BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22834_g3_i1 len=1550 path=[11619:0-298 9453:299-1344 5385:1345-1388
8158:1389-1437 5478:1438-1549]

Length=1550
                                                                      Score     E

ref|XP_009795954.1|  PREDICTED: protein trichome birefringence-li...    492   2e-164   
ref|XP_006356414.1|  PREDICTED: uncharacterized protein LOC102583109    486   1e-162   
ref|XP_009591829.1|  PREDICTED: protein trichome birefringence-li...    481   7e-160   
ref|XP_004238644.1|  PREDICTED: protein trichome birefringence-li...    473   6e-158   
gb|EYU28435.1|  hypothetical protein MIMGU_mgv1a003426mg                452   3e-149   
ref|XP_006483906.1|  PREDICTED: protein YLS7-like                       447   3e-147   
ref|XP_006438320.1|  hypothetical protein CICLE_v10031033mg             447   3e-147   
gb|KDO82333.1|  hypothetical protein CISIN_1g007771mg                   447   3e-147   
ref|XP_008389689.1|  PREDICTED: protein trichome birefringence-li...    446   1e-146   
ref|XP_006378226.1|  hypothetical protein POPTR_0010s05310g             441   9e-146   
ref|XP_007157368.1|  hypothetical protein PHAVU_002G064300g             434   2e-143   
ref|XP_006302106.1|  hypothetical protein CARUB_v10020097mg             435   3e-143   
gb|KDP26622.1|  hypothetical protein JCGZ_17780                         436   7e-143   
ref|XP_011045285.1|  PREDICTED: protein trichome birefringence-li...    434   7e-143   
emb|CDP13190.1|  unnamed protein product                                435   3e-142   
ref|XP_009113182.1|  PREDICTED: protein trichome birefringence-li...    432   6e-142   
ref|XP_008340353.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    429   1e-141   
ref|XP_010473258.1|  PREDICTED: protein trichome birefringence-li...    430   3e-141   
dbj|BAD95134.1|  hypothetical protein                                   429   3e-141   Arabidopsis thaliana [mouse-ear cress]
gb|KEH27750.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    423   7e-141   
ref|XP_002525401.1|  conserved hypothetical protein                     430   8e-141   Ricinus communis
ref|XP_002265658.2|  PREDICTED: protein trichome birefringence-li...    432   9e-141   Vitis vinifera
ref|XP_004143065.1|  PREDICTED: uncharacterized protein LOC101210768    429   1e-140   
ref|NP_176278.2|  uncharacterized protein                               429   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004489803.1|  PREDICTED: uncharacterized protein LOC101513224    428   1e-140   
ref|XP_006392115.1|  hypothetical protein EUTSA_v10023395mg             427   3e-140   
ref|XP_007221982.1|  hypothetical protein PRUPE_ppa002834mg             430   4e-140   
ref|XP_010418022.1|  PREDICTED: protein trichome birefringence-li...    427   5e-140   
ref|XP_011086599.1|  PREDICTED: protein trichome birefringence-li...    428   7e-140   
ref|XP_003613189.1|  hypothetical protein MTR_5g033800                  423   4e-139   
gb|KFK40758.1|  hypothetical protein AALP_AA2G037100                    424   4e-139   
ref|XP_010510908.1|  PREDICTED: protein trichome birefringence-li...    424   5e-139   
emb|CDY69617.1|  BnaA09g53160D                                          424   6e-139   
gb|AAB71964.1|  Hypothetical protein                                    428   7e-139   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40499.1|  BnaC09g14570D                                          422   1e-138   
ref|XP_003517720.1|  PREDICTED: protein YLS7-like                       422   1e-138   
ref|XP_010251171.1|  PREDICTED: protein trichome birefringence-li...    426   2e-138   
emb|CBI28569.3|  unnamed protein product                                416   3e-138   
ref|XP_003519825.1|  PREDICTED: protein YLS7-like                       419   7e-137   
ref|XP_010553609.1|  PREDICTED: protein trichome birefringence-li...    419   8e-137   
ref|XP_008444354.1|  PREDICTED: protein trichome birefringence-li...    417   5e-136   
ref|XP_002886589.1|  hypothetical protein ARALYDRAFT_475253             415   1e-135   
ref|XP_010026659.1|  PREDICTED: protein trichome birefringence-li...    413   6e-135   
ref|XP_004298485.1|  PREDICTED: uncharacterized protein LOC101297725    416   6e-135   
ref|XP_004509571.1|  PREDICTED: uncharacterized protein LOC101508086    411   4e-133   
gb|KEH20203.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    409   4e-133   
ref|XP_008221854.1|  PREDICTED: protein trichome birefringence-li...    411   7e-133   
gb|KHN14559.1|  hypothetical protein glysoja_027168                     405   7e-132   
ref|XP_007044711.1|  Uncharacterized protein TCM_010432                 407   3e-131   
ref|XP_006602386.1|  PREDICTED: protein YLS7-like                       399   3e-129   
ref|XP_007153754.1|  hypothetical protein PHAVU_003G062400g             397   1e-128   
ref|XP_006585942.1|  PREDICTED: protein YLS7-like                       394   3e-127   
ref|XP_010682517.1|  PREDICTED: protein trichome birefringence-li...    385   4e-124   
ref|XP_010940155.1|  PREDICTED: protein trichome birefringence-li...    380   8e-121   
ref|XP_008812175.1|  PREDICTED: protein trichome birefringence-li...    376   2e-119   
ref|XP_010100425.1|  hypothetical protein L484_027736                   364   3e-116   
ref|XP_006841061.1|  hypothetical protein AMTR_s00085p00172090          352   1e-111   
ref|XP_009392183.1|  PREDICTED: protein trichome birefringence-li...    357   8e-111   
gb|KHN00372.1|  hypothetical protein glysoja_000040                     348   8e-110   
ref|NP_001053267.1|  Os04g0508000                                       353   1e-109   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67561.1|  OSIGBa0101P20.4                                        353   2e-109   Oryza sativa [red rice]
ref|XP_002448144.1|  hypothetical protein SORBIDRAFT_06g022030          351   1e-108   Sorghum bicolor [broomcorn]
ref|XP_004978124.1|  PREDICTED: uncharacterized protein LOC101771038    352   2e-108   
ref|XP_006849537.1|  hypothetical protein AMTR_s00024p00162030          350   5e-108   
gb|AFW58807.1|  putative DUF231 domain containing family protein        347   3e-107   
ref|XP_008663376.1|  PREDICTED: protein trichome birefringence-li...    347   5e-107   
ref|XP_008789200.1|  PREDICTED: protein trichome birefringence          343   4e-106   
emb|CCI55362.1|  PH01B035L11.7                                          343   6e-106   
gb|EMT28814.1|  hypothetical protein F775_14799                         342   2e-105   
ref|XP_010265940.1|  PREDICTED: protein trichome birefringence-like     339   4e-105   
ref|NP_001057100.1|  Os06g0207500                                       340   2e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009414351.1|  PREDICTED: protein trichome birefringence-li...    338   4e-104   
ref|XP_008679266.1|  PREDICTED: protein trichome birefringence-li...    339   7e-104   
dbj|BAD35858.1|  lustrin A-like                                         341   1e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010227191.1|  PREDICTED: protein trichome birefringence-li...    338   2e-103   
gb|EAZ36212.1|  hypothetical protein OsJ_20530                          341   2e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010932482.1|  PREDICTED: protein trichome birefringence-li...    336   2e-103   
gb|EMS61403.1|  hypothetical protein TRIUR3_19587                       337   8e-103   
ref|XP_004954083.1|  PREDICTED: cell wall protein AWA1-like             336   1e-102   
ref|XP_003560946.2|  PREDICTED: protein trichome birefringence-li...    338   2e-102   
ref|XP_009391441.1|  PREDICTED: protein trichome birefringence-like     334   4e-102   
ref|XP_006656749.1|  PREDICTED: mucin-19-like                           335   1e-101   
dbj|BAD16880.1|  hypothetical protein                                   332   2e-101   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87710.1|  hypothetical protein OsI_09124                          331   5e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_002454638.1|  hypothetical protein SORBIDRAFT_04g034670          332   6e-101   Sorghum bicolor [broomcorn]
ref|XP_008646340.1|  PREDICTED: protein trichome birefringence          331   7e-101   
gb|AFW73695.1|  putative DUF231 domain containing family protein        330   8e-101   
ref|XP_009417662.1|  PREDICTED: protein trichome birefringence-like     330   1e-100   
ref|XP_006649087.1|  PREDICTED: protein YLS7-like                       330   1e-100   
gb|KHN26901.1|  hypothetical protein glysoja_035540                     323   1e-100   
ref|XP_010917266.1|  PREDICTED: protein trichome birefringence          328   3e-100   
ref|XP_010673529.1|  PREDICTED: protein trichome birefringence-like     318   6e-100   
ref|XP_010257492.1|  PREDICTED: protein trichome birefringence          325   7e-100   
gb|KDO71838.1|  hypothetical protein CISIN_1g045325mg                   319   7e-100   
ref|NP_001141610.1|  uncharacterized protein LOC100273728               317   8e-100   Zea mays [maize]
ref|XP_006488998.1|  PREDICTED: protein YLS7-like                       320   1e-99    
dbj|BAK01401.1|  predicted protein                                      328   2e-99    
ref|XP_006854129.1|  hypothetical protein AMTR_s00048p00162020          322   2e-99    
ref|XP_002436669.1|  hypothetical protein SORBIDRAFT_10g006800          330   3e-99    Sorghum bicolor [broomcorn]
gb|AFW85381.1|  putative DUF231 domain containing family protein        330   3e-99    
ref|XP_002271893.1|  PREDICTED: protein trichome birefringence-li...    319   3e-99    Vitis vinifera
ref|XP_004964924.1|  PREDICTED: fibroin heavy chain-like                331   3e-99    
ref|XP_009587467.1|  PREDICTED: protein trichome birefringence-like     321   5e-99    
ref|XP_008791924.1|  PREDICTED: protein trichome birefringence-li...    327   7e-99    
ref|XP_009783417.1|  PREDICTED: protein trichome birefringence-li...    320   3e-98    
ref|XP_003573026.1|  PREDICTED: protein trichome birefringence          325   4e-98    
ref|XP_006357865.1|  PREDICTED: uncharacterized protein LOC102596807    322   5e-98    
ref|XP_009393972.1|  PREDICTED: protein trichome birefringence-li...    316   1e-97    
ref|XP_004228795.2|  PREDICTED: protein trichome birefringence-like     311   1e-97    
ref|XP_002519189.1|  conserved hypothetical protein                     315   2e-97    Ricinus communis
ref|XP_011100832.1|  PREDICTED: protein trichome birefringence-li...    314   3e-97    
ref|XP_002308359.2|  hypothetical protein POPTR_0006s20840g             316   3e-96    Populus trichocarpa [western balsam poplar]
ref|XP_007204980.1|  hypothetical protein PRUPE_ppa003027mg             315   6e-96    
ref|XP_009369426.1|  PREDICTED: protein trichome birefringence          315   7e-96    
ref|XP_008387218.1|  PREDICTED: protein trichome birefringence-like     315   9e-96    
ref|XP_010268038.1|  PREDICTED: protein trichome birefringence-li...    309   2e-95    
gb|EYU44005.1|  hypothetical protein MIMGU_mgv1a026273mg                308   3e-95    
ref|XP_010671195.1|  PREDICTED: protein trichome birefringence-li...    309   4e-95    
ref|XP_004296154.1|  PREDICTED: uncharacterized protein LOC101303316    310   4e-95    
ref|XP_009757308.1|  PREDICTED: protein trichome birefringence-like     315   5e-95    
ref|XP_008240911.1|  PREDICTED: protein trichome birefringence          312   7e-95    
ref|XP_010044971.1|  PREDICTED: protein trichome birefringence-li...    308   2e-94    
ref|XP_010557950.1|  PREDICTED: protein trichome birefringence-like     311   3e-94    
ref|XP_010498482.1|  PREDICTED: protein trichome birefringence-li...    309   3e-94    
ref|XP_011039468.1|  PREDICTED: protein trichome birefringence-like     311   3e-94    
ref|XP_011005287.1|  PREDICTED: protein trichome birefringence-like     311   4e-94    
ref|XP_004249181.1|  PREDICTED: protein trichome birefringence          312   4e-94    
ref|XP_007204224.1|  hypothetical protein PRUPE_ppa002919mg             310   7e-94    
ref|XP_004249290.1|  PREDICTED: protein trichome birefringence-like     308   7e-94    
gb|EYU17992.1|  hypothetical protein MIMGU_mgv1a025478mg                306   7e-94    
emb|CDO98793.1|  unnamed protein product                                305   9e-94    
ref|XP_009611858.1|  PREDICTED: protein trichome birefringence-like     310   1e-93    
ref|XP_010464957.1|  PREDICTED: protein trichome birefringence-li...    306   3e-93    
ref|XP_009375160.1|  PREDICTED: protein trichome birefringence-like     303   5e-93    
ref|XP_007162340.1|  hypothetical protein PHAVU_001G143600g             308   5e-93    
ref|XP_011075105.1|  PREDICTED: protein trichome birefringence-like     307   6e-93    
ref|XP_006351352.1|  PREDICTED: uncharacterized protein LOC102598...    308   7e-93    
ref|XP_008352661.1|  PREDICTED: protein trichome birefringence-li...    305   9e-93    
ref|XP_006399144.1|  hypothetical protein EUTSA_v10012993mg             306   9e-93    
ref|XP_008443032.1|  PREDICTED: protein trichome birefringence          306   1e-92    
ref|XP_010520026.1|  PREDICTED: protein trichome birefringence-like     307   1e-92    
ref|XP_002323329.2|  hypothetical protein POPTR_0016s05930g             306   1e-92    Populus trichocarpa [western balsam poplar]
ref|XP_002882764.1|  predicted protein                                  305   2e-92    
ref|XP_003520540.1|  PREDICTED: protein YLS7-like                       306   2e-92    
ref|XP_006351351.1|  PREDICTED: uncharacterized protein LOC102598...    308   2e-92    
ref|XP_008363351.1|  PREDICTED: protein trichome birefringence-li...    304   2e-92    
emb|CDX98947.1|  BnaC09g48880D                                          305   2e-92    
ref|XP_010486896.1|  PREDICTED: protein trichome birefringence-li...    303   4e-92    
ref|XP_002280022.1|  PREDICTED: protein trichome birefringence          306   5e-92    Vitis vinifera
ref|XP_008360191.1|  PREDICTED: protein trichome birefringence-li...    303   6e-92    
ref|XP_006395071.1|  hypothetical protein EUTSA_v10005359mg             300   8e-92    
ref|XP_009604045.1|  PREDICTED: protein trichome birefringence-like     305   9e-92    
emb|CDP10159.1|  unnamed protein product                                304   9e-92    
ref|XP_006362212.1|  PREDICTED: uncharacterized protein LOC102599885    306   9e-92    
ref|XP_010058223.1|  PREDICTED: protein trichome birefringence          305   9e-92    
ref|XP_007207689.1|  hypothetical protein PRUPE_ppa023743mg             301   2e-91    
emb|CDX70077.1|  BnaA10g24260D                                          302   2e-91    
ref|XP_009130955.1|  PREDICTED: protein trichome birefringence-like     303   2e-91    
ref|XP_004161492.1|  PREDICTED: uncharacterized protein LOC101228487    303   3e-91    
ref|XP_004136561.1|  PREDICTED: uncharacterized protein LOC101220024    303   3e-91    
ref|XP_011078818.1|  PREDICTED: protein trichome birefringence-like     303   3e-91    
ref|XP_009783309.1|  PREDICTED: protein trichome birefringence-like     304   4e-91    
emb|CDY05000.1|  BnaAnng01820D                                          300   4e-91    
gb|KDP24643.1|  hypothetical protein JCGZ_25559                         303   4e-91    
ref|XP_006355406.1|  PREDICTED: uncharacterized protein LOC102580314    298   4e-91    
emb|CDY55774.1|  BnaA03g55480D                                          300   4e-91    
ref|XP_008791066.1|  PREDICTED: protein trichome birefringence-li...    298   5e-91    
ref|XP_007011182.1|  Uncharacterized protein isoform 1                  301   7e-91    
ref|XP_008229144.1|  PREDICTED: protein trichome birefringence-li...    302   8e-91    
ref|XP_010111373.1|  hypothetical protein L484_028030                   301   8e-91    
ref|XP_002311402.2|  hypothetical protein POPTR_0008s10790g             294   8e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010920201.1|  PREDICTED: protein trichome birefringence-li...    297   1e-90    
ref|XP_007029023.1|  Emb:CAB82953.1, putative                           302   1e-90    
ref|XP_006407376.1|  hypothetical protein EUTSA_v10020451mg             299   1e-90    
ref|XP_009376704.1|  PREDICTED: protein trichome birefringence-li...    301   2e-90    
gb|EMS48369.1|  hypothetical protein TRIUR3_11824                       295   2e-90    
emb|CDY00034.1|  BnaC09g02670D                                          295   2e-90    
ref|XP_011083135.1|  PREDICTED: protein trichome birefringence-li...    299   4e-90    
ref|XP_004303340.1|  PREDICTED: uncharacterized protein LOC101308299    300   4e-90    
ref|XP_009364158.1|  PREDICTED: protein trichome birefringence-li...    300   6e-90    
emb|CDX81015.1|  BnaC03g02690D                                          296   6e-90    
ref|XP_009125778.1|  PREDICTED: protein trichome birefringence-like     296   7e-90    
gb|ABK28553.1|  unknown                                                 298   7e-90    Arabidopsis thaliana [mouse-ear cress]
ref|NP_187813.1|  protein TRICHOME BIREFRINGENCE-LIKE 1                 297   8e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CDY14070.1|  BnaC02g01870D                                          294   8e-90    
ref|XP_006282292.1|  hypothetical protein CARUB_v10028578mg             294   9e-90    
gb|KFK25082.1|  hypothetical protein AALP_AA8G063700                    298   9e-90    
ref|XP_010672635.1|  PREDICTED: protein trichome birefringence-li...    298   1e-89    
ref|NP_199745.1|  protein TRICHOME BIREFRINGENCE-LIKE                   294   1e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122281.1|  PREDICTED: protein trichome birefringence          299   1e-89    
ref|XP_002534436.1|  conserved hypothetical protein                     297   1e-89    Ricinus communis
gb|EPS66265.1|  hypothetical protein M569_08511                         290   1e-89    
ref|XP_010535816.1|  PREDICTED: protein trichome birefringence-li...    295   2e-89    
ref|XP_003535115.1|  PREDICTED: protein YLS7-like                       297   2e-89    
ref|XP_003553434.1|  PREDICTED: protein YLS7-like                       298   2e-89    
gb|KFK26585.1|  hypothetical protein AALP_AA8G267500                    293   3e-89    
ref|XP_006299462.1|  hypothetical protein CARUB_v10015627mg             296   3e-89    
ref|XP_002534536.1|  conserved hypothetical protein                     298   3e-89    Ricinus communis
ref|XP_008361466.1|  PREDICTED: protein trichome birefringence-li...    298   4e-89    
gb|KHN37297.1|  hypothetical protein glysoja_013512                     295   4e-89    
ref|XP_011037956.1|  PREDICTED: protein trichome birefringence-like     295   4e-89    
ref|XP_006590231.1|  PREDICTED: protein YLS7-like                       295   4e-89    
ref|XP_010442398.1|  PREDICTED: protein trichome birefringence-li...    292   5e-89    
ref|XP_002871228.1|  hypothetical protein ARALYDRAFT_487481             296   7e-89    
ref|XP_006492844.1|  PREDICTED: protein YLS7-like                       297   8e-89    
ref|XP_004229072.1|  PREDICTED: protein trichome birefringence-li...    292   8e-89    
ref|XP_011020489.1|  PREDICTED: protein trichome birefringence-li...    292   8e-89    
emb|CDY08459.1|  BnaA05g26950D                                          295   1e-88    
ref|XP_010491248.1|  PREDICTED: protein trichome birefringence-like     296   1e-88    
ref|XP_004497358.1|  PREDICTED: uncharacterized protein LOC101512304    293   2e-88    
ref|XP_004493599.1|  PREDICTED: uncharacterized protein LOC101511851    295   2e-88    
ref|NP_568173.2|  protein TRICHOME BIREFRINGENCE                        295   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003555633.2|  PREDICTED: protein YLS7-like                       293   2e-88    
emb|CDY49608.1|  BnaA09g03300D                                          290   2e-88    
ref|XP_009111874.1|  PREDICTED: protein trichome birefringence-li...    290   3e-88    
ref|XP_010482212.1|  PREDICTED: protein trichome birefringence-li...    290   3e-88    
gb|KHG04354.1|  CAS1 domain-containing 1                                293   3e-88    
ref|XP_003625280.1|  hypothetical protein MTR_7g093450                  294   3e-88    
ref|XP_010452610.1|  PREDICTED: protein trichome birefringence          295   3e-88    
ref|XP_006287297.1|  hypothetical protein CARUB_v10000490mg             295   4e-88    
ref|XP_006429897.1|  hypothetical protein CICLE_v10011263mg             295   5e-88    
gb|EYU39954.1|  hypothetical protein MIMGU_mgv1a008556mg                286   6e-88    
ref|XP_007035738.1|  Trichome birefringence-like 4                      289   9e-88    
gb|KFK38572.1|  hypothetical protein AALP_AA3G130900                    291   9e-88    
emb|CDY72094.1|  BnaCnng75930D                                          291   1e-87    
ref|XP_002865730.1|  hypothetical protein ARALYDRAFT_331346             288   1e-87    
ref|XP_006575204.1|  PREDICTED: protein YLS7-like                       293   1e-87    
gb|KEH16599.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    290   2e-87    
gb|ADI48429.1|  trichome birefringence                                  292   3e-87    
emb|CDY05635.1|  BnaC02g39020D                                          288   3e-87    
ref|XP_004497886.1|  PREDICTED: uncharacterized protein LOC101512080    290   3e-87    
gb|KDP44302.1|  hypothetical protein JCGZ_19169                         286   4e-87    
ref|XP_009146650.1|  PREDICTED: protein trichome birefringence-li...    290   5e-87    
ref|XP_011017737.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    289   5e-87    
gb|AES97753.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    289   6e-87    
ref|XP_007145701.1|  hypothetical protein PHAVU_007G261000g             292   1e-86    
ref|XP_003592794.1|  hypothetical protein MTR_1g116130                  289   1e-86    
ref|XP_004502134.1|  PREDICTED: uncharacterized protein LOC101510392    286   1e-86    
ref|XP_002308095.2|  hypothetical protein POPTR_0006s07090g             287   2e-86    Populus trichocarpa [western balsam poplar]
gb|AES91931.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    286   2e-86    
emb|CDY33914.1|  BnaA02g30730D                                          285   2e-86    
ref|XP_009129778.1|  PREDICTED: protein trichome birefringence-li...    285   2e-86    
ref|XP_011020096.1|  PREDICTED: protein trichome birefringence-li...    286   3e-86    
ref|XP_009763711.1|  PREDICTED: protein trichome birefringence-li...    287   3e-86    
