), Gaps = 10/152 (7%)
 Frame = +1

Query  769   EAVELNALNGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEE  948
             +A+   A  G   FP+P  +A + E F       GYRA  +  LAR V  G + L+ +  
Sbjct  173   DALGATAPLGTRAFPTPSAMASMPERFYRDEIRAGYRAPFLAALARDVASGALDLEGLRG  232

Query  949   CCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSS  1128
                +P     D LAR+++ + GFGP+   ++L  LG +  +  D+ T         +   
Sbjct  233   TA-EPT----DALARRIRALAGFGPYATEHLLRLLGRHDHLALDAWT--RPALARLRGRR  285

Query  1129  TLTVQKDVEAIYGKYAPFQFLVYWSEI---WH  1215
              +   + +   Y  Y  F  L  W E+   WH
Sbjct  286   RVPTDRALRRWYAPYGEFAGLAMWLEVTADWH  317



>emb|CDY11690.1| BnaC06g12980D [Brassica napus]
Length=212

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 7/51 (14%)
 Frame = +3

Query  144  LEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHP  296
            + KAVC+HG FMMAPN WDP +K+L RPL LS+         SV+V +SHP
Sbjct  1    MAKAVCNHGFFMMAPNVWDPKSKSLTRPLTLSNSS-------SVSVTISHP  44



>ref|WP_028243959.1| hypothetical protein [Pseudobutyrivibrio ruminis]
Length=278

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 72/139 (52%), Gaps = 14/139 (10%)
 Frame = +1

Query  805   NFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDE  984
             +FP P+ LA + ES L     LGYRA  II +++ VV+G + +K+I E         YDE
Sbjct  148   HFPKPQVLAFIPESELMDGTALGYRADYIIGISKQVVDGTLDIKKISEM-------EYDE  200

Query  985   LARQLKEIDGFGPFTCANVLMCLGYYHV--IPTDSETIRHLKQVHAKSSSTLTVQKDVEA  1158
                 L +I G GP   AN +M  G++ +   P D+     +K++ ++  S+ + +  ++ 
Sbjct  201   AMNNLLKIKGIGP-KVANCIMLYGFHFMESYPIDT----WMKKIISEDYSSYSKEDYLKY  255

Query  1159  IYGKYAPFQFLVYWSEIWH  1215
             I   Y+ FQ  V   + +H
Sbjct  256   INCSYSGFQGYVQQLQFYH  274



>ref|WP_012632149.1| iron-sulfur cluster assembly protein HesB [Anaeromyxobacter dehalogenans]
 ref|YP_002491195.1| HhH-GPD family protein [Anaeromyxobacter dehalogenans 2CP-1]
 gb|ACL64129.1| HhH-GPD family protein [Anaeromyxobacter dehalogenans 2CP-1]
Length=309

 Score = 60.8 bits (146),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 62/139 (45%), Gaps = 10/139 (7%)
 Frame = +1

Query  808   FPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDEL  987
             FP+   +A   E F       GYRA  ++ LARG  +G +   ++E   R P   + D L
Sbjct  171   FPTAEAMAARTERFYRDEIRAGYRAPFLLALARGAADGTL---DLEALRRSP--LDTDAL  225

Query  988   ARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIYG  1167
              R++  + GFGP+   ++L  LG +  +  DS T   L ++  K        + +   + 
Sbjct  226   GRRISGLKGFGPYATEHLLRLLGRHDHLALDSWTRPKLARLRGKRRP--PADRTLRRWFA  283

Query  1168  KYAPFQFLVYWSEI---WH  1215
              Y  +  L  W E+   WH
Sbjct  284   PYGRWAGLAMWLEVTADWH  302



>ref|WP_015549452.1| 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase 
[Butyrivibrio fibrisolvens]
 ref|YP_007819425.1| 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase 
[Butyrivibrio fibrisolvens 16/4]
 emb|CBK74359.1| 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase 
[Butyrivibrio fibrisolvens 16/4]
Length=279

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 69/139 (50%), Gaps = 14/139 (10%)
 Frame = +1

Query  805   NFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDE  984
             +FP P  LA + E+ L     LGYRA  II +++ V+EGR+   +IE   + P    Y++
Sbjct  148   HFPKPEVLAFVPETELMDGTALGYRADYIIGISKAVMEGRL---DIEAISQLP----YEQ  200

Query  985   LARQLKEIDGFGPFTCANVLMCLGYYHV--IPTDSETIRHLKQVHAKSSSTLTVQKDVEA  1158
                +L EI G GP   AN +M  G++ +   P D+     +K++  +     + +  +E 
Sbjct  201   AYEKLLEIKGIGP-KVANCIMLYGFHFMESYPIDT----WMKKIINEDYKEYSKEDYLEY  255

Query  1159  IYGKYAPFQFLVYWSEIWH  1215
             I   Y  FQ  V   + +H
Sbjct  256   INSSYGGFQGYVQQLQFYH  274



>ref|WP_027831953.1| hypothetical protein [Marinobacter sp. HL-58]
Length=281

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 71/154 (46%), Gaps = 15/154 (10%)
 Frame = +1

Query  742   CSSSDLHSAEAVELNALNGVGN--FPSPRELAELNESFLAKRCNLGYRAARIINLARGVV  915
             C+ +       V + +L  +GN  FP+P ++ E+    LA  C LG+RA  + N+   ++
Sbjct  127   CTINTTWQQTKVMVGSLVSLGNGLFPAPNDILEIGPDRLAGECKLGFRARTVTNVTVQLL  186

Query  916   EGRIPLKEIEECCRQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIR  1095
                +  +  +      +  NYD L      + G GP++ A+ +M L  +  +P DSE   
Sbjct  187   HDGVINQ--DGSAAGDSSVNYDYLTY----LKGIGPYSAAHAMMLLRDFSTLPVDSEVSA  240

Query  1096  HLKQVHAKSSSTLTVQKDVEAIYGKYAPFQFLVY  1197
             +L++    S       KD +  +  +  ++FL Y
Sbjct  241   YLRERGFDS-------KDAQEAFRHWGQYRFLGY  267



>ref|WP_006836275.1| DNA-3-methyladenine glycosylase [Bacillus sp. SG-1]
 gb|EDL65121.1| YfjP [Bacillus sp. SG-1]
Length=290

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 71/142 (50%), Gaps = 10/142 (7%)
 Frame = +1

Query  793   NGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLS  972
             +GV  +P P ++AEL+ S L +      +A  +I +++ + EGR+ L+E+EE   +    
Sbjct  152   DGVWFYPQPSDVAELDISELREMQFSQRKAEYVIGVSKEIAEGRLNLQELEEKSDE----  207

Query  973   NYDELARQLKEIDGFGPFTCANVLM-CLGYYHVIP-TDSETIRHLKQVHAKSSSTLTVQK  1146
                E+ ++L ++ G GP+T  N LM  LG  ++ P TD      LK+++         + 
Sbjct  208   ---EILKELVKLRGIGPWTAENYLMFALGRLNLFPKTDIGIQNALKKLYGMDRKPSLAEI  264

Query  1147  D-VEAIYGKYAPFQFLVYWSEI  1209
             D + A +  Y  +  L  W  I
Sbjct  265   DKMSAAWNPYLSYASLYLWRSI  286



>ref|WP_035109549.1| 8-oxoguanine DNA glycosylase [Finegoldia magna]
Length=294

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 76/147 (52%), Gaps = 15/147 (10%)
 Frame = +1

Query  781   LNALNG--VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECC  954
             L   NG  + +FP P +L ++    + + C +G+R  RI+++A+ V +    + EI+   
Sbjct  148   LGEFNGRKLYSFPKPEDLEKVPVEEMREVCRVGFRDKRIVDVAKMVADNEFDIFEID---  204

Query  955   RQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGY--YHVIPTDSETIRHLKQVHAKSSS  1128
                NLSN +EL ++L ++ G GP   A+ +M   Y  ++  P D    R ++ +  K  +
Sbjct  205   ---NLSN-EELRKELIKLPGVGP-KVADCIMLFSYNRHNTFPVDVWIKRVMEYLFIKEET  259