ref|XP_002297655.2|  hypothetical protein POPTR_0001s04810g             287   4e-86    Populus trichocarpa [western balsam poplar]
ref|XP_006366199.1|  PREDICTED: uncharacterized protein LOC102583...    286   4e-86    
gb|KHG05807.1|  Pyridoxal-phosphate-dependent serine hydroxymethy...    283   6e-86    
ref|XP_006657213.1|  PREDICTED: protein YLS7-like                       282   7e-86    
ref|XP_002324663.2|  hypothetical protein POPTR_0018s13290g             285   8e-86    Populus trichocarpa [western balsam poplar]
ref|XP_004296155.1|  PREDICTED: uncharacterized protein LOC101303602    293   9e-86    
gb|EPS65088.1|  hypothetical protein M569_09686                         286   9e-86    
ref|XP_006366198.1|  PREDICTED: uncharacterized protein LOC102583...    286   1e-85    
ref|XP_011069938.1|  PREDICTED: protein trichome birefringence-li...    286   1e-85    
ref|XP_010265394.1|  PREDICTED: protein trichome birefringence-li...    284   2e-85    
gb|KFK38571.1|  hypothetical protein AALP_AA3G130800                    290   3e-85    
ref|XP_010259297.1|  PREDICTED: protein trichome birefringence-li...    283   4e-85    
ref|XP_010107044.1|  hypothetical protein L484_003589                   284   5e-85    
ref|XP_002437399.1|  hypothetical protein SORBIDRAFT_10g026240          283   5e-85    Sorghum bicolor [broomcorn]
gb|KHG20627.1|  CAS1 domain-containing 1                                285   5e-85    
ref|XP_010046898.1|  PREDICTED: protein trichome birefringence-li...    282   6e-85    
ref|XP_006419433.1|  hypothetical protein CICLE_v10006676mg             280   9e-85    
ref|XP_006840447.1|  hypothetical protein AMTR_s00045p00169080          280   1e-84    
ref|XP_009610815.1|  PREDICTED: protein trichome birefringence-li...    283   1e-84    
ref|XP_006845734.1|  hypothetical protein AMTR_s00019p00245310          275   1e-84    
ref|XP_004243016.1|  PREDICTED: protein trichome birefringence-li...    283   2e-84    
ref|XP_003560398.1|  PREDICTED: protein trichome birefringence-li...    280   2e-84    
ref|XP_007154672.1|  hypothetical protein PHAVU_003G138100g             280   2e-84    
ref|XP_008649021.1|  PREDICTED: protein trichome birefringence-li...    281   5e-84    
gb|KHN17657.1|  hypothetical protein glysoja_005854                     279   5e-84    
ref|XP_003550638.1|  PREDICTED: protein YLS7-like                       279   5e-84    
ref|XP_007222250.1|  hypothetical protein PRUPE_ppa004735mg             280   1e-83    
ref|XP_008223825.1|  PREDICTED: protein trichome birefringence-li...    280   1e-83    
ref|XP_009394684.1|  PREDICTED: protein trichome birefringence-li...    278   2e-83    
emb|CDP03007.1|  unnamed protein product                                281   2e-83    
ref|XP_010544965.1|  PREDICTED: protein trichome birefringence-li...    278   2e-83    
ref|XP_002268396.1|  PREDICTED: protein trichome birefringence-li...    280   3e-83    Vitis vinifera
ref|XP_010687461.1|  PREDICTED: protein trichome birefringence-li...    277   4e-83    
emb|CBW30176.1|  Conserved hypothetical protein                         277   5e-83    
ref|XP_006453211.1|  hypothetical protein CICLE_v10008256mg             276   5e-83    
emb|CBW30214.1|  Conserved hypothetical protein                         277   5e-83    
gb|KHG14015.1|  CAS1 domain-containing 1                                277   6e-83    
ref|XP_006474304.1|  PREDICTED: protein YLS7-like                       277   6e-83    
gb|EYU37306.1|  hypothetical protein MIMGU_mgv1a022803mg                277   9e-83    
emb|CDY16546.1|  BnaC09g37270D                                          276   1e-82    
emb|CDX76633.1|  BnaC08g32190D                                          276   1e-82    
gb|KDP35862.1|  hypothetical protein JCGZ_10642                         278   2e-82    
emb|CBI17853.3|  unnamed protein product                                271   2e-82    
ref|XP_006400622.1|  hypothetical protein EUTSA_v10013361mg             276   2e-82    
ref|XP_008781812.1|  PREDICTED: protein trichome birefringence-li...    276   2e-82    
ref|XP_003541536.1|  PREDICTED: protein YLS7-like                       275   4e-82    
emb|CDY11418.1|  BnaA09g39840D                                          275   4e-82    
ref|XP_007014486.1|  Trichome birefringence-like 5 isoform 1            274   4e-82    
ref|XP_010913702.1|  PREDICTED: protein trichome birefringence-li...    275   5e-82    
emb|CDX92451.1|  BnaA10g14900D                                          275   6e-82    
ref|XP_009342821.1|  PREDICTED: protein trichome birefringence-li...    275   7e-82    
ref|XP_006349183.1|  PREDICTED: uncharacterized protein LOC102598625    276   8e-82    
ref|XP_009120795.1|  PREDICTED: protein trichome birefringence-li...    275   9e-82    
ref|NP_001058264.1|  Os06g0659400                                       273   1e-81    
gb|KHN22642.1|  hypothetical protein glysoja_027530                     273   1e-81    
ref|XP_010420901.1|  PREDICTED: protein trichome birefringence-li...    274   2e-81    
gb|AAM64322.1|  unknown                                                 273   2e-81    
ref|XP_008450807.1|  PREDICTED: protein trichome birefringence-li...    273   2e-81    
ref|XP_002878459.1|  hypothetical protein ARALYDRAFT_486743             273   2e-81    
ref|XP_002862720.1|  hypothetical protein ARALYDRAFT_497319             273   2e-81    
ref|XP_006402380.1|  hypothetical protein EUTSA_v10005925mg             273   2e-81    
ref|XP_004299786.1|  PREDICTED: uncharacterized protein LOC101312731    273   3e-81    
ref|XP_006287593.1|  hypothetical protein CARUB_v10000803mg             273   3e-81    
ref|XP_009120981.1|  PREDICTED: protein trichome birefringence-li...    274   3e-81    
ref|XP_010558437.1|  PREDICTED: protein trichome birefringence-li...    272   3e-81    
ref|NP_197559.1|  protein trichome birefringence-like 5                 273   3e-81    
ref|XP_003609734.1|  hypothetical protein MTR_4g121560                  272   4e-81    
ref|XP_009116908.1|  PREDICTED: protein trichome birefringence-li...    272   4e-81    
ref|XP_010087235.1|  hypothetical protein L484_009744                   273   5e-81    
ref|XP_002871948.1|  hypothetical protein ARALYDRAFT_488963             272   7e-81    
ref|XP_010454365.1|  PREDICTED: protein trichome birefringence-li...    272   7e-81    
ref|XP_002527690.1|  conserved hypothetical protein                     273   1e-80    
gb|KFK35420.1|  hypothetical protein AALP_AA5G282000                    271   1e-80    
gb|EMT28517.1|  hypothetical protein F775_15700                         269   1e-80    
ref|XP_004507925.1|  PREDICTED: uncharacterized protein LOC101489...    271   1e-80    
ref|XP_004150389.1|  PREDICTED: uncharacterized protein LOC101212427    271   2e-80    
ref|XP_009604954.1|  PREDICTED: protein trichome birefringence-li...    272   2e-80    
ref|XP_010493164.1|  PREDICTED: protein trichome birefringence-li...    271   2e-80    
gb|EPS60512.1|  hypothetical protein M569_14291                         271   2e-80    
gb|KFK26286.1|  hypothetical protein AALP_AA8G228100                    271   2e-80    
ref|XP_010267992.1|  PREDICTED: protein trichome birefringence-li...    270   3e-80    
ref|XP_003610012.1|  hypothetical protein MTR_4g126950                  269   3e-80    
ref|XP_010038289.1|  PREDICTED: protein trichome birefringence-li...    271   3e-80    
ref|XP_006444502.1|  hypothetical protein CICLE_v100200871mg            268   3e-80    
ref|XP_006290990.1|  hypothetical protein CARUB_v10017104mg             268   2e-79    
ref|XP_007051109.1|  Trichome birefringence-like 6                      270   3e-79    
gb|KCW59798.1|  hypothetical protein EUGRSUZ_H02546                     260   3e-79    
ref|XP_004229386.1|  PREDICTED: protein trichome birefringence-li...    269   4e-79    
ref|XP_011079550.1|  PREDICTED: protein trichome birefringence-li...    269   5e-79    
ref|XP_010523922.1|  PREDICTED: protein trichome birefringence-li...    267   6e-79    
ref|XP_006492340.1|  PREDICTED: protein YLS7-like                       268   6e-79    
ref|XP_002301513.2|  hypothetical protein POPTR_0002s19680g             267   7e-79    
ref|XP_002467977.1|  hypothetical protein SORBIDRAFT_01g037455          267   9e-79    
ref|NP_191798.1|  protein trichome birefringence-like 6                 266   1e-78    
ref|XP_002515280.1|  conserved hypothetical protein                     268   2e-78    
ref|XP_010512629.1|  PREDICTED: protein trichome birefringence-li...    265   2e-78    
ref|XP_004984615.1|  PREDICTED: uncharacterized protein LOC101785375    270   2e-78    
gb|KDP28262.1|  hypothetical protein JCGZ_14033                         268   2e-78    
gb|EPS68903.1|  hypothetical protein M569_05864                         262   2e-78    
ref|XP_007142667.1|  hypothetical protein PHAVU_007G006500g             266   2e-78    
ref|XP_010468959.1|  PREDICTED: protein trichome birefringence-li...    265   3e-78    
gb|AFK44929.1|  unknown                                                 265   4e-78    
emb|CDP17066.1|  unnamed protein product                                266   4e-78    
ref|XP_010693998.1|  PREDICTED: protein trichome birefringence-li...    262   6e-78    
ref|XP_009783488.1|  PREDICTED: protein trichome birefringence-li...    265   8e-78    
gb|KHN19212.1|  hypothetical protein glysoja_041564                     260   1e-77    
ref|XP_010413281.1|  PREDICTED: protein trichome birefringence-li...    263   1e-77    
ref|XP_009378730.1|  PREDICTED: protein trichome birefringence-li...    265   2e-77    
gb|EPS62559.1|  hypothetical protein M569_12231                         263   2e-77    
dbj|BAK07580.1|  predicted protein                                      267   2e-77    
ref|XP_010679388.1|  PREDICTED: protein trichome birefringence-li...    264   2e-77    
ref|XP_009418554.1|  PREDICTED: protein trichome birefringence-li...    262   3e-77    
ref|XP_004984616.1|  PREDICTED: uncharacterized protein LOC101785781    265   6e-77    
gb|EYU46810.1|  hypothetical protein MIMGU_mgv1a005200mg                262   6e-77    
ref|XP_003561699.1|  PREDICTED: protein trichome birefringence-li...    266   7e-77    
ref|XP_011042254.1|  PREDICTED: protein trichome birefringence-li...    263   1e-76    
ref|XP_009384431.1|  PREDICTED: protein trichome birefringence-li...    263   1e-76    
ref|XP_008660213.1|  PREDICTED: protein trichome birefringence-li...    265   2e-76    
ref|XP_003520751.1|  PREDICTED: protein YLS7-like                       261   2e-76    
ref|XP_004494426.1|  PREDICTED: uncharacterized protein LOC101501...    260   2e-76    
ref|XP_003625972.1|  hypothetical protein MTR_7g109550                  260   2e-76    
ref|XP_003553667.1|  PREDICTED: protein YLS7-like                       259   6e-76    
gb|EAY89710.1|  hypothetical protein OsI_11248                          261   8e-76    
ref|XP_008235216.1|  PREDICTED: protein trichome birefringence-li...    259   9e-76    
ref|NP_001049898.2|  Os03g0307700                                       261   2e-75    
ref|XP_010671194.1|  PREDICTED: protein trichome birefringence-li...    256   3e-75    
gb|AAM67355.1|  unknown                                                 252   3e-75    
emb|CBI36952.3|  unnamed protein product                                256   3e-75    
ref|XP_008369046.1|  PREDICTED: protein trichome birefringence-li...    258   4e-75    
ref|XP_010652247.1|  PREDICTED: protein trichome birefringence-li...    256   1e-74    
ref|XP_004301795.1|  PREDICTED: uncharacterized protein LOC101300923    256   1e-74    
ref|XP_010942466.1|  PREDICTED: protein trichome birefringence-li...    254   2e-74    
ref|XP_007201163.1|  hypothetical protein PRUPE_ppa004056mg             256   3e-74    
ref|XP_008781112.1|  PREDICTED: protein trichome birefringence-li...    257   4e-74    
ref|XP_010670899.1|  PREDICTED: protein trichome birefringence-li...    251   6e-74    
ref|XP_006664334.1|  PREDICTED: protein YLS7-like                       248   1e-72    
emb|CBX25391.1|  hypothetical_protein                                   247   2e-72    
gb|EEC68856.1|  hypothetical protein OsI_37453                          248   2e-72    
ref|NP_001066145.1|  Os12g0145400                                       248   3e-72    
emb|CBX24452.1|  hypothetical_protein                                   248   4e-72    
ref|XP_010931950.1|  PREDICTED: protein trichome birefringence-li...    249   4e-72    
emb|CBI30004.3|  unnamed protein product                                243   7e-72    
ref|XP_007163180.1|  hypothetical protein PHAVU_001G213200g             249   1e-71    
gb|ABR16389.1|  unknown                                                 247   2e-71    
ref|XP_002871866.1|  hypothetical protein ARALYDRAFT_351018             246   4e-71    
ref|NP_197417.1|  protein trichome birefringence-like 11                246   4e-71    
ref|XP_004296926.1|  PREDICTED: uncharacterized protein LOC101310689    245   6e-71    
ref|XP_006649967.1|  PREDICTED: uncharacterized protein LOC102700223    249   9e-71    
ref|XP_004149267.1|  PREDICTED: uncharacterized protein LOC101220391    244   9e-71    
gb|EAZ01954.1|  hypothetical protein OsI_23985                          245   1e-70    
ref|XP_008454494.1|  PREDICTED: protein trichome birefringence-li...    246   1e-70    
dbj|BAJ93336.1|  predicted protein                                      240   1e-70    
ref|XP_008458564.1|  PREDICTED: protein trichome birefringence-li...    244   1e-70    
ref|XP_008793675.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    243   2e-70    
ref|XP_010921490.1|  PREDICTED: protein trichome birefringence-li...    247   2e-70    
ref|XP_004164982.1|  PREDICTED: uncharacterized LOC101220002            242   2e-70    
ref|XP_010420710.1|  PREDICTED: protein trichome birefringence-li...    243   3e-70    
ref|XP_010492967.1|  PREDICTED: protein trichome birefringence-li...    243   3e-70    
ref|XP_004152223.1|  PREDICTED: uncharacterized protein LOC101220002    244   6e-70    
ref|XP_009412789.1|  PREDICTED: protein trichome birefringence-li...    242   7e-70    
ref|XP_006287694.1|  hypothetical protein CARUB_v10000904mg             242   1e-69    
ref|XP_010454183.1|  PREDICTED: protein trichome birefringence-li...    241   1e-69    
gb|KDP40121.1|  hypothetical protein JCGZ_02119                         241   2e-69    
gb|KCW90321.1|  hypothetical protein EUGRSUZ_A02463                     243   2e-69    
gb|ADE76095.1|  unknown                                                 241   2e-69    
gb|EYU45620.1|  hypothetical protein MIMGU_mgv1a026217mg                240   2e-69    
ref|XP_003578929.1|  PREDICTED: protein trichome birefringence-li...    241   2e-69    
dbj|BAJ99077.1|  predicted protein                                      241   2e-69    
ref|XP_010906887.1|  PREDICTED: protein trichome birefringence-li...    241   3e-69    
ref|XP_008797040.1|  PREDICTED: protein trichome birefringence-li...    239   3e-69    
ref|XP_008790984.1|  PREDICTED: protein trichome birefringence-li...    241   4e-69    
ref|XP_002467978.1|  hypothetical protein SORBIDRAFT_01g037460          244   7e-69    
gb|EMS45859.1|  hypothetical protein TRIUR3_33009                       238   1e-68    
ref|XP_006399143.1|  hypothetical protein EUTSA_v10012993mg             238   2e-68    
gb|KFK26160.1|  hypothetical protein AALP_AA8G211000                    238   3e-68    
ref|XP_006349228.1|  PREDICTED: uncharacterized protein LOC102584626    237   5e-68    
ref|XP_002520761.1|  conserved hypothetical protein                     238   5e-68    
gb|KFK38044.1|  hypothetical protein AALP_AA3G062900                    238   5e-68    
gb|EMT22532.1|  hypothetical protein F775_19187                         237   5e-68    
ref|NP_566270.1|  protein TRICHOME BIREFRINGENCE-LIKE 10                234   6e-68    
ref|XP_010486094.1|  PREDICTED: protein trichome birefringence-li...    237   7e-68    
ref|XP_006297589.1|  hypothetical protein CARUB_v10013611mg             237   7e-68    
ref|XP_009410411.1|  PREDICTED: protein trichome birefringence-li...    237   8e-68    
ref|XP_010486093.1|  PREDICTED: protein trichome birefringence-li...    237   9e-68    
ref|XP_004229426.1|  PREDICTED: protein trichome birefringence-li...    236   9e-68    
ref|XP_009587134.1|  PREDICTED: protein trichome birefringence-li...    236   9e-68    
ref|XP_007200128.1|  hypothetical protein PRUPE_ppa017879mg             243   1e-67    
ref|XP_007050644.1|  Trichome birefringence-like 11 isoform 2           243   2e-67    
ref|XP_007050643.1|  Trichome birefringence-like 11 isoform 1           243   2e-67    
ref|XP_009779052.1|  PREDICTED: protein trichome birefringence-li...    235   2e-67    
ref|XP_006407985.1|  hypothetical protein EUTSA_v10020661mg             236   3e-67    
ref|XP_010435819.1|  PREDICTED: protein trichome birefringence-li...    236   3e-67    
gb|EEE51654.1|  hypothetical protein OsJ_32966                          234   3e-67    
ref|XP_006400475.1|  hypothetical protein EUTSA_v10013457mg             235   3e-67    
ref|XP_010464175.1|  PREDICTED: protein trichome birefringence-li...    236   3e-67    
ref|XP_010464174.1|  PREDICTED: protein trichome birefringence-li...    236   3e-67    
ref|XP_010435750.1|  PREDICTED: protein trichome birefringence-li...    235   3e-67    
ref|NP_974235.1|  protein TRICHOME BIREFRINGENCE-LIKE 10                235   3e-67    
ref|XP_009134870.1|  PREDICTED: protein trichome birefringence-li...    235   4e-67    
ref|XP_010551768.1|  PREDICTED: protein trichome birefringence-li...    235   4e-67    
gb|ABA91480.2|  expressed protein                                       235   5e-67    
ref|XP_007147753.1|  hypothetical protein PHAVU_006G152100g             237   5e-67    
emb|CBX25505.1|  hypothetical_protein                                   235   5e-67    
ref|XP_011090776.1|  PREDICTED: protein trichome birefringence-li...    234   9e-67    
ref|XP_004247157.1|  PREDICTED: protein trichome birefringence-li...    233   2e-66    
emb|CDY58337.1|  BnaA03g57390D                                          233   2e-66    
ref|XP_010094001.1|  hypothetical protein L484_007347                   233   2e-66    
gb|KCW84266.1|  hypothetical protein EUGRSUZ_B01121                     229   2e-66    
ref|XP_003541625.2|  PREDICTED: protein YLS7-like                       233   2e-66    
emb|CDO99006.1|  unnamed protein product                                232   2e-66    
ref|XP_010070234.1|  PREDICTED: protein trichome birefringence-li...    232   3e-66    
ref|XP_008390840.1|  PREDICTED: protein trichome birefringence-li...    232   4e-66    
ref|XP_002884558.1|  hypothetical protein ARALYDRAFT_896718             232   4e-66    
ref|XP_008351230.1|  PREDICTED: protein trichome birefringence-li...    232   4e-66    
ref|XP_009338476.1|  PREDICTED: protein trichome birefringence-li...    232   5e-66    
ref|XP_010240099.1|  PREDICTED: protein trichome birefringence-li...    231   5e-66    
ref|XP_004978659.1|  PREDICTED: uncharacterized protein LOC101774156    231   6e-66    
ref|XP_006489319.1|  PREDICTED: protein YLS7-like isoform X2            229   7e-66    
gb|KHN37582.1|  hypothetical protein glysoja_007285                     231   7e-66    
ref|XP_010684255.1|  PREDICTED: protein trichome birefringence-li...    231   7e-66    
ref|XP_011082552.1|  PREDICTED: protein trichome birefringence-li...    228   7e-66    
gb|KCW60835.1|  hypothetical protein EUGRSUZ_H03574                     231   9e-66    
ref|XP_011071665.1|  PREDICTED: protein trichome birefringence-li...    231   9e-66    
ref|XP_010024392.1|  PREDICTED: protein trichome birefringence-li...    231   9e-66    
ref|XP_007225765.1|  hypothetical protein PRUPE_ppa005540mg             231   1e-65    
ref|XP_010278184.1|  PREDICTED: protein trichome birefringence-li...    231   1e-65    
ref|XP_009405954.1|  PREDICTED: protein trichome birefringence-li...    230   1e-65    
ref|XP_008340925.1|  PREDICTED: protein trichome birefringence-li...    230   2e-65    
ref|XP_009129639.1|  PREDICTED: protein trichome birefringence-li...    230   3e-65    
ref|XP_006489318.1|  PREDICTED: protein YLS7-like isoform X1            230   3e-65    
ref|XP_010546847.1|  PREDICTED: protein trichome birefringence-li...    229   3e-65    
ref|XP_007034643.1|  Trichome birefringence-like 11 isoform 2           229   3e-65    
gb|EYU41525.1|  hypothetical protein MIMGU_mgv1a021660mg                230   3e-65    
ref|XP_003554245.1|  PREDICTED: protein YLS7-like                       229   4e-65    
ref|XP_007034642.1|  Trichome birefringence-like 11 isoform 1           229   4e-65    
gb|KDO70900.1|  hypothetical protein CISIN_1g037533mg                   224   4e-65    
ref|XP_008222980.1|  PREDICTED: protein trichome birefringence-li...    229   4e-65    
ref|XP_010035521.1|  PREDICTED: protein trichome birefringence-li...    229   5e-65    
ref|XP_006419843.1|  hypothetical protein CICLE_v10004949mg             227   5e-65    
emb|CDX92550.1|  BnaA10g15890D                                          229   5e-65    
ref|XP_009364196.1|  PREDICTED: protein trichome birefringence-li...    229   5e-65    
ref|XP_009120909.1|  PREDICTED: protein trichome birefringence-li...    229   5e-65    
ref|XP_008222981.1|  PREDICTED: protein trichome birefringence-li...    229   5e-65    
emb|CDY13982.1|  BnaC09g38440D                                          229   7e-65    
emb|CDY27711.1|  BnaA05g31200D                                          229   8e-65    
ref|XP_009378728.1|  PREDICTED: protein trichome birefringence-li...    227   9e-65    
ref|XP_004977553.1|  PREDICTED: uncharacterized protein LOC101774406    228   1e-64    
ref|XP_006419844.1|  hypothetical protein CICLE_v10004949mg             228   1e-64    
gb|EMS65860.1|  hypothetical protein TRIUR3_17105                       231   1e-64    
ref|XP_002517183.1|  conserved hypothetical protein                     228   2e-64    
ref|XP_011082551.1|  PREDICTED: protein trichome birefringence-li...    227   2e-64    
ref|XP_006366978.1|  PREDICTED: uncharacterized protein LOC102602041    228   2e-64    
emb|CDY05229.1|  BnaC05g45740D                                          228   2e-64    
ref|XP_010649869.1|  PREDICTED: protein trichome birefringence-li...    225   2e-64    
ref|XP_006352779.1|  PREDICTED: uncharacterized protein LOC102598...    227   2e-64    
gb|KHN19883.1|  hypothetical protein glysoja_033515                     226   2e-64    