Query  1129  TLT-VQKDVEAIYGKYAPF--QFLVYW  1200
                 + K  + ++G YA +  Q+L Y+
Sbjct  260   NKNLIAKYADDLFGDYAGYAQQYLFYY  286



>gb|EFH92663.1| 8-oxoguanine DNA-glycosylase (ogg) [Finegoldia magna ATCC 53516]
Length=297

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 76/147 (52%), Gaps = 15/147 (10%)
 Frame = +1

Query  781   LNALNG--VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECC  954
             L   NG  + +FP P +L ++    + + C +G+R  RI+++A+ V +    + EI+   
Sbjct  151   LGEFNGRKLYSFPKPEDLEKVPVEEMREVCRVGFRDKRIVDVAKMVADNEFDIFEID---  207

Query  955   RQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGY--YHVIPTDSETIRHLKQVHAKSSS  1128
                NLSN +EL ++L ++ G GP   A+ +M   Y  ++  P D    R ++ +  K  +
Sbjct  208   ---NLSN-EELRKELIKLPGVGP-KVADCIMLFSYNRHNTFPVDVWIKRVMEYLFIKEET  262

Query  1129  TLT-VQKDVEAIYGKYAPF--QFLVYW  1200
                 + K  + ++G YA +  Q+L Y+
Sbjct  263   NKNLIAKYADDLFGDYAGYAQQYLFYY  289



>ref|WP_036207075.1| hypothetical protein [Marinobacter sp. MCTG268]
Length=286

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/134 (25%), Positives = 61/134 (46%), Gaps = 14/134 (10%)
 Frame = +1

Query  796   GVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSN  975
             G G FP P EL  +    LA+ C LG+RA  +  +   +++ +       +     ++ +
Sbjct  153   GDGLFPEPGELQTIGPRRLAEECKLGFRARTVDTVTDQLLQDQAIQT---DGSAHSDIID  209

Query  976   YDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVE  1155
             YD L      + G GP+  A+ +M +  +  +P DSE   +L+Q            KD +
Sbjct  210   YDYLI----SLKGIGPYAAAHTMMLMRDFETLPVDSEVSTYLRQQGFDP-------KDAQ  258

Query  1156  AIYGKYAPFQFLVY  1197
             + +  +  ++FL Y
Sbjct  259   SAFQHWGEYRFLGY  272



>ref|WP_028246747.1| hypothetical protein [Pseudobutyrivibrio ruminis]
Length=279

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 69/139 (50%), Gaps = 14/139 (10%)
 Frame = +1

Query  805   NFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDE  984
             +FP    L+ + E+ L     LGYRA  II +++ V  G +   +IE+  + P    YDE
Sbjct  148   HFPKAETLSYIPEAELMDGTALGYRADYIIGISQKVAAGEL---DIEKISKLP----YDE  200

Query  985   LARQLKEIDGFGPFTCANVLMCLGYYHV--IPTDSETIRHLKQVHAKSSSTLTVQKDVEA  1158
                +L EI G GP   AN +M  G++ +   P D+     +K++  +  S+ T  K +E 
Sbjct  201   AYGKLLEIKGIGP-KVANCIMLYGFHFMESYPIDT----WMKKIITEDYSSYTKDKYLEY  255

Query  1159  IYGKYAPFQFLVYWSEIWH  1215
             I   Y+ +Q  V   + +H
Sbjct  256   INDCYSGYQGYVQQLQFYH  274



>ref|WP_002841813.1| 8-oxoguanine DNA glycosylase [Finegoldia magna]
 gb|EGS33524.1| 8-oxoguanine DNA glycosylase, N-terminal domain protein [Finegoldia 
magna SY403409CC001050417]
Length=294

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 77/147 (52%), Gaps = 15/147 (10%)
 Frame = +1

Query  781   LNALNG--VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECC  954
             L   NG  + +FP P +LA++    + + C +G+R  RI+++++ V      + EI++  
Sbjct  148   LGDFNGRKLYSFPKPEDLAKVPVEEMREVCRVGFRDKRIVDVSKMVANNEFDILEIDK--  205

Query  955   RQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGY--YHVIPTDSETIRHLKQVHAKSSS  1128
                 LSN +EL ++L ++ G GP   A+ +M   Y  ++  P D    R ++ +  K  +
Sbjct  206   ----LSN-EELRKELIKLPGVGP-KVADCIMLFSYNRHNTFPVDVWIKRVMEYLFIKEDT  259

Query  1129  TLT-VQKDVEAIYGKYAPF--QFLVYW  1200
                 + K  + ++G+YA +  Q+L Y+
Sbjct  260   NKNLIAKYADDLFGEYAGYAQQYLFYY  286



>ref|WP_002837958.1| 8-oxoguanine DNA glycosylase [Finegoldia magna]
 gb|EFK93880.1| 8-oxoguanine DNA-glycosylase (ogg) [Finegoldia magna ACS-171-V-Col3]
Length=294

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 77/147 (52%), Gaps = 15/147 (10%)
 Frame = +1

Query  781   LNALNG--VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECC  954
             L   NG  + +FP P +LA++    + + C +G+R  RI+++++ V      + EI++  
Sbjct  148   LGDFNGRKLYSFPKPEDLAKVPVQEMREVCRVGFRDKRIVDVSKMVANNEFDILEIDK--  205

Query  955   RQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGY--YHVIPTDSETIRHLKQVHAKSSS  1128
                 LSN +EL ++L ++ G GP   A+ +M   Y  ++  P D    R ++ +  K  +
Sbjct  206   ----LSN-EELRKELIKLPGVGP-KVADCIMLFSYNRHNTFPVDVWIKRVMEYLFIKEET  259

Query  1129  TLT-VQKDVEAIYGKYAPF--QFLVYW  1200
                 + K  + ++G+YA +  Q+L Y+
Sbjct  260   NKNLIAKYADDLFGEYAGYAQQYLFYY  286



>ref|WP_012290689.1| 8-oxoguanine DNA glycosylase [Finegoldia magna]
 ref|YP_001692196.1| putative 8-oxoguanine DNA glycosylase [Finegoldia magna ATCC 
29328]
 dbj|BAG08306.1| putative 8-oxoguanine DNA glycosylase [Finegoldia magna ATCC 
29328]
Length=294

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 77/147 (52%), Gaps = 15/147 (10%)
 Frame = +1

Query  781   LNALNG--VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECC  954
             L   NG  + +FP P +LA++    + + C +G+R  RI+++++ V      + EI++  
Sbjct  148   LGDFNGRKLYSFPKPEDLAKVPVQEMREVCRVGFRDKRIVDVSKMVANNEFDILEIDK--  205

Query  955   RQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGY--YHVIPTDSETIRHLKQVHAKSSS  1128
                 LSN +EL ++L ++ G GP   A+ +M   Y  ++  P D    R ++ +  K  +
Sbjct  206   ----LSN-EELRKELIKLPGVGP-KVADCIMLFSYNRHNTFPVDVWIKRVMEYLFIKEET  259

Query  1129  TLT-VQKDVEAIYGKYAPF--QFLVYW  1200
                 + K  + ++G+YA +  Q+L Y+
Sbjct  260   NKNLIAKYADDLFGEYAGYAQQYLFYY  286



>gb|AIZ57281.1| hypothetical protein Mpt1_c14250 [Methanomassiliicoccales archaeon 
Mpt1]
Length=270

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 61/134 (46%), Gaps = 11/134 (8%)
 Frame = +1

Query  808   FPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDEL  987
             FP+P+++ +  E      C LGYR  R I LA     G I L+ I E       + Y E 
Sbjct  137   FPTPKQILDKQEEIPC--CRLGYRQDRFIELAERTENGAIDLEAIGE-------AGYSEC  187

Query  988   ARQLKEIDGFGPFTCANV-LMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVEAIY  1164
               +L EI+G GP     V L   G+    P D+   + L +++  + S   + +     +
Sbjct  188   VGRLIEINGVGPKVADCVALFGFGHLEAFPVDARISKCLNEMYGVTGSYKVMSEFGRKKF  247