>ref|XP_009795954.1| PREDICTED: protein trichome birefringence-like 2 [Nicotiana sylvestris]
Length=621

 Score =   492 bits (1267),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 248/349 (71%), Positives = 280/349 (80%), Gaps = 16/349 (5%)
 Frame = +1

Query  526   GNFSGEAKDGSF-----GLWKKTHELNRSEIGKNVNFTGFTEKKGDGSGKN--GGFSLEG  684
             GNF    K+GSF     G+ K T +LN S I  N+ F+ F+     GS  +  GG +   
Sbjct  166   GNFFENVKNGSFVVQESGITKNTPQLNGSCIDGNITFSNFSGASDIGSVNSNVGGPTYVE  225

Query  685   ETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGEN-GSELLRKGRSFYSDCDIFD  861
             + V S    NG+R +   V V I  KG  S  +N  IG N G  L+ +G+ FY DCDIFD
Sbjct  226   DVVGS----NGERKK---VAV-IEGKGGVSVERNGGIGSNDGKSLIGRGKDFYGDCDIFD  277

Query  862   GEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERL  1041
             GEWVRDDTKP+YPPGSCP IDRDFDCHL+KRPDD Y+KWRW+P+ACDIPS NATDFLERL
Sbjct  278   GEWVRDDTKPHYPPGSCPIIDRDFDCHLNKRPDDGYIKWRWQPYACDIPSLNATDFLERL  337

Query  1042  RGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSV  1221
             RGQKLVFVGDSLNRNMWESLVCILRH +RDKKRV+EISGR +FKKKGFYAFRFEDYNCSV
Sbjct  338   RGQKLVFVGDSLNRNMWESLVCILRHSIRDKKRVYEISGRHEFKKKGFYAFRFEDYNCSV  397

Query  1222  DFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGED  1401
             DFVSSPFLVR+S+FKG NGSFETLRLDLM+KTTSMY+DADIVIFNTGHWWTHEKTSRGED
Sbjct  398   DFVSSPFLVRQSAFKGKNGSFETLRLDLMEKTTSMYSDADIVIFNTGHWWTHEKTSRGED  457