Query  1165  GKYAPF-QFLVYWS  1203
             G+YA + Q  +Y S
Sbjct  248   GRYAGYAQEFLYHS  261



>ref|WP_002839100.1| 8-oxoguanine DNA glycosylase [Finegoldia magna]
 gb|EFL54913.1| 8-oxoguanine DNA-glycosylase (ogg) [Finegoldia magna BVS033A4]
Length=294

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 77/147 (52%), Gaps = 15/147 (10%)
 Frame = +1

Query  781   LNALNG--VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECC  954
             L   NG  + +FP P +LA++    + + C +G+R  RI+++++ V      + EI++  
Sbjct  148   LGDFNGRKLYSFPKPEDLAKVPVEEMREVCRVGFRDKRIVDVSKMVANNEFDILEIDK--  205

Query  955   RQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGY--YHVIPTDSETIRHLKQVHAKSSS  1128
                 LSN +EL ++L ++ G GP   A+ +M   Y  ++  P D    R ++ +  K  +
Sbjct  206   ----LSN-EELRKELIKLPGVGP-KVADCIMLFSYNRHNTFPVDVWIKRVMEYLFIKEET  259

Query  1129  TLT-VQKDVEAIYGKYAPF--QFLVYW  1200
                 + K  + ++G+YA +  Q+L Y+
Sbjct  260   NKNLIAKYADDLFGEYAGYAQQYLFYY  286



>ref|WP_035112658.1| 8-oxoguanine DNA glycosylase [Finegoldia magna]
 gb|EXF26582.1| 8-oxoguanine DNA glycosylase [Finegoldia magna ALB8]
Length=294

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 77/147 (52%), Gaps = 15/147 (10%)
 Frame = +1

Query  781   LNALNG--VGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECC  954
             L   NG  + +FP P +LA++    + + C +G+R  RI+++++ V      + EI++  
Sbjct  148   LGDFNGRKLYSFPKPEDLAKVPVEEMREVCRVGFRDKRIVDVSKMVANNEFDILEIDK--  205

Query  955   RQPNLSNYDELARQLKEIDGFGPFTCANVLMCLGY--YHVIPTDSETIRHLKQVHAKSSS  1128
                 LSN +EL ++L ++ G GP   A+ +M   Y  ++  P D    R ++ +  K  +
Sbjct  206   ----LSN-EELRKELIKLPGVGP-KVADCIMLFSYNRHNTFPVDVWIKRVMEYLFIKEET  259

Query  1129  TLT-VQKDVEAIYGKYAPF--QFLVYW  1200
                 + K  + ++G+YA +  Q+L Y+
Sbjct  260   NKNLIAKYADDLFGEYAGYAQQYLFYY  286



>ref|WP_003516777.1| 8-oxoguanine DNA glycosylase [Ruminiclostridium thermocellum]
 ref|YP_005689161.1| DNA-(apurinic or apyrimidinic site) lyase [Ruminiclostridium 
thermocellum DSM 1313]
 gb|EEU02103.1| DNA-(apurinic or apyrimidinic site) lyase [Ruminiclostridium 
thermocellum DSM 2360]
 gb|ADU75710.1| DNA-(apurinic or apyrimidinic site) lyase [Ruminiclostridium 
thermocellum DSM 1313]
 gb|EIC03746.1| 8-oxoguanine DNA glycosylase domain-containing protein [Ruminiclostridium 
thermocellum YS]
 gb|EIC12145.1| 8-oxoguanine DNA glycosylase domain-containing protein [Ruminiclostridium 
thermocellum AD2]
Length=295

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 68/136 (50%), Gaps = 12/136 (9%)
 Frame = +1

Query  808   FPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDEL  987
             FPS ++L+      L ++   G+R   I+N A+ V EG+I L   E+ C    +   D L
Sbjct  160   FPSAKQLSHATLEEL-EQTGAGFRCKYIMNAAKMVNEGKINL---EDVCSMDTVEARDFL  215

Query  988   ARQLKEIDGFGPFTCANVLMCLGY-YHVIPTDSETIRHLKQVHAKSSSTL-TVQKDVEAI  1161
              R     +G GP      L+  G  Y V PTD    R +++++ KS ++   +Q+     
Sbjct  216   MR----FEGVGPKVADCTLLYSGTKYDVFPTDVWVKRVMEELYFKSEASFGEIQEFARDY  271

Query  1162  YGKYAPF--QFLVYWS  1203
             +GKYA F  Q+L Y++
Sbjct  272   FGKYAGFAQQYLFYYA  287



>ref|XP_009102171.1| PREDICTED: uncharacterized protein LOC103828315 [Brassica rapa]
Length=162

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  144  LEKAVCSHGLFMMAPNHWDPLTKTLERPL  230
            +EKA C+HG FMMAPN WDP +K+L RP+
Sbjct  1    MEKAACNHGFFMMAPNGWDPKSKSLTRPM  29



>ref|WP_015505530.1| 8-oxoguanine-DNA-glycosylase [Candidatus Methanomethylophilus 
alvus]
 ref|YP_007714308.1| 8-oxoguanine-DNA-glycosylase [Candidatus Methanomethylophilus 
alvus Mx1201]
 gb|AGI86384.1| 8-oxoguanine-DNA-glycosylase [Candidatus Methanomethylophilus 
alvus Mx1201]
Length=263

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 64/137 (47%), Gaps = 13/137 (9%)
 Frame = +1

Query  808   FPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDEL  987
             FP+P+++ +  E      C LG+R  R I LA+    G I ++ +++         YD L
Sbjct  136   FPTPKQILDREECI--GECRLGFREHRFIELAQRTENGEIDIEGMKDL-------PYDGL  186

Query  988   ARQLKEIDGFGPFTCANVLMCLGYYHV--IPTDSETIRHLKQVHAKSSSTLTVQKDVEAI  1161
              ++L  I+G GP   A+ +   GY H+   P D      +K  +    +  TV      +
Sbjct  187   VKELMTINGVGP-KVADCVALFGYGHMEAFPVDVRIQNVMKAKYGVEGNYKTVSAYGRNL  245

Query  1162  YGKYAPF-QFLVYWSEI  1209
             +G+YA + Q  +Y SE 
Sbjct  246   FGEYAGYAQEFLYHSEF  262



>ref|WP_003514139.1| 8-oxoguanine DNA glycosylase [Ruminiclostridium thermocellum]
 ref|YP_001038468.1| 8-oxoguanine DNA glycosylase-like protein [Ruminiclostridium 
thermocellum ATCC 27405]
 gb|ABN53275.1| DNA-(apurinic or apyrimidinic site) lyase [Ruminiclostridium 
thermocellum ATCC 27405]
 gb|EFB37492.1| DNA-(apurinic or apyrimidinic site) lyase [Ruminiclostridium 
thermocellum JW20]
 emb|CDG36569.1| 8-oxoguanine DNA glycosylase-like protein [Ruminiclostridium 
thermocellum BC1]
Length=295

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 67/136 (49%), Gaps = 12/136 (9%)
 Frame = +1

Query  808   FPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDEL  987
             FPS ++L+      L ++   G+R   I+N A+ V EG+I L   E+ C    +   D L
Sbjct  160   FPSAKQLSHATLEEL-EQTGAGFRCKYIMNAAKMVNEGKINL---EDVCSMDTVEARDFL  215

Query  988   ARQLKEIDGFGPFTCANVLMCLGY-YHVIPTDSETIRHLKQVHAKSSSTL-TVQKDVEAI  1161
              R      G GP      L+  G  Y V PTD    R +++++ KS ++   +Q+     
Sbjct  216   MR----FQGVGPKVADCTLLYSGTKYDVFPTDVWVKRVMEELYFKSEASFGEIQEFARDY  271

Query  1162  YGKYAPF--QFLVYWS  1203
             +GKYA F  Q+L Y++
Sbjct  272   FGKYAGFAQQYLFYYA  287



>ref|WP_022532573.1| dNA-(Apurinic or apyrimidinic site) lyase [Methanoculleus sp. 
CAG:1088]
 emb|CDF30713.1| dNA-(Apurinic or apyrimidinic site) lyase [Methanoculleus sp. 
CAG:1088]
Length=265

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 64/137 (47%), Gaps = 13/137 (9%)
 Frame = +1