Query  1402  YYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             YYQEGN VH RL+VLEAYKRAL TWARWVDKN+D +RT++ FRGYSATH
Sbjct  458   YYQEGNHVHARLKVLEAYKRALSTWARWVDKNLDGSRTQIFFRGYSATH  506



>ref|XP_006356414.1| PREDICTED: uncharacterized protein LOC102583109 [Solanum tuberosum]
Length=570

 Score =   486 bits (1250),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 275/466 (59%), Positives = 318/466 (68%), Gaps = 61/466 (13%)
 Frame = +1

Query  301   MELKKHAFSGQFLQHAFLPRRKF--SGCWRLSvaaaffmvgvavLNFSFKAPFFNPVVQG  474
             M+LKK  FS         PRRK   SG + L VAA+F  V + +LN+SFK+PF  PV  G
Sbjct  1     MDLKKLPFSDS------SPRRKVVVSG-FGLGVAASFIFVCILLLNYSFKSPFVTPVFTG  53

Query  475   LNG--------------FGYRNATVCCSPP------EGNFSGEA-----KDGSFG-----  564
              +               F + NA+V  S         GNFS +      + G F      
Sbjct  54    FSYSDNNNSNSTLISWPFSFSNASVSLSSKASHNVENGNFSVQETKKIDESGIFSNLEEK  113

Query  565   --LWKKTHELNRSEIGKNVNF----TGFTEKKGDGSGKNGGFSLEGETVKSE--------  702
               +   TH LN SE  KN +F    +G   KK  GS  +G  ++ G    ++        
Sbjct  114   GEILGNTHVLNFSEKVKNRSFLVQESGIV-KKTHGSEIDGNGTVLGIQDSTKYNVTSTYI  172

Query  703   ----GSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEW  870
                 GS  GDR +   V V   K G S      +   +G  L+R+ + FY DCD++DGEW
Sbjct  173   EDVVGSSGGDRKK---VAVGEGKGGLSVEKNGVLFQSDGESLIRRDKDFYGDCDVYDGEW  229

Query  871   VRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQ  1050
             VRDDTKPYYPPGSCP IDRDFDCHL+KRPDD Y+KWRW+P+ACDIPS NATDFLERLRGQ
Sbjct  230   VRDDTKPYYPPGSCPIIDRDFDCHLNKRPDDEYIKWRWQPYACDIPSLNATDFLERLRGQ  289

Query  1051  KLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFV  1230
             KLVFVGDSLNRNMWESLVCILRH +RDKKRV+EISGR +FKKKGFYAFRFEDYNCSVDFV
Sbjct  290   KLVFVGDSLNRNMWESLVCILRHSIRDKKRVYEISGRHEFKKKGFYAFRFEDYNCSVDFV  349

Query  1231  SSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQ  1410
             SSPFLVR+S+FKG NGSFETLRLDLMDKTTSMY+DADIVIFNTGHWWTHEKTSRGEDYYQ
Sbjct  350   SSPFLVRQSTFKGKNGSFETLRLDLMDKTTSMYSDADIVIFNTGHWWTHEKTSRGEDYYQ  409

Query  1411  EGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             EGN VH RL+VLEAYKRA+ TWARWVD+N   +RT+VIFRGYS TH
Sbjct  410   EGNHVHGRLKVLEAYKRAISTWARWVDQNFGGSRTQVIFRGYSVTH  455



>ref|XP_009591829.1| PREDICTED: protein trichome birefringence-like 2 [Nicotiana tomentosiformis]
Length=622

 Score =   481 bits (1237),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 239/349 (68%), Positives = 276/349 (79%), Gaps = 16/349 (5%)
 Frame = +1

Query  526   GNFSGEAKDGSF-----GLWKKTHELNRSEIGKNVNFTGFTEKKGDGS-GKNGGFSLEGE  687
             GNF    K+GSF     G+ K + +LN + I  ++ F+ F+     GS   N G     E
Sbjct  167   GNFFENVKNGSFVVQESGIPKNSPQLNGTHIDGDITFSNFSGATDIGSVNSNVGTPTYVE  226

Query  688   TVKSEGSENGDRSRSRGVGVEISK-KGTSSTVKNDMIGEN-GSELLRKGRSFYSDCDIFD  861
              V      NG+R +     V +++ KG  S  +N  IG N G  L  +G+ FY DCDIFD
Sbjct  227   DVVGS---NGERKK-----VAVTEGKGGVSVEQNGGIGSNDGKSLTGRGKDFYGDCDIFD  278

Query  862   GEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERL  1041
             GEWVRDDTKP+YPPGSCP IDRDFDCHL+KRPDD Y+KWRW+P+ACDIPS NATDFLERL
Sbjct  279   GEWVRDDTKPHYPPGSCPIIDRDFDCHLNKRPDDGYIKWRWQPYACDIPSLNATDFLERL  338

Query  1042  RGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSV  1221
             RGQKLVFVGDSLNRNMWESLVCILRH +R+KKRV+EISGR +FKKKGFYAFRFEDYNCSV
Sbjct  339   RGQKLVFVGDSLNRNMWESLVCILRHSIREKKRVYEISGRHEFKKKGFYAFRFEDYNCSV  398

Query  1222  DFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGED  1401
             DFVSSPFLVR+S+FKG NG FETLRLD+M+KTTSMY+DADI+IFNTGHWWTHEKTSRGED
Sbjct  399   DFVSSPFLVRQSAFKGKNGPFETLRLDMMEKTTSMYSDADIIIFNTGHWWTHEKTSRGED  458

Query  1402  YYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             YYQEGN VH RL+VLEAYKRAL TWARWVDKN+D +RT++ FRGYSATH
Sbjct  459   YYQEGNHVHARLKVLEAYKRALSTWARWVDKNLDGSRTQIFFRGYSATH  507



>ref|XP_004238644.1| PREDICTED: protein trichome birefringence-like 2 [Solanum lycopersicum]
Length=543

 Score =   473 bits (1217),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 244/400 (61%), Positives = 291/400 (73%), Gaps = 32/400 (8%)
 Frame = +1

Query  427   LNFSFKAPFFNPVVQGLNG--------------FGYRNATVCCSPP---EGNFSGEAKDG  555
             L +S K+PF  PV    +               F + NA+V  S      GNFS    D 
Sbjct  38    LKYSSKSPFLIPVFSYSDNNNNNNSNSTLISWPFAFSNASVSLSSKASHSGNFSTNKIDE  97

Query  556   SFGLWKKTHEL----NRSEIGKNVNFTGFTEKKGDGS----GKNGGFSLEGETVKSEGSE  711
             S G++    E+    + SE  KN +F    ++ G+G+      +  +++    ++     
Sbjct  98    S-GIFSNFGEILGNPHVSEKVKNESF--LVQESGNGTVLSIQDSTNYNVTSTYIEDVVGL  154

Query  712   NGDRSRSRGVGVEISKKGTSSTVKNDMI-GENGSELLRKGRSFYSDCDIFDGEWVRDDTK  888
             +G   +   VG     KG+    KN ++   +G  L+R+ R FY DCD++DGEWVRDDTK
Sbjct  155   SGGDRKKVAVG---EGKGSLPVEKNAVLFKSDGESLIRRHRDFYGDCDVYDGEWVRDDTK  211

Query  889   PYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVG  1068
             PYYPPGSCP IDRDFDCHL+KRPDD Y+KWRW+P+ACDIPS NATDFLERLRGQKLVFVG
Sbjct  212   PYYPPGSCPMIDRDFDCHLNKRPDDEYIKWRWQPYACDIPSLNATDFLERLRGQKLVFVG  271

Query  1069  DSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLV  1248
             DSLNRNMWESLVCILRH +RDK+RV+EISGR +FKKKGFYAFRFEDYNCSVDFVSSPFLV
Sbjct  272   DSLNRNMWESLVCILRHSIRDKRRVYEISGRHEFKKKGFYAFRFEDYNCSVDFVSSPFLV  331

Query  1249  RESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVH  1428
             R+S+FKG NGSFETLRLDLMDKTTSMY+DADIVIFNTGHWWTHEKTSRGEDYYQEGN VH
Sbjct  332   RQSTFKGKNGSFETLRLDLMDKTTSMYSDADIVIFNTGHWWTHEKTSRGEDYYQEGNHVH  391

Query  1429  PRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
              RL+VLEAYKRA+ TWARWVD+N D +R++VIFRGYS TH
Sbjct  392   GRLKVLEAYKRAISTWARWVDQNFDGSRSQVIFRGYSVTH  431



>gb|EYU28435.1| hypothetical protein MIMGU_mgv1a003426mg [Erythranthe guttata]
Length=586

 Score =   452 bits (1163),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 260/491 (53%), Positives = 310/491 (63%), Gaps = 68/491 (14%)
 Frame = +1

Query  226   LGFGFQCFSGLGSRETVERKKERKGMELKKHAFSGQFLQHAFLPRRKFSGCWRLSvaaaf  405
             +GFGF   SGL +            M+LKK AF  Q L     PRRK    +   V  +F
Sbjct  2     VGFGFS--SGLSA------------MDLKKLAFPDQILSS---PRRKVVSPFGFGVLLSF  44

Query  406   fmvgvavLNFSFKAPFFNPVVQGLNGFGYR-NATVCCSPPEGNFSGEAKDG---------  555
              +    + N S K P  NPV QGL  FG R N++    P  G F+    +G         
Sbjct  45    IVFCAVLFNISSKGPLSNPVFQGLYSFGSRKNSSSISWPFSGVFNNSTANGGNETSTVNS  104

Query  556   -------SFGLWKKTHELNRSEIGKNV---NFTGFTEKKGDGSGKNGGFSLEGETVKSEG  705
                    +  +  K+ +L  S    NV      G   K G  S  NG   ++   + S+ 
Sbjct  105   LNETLLPNVAVSNKSLDLIESGEKGNVFEKAHLGNESKNGSFSKLNGSQPVKNPVLVSDS  164

Query  706   ----------SENGDRSRSRG-------VGVEISKKGTSSTVKNDMIGE-------NGSE  813
                       S+NG  S+  G       V V  S  GT S V + + G+        G+ 
Sbjct  165   VNGTESGVNESKNGSFSKLNGSQPVKNPVLVIDSVNGTESVVGDSVNGDCSGREDSGGNS  224

Query  814   LLRK------GRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVK  975
              L K      GRS Y +CDIF+G+WVRDD+KPYYPPGSCP+IDRDFDCH + RPD  +VK
Sbjct  225   CLPKIESSGNGRS-YKNCDIFNGKWVRDDSKPYYPPGSCPYIDRDFDCHSNGRPDTEFVK  283

Query  976   WRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEIS  1155
             WRW+P  CD+P  N T+FLE LRG+KLVFVGDSLNRNMWESLVC+LRH V DK RV+EIS
Sbjct  284   WRWQPFDCDMPRLNVTNFLEILRGKKLVFVGDSLNRNMWESLVCVLRHGVEDKNRVYEIS  343

Query  1156  GRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYND  1335
             GR +FKKKGFYAFRFEDYNCS+DFVSSPFLV+ESSF G NGSFETLRLDLMD TTSMY+D
Sbjct  344   GRHEFKKKGFYAFRFEDYNCSIDFVSSPFLVKESSFNGKNGSFETLRLDLMDGTTSMYHD  403

Query  1336  ADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRT  1515
             AD++IFNTGHWWTHEKTSRGE YYQEGN VHPRL+VLEAYKRA+ TWA+WVDKN+D+N+T
Sbjct  404   ADVIIFNTGHWWTHEKTSRGEGYYQEGNHVHPRLKVLEAYKRAIITWAKWVDKNIDSNKT  463

Query  1516  EVIFRGYSATH  1548
             EVIFRGYS TH
Sbjct  464   EVIFRGYSVTH  474



>ref|XP_006483906.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=590

 Score =   447 bits (1150),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 256/491 (52%), Positives = 305/491 (62%), Gaps = 91/491 (19%)
 Frame = +1

Query  301   MELKKHAFSGQFLQHAFLPRRKFSGCWRLSvaaaffmvgvavLNFSFKAPFFNPVVQGLN  480
             ME +K AF+ Q L     PRRK    + L VAA   +  V +L+ S KAP  +P+ QG N
Sbjct  1     MESRKVAFTEQLLS----PRRKVVSGFGLGVAATVIVFVVLLLSNSLKAPAVSPLFQGFN  56

Query  481   ---------------GFGYRNATV------------------CCSPPEG-----------  528
                             F +  A                        P+G           
Sbjct  57    LVRVINNNSSRVVSWPFSFTTAVSNDTGVSVSGGRQADSSVDLVGKPQGANVSNEIAHLG  116

Query  529   NFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGSG--KNGGFSLEGETVKSE  702
             N + EA+ GS        E N S + +N NF+  +  K + S    NG F +E      E
Sbjct  117   NLTQEAEVGSI------LEANASAVSRNGNFSDSSADKVNFSHTVNNGSFPVE------E  164

Query  703   GSENGDRS-------RSRGVGVE-------ISKKGTSSTVKNDMIGENGS----------  810
             G   G+ S        S+ +G +       ++ K   +    +  G+ GS          
Sbjct  165   GRSCGNCSLVVKGDVNSKEIGSQFVNNTSYVNSKVPDNNNVTNFSGDGGSLNDSNNKITN  224

Query  811   -----ELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVK  975
                  E  +   S Y  C+IFDG WVRDD+KPYYPPGSCP+IDRDFDCHL+ RPDD +VK
Sbjct  225   PRYDSEPTKMHGSSYDKCNIFDGRWVRDDSKPYYPPGSCPYIDRDFDCHLNGRPDDGFVK  284

Query  976   WRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEIS  1155
             W+W+P+ CDIPS NATDFLERLRG+KLVFVGDSLNRNMWESLVCILR+ +R+KKRV+EIS
Sbjct  285   WKWQPNGCDIPSLNATDFLERLRGKKLVFVGDSLNRNMWESLVCILRNSIRNKKRVYEIS  344

Query  1156  GRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYND  1335
             GR +FKKKGFYAF FEDYNC+VDFVSSPFLVRESSF G NG+FETLRLDLMD+TTSMY D
Sbjct  345   GRREFKKKGFYAFIFEDYNCTVDFVSSPFLVRESSFTGRNGTFETLRLDLMDRTTSMYQD  404

Query  1336  ADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRT  1515
             AD++IFNTGHWWTHEKTSRGEDYYQEGN VHPRL+VLEAYKRAL TWARWVDKNVD NRT
Sbjct  405   ADVIIFNTGHWWTHEKTSRGEDYYQEGNFVHPRLKVLEAYKRALTTWARWVDKNVDHNRT  464

Query  1516  EVIFRGYSATH  1548
             +V FRGYS TH
Sbjct  465   KVFFRGYSVTH  475



>ref|XP_006438320.1| hypothetical protein CICLE_v10031033mg [Citrus clementina]
 gb|ESR51560.1| hypothetical protein CICLE_v10031033mg [Citrus clementina]
Length=590

 Score =   447 bits (1150),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 256/491 (52%), Positives = 305/491 (62%), Gaps = 91/491 (19%)
 Frame = +1

Query  301   MELKKHAFSGQFLQHAFLPRRKFSGCWRLSvaaaffmvgvavLNFSFKAPFFNPVVQGLN  480
             ME +K AF+ Q L     PRRK    + L VAA   +  V +L+ S KAP  +P+ QG N
Sbjct  1     MESRKVAFTEQLLS----PRRKVVSGFGLGVAATVIVFVVLLLSNSLKAPAVSPLFQGFN  56

Query  481   ---------------GFGYRNATV------------------CCSPPEG-----------  528
                             F +  A                        P+G           
Sbjct  57    LVRVINNNSSRVVSWPFSFTTAVSNDTGVSVSGGRQADSSVDLVGKPQGANVSNEIAHLG  116

Query  529   NFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGSG--KNGGFSLEGETVKSE  702
             N + EA+ GS        E N S + +N NF+  +  K   S    NG F +E      E
Sbjct  117   NLTQEAEVGSI------LEANASAVSRNGNFSDSSADKVKFSHTVNNGSFPVE------E  164

Query  703   GSENGDRS-------RSRGVGVE-------ISKKGTSSTVKNDMIGENGS----------  810
             G   G+ S        S+ +G +       ++ K   +    ++ G+ GS          
Sbjct  165   GRSCGNCSLVVKGDVNSKEIGSQFVNNTSYVNSKVPDNNNVTNLSGDGGSLNDSNNKITN  224

Query  811   -----ELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVK  975
                  E  +   S Y  C+IFDG WVRDD+KPYYPPGSCP+IDRDFDCHL+ RPDD +VK
Sbjct  225   PRYDSEPTKMHGSSYDKCNIFDGRWVRDDSKPYYPPGSCPYIDRDFDCHLNGRPDDGFVK  284

Query  976   WRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEIS  1155
             W+W+P+ CDIPS NATDFLERLRG+KLVFVGDSLNRNMWESLVCILR+ +R+KKRV+EIS
Sbjct  285   WKWQPNGCDIPSLNATDFLERLRGKKLVFVGDSLNRNMWESLVCILRNSIRNKKRVYEIS  344

Query  1156  GRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYND  1335
             GR +FKKKGFYAF FEDYNC+VDFVSSPFLVRESSF G NG+FETLRLDLMD+TTSMY D
Sbjct  345   GRREFKKKGFYAFIFEDYNCTVDFVSSPFLVRESSFTGRNGTFETLRLDLMDRTTSMYQD  404

Query  1336  ADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRT  1515
             AD++IFNTGHWWTHEKTSRGEDYYQEGN VHPRL+VLEAYKRAL TWARWVDKNVD NRT
Sbjct  405   ADVIIFNTGHWWTHEKTSRGEDYYQEGNFVHPRLKVLEAYKRALTTWARWVDKNVDHNRT  464

Query  1516  EVIFRGYSATH  1548
             +V FRGYS TH
Sbjct  465   KVFFRGYSVTH  475



>gb|KDO82333.1| hypothetical protein CISIN_1g007771mg [Citrus sinensis]
Length=590

 Score =   447 bits (1150),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 256/491 (52%), Positives = 305/491 (62%), Gaps = 91/491 (19%)
 Frame = +1

Query  301   MELKKHAFSGQFLQHAFLPRRKFSGCWRLSvaaaffmvgvavLNFSFKAPFFNPVVQGLN  480
             ME +K AF+ Q L     PRRK    + L VAA   +  V +L+ S KAP  +P+ QG N
Sbjct  1     MESRKVAFTEQLLS----PRRKVVSGFGLGVAATVIVFVVLLLSNSLKAPAVSPLFQGFN  56

Query  481   ---------------GFGYRNATV------------------CCSPPEG-----------  528
                             F +  A                        P+G           
Sbjct  57    LVRVINNNSSRVVSWPFSFTTAVSNDTGVSVSGGRQADSSVDLVGKPQGANVSNEIAHLG  116

Query  529   NFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGSG--KNGGFSLEGETVKSE  702
             N + EA+ GS        E N S + +N NF+  +  K + S    NG F +E      E
Sbjct  117   NLTQEAEVGSI------LEANASAVSRNGNFSDSSADKVNFSHTVNNGSFPVE------E  164

Query  703   GSENGDRS-------RSRGVGVE-------ISKKGTSSTVKNDMIGENGS----------  810
             G   G+ S        S+ +G +       ++ K   +    +  G+ GS          
Sbjct  165   GRSCGNCSLVVKGDVNSKEIGSQFVNNTSYVNSKVPDNNNVTNFSGDGGSLNDSNNKITN  224

Query  811   -----ELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVK  975
                  E  +   S Y  C+IFDG WVRDD+KPYYPPGSCP+IDRDFDCHL+ RPDD +VK
Sbjct  225   PRYDSEPTKMHGSSYDKCNIFDGRWVRDDSKPYYPPGSCPYIDRDFDCHLNGRPDDGFVK  284

Query  976   WRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEIS  1155
             W+W+P+ CDIPS NATDFLERLRG+KLVFVGDSLNRNMWESLVCILR+ +R+KKRV+EIS
Sbjct  285   WKWQPNGCDIPSLNATDFLERLRGKKLVFVGDSLNRNMWESLVCILRNSIRNKKRVYEIS  344

Query  1156  GRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYND  1335
             GR +FKKKGFYAF FEDYNC+VDFVSSPFLVRESSF G NG+FETLRLDLMD+TTSMY D
Sbjct  345   GRREFKKKGFYAFIFEDYNCTVDFVSSPFLVRESSFTGRNGTFETLRLDLMDRTTSMYQD  404

Query  1336  ADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRT  1515
             AD++IFNTGHWWTHEKTSRGEDYYQEGN VHPRL+VLEAYKRAL TWARWVDKNVD NRT
Sbjct  405   ADVIIFNTGHWWTHEKTSRGEDYYQEGNFVHPRLKVLEAYKRALTTWARWVDKNVDHNRT  464

Query  1516  EVIFRGYSATH  1548
             +V FRGYS TH
Sbjct  465   KVFFRGYSVTH  475



>ref|XP_008389689.1| PREDICTED: protein trichome birefringence-like 2 [Malus domestica]
Length=595

 Score =   446 bits (1146),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 232/392 (59%), Positives = 275/392 (70%), Gaps = 41/392 (10%)
 Frame = +1

Query  487   GYRNATVCCSPPEGNFSGEAKDGSFG----LWKKTHELNRSEIGKNVNF-----------  621
             G +N T    P  GNF+ E KDGSFG    + K+ +    S I +N NF           
Sbjct  92    GKQNFTDLEKPHLGNFTEEGKDGSFGVGGEMGKQKNSEKGSAIAENGNFLNSNGGGTSLE  151

Query  622   ------TGFTEKKGDGSGK----NGGFSLEG-ETVKSEGSENGDRSRSR----GVGVEIS  756
                   +    K G   G+    NG  SL G E + +E +  G  SR+     G   +I 
Sbjct  152   IAHLGNSSEVSKNGSLHGEEGRVNGNLSLSGKEDMHAEKAVEGSFSRNTSSVDGNAAKIV  211

Query  757   KKGTS--------STVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSC  912
             KK  +        STVK   I +  S++ +     Y  CDIF+G WVRDD+KPYYP GSC
Sbjct  212   KKKRAWKAAHRGNSTVK---IADYDSQMGKMQTDLYQKCDIFNGRWVRDDSKPYYPGGSC  268

Query  913   PFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMW  1092
             P+IDRDF+CHL+ R D A++KW+W+P+ CDIPS NATDFL RLRG++LVFVGDSLNRNMW
Sbjct  269   PYIDRDFNCHLNGRADSAFIKWKWQPNECDIPSLNATDFLMRLRGKRLVFVGDSLNRNMW  328

Query  1093  ESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGV  1272
             ESLVCILRHV+R+KKRV EISG+ +FKKKG YAFRFEDYNCSVDFV SPFLVRESSF   
Sbjct  329   ESLVCILRHVIRNKKRVHEISGKKEFKKKGVYAFRFEDYNCSVDFVVSPFLVRESSFTSK  388

Query  1273  NGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEA  1452
             NG+FETLRLDLMD+TTSMY+DAD+++FNTGHWWTHEKTSRGEDYYQEGN VHPRL+VLEA
Sbjct  389   NGTFETLRLDLMDRTTSMYHDADVIVFNTGHWWTHEKTSRGEDYYQEGNHVHPRLKVLEA  448

Query  1453  YKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             YKRAL TWARWVDK +D NRT+V FRGYS TH
Sbjct  449   YKRALTTWARWVDKYIDVNRTQVFFRGYSVTH  480



>ref|XP_006378226.1| hypothetical protein POPTR_0010s05310g [Populus trichocarpa]
 gb|ERP56023.1| hypothetical protein POPTR_0010s05310g [Populus trichocarpa]
Length=517

 Score =   441 bits (1133),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 234/425 (55%), Positives = 284/425 (67%), Gaps = 32/425 (8%)
 Frame = +1

Query  301   MELKKHAFSGQFLQHAFLPRRKFSGCWRLSvaaaffmvgvavLNFSFKAPFFNPVVQGLN  480
             ME K+ A   Q L     PRRK    W ++      +     L  SFK     P  QG N
Sbjct  1     MESKRLALPDQLLA----PRRKPFLLWVVASLIILSLFF---LTTSFKGRIVTPFFQGFN  53

Query  481   GFGYRNATVCCS----PPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGD  648
                  ++ V       PP  N +        G+      L ++ +G   NFT  T+    
Sbjct  54    SVTRNSSLVSWPFSRFPPSENSTASPPANVIGV-----VLEKTYVG---NFTEITQ----  101

Query  649   GSGKNGGFSLEGETV-KSEGSENGDRSRSRGVGVEISKKGTS----STVKNDMIGENGSE  813
                 NG F  E  +V KS  +++G+ + S G G  + +           KN      G E
Sbjct  102   ----NGSFGDEATSVPKSPEAKSGNLTDSSGDGGVLERPLLGVIEVGNQKNGRFPGGGGE  157

Query  814   LLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPH  993
                  +  +  CDIFDG+WVRDD+KPYYPPGSCP+ID+DFDCHL++RPD  +VKW+W+P+
Sbjct  158   QGGHNKVSFEKCDIFDGKWVRDDSKPYYPPGSCPYIDKDFDCHLNRRPDVGFVKWKWQPN  217

Query  994   ACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFK  1173
              CDIPS NATDFLERLRG+KLVFVGDSLNRNMWESLVCIL + +  KKRV+EISGR +FK
Sbjct  218   GCDIPSLNATDFLERLRGKKLVFVGDSLNRNMWESLVCILSNSIGKKKRVYEISGRREFK  277

Query  1174  KKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIF  1353
             KKGFYAFRFEDYNC+VDFVSSPFLVRESSFK  NG+FETLRLDLMD+TTSMY+DAD++IF
Sbjct  278   KKGFYAFRFEDYNCTVDFVSSPFLVRESSFKSKNGTFETLRLDLMDRTTSMYHDADVIIF  337

Query  1354  NTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRG  1533
             NTGHWWTH+KTSRGEDYYQEGN +H RL+VLEAYKRAL TWARW+DKN+D NRT V+F+G
Sbjct  338   NTGHWWTHDKTSRGEDYYQEGNHIHRRLKVLEAYKRALLTWARWIDKNIDRNRTLVLFKG  397

Query  1534  YSATH  1548
             YS TH
Sbjct  398   YSVTH  402



>ref|XP_007157368.1| hypothetical protein PHAVU_002G064300g [Phaseolus vulgaris]
 gb|ESW29362.1| hypothetical protein PHAVU_002G064300g [Phaseolus vulgaris]
Length=518

 Score =   434 bits (1117),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 198/273 (73%), Positives = 232/273 (85%), Gaps = 4/273 (1%)
 Frame = +1

Query  742   GVEISKKGTSSTVKNDMIGENGSELLRKGR----SFYSDCDIFDGEWVRDDTKPYYPPGS  909
             G E    G SS   +D +G+    L++       S + +CDIFDG+WVRD++KPYYP GS
Sbjct  130   GKENGHAGNSSCSGDDALGKCEEGLVKASNGSVGSLFVECDIFDGKWVRDESKPYYPLGS  189

Query  910   CPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNM  1089
             CP IDRDFDCHL+ RPD  YVKW+W+P+ CDIPS NATDFLE+LRGQKLVFVGDSLNRNM
Sbjct  190   CPLIDRDFDCHLNGRPDSEYVKWKWQPNGCDIPSLNATDFLEKLRGQKLVFVGDSLNRNM  249

Query  1090  WESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKG  1269
             WES+VCILR  V+DKKRVFEISG+++FKKKG YAFRFEDYNCSVDFVSSPF+VRES+FKG
Sbjct  250   WESMVCILRQSVKDKKRVFEISGKTEFKKKGVYAFRFEDYNCSVDFVSSPFIVRESTFKG  309

Query  1270  VNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLE  1449
              NGSFETLRLDLMD+TTS Y+DADI++FNTGHWWTHEKTSRGEDYYQEGN ++PRL+VL+
Sbjct  310   TNGSFETLRLDLMDQTTSTYHDADIIVFNTGHWWTHEKTSRGEDYYQEGNHIYPRLKVLD  369

Query  1450  AYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             AY RAL TWA+W+D N+DANRT+V FRGYS TH
Sbjct  370   AYTRALTTWAKWIDNNIDANRTQVFFRGYSVTH  402



>ref|XP_006302106.1| hypothetical protein CARUB_v10020097mg [Capsella rubella]
 gb|EOA35004.1| hypothetical protein CARUB_v10020097mg [Capsella rubella]
Length=548

 Score =   435 bits (1119),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 223/392 (57%), Positives = 276/392 (70%), Gaps = 25/392 (6%)
 Frame = +1

Query  439   FKAPFFNPVVQGLNGFGYRNAT----VCCSPPEGNFS-GEAKDGSFGLWKKTHELNRSEI  603
             F  PF +P++QGL       ++    V   P   N +  +AK  SF   +++ E   +  
Sbjct  45    FNVPFVSPLLQGLKSSNLNTSSSVKQVEEKPHVVNLTVPDAKVPSFVPEQRSGETGDTAS  104

Query  604   GKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENG-----DRSRSRGVGVEISKKGT  768
              KN   +G  +     SG+  G ++   T  S   E+G     D   +  V    +    
Sbjct  105   LKNTTLSGEGKVPSFDSGQGSGDTV---TTNSSLGEDGKVAVADDQNTLEVNATTTNVAN  161

Query  769   SSTVKNDMIG---------ENGSELLRKGRSFYSDCDIFDGEWVR--DDTKPYYPPGSCP  915
             SS++ +D+ G         ENGS +  + R  + DCDI+DG WV+  D+T PYYPPGSCP
Sbjct  162   SSSLVSDLGGRYVPANSSEENGSVVTDRSRGSFEDCDIYDGRWVKADDETMPYYPPGSCP  221

Query  916   FIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWE  1095
             +IDRDF+CH + RPDDAYVKWRW+P+ CDIP  N TDFLE+LRG+KLVFVGDS+NRNMWE
Sbjct  222   YIDRDFNCHANGRPDDAYVKWRWQPNGCDIPRLNGTDFLEKLRGKKLVFVGDSINRNMWE  281

Query  1096  SLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVN  1275
             SLVCILRH ++DKKRV+EISGR +FKKKGFYAFRFEDYNC+VDFV SPF VRESSFKGVN
Sbjct  282   SLVCILRHSLKDKKRVYEISGRREFKKKGFYAFRFEDYNCTVDFVGSPFFVRESSFKGVN  341

Query  1276  GS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEA  1452
             G+  ETLRLD+MDKTTSMY+DADI+IFNTGHWWTH+KT  GE+YYQEGN V+PRL+VLEA
Sbjct  342   GTKLETLRLDMMDKTTSMYSDADILIFNTGHWWTHDKTKLGENYYQEGNVVYPRLKVLEA  401

Query  1453  YKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             YKRAL TWA+WVDKN+D + T VIFRGYS TH
Sbjct  402   YKRALTTWAKWVDKNIDRSHTHVIFRGYSVTH  433



>gb|KDP26622.1| hypothetical protein JCGZ_17780 [Jatropha curcas]
Length=584

 Score =   436 bits (1120),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 213/341 (62%), Positives = 257/341 (75%), Gaps = 15/341 (4%)
 Frame = +1

Query  526   GNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEG  705
             GNF   + +GS  + +KTH  N  ++ K+ +  G   +           SL G++++ + 
Sbjct  144   GNFPVFSGNGS--VLEKTHLGNFDDVVKDGSLPGQEARN---------LSLSGDSIEGKS  192

Query  706   SENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDT  885
              EN   S       +I+ KG         I + G E  + G   +  CDIFDG+WVRDD+
Sbjct  193   VENS--SVVDSTVAKINNKGNLLYKGEFGISQGGEEGNQSGN--FETCDIFDGQWVRDDS  248

Query  886   KPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFV  1065
             KPYYP GSCP IDRDFDCH ++RPDD +VKW+W+P+ C++PS NATDFLERLRGQKLVFV
Sbjct  249   KPYYPAGSCPHIDRDFDCHRNRRPDDGFVKWKWQPNGCNVPSLNATDFLERLRGQKLVFV  308

Query  1066  GDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFL  1245
             GDSLNRNMWESLVCILRH++++KKRV+EISGR++FKKKGFYAF FEDYNC+VDFV SPFL
Sbjct  309   GDSLNRNMWESLVCILRHIIKNKKRVYEISGRTEFKKKGFYAFIFEDYNCTVDFVGSPFL  368

Query  1246  VRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRV  1425
             VRESSF   NG+FETLRLDLMD TT MY DADI++FNTGHWWTHEKTSRGEDYYQEGN V
Sbjct  369   VRESSFNSQNGTFETLRLDLMDHTTKMYQDADIIVFNTGHWWTHEKTSRGEDYYQEGNFV  428