Query  808   FPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDEL  987
             FP+P+++ +  E      C LG+R  R I LA+    G I ++ +++         YD L
Sbjct  138   FPTPKQILDREECI--GECRLGFRERRFIELAQRTENGEIDIEGMKDL-------PYDGL  188

Query  988   ARQLKEIDGFGPFTCANVLMCLGYYHV--IPTDSETIRHLKQVHAKSSSTLTVQKDVEAI  1161
              ++L  I+G GP   A+ +   GY H+   P D      +K  +    +  TV      +
Sbjct  189   VKELMTINGVGP-KVADCVALFGYGHMEAFPVDVRIQNVMKAKYGVEGNYKTVSAYGRNL  247

Query  1162  YGKYAPF-QFLVYWSEI  1209
             +G+YA + Q  +Y SE 
Sbjct  248   FGEYAGYAQEFLYHSEF  264



>ref|WP_015247805.1| 3-methyladenine DNA glycosylase [Singulisphaera acidiphila]
 ref|YP_007204384.1| 3-methyladenine DNA glycosylase [Singulisphaera acidiphila DSM 
18658]
 gb|AGA28689.1| 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase 
[Singulisphaera acidiphila DSM 18658]
Length=312

 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 63/138 (46%), Gaps = 8/138 (6%)
 Frame = +1

Query  796   GVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSN  975
             G  +FP+P  +A L+   L      GYR+A +  LAR + E  + L    E  R+P   +
Sbjct  160   GEHSFPTPERVASLSVDALNDHVRAGYRSAYLSQLARAIAEEGLDL----ESWREPGTPS  215

Query  976   YDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDSETIRHLKQVHAKSSSTLTVQKDVE  1155
              D+L R+++ + GFG +   ++   LG +  +  DS      ++   ++   L   K + 
Sbjct  216   -DDLFRRIRGLKGFGEYAAGSMCRLLGTFDRLGLDSSCRASFRE---RNGGELASDKQIA  271

Query  1156  AIYGKYAPFQFLVYWSEI  1209
               Y  +  +  L  W ++
Sbjct  272   LYYEPFGEWCGLALWMDV  289



>ref|WP_028236501.1| hypothetical protein [Pseudobutyrivibrio sp. MD2005]
Length=278

 Score = 51.6 bits (122),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 67/139 (48%), Gaps = 14/139 (10%)
 Frame = +1

Query  805   NFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLSNYDE  984
             +FP    LA + E+ L     LGYRA  II +++ V+ G + +K I E        +Y+ 
Sbjct  148   HFPKAETLAYVPEAELMDGTALGYRADYIIGISKQVLAGSLDIKNISEM-------SYES  200

Query  985   LARQLKEIDGFGPFTCANVLMCLGYYHV--IPTDSETIRHLKQVHAKSSSTLTVQKDVEA  1158
                 L +I G GP   AN +M  G++ +   P D+     +K++ ++  S  T  + +  
Sbjct  201   AMASLLKIKGIGP-KVANCIMLYGFHFMESYPIDT----WMKKIISEDYSGYTKDEYLSY  255

Query  1159  IYGKYAPFQFLVYWSEIWH  1215
             +  KYA +Q  V   + +H
Sbjct  256   VNEKYAGYQGYVQQLQFYH  274



>ref|WP_020468712.1| hypothetical protein [Zavarzinella formosa]
Length=304

 Score = 51.6 bits (122),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 50/97 (52%), Gaps = 5/97 (5%)
 Frame = +1

Query  793   NGVGNFPSPRELAELNESFLAKRCNLGYRAARIINLARGVVEGRIPLKEIEECCRQPNLS  972
             +G+ +FP+P  +AE+  +   +    GYR+  +  LA  +V G    K   E  R P +S
Sbjct  159   DGLHSFPTPERIAEMPVNEFHEHVRAGYRSVWLHELATAIVAG----KTDPESWRTPTVS  214

Query  973   NYDELARQLKEIDGFGPFTCANVLMCLGYYHVIPTDS  1083
             + D L RQ+K + GFG +   ++   LG +  +  DS
Sbjct  215   SSD-LFRQIKTLKGFGDYAAGSMCRLLGRFDRLGLDS  250



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4101634907730