Query  1426  HPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             HPRL+VLEAY+RAL TWARWVD N+D NRT+V FRGYS TH
Sbjct  429   HPRLKVLEAYRRALLTWARWVDNNIDRNRTQVFFRGYSVTH  469



>ref|XP_011045285.1| PREDICTED: protein trichome birefringence-like 2 [Populus euphratica]
Length=549

 Score =   434 bits (1117),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 236/441 (54%), Positives = 291/441 (66%), Gaps = 32/441 (7%)
 Frame = +1

Query  301   MELKKHAFSGQFLQHAFLPRRKFSGCWRLSvaaaffmvgvavLNFSFKAPFFNPVVQGLN  480
             ME K  A   Q L     PRRK    W ++      +     L  SFK     P  QG N
Sbjct  1     MESKGLALPDQLLA----PRRKPFLLWVVASLIILSLFF---LTTSFKGRIVTPFFQGFN  53

Query  481   GFGYRNATVCCS----PPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNF----TGFTE  636
                + ++ V       PP+ + +    + +  + +K H  N +EI +N +F    T   +
Sbjct  54    SVTHNSSLVSWPFSRFPPKNSTASPPANVTGVVLEKIHVGNFTEITQNGSFGDEATSVPK  113

Query  637   KKGDGSGKNGGFSLEGETVKSE---GSENGDRSRSRGVGVEISKKGTSSTVKNDMIGEN-  804
                  SG     S +G  ++       E G+ S S  V    +K+        ++I EN 
Sbjct  114   SPEAKSGNLIDSSGDGGVLERPLLGVIEVGNHSLSSNVDDADAKRSAEGKSVENLIAENK  173

Query  805   -----------GSELLRKG--RSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHL  945
                        GSE  + G  +  +  CDIFDG+WVRDD+KPYYPPGSCP+ID+DFDCH 
Sbjct  174   NEGNEENGRFPGSEGDQGGHNKVSFEKCDIFDGKWVRDDSKPYYPPGSCPYIDKDFDCHR  233

Query  946   HKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVV  1125
             + RPD  +VKW+W+P+ CDIPS NATDFLERLRG+KLVFVGDSLNRNMWESLVCILR+ +
Sbjct  234   NGRPDVGFVKWKWQPNGCDIPSLNATDFLERLRGKKLVFVGDSLNRNMWESLVCILRNSI  293

Query  1126  RDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDL  1305
               KKRV+EISGR +FKKKGFYAFRFEDYNC+VDFVSSPFLVRESSF+  NG+FETLRLDL
Sbjct  294   GKKKRVYEISGRREFKKKGFYAFRFEDYNCTVDFVSSPFLVRESSFESKNGTFETLRLDL  353

Query  1306  MDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARW  1485
             MD+TTSMY+DAD++IFNTGHWWTH+KTSRGEDYYQEGN +H RL+VLEAYKRAL TWARW
Sbjct  354   MDQTTSMYHDADVIIFNTGHWWTHDKTSRGEDYYQEGNHIHRRLKVLEAYKRALLTWARW  413

Query  1486  VDKNVDANRTEVIFRGYSATH  1548
             +DKN+D NRT V+FRGYS TH
Sbjct  414   IDKNIDRNRTLVLFRGYSVTH  434



>emb|CDP13190.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   435 bits (1119),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 250/511 (49%), Positives = 305/511 (60%), Gaps = 97/511 (19%)
 Frame = +1

Query  301   MELKKHAFSGQFLQHAFLPRR-KFSGCWRLSvaaaffmvgvavLNFS-FKAPFFNPVVQG  474
             M+ KK AF  QF      PRR K    + L + A+ F++ V   N S F AP  NPV++G
Sbjct  1     MDWKKIAFLDQFPCWTTSPRRRKVVSGFGLGLVASMFVLSVVSFNVSSFMAPLINPVLKG  60

Query  475   LNGFGYRN----------------ATVCCSPPEGNFSGEAKDGS-FGLWKKTHELNRSE-  600
              N F  RN                 T CC+    N +    +   F +   TH+ N SE 
Sbjct  61    FNIFASRNYNTTSCILSWPVYFSRTTSCCNASSCNGTIITNNVEYFMVTNGTHDRNVSES  120

Query  601   -----------IGKNVNFTGFTEKKGDGS----------------------GKNGGFSLE  681
                        + +N +    +EK  +G+                       KNG F+  
Sbjct  121   RKFIYSGGKGEVLQNAHVGNLSEKVKNGNLSVEVEGGKAQDESLVINGSLDDKNGNFTNL  180

Query  682   GETVKSEGSEN---------GDRSRSRGVGVEISKKGTSSTVKNDMIG------ENGSEL  816
             G    + G++N            S    V VE  K G     K  ++G      ENG  +
Sbjct  181   GNFSNNVGNQNVTAGGPNAKEQTSYQNAVSVERPKSGGDEVPKGSILGNLTVNRENG--V  238

Query  817   LRKGR---------------------------SFYSDCDIFDGEWVRDDTKPYYPPGSCP  915
              R G+                           S   +C+I+DG WVR+D KPYYPPGSCP
Sbjct  239   TRTGKEEKSPERNDRGISSRESNSIKGMMNSNSLNRNCNIYDGRWVRNDAKPYYPPGSCP  298

Query  916   FIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWE  1095
             +IDRDFDC+L+KRPDD ++KW+W+P+ CDIPS NATDFLERLRGQ+LVFVGDSLNRNMWE
Sbjct  299   YIDRDFDCYLNKRPDDNFLKWKWQPYNCDIPSLNATDFLERLRGQRLVFVGDSLNRNMWE  358

Query  1096  SLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVN  1275
             SLVCILRH V DKK V EISG+++FKKKGFYAFRFEDYNCSVDFVSSPFLVRES+F G N
Sbjct  359   SLVCILRHSVSDKKSVHEISGKTEFKKKGFYAFRFEDYNCSVDFVSSPFLVRESTFNGKN  418

Query  1276  GSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAY  1455
             GSFETLRLDLMDK+TSMY DAD+++FNT HWWTHEKTS+GEDYYQEGN VH RL+VLEAY
Sbjct  419   GSFETLRLDLMDKSTSMYYDADVLVFNTAHWWTHEKTSKGEDYYQEGNHVHGRLKVLEAY  478

Query  1456  KRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KRAL TWARWVDK++D  R++V+FRGYS  H
Sbjct  479   KRALRTWARWVDKSIDKTRSQVVFRGYSVMH  509



>ref|XP_009113182.1| PREDICTED: protein trichome birefringence-like 2 [Brassica rapa]
Length=542

 Score =   432 bits (1110),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 221/391 (57%), Positives = 276/391 (71%), Gaps = 24/391 (6%)
 Frame = +1

Query  430   NFSFKAPFFNPVVQGLNGFGYRNATVCCS-PPEGNFSGEAKDGSFGLWKKTHELNRSEIG  606
             N SF  PF +P++QGL      N  +  S  P+ N SG +   +    KK   +   + G
Sbjct  43    NSSFNVPFVSPLLQGLRN---SNLNIPSSVSPQFNSSGSSSSSNQVEEKKPEVVQTRDTG  99

Query  607   -KNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGS---ENGDRSRSRGVGVEISKKGTSS  774
              KN + +G  E     SG   G ++   T+  +G     N + +      + +   G SS
Sbjct  100   SKNTSLSGEGEVSSFESGPRSGETVINSTLSEDGKVSVRNDENTLEANATISV---GNSS  156

Query  775   TVKNDMIG----------ENGSELLRKGRSFYSDCDIFDGEWVR--DDTKPYYPPGSCPF  918
             ++ +D+ G          +N +    + R  Y DCDI+DG WVR  D+T PYYPPGSCP+
Sbjct  157   SLVSDLGGRFVPANSSNEKNATVEADRSRGSYEDCDIYDGNWVRAYDETMPYYPPGSCPY  216

Query  919   IDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWES  1098
             IDRDF+CH +KRPDD YVKW+W+P+ CDIP  N TDFLE+LRG+KLVFVGDS+NRNMWES
Sbjct  217   IDRDFNCHANKRPDDGYVKWKWQPNGCDIPRLNGTDFLEKLRGKKLVFVGDSINRNMWES  276

Query  1099  LVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG  1278
             LVCILRH ++DKKRV+EISGR +FKK+GFYAFRFEDYNC+VDFV SPF VRESSF+GVNG
Sbjct  277   LVCILRHSLKDKKRVYEISGRREFKKRGFYAFRFEDYNCTVDFVGSPFFVRESSFRGVNG  336

Query  1279  -SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAY  1455
              + ETLRLD+MDKTTSMY DADI+IFNTGHWWTH+KT  GE+YYQEGN V+PRL+VLEAY
Sbjct  337   TTMETLRLDMMDKTTSMYRDADILIFNTGHWWTHDKTKLGENYYQEGNVVYPRLKVLEAY  396

Query  1456  KRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KRAL TWA+WVDKN+D N+T V+FRGYS TH
Sbjct  397   KRALTTWAKWVDKNIDRNQTHVVFRGYSETH  427



>ref|XP_008340353.1| PREDICTED: LOW QUALITY PROTEIN: protein trichome birefringence-like 
2 [Malus domestica]
Length=483

 Score =   429 bits (1103),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 191/252 (76%), Positives = 224/252 (89%), Gaps = 0/252 (0%)
 Frame = +1

Query  793   IGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYV  972
             I E  S++++     Y  CDIF G WVRDD+KPYYP GSCP+IDRDF+CHL+ RPD+A++
Sbjct  117   IVEYDSQMVKMQTDLYQQCDIFXGRWVRDDSKPYYPGGSCPYIDRDFNCHLNGRPDNAFI  176

Query  973   KWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEI  1152
             KW+W+P+ CDIPS NATDFL RLRG+++VFVGDSLNRNMWESLVCILRH +R+KKRV EI
Sbjct  177   KWKWQPNECDIPSLNATDFLVRLRGKRMVFVGDSLNRNMWESLVCILRHSIRNKKRVHEI  236

Query  1153  SGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYN  1332
             SG+ +FKKKGFYAFRFEDYNCSVDFV+SPFLVRESSF G NG+FETLRLDLMD+TTSMY+
Sbjct  237   SGKREFKKKGFYAFRFEDYNCSVDFVASPFLVRESSFTGQNGTFETLRLDLMDQTTSMYD  296

Query  1333  DADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANR  1512
             DAD+++FNTG WWTHEKTSRGEDYYQEGN VHPRL+VLEAYKRAL TWARWVD+N+D +R
Sbjct  297   DADVMVFNTGRWWTHEKTSRGEDYYQEGNYVHPRLQVLEAYKRALTTWARWVDENIDVDR  356

Query  1513  TEVIFRGYSATH  1548
             T+V FRGYS TH
Sbjct  357   TQVFFRGYSVTH  368



>ref|XP_010473258.1| PREDICTED: protein trichome birefringence-like 2 [Camelina sativa]
Length=541

 Score =   430 bits (1106),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 225/389 (58%), Positives = 270/389 (69%), Gaps = 26/389 (7%)
 Frame = +1

Query  439   FKAPFFNPVVQGLNGFGYRNAT-----VCCSPPEGNFSG---EAKDGSFGLWKKTHELNR  594
             F  PF +P++QGL       ++     V   P   N +    +AK  +F   +++ E  R
Sbjct  45    FNVPFVSPLLQGLKNSNLNTSSSSVKQVDEKPQVVNLTDTVPDAKVPTFAPEQRSEE-TR  103

Query  595   SEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSS  774
                 KN   +   +    GSG+  G     ETV +  S   D++ +  V    S   +SS
Sbjct  104   DAGSKNTALSEEGKVPSFGSGQRSG-----ETVTTNSSLTDDQN-TLEVNATTSVANSSS  157

Query  775   TVKN--------DMIGENGSELLRKGRSFYSDCDIFDGEWVRDD--TKPYYPPGSCPFID  924
              V +        +   ENGS    + R  + DCDI+DG WVR D  T PYYP GSCP+ID
Sbjct  158   LVSDLGGRFVPANTSNENGSVATDRSRGSFEDCDIYDGSWVRADGETMPYYPSGSCPYID  217

Query  925   RDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLV  1104
             RDF+CH + RPDDAYVKWRW+P+ CDIP  N TDFLE+LRG+KLVFVGDS+NRNMWESLV
Sbjct  218   RDFNCHANGRPDDAYVKWRWQPNGCDIPRLNGTDFLEKLRGKKLVFVGDSINRNMWESLV  277

Query  1105  CILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-  1281
             CILRH V+DKKRV+EISGR +FKKKGFYAFRFEDYNC+VDFV SPF VRESSFKGVNG+ 
Sbjct  278   CILRHSVKDKKRVYEISGRREFKKKGFYAFRFEDYNCTVDFVGSPFFVRESSFKGVNGTK  337

Query  1282  FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKR  1461
              ETLRLD+MDKTTSMY DADI+IFNTGHWWTH+KT  GE+YYQEGN V+PRL+VLEAYKR
Sbjct  338   LETLRLDMMDKTTSMYRDADILIFNTGHWWTHDKTKLGENYYQEGNVVYPRLKVLEAYKR  397

Query  1462  ALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             AL TWA+WVDKN+D N T VIFRGYS TH
Sbjct  398   ALITWAKWVDKNIDRNHTHVIFRGYSVTH  426



>dbj|BAD95134.1| hypothetical protein [Arabidopsis thaliana]
Length=499

 Score =   429 bits (1102),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 216/386 (56%), Positives = 272/386 (70%), Gaps = 24/386 (6%)
 Frame = +1

Query  445   APFFNPVVQGLNGFGYRNAT----VCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIG-K  609
              PF +P++QGL      N++    V   P   N + +  D       K       + G K
Sbjct  47    VPFVSPLLQGLKSSNLNNSSSVKQVNEKPEVVNLTDKVPD------VKVPSFVVPDAGSK  100

Query  610   NVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKND  789
             N   +  ++     SG+  G +++  ++  EG+ +    ++       +  G SS++ +D
Sbjct  101   NTTLSEESKVPSFDSGQRSGETVKNSSLAEEGNGSVADDQNTLEANATTSVGNSSSLVSD  160

Query  790   MIG----------ENGSELLRKGRSFYSDCDIFDGEWVR--DDTKPYYPPGSCPFIDRDF  933
             + G          ENGS    + R  Y DCDI+DG WVR  D+T PYYPPGSCP+IDRDF
Sbjct  161   LGGRFVVPANTSKENGSVTEDRSRGSYEDCDIYDGSWVRADDETMPYYPPGSCPYIDRDF  220

Query  934   DCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCIL  1113
             +CH + RPDDAYVKWRW+P+ CDIP  N TDFLE+LRG+KLVFVGDS+NRNMWESL+CIL
Sbjct  221   NCHANGRPDDAYVKWRWQPNGCDIPRLNGTDFLEKLRGKKLVFVGDSINRNMWESLICIL  280

Query  1114  RHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFET  1290
             RH ++DKKRV+EISGR +FKKKGFYAFRFEDYNC+VDFV SPF VRESSFKGVNG + ET
Sbjct  281   RHSLKDKKRVYEISGRREFKKKGFYAFRFEDYNCTVDFVGSPFFVRESSFKGVNGTTLET  340

Query  1291  LRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALY  1470
             LRLD+MDKTTSMY DADI+IFNTGHWWTH+KT  GE+YYQEGN V+PRL+VLEAYKRAL 
Sbjct  341   LRLDMMDKTTSMYRDADILIFNTGHWWTHDKTKLGENYYQEGNVVYPRLKVLEAYKRALI  400

Query  1471  TWARWVDKNVDANRTEVIFRGYSATH  1548
             TWA+WVDKN+D ++T ++FRGYS TH
Sbjct  401   TWAKWVDKNIDRSQTHIVFRGYSVTH  426



>gb|KEH27750.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=381

 Score =   423 bits (1088),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 209/302 (69%), Positives = 241/302 (80%), Gaps = 13/302 (4%)
 Frame = +1

Query  661   NGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGS------ELLR  822
             N GF     T+    SENG  +     GV+  K G  S  K + I EN S      E L+
Sbjct  84    NQGFE---NTLLGNFSENGYNASFLSNGVD--KVGNFSAGKGE-IDENLSGSVAVEENLK  137

Query  823   KGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACD  1002
              G+ F   CDIFDG WVRDD+KPYY  GSCPF+DRDFDCHL+ RPD  YVKW+W+P+ CD
Sbjct  138   DGK-FDEKCDIFDGNWVRDDSKPYYELGSCPFVDRDFDCHLNGRPDSDYVKWKWKPNGCD  196

Query  1003  IPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKG  1182
             IPS NATDFLE+LRGQ+LVFVGDSLNRNMWES+VCILR  + DKKRV+EISG+ +FKKKG
Sbjct  197   IPSLNATDFLEKLRGQRLVFVGDSLNRNMWESMVCILRQSINDKKRVYEISGKHEFKKKG  256

Query  1183  FYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTG  1362
              YAFRFEDYNCSVDFVSSPF+V+ES+FKGVNGSFETLRLDLMD+TTS Y+DA+I++FNTG
Sbjct  257   VYAFRFEDYNCSVDFVSSPFIVQESTFKGVNGSFETLRLDLMDQTTSTYHDAEIIVFNTG  316

Query  1363  HWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSA  1542
             HWWTHEKTSRGEDYYQEGN V+PRL+VL+AY RAL TWARW+D N+DANRT V FRGYS 
Sbjct  317   HWWTHEKTSRGEDYYQEGNHVYPRLKVLDAYTRALKTWARWIDNNIDANRTNVFFRGYSV  376

Query  1543  TH  1548
             TH
Sbjct  377   TH  378



>ref|XP_002525401.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37039.1| conserved hypothetical protein [Ricinus communis]
Length=581

 Score =   430 bits (1106),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 217/357 (61%), Positives = 257/357 (72%), Gaps = 29/357 (8%)
 Frame = +1

Query  487   GYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGK-NVNFTGFTEKKGDGSGKN  663
             G+ N +V  +   GNFS   K+GS       H  +   IG  +V+  G+ +         
Sbjct  136   GHGNGSVIENTNLGNFSDMLKNGSL------HGEDEIFIGNFSVSIDGYLD---------  180

Query  664   GGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGE--NGSELLRKGRSF  837
                S+EG+++++    N            +  K   + + N+ +G    G E  R   S 
Sbjct  181   ANRSIEGKSLENFNDVNN---------TVLDDKDKDNLIYNEELGRFRGGEEENRNASS-  230

Query  838   YSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFN  1017
                CDIFDG+WVRDD+KPYYP GSCP IDRDF+CHL+ RPDD +VKW+W+P+ C IPS N
Sbjct  231   -ETCDIFDGQWVRDDSKPYYPAGSCPHIDRDFECHLNGRPDDGFVKWKWQPNRCSIPSLN  289

Query  1018  ATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFR  1197
             ATDFLERLRGQ LVFVGDSLNRNMWESLVCILRH +RDKKRV+EISGR++FKKKGFYAFR
Sbjct  290   ATDFLERLRGQTLVFVGDSLNRNMWESLVCILRHSIRDKKRVYEISGRTEFKKKGFYAFR  349

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTH  1377
             FEDYNCSVDFV SPFLVRESSF   NG  ETLRLDLMD TT MY DADI++FNTGHWWTH
Sbjct  350   FEDYNCSVDFVGSPFLVRESSFSSKNGKLETLRLDLMDLTTKMYQDADIIVFNTGHWWTH  409

Query  1378  EKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             EKTSRGEDYYQEG+ VHPRL+V+EAYKRAL TWARWVDKN+D NRT++ FRGYS TH
Sbjct  410   EKTSRGEDYYQEGDYVHPRLKVMEAYKRALLTWARWVDKNIDGNRTQIFFRGYSVTH  466



>ref|XP_002265658.2| PREDICTED: protein trichome birefringence-like 2 [Vitis vinifera]
Length=623

 Score =   432 bits (1110),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 246/516 (48%), Positives = 302/516 (59%), Gaps = 108/516 (21%)
 Frame = +1

Query  301   MELKKHAFSGQFLQHAFLPRRKFSGCWRLSvaaaffmvgvavLNFSFKAPFFNPVVQGLN  480
             ME KK  FS Q L     P+RK    + L + A+  ++ +   N SF  P F    +G +
Sbjct  1     MEWKKLGFSEQILS----PKRKVVSGFALGLGASLIVLTIVSFNTSFNVPMF----RGFS  52

Query  481   GFGYRNAT---------------------------------------VCCSPPEGNFSGE  543
              FG  N++                                       V  S P+ + SG 
Sbjct  53    NFGASNSSLASWSFSFSSTSSSTASPTNATLDFHDSADFKQGTEDGRVVDSTPQASLSGM  112

Query  544   AKDGS-FGL-WKKTHELNRSEIGKNVNFT---GFTEKK--GDGSGKNGGFSLEGETVK--  696
              KDG   G+  +KTH  N SE+ KN +FT   G+  +    D SG     SL    V+  
Sbjct  113   DKDGDPLGIVLEKTHLGNTSEMVKNGSFTVDGGWIPETTHADASGTATKASLSNSNVEGM  172

Query  697   ----------SEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENG-------------  807
                       SE   NG      G  +  +  G +++     + EN              
Sbjct  173   TSDMAILGNSSEMVNNGSSPGEEGTVIGKTGLGGNTSDGKIFVAENNNVGNLSYSGEYTK  232

Query  808   -----------------------------SELLRKGRSFYSDCDIFDGEWVRDDTKPYYP  900
                                          S+L +   SFY  CDIFDG WVRDD+KPYYP
Sbjct  233   PPTEEESGTAGNDAGKATTNNKITATHYHSQLKKMPNSFYGGCDIFDGRWVRDDSKPYYP  292

Query  901   PGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLN  1080
              GSCP+IDRDFDCHL+ RPDD Y+KWRW+P+ CDIPS NATDFLERLRG+KL+FVGDSLN
Sbjct  293   AGSCPYIDRDFDCHLNGRPDDDYLKWRWQPNGCDIPSLNATDFLERLRGKKLIFVGDSLN  352

Query  1081  RNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESS  1260
             RNMWES+VCILRH V DKKRV+EISGR +FKKKGFYAFRFEDYNCSVDFV++PFLV+ESS
Sbjct  353   RNMWESMVCILRHSVEDKKRVYEISGRKEFKKKGFYAFRFEDYNCSVDFVNAPFLVQESS  412

Query  1261  FKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLE  1440
             F G N +FETLRLD MDK+T+ ++DADI++FNTGHWWTHEKTSRGE YYQEGN VHPRL+
Sbjct  413   FNGRNRTFETLRLDEMDKSTTTFHDADIIVFNTGHWWTHEKTSRGEYYYQEGNYVHPRLK  472

Query  1441  VLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             VL+AY +AL TWARWVDKN+++N T+V FRGYS TH
Sbjct  473   VLKAYTKALTTWARWVDKNINSNMTQVFFRGYSITH  508



>ref|XP_004143065.1| PREDICTED: uncharacterized protein LOC101210768 [Cucumis sativus]
 ref|XP_004159591.1| PREDICTED: uncharacterized LOC101210768 [Cucumis sativus]
 gb|KGN62305.1| hypothetical protein Csa_2G348910 [Cucumis sativus]
Length=553

 Score =   429 bits (1103),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/345 (61%), Positives = 244/345 (71%), Gaps = 4/345 (1%)
 Frame = +1

Query  517   PPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGS-GKNGGFSLEGETV  693
             PP  N +    + +  L    H  N S    N       E     +   +   SL   T 
Sbjct  97    PPFPNHTHRHNNATLQL--NPHSPNASLFPPNATLFDIPELDTQHNFPPSNSTSLNTNTT  154

Query  694   KSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWV  873
             +     N   S ++G        G +++     I  N   LL    SFY DCDIFDGEWV
Sbjct  155   RYPKDTNHS-SNAQGNMPSQPNGGATNSSHTIEISNNTQPLLTSDDSFYEDCDIFDGEWV  213

Query  874   RDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQK  1053
             RDD+KPYYP GSCPFIDRDFDC L+KRPDD YVKW+W+P+ C+IPS NAT FLE LRG+ 
Sbjct  214   RDDSKPYYPLGSCPFIDRDFDCDLNKRPDDGYVKWKWQPYGCNIPSLNATHFLEVLRGRS  273

Query  1054  LVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVS  1233
             LVFVGDSLNRNMWESLVCILRH V DKK+V+EISGR++FKKKGFYAFRFEDYNCSVDFVS
Sbjct  274   LVFVGDSLNRNMWESLVCILRHSVSDKKKVYEISGRTEFKKKGFYAFRFEDYNCSVDFVS  333

Query  1234  SPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQE  1413
             SPFLVRESSFK  NG+ ETLRLDLMD TT MY D+D+++FNTGHWWTH+KTSRGEDYYQE
Sbjct  334   SPFLVRESSFKRKNGTIETLRLDLMDPTTEMYRDSDVLVFNTGHWWTHDKTSRGEDYYQE  393

Query  1414  GNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             GN VH +L+VLEA+KRAL TW RW+D NVD NRT V FRGYS +H
Sbjct  394   GNHVHSKLKVLEAFKRALTTWGRWIDNNVDKNRTLVFFRGYSYSH  438



>ref|NP_176278.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8VYR3.1|TBL2_ARATH RecName: Full=Protein trichome birefringence-like 2 [Arabidopsis 
thaliana]
 gb|AAL49770.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91701.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33733.1| uncharacterized protein AT1G60790 [Arabidopsis thaliana]
Length=541

 Score =   429 bits (1102),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 216/386 (56%), Positives = 272/386 (70%), Gaps = 24/386 (6%)
 Frame = +1

Query  445   APFFNPVVQGLNGFGYRNAT----VCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIG-K  609
              PF +P++QGL      N++    V   P   N + +  D       K       + G K
Sbjct  47    VPFVSPLLQGLKSSNLNNSSSVKQVNEKPEVVNLTDKVPD------VKVPSFVVPDAGSK  100

Query  610   NVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKND  789
             N   +  ++     SG+  G +++  ++  EG+ +    ++       +  G SS++ +D
Sbjct  101   NTTLSEESKVPSFDSGQRSGETVKNSSLAEEGNGSVADDQNTLEANATTSVGNSSSLVSD  160

Query  790   MIG----------ENGSELLRKGRSFYSDCDIFDGEWVR--DDTKPYYPPGSCPFIDRDF  933
             + G          ENGS    + R  Y DCDI+DG WVR  D+T PYYPPGSCP+IDRDF
Sbjct  161   LGGRFVVPANTSKENGSVTEDRSRGSYEDCDIYDGSWVRADDETMPYYPPGSCPYIDRDF  220

Query  934   DCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCIL  1113
             +CH + RPDDAYVKWRW+P+ CDIP  N TDFLE+LRG+KLVFVGDS+NRNMWESL+CIL
Sbjct  221   NCHANGRPDDAYVKWRWQPNGCDIPRLNGTDFLEKLRGKKLVFVGDSINRNMWESLICIL  280

Query  1114  RHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFET  1290
             RH ++DKKRV+EISGR +FKKKGFYAFRFEDYNC+VDFV SPF VRESSFKGVNG + ET
Sbjct  281   RHSLKDKKRVYEISGRREFKKKGFYAFRFEDYNCTVDFVGSPFFVRESSFKGVNGTTLET  340

Query  1291  LRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALY  1470
             LRLD+MDKTTSMY DADI+IFNTGHWWTH+KT  GE+YYQEGN V+PRL+VLEAYKRAL 
Sbjct  341   LRLDMMDKTTSMYRDADILIFNTGHWWTHDKTKLGENYYQEGNVVYPRLKVLEAYKRALI  400

Query  1471  TWARWVDKNVDANRTEVIFRGYSATH  1548
             TWA+WVDKN+D ++T ++FRGYS TH
Sbjct  401   TWAKWVDKNIDRSQTHIVFRGYSVTH  426



>ref|XP_004489803.1| PREDICTED: uncharacterized protein LOC101513224 [Cicer arietinum]
Length=528

 Score =   428 bits (1101),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/271 (72%), Positives = 230/271 (85%), Gaps = 2/271 (1%)
 Frame = +1

Query  742   GVEISKKGTSSTV--KNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCP  915
             G EI  K +S +V  +  M GE   +  + G   Y  C+IFDG WVRDD+KPYYP GSCP
Sbjct  143   GSEIVAKNSSVSVNVEKTMEGETEKKSEKVGNFDYEKCNIFDGNWVRDDSKPYYPLGSCP  202

Query  916   FIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWE  1095
             F+DRDFDCHL+ RPD  YVKW+W+P+ CDIPS NATDFLE+LRG++LVFVGDSLNRNMWE
Sbjct  203   FVDRDFDCHLNGRPDSDYVKWKWKPNGCDIPSLNATDFLEKLRGRRLVFVGDSLNRNMWE  262

Query  1096  SLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVN  1275
             S+VCILR  + + KRV+EISGR++FKKKG YAFRFEDYNCSVDFVSSPF+VRES+FKG N
Sbjct  263   SMVCILRQSISNMKRVYEISGRTEFKKKGVYAFRFEDYNCSVDFVSSPFIVRESTFKGKN  322

Query  1276  GSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAY  1455
             GSFETLRLDLMD+TT+ Y+DADI++FNTGHWWTHEKTS+GEDYYQEGN V+PRL+VL+AY
Sbjct  323   GSFETLRLDLMDQTTTTYHDADIIVFNTGHWWTHEKTSKGEDYYQEGNHVYPRLKVLDAY  382

Query  1456  KRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KRAL TWARW+D N+D NRT+V FRGYS TH
Sbjct  383   KRALTTWARWIDNNIDVNRTQVFFRGYSVTH  413



>ref|XP_006392115.1| hypothetical protein EUTSA_v10023395mg [Eutrema salsugineum]
 gb|ESQ29401.1| hypothetical protein EUTSA_v10023395mg [Eutrema salsugineum]
Length=548

 Score =   427 bits (1099),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 274/404 (68%), Gaps = 50/404 (12%)
 Frame = +1

Query  439   FKAPFFNPVVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVN  618
             F  PF +P++QGL     +N+ +   P   N   E          K   +N ++   +V 
Sbjct  46    FNVPFVSPLLQGL-----KNSNLNI-PSSVNQVDE----------KPEVVNLTDNVPDVK  89

Query  619   FTGF--TEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGV-----GVEISKK-----  762
                F   ++ GD S KN   S EGE    +  +  +++          G ++S       
Sbjct  90    VPNFDAEQRSGDTSSKNTSLSGEGEVASFDSEQRSEKTVKNSSLVDEDGTKVSTANDENT  149

Query  763   ---------GTSSTVKNDMIG----------ENGSELLRKGRSFYSDCDIFDGEWVR--D  879
                      G SS++ +D  G          +NGS    + R  Y DCDI+DG WVR  D
Sbjct  150   LESNATISVGNSSSLVSDSGGGFVPSNSSEEDNGSVETDRSRGSYEDCDIYDGNWVRADD  209

Query  880   DTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLV  1059
             +T PYYPPGSCP+IDRDF+CH + RPDDAYVKW+W+P+ CDIP  N TDFLE+LRG+KLV
Sbjct  210   ETMPYYPPGSCPYIDRDFNCHANGRPDDAYVKWKWQPNGCDIPRLNGTDFLEKLRGKKLV  269

Query  1060  FVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSP  1239
             FVGDS+NRNMWESLVC+LRH ++DKKRV+EISGR +FKK+GFYAFRFEDYNC+VDFV SP
Sbjct  270   FVGDSINRNMWESLVCVLRHSLKDKKRVYEISGRREFKKRGFYAFRFEDYNCTVDFVGSP  329

Query  1240  FLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEG  1416
             F VRESSFKGVNG+  ETLRLDLMDKTTSMY DADI+IFNTGHWWTH+KT  GE+YYQEG
Sbjct  330   FFVRESSFKGVNGTRLETLRLDLMDKTTSMYKDADILIFNTGHWWTHDKTKLGENYYQEG  389

Query  1417  NRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             N V+PRL+VLEAYKRAL TWA+WVDKN++ N+T V+FRGYS TH
Sbjct  390   NVVYPRLKVLEAYKRALATWAKWVDKNINRNQTHVVFRGYSVTH  433



>ref|XP_007221982.1| hypothetical protein PRUPE_ppa002834mg [Prunus persica]
 gb|EMJ23181.1| hypothetical protein PRUPE_ppa002834mg [Prunus persica]
Length=629

 Score =   430 bits (1105),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 201/293 (69%), Positives = 243/293 (83%), Gaps = 2/293 (1%)
 Frame = +1

Query  673   SLEGETVKSEGSENGDRSRS-RGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDC  849
             ++EG   K+  +E+   + + R   V  +    +S  KN +I +  S+L +     Y  C
Sbjct  223   TIEGSLSKNSSNEDDKVTENKRKKSVRETAHLGNSKEKNKII-DYDSQLRKMQTDSYQKC  281

Query  850   DIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDF  1029
             DIF G+WVRDD+KPYYP GSCP+IDRDF+C L+ RPD+A++KW+W+P+ CDIPS NATDF
Sbjct  282   DIFFGKWVRDDSKPYYPGGSCPYIDRDFNCQLNGRPDNAFIKWKWQPNECDIPSLNATDF  341

Query  1030  LERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDY  1209
             LERLRG++LVFVGDSLNRNMWESLVCILR+ +R K+RV EISG+S+FKKKGFYAFRFEDY
Sbjct  342   LERLRGKRLVFVGDSLNRNMWESLVCILRNSLRYKRRVHEISGKSEFKKKGFYAFRFEDY  401

Query  1210  NCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTS  1389
             NCSVDFV+SPFLVRESSF G NGSFETLRLD+MD+TTSMY+DAD+++FNTGHWWTHEKTS
Sbjct  402   NCSVDFVASPFLVRESSFTGQNGSFETLRLDMMDRTTSMYHDADVIVFNTGHWWTHEKTS  461

Query  1390  RGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +GEDYYQEGN VHPRL+VLEAYKRAL TWARWVDKN+D  RT+V FRGYS TH
Sbjct  462   KGEDYYQEGNYVHPRLKVLEAYKRALTTWARWVDKNIDVKRTQVFFRGYSVTH  514



>ref|XP_010418022.1| PREDICTED: protein trichome birefringence-like 2 [Camelina sativa]
Length=545

 Score =   427 bits (1098),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 222/398 (56%), Positives = 269/398 (68%), Gaps = 40/398 (10%)
 Frame = +1

Query  439   FKAPFFNPVVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVN  618
             F  PF +P++QGL       ++   S                  +K   +N ++   +V 
Sbjct  45    FNVPFVSPLLQGLKSSNLNPSSSSSSSSVKQVD-----------EKPQVVNLTDTVPDVK  93

Query  619   FTGF-----TEKKGDGSGKNGGFSLEG------------ETVKSEGSENGDRSRSRGVGV  747
                F     +E+  D S KN   S +G            ETV +  S   D++ +  V  
Sbjct  94    VPTFVPEQRSEETSDASSKNTTLSEDGKVPSFGSGQRSGETVTTNSSLADDQN-TLEVNA  152

Query  748   EISKKGTSSTVKN--------DMIGENGSELLRKGRSFYSDCDIFDGEWVR--DDTKPYY  897
               S   +SS V +        +   ENGS +  + R  + DCDI+DG WVR  D+T PYY
Sbjct  153   TTSVANSSSLVSDLGGRFVPANTSNENGSVVTDRTRGSFEDCDIYDGSWVRADDETMPYY  212

Query  898   PPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSL  1077
             P GSCP+IDRDF+CH + RPDDAYVKWRW+P+ CDIP  N TDFLE+LRG+KLVFVGDS+
Sbjct  213   PSGSCPYIDRDFNCHANGRPDDAYVKWRWQPNGCDIPRLNGTDFLEKLRGKKLVFVGDSI  272

Query  1078  NRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRES  1257
             NRNMWESLVCILRH ++DKKRV+EISGR +FKKKGFYAFRFEDYNC+VDFV SPF VRES
Sbjct  273   NRNMWESLVCILRHSLKDKKRVYEISGRREFKKKGFYAFRFEDYNCTVDFVGSPFFVRES  332

Query  1258  SFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPR  1434
             SFKGVNG+  ETLRLD+MDKTTSMY DADI+IFNTGHWWTH+KT  GE+YYQEGN V+PR
Sbjct  333   SFKGVNGTKLETLRLDMMDKTTSMYRDADILIFNTGHWWTHDKTKLGENYYQEGNVVYPR  392

Query  1435  LEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             L+VLEAYKRAL TWA+WVDKN+D N T VIFRGYS TH
Sbjct  393   LKVLEAYKRALTTWAKWVDKNIDRNHTHVIFRGYSVTH  430



>ref|XP_011086599.1| PREDICTED: protein trichome birefringence-like 2 [Sesamum indicum]
Length=598

 Score =   428 bits (1101),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 224/368 (61%), Positives = 259/368 (70%), Gaps = 38/368 (10%)
 Frame = +1

Query  526   GNFSGEAKDGSF-----GLWKKTHELNRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGET  690
             GN S + + G F      L  KT E N S  G+N           DGSG+  G   E  T
Sbjct  131   GNDSEKLQGGRFIVGEGSLVVKTDERNVSSSGRNTILM-------DGSGR--GNESETAT  181

Query  691   VKS-----------EGSENGDRSR-------SRGVGVEISKKGTSSTVKNDMIGENGSEL  816
             V              G EN +R+        SR   VE  + G+     ND  G+ G   
Sbjct  182   VMDLIDDDVRNGTVSGKENVNRNSTVKYRHGSRDAEVESLQVGSVGNYSND--GDTGGSR  239

Query  817   LR----KGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRW  984
             +          Y DCD+F G WVRDD+ P+YPPGSCP+IDRDF+CHL+ RPD+ ++KWRW
Sbjct  240   INWTEAPANRSYEDCDMFKGRWVRDDSMPFYPPGSCPYIDRDFECHLNGRPDNEFLKWRW  299

Query  985   RPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRS  1164
             +P  CDIP FNATDFLERLRG+KLVFVGDSLNRNMWESLVC+LRH V DK RV+EISGR 
Sbjct  300   QPDDCDIPRFNATDFLERLRGKKLVFVGDSLNRNMWESLVCLLRHAVEDKNRVYEISGRH  359

Query  1165  DFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADI  1344
             +FKKKGF+A RFEDYNCSVDFVSSPFLV++SSF G NGSF+TLRLDLMD+TTSMY+DAD+
Sbjct  360   EFKKKGFFAIRFEDYNCSVDFVSSPFLVKQSSFSGKNGSFDTLRLDLMDETTSMYHDADV  419

Query  1345  VIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVI  1524
             +IFNTGHWWTHEKTSRGEDYYQEG+ VHPRL+ LEAYKRAL TW RWVDKNVD NRT+VI
Sbjct  420   MIFNTGHWWTHEKTSRGEDYYQEGDYVHPRLKALEAYKRALTTWGRWVDKNVDGNRTQVI  479

Query  1525  FRGYSATH  1548
             FRGYS TH
Sbjct  480   FRGYSVTH  487



>ref|XP_003613189.1| hypothetical protein MTR_5g033800 [Medicago truncatula]
 gb|AES96147.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=493

 Score =   423 bits (1087),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/302 (69%), Positives = 241/302 (80%), Gaps = 13/302 (4%)
 Frame = +1

Query  661   NGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGS------ELLR  822
             N GF     T+    SENG  +     GV+  K G  S  K + I EN S      E L+
Sbjct  84    NQGFE---NTLLGNFSENGYNASFLSNGVD--KVGNFSAGKGE-IDENLSGSVAVEENLK  137

Query  823   KGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACD  1002
              G+ F   CDIFDG WVRDD+KPYY  GSCPF+DRDFDCHL+ RPD  YVKW+W+P+ CD
Sbjct  138   DGK-FDEKCDIFDGNWVRDDSKPYYELGSCPFVDRDFDCHLNGRPDSDYVKWKWKPNGCD  196

Query  1003  IPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKG  1182
             IPS NATDFLE+LRGQ+LVFVGDSLNRNMWES+VCILR  + DKKRV+EISG+ +FKKKG
Sbjct  197   IPSLNATDFLEKLRGQRLVFVGDSLNRNMWESMVCILRQSINDKKRVYEISGKHEFKKKG  256

Query  1183  FYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTG  1362
              YAFRFEDYNCSVDFVSSPF+V+ES+FKGVNGSFETLRLDLMD+TTS Y+DA+I++FNTG
Sbjct  257   VYAFRFEDYNCSVDFVSSPFIVQESTFKGVNGSFETLRLDLMDQTTSTYHDAEIIVFNTG  316

Query  1363  HWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSA  1542
             HWWTHEKTSRGEDYYQEGN V+PRL+VL+AY RAL TWARW+D N+DANRT V FRGYS 
Sbjct  317   HWWTHEKTSRGEDYYQEGNHVYPRLKVLDAYTRALKTWARWIDNNIDANRTNVFFRGYSV  376

Query  1543  TH  1548
             TH
Sbjct  377   TH  378



>gb|KFK40758.1| hypothetical protein AALP_AA2G037100 [Arabis alpina]
Length=535

 Score =   424 bits (1090),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 223/390 (57%), Positives = 268/390 (69%), Gaps = 29/390 (7%)
 Frame = +1

Query  430   NFSFKAPFFNPVVQGLNGFGYRNAT-----VCCSPPEGNFSGEAKDGSFGLWKKTHELNR  594
             N SF  PF +P++QGL       ++     V  +P   N + +  D     +    E   
Sbjct  43    NPSFSVPFVSPLLQGLKNSNLNTSSSSFKQVEENPQVVNLTDQVPDVKVPSFDA--EQRS  100

Query  595   SEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSS  774
              E  KN+  +G  +     SG+        ETVK   S   D +            G SS
Sbjct  101   GETVKNITLSGDGKVSSFDSGQRSA-----ETVKDSSSVANDENTLETNATR--SVGNSS  153

Query  775   TVKNDMIG---------ENGSELLRKGRSFYSDCDIFDGEWVRDD--TKPYYPPGSCPFI  921
             ++ +D+ G         ENGS      R  Y DCDI+DG WVRDD  T PYYP GSCP+I
Sbjct  154   SLVSDLGGRYVPKNSSEENGSV---ASRGSYEDCDIYDGNWVRDDDETMPYYPSGSCPYI  210

Query  922   DRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESL  1101
             DRDF+CH + RPDDA+VKW+W+P+ CDIP  N TDFLE+LRG+KLVFVGDS+NRNMWESL
Sbjct  211   DRDFNCHANGRPDDAFVKWKWQPNGCDIPRLNGTDFLEKLRGKKLVFVGDSINRNMWESL  270

Query  1102  VCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-  1278
             VCILR+ ++DKKRV+EISGRS+FKKKGFYAFRFEDYNC+VDFV SPF VRESSFKGVNG 
Sbjct  271   VCILRNSLKDKKRVYEISGRSEFKKKGFYAFRFEDYNCTVDFVGSPFFVRESSFKGVNGT  330

Query  1279  SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYK  1458
             + ETLRLD+MDKTTSMY DADI+IFNTGHWWTH+KT  GE+YYQEGN V+PRL+VLEAYK
Sbjct  331   TLETLRLDMMDKTTSMYRDADILIFNTGHWWTHDKTKLGENYYQEGNVVYPRLKVLEAYK  390

Query  1459  RALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             RAL TWA+WVDKN+D + T VIFRGYS TH
Sbjct  391   RALVTWAKWVDKNIDRSHTHVIFRGYSVTH  420



>ref|XP_010510908.1| PREDICTED: protein trichome birefringence-like 2 [Camelina sativa]
Length=541

 Score =   424 bits (1091),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 219/398 (55%), Positives = 268/398 (67%), Gaps = 44/398 (11%)
 Frame = +1

Query  439   FKAPFFNPVVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVN  618
             F  PF +P++QGL       ++      +               +K   +N ++   +  
Sbjct  45    FNVPFVSPLLQGLKSSNLNTSSSSVKQVD---------------EKPQVVNLTDTVPDAK  89

Query  619   FTGF-----TEKKGDGSGKNGGFSLE------------GETVKSEGSENGDRSRSRGVGV  747
                F     +E+ GD   KN   S E            GETV +  S   D++ +  V  
Sbjct  90    VPTFVPEQRSEETGDAGSKNTTLSEEGKVPSFDSGQRSGETVTTNSSLADDQN-TLEVNA  148

Query  748   EISKKGTSSTVKN--------DMIGENGSELLRKGRSFYSDCDIFDGEWVR--DDTKPYY  897
               S   +SS V +        +   ENGS +  + R  + DCDI+DG WVR  D+T PYY
Sbjct  149   TTSVANSSSLVSDLGGRFVPANTSNENGSVVTDRSRGSFEDCDIYDGSWVRADDETMPYY  208

Query  898   PPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSL  1077
             P GSCP+IDRDF+CH + RPDDAYVKWRW+P+ CDIP  N TDFLE+LRG+KLVFVGDS+
Sbjct  209   PSGSCPYIDRDFNCHANGRPDDAYVKWRWQPNGCDIPRLNGTDFLEKLRGKKLVFVGDSI  268

Query  1078  NRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRES  1257
             NRNMWESLVCILRH ++DK+RV+EISGRS+FKKKGFYAFRFEDYNC+VDFV SPF VRES
Sbjct  269   NRNMWESLVCILRHSLKDKERVYEISGRSEFKKKGFYAFRFEDYNCTVDFVGSPFFVRES  328

Query  1258  SFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPR  1434
             SFKGVNG + ETLRLD+MDKTTSMY DADI+IFNTGHWWTH+KT  GE+YYQEG+ V+ R
Sbjct  329   SFKGVNGTTLETLRLDMMDKTTSMYRDADILIFNTGHWWTHDKTKLGENYYQEGDVVYTR  388

Query  1435  LEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             L+VLEAYKRAL TWA+WVDKN+D N T VIFRGYS TH
Sbjct  389   LKVLEAYKRALITWAKWVDKNIDRNHTHVIFRGYSVTH  426



>emb|CDY69617.1| BnaA09g53160D [Brassica napus]
Length=551

 Score =   424 bits (1091),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 220/399 (55%), Positives = 274/399 (69%), Gaps = 31/399 (8%)
 Frame = +1

Query  430   NFSFKAPFFNPVVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHEL-------  588
             N SF  PF +P++QGL       ++     P+ N SG +   +    KK   +       
Sbjct  43    NSSFNVPFVSPLLQGLRNSNLSISSS--VSPQFNSSGSSSSSNQVEDKKPEVVVPVPSFE  100

Query  589   ---NRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGS---ENGDRSRSRGVGVE  750
                 R    KN + +G  E     SG   G ++   T+  +G     N + +      + 
Sbjct  101   SGQTRDTGSKNTSLSGEGEVSSFESGPRSGETVINSTLSEDGKVSVRNDENTLEANATIS  160

Query  751   ISKKGTSSTVKNDMIG----------ENGSELLRKGRSFYSDCDIFDGEWVR--DDTKPY  894
             +   G SS++ +D+ G          +N +    + R  Y DCDI+DG WVR  D+T PY
Sbjct  161   V---GNSSSLVSDLGGRFVPANPSNEKNATVEADRSRGSYEDCDIYDGNWVRADDETMPY  217

Query  895   YPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDS  1074
             YPPGSCP+IDRDF+CH +KRPDD YVKW+W+P+ CDIP  N TDFLE+LRG+KLVFVGDS
Sbjct  218   YPPGSCPYIDRDFNCHANKRPDDGYVKWKWQPNGCDIPRLNGTDFLEKLRGKKLVFVGDS  277

Query  1075  LNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRE  1254
             +NRNMWESLVCILRH ++DKKRV+EISGR +FKK+GFYAFRFEDYNC+VDFV SPF VRE
Sbjct  278   INRNMWESLVCILRHSLKDKKRVYEISGRREFKKRGFYAFRFEDYNCTVDFVGSPFFVRE  337

Query  1255  SSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHP  1431
             SSFKGVNG + ETLRLD+MDKTTSMY DADI+IFNTGHWWTH+KT  GE+YYQEGN V+P
Sbjct  338   SSFKGVNGTTLETLRLDMMDKTTSMYRDADILIFNTGHWWTHDKTKLGENYYQEGNVVYP  397

Query  1432  RLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             RL+VLEAYKRAL TWA+WVDKN+D N+T V+FRGYS TH
Sbjct  398   RLKVLEAYKRALTTWAKWVDKNIDRNQTHVVFRGYSETH  436



>gb|AAB71964.1| Hypothetical protein [Arabidopsis thaliana]
Length=664

 Score =   428 bits (1100),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 216/386 (56%), Positives = 272/386 (70%), Gaps = 24/386 (6%)
 Frame = +1

Query  445   APFFNPVVQGLNGFGYRNAT----VCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIG-K  609
              PF +P++QGL      N++    V   P   N + +  D       K       + G K
Sbjct  47    VPFVSPLLQGLKSSNLNNSSSVKQVNEKPEVVNLTDKVPD------VKVPSFVVPDAGSK  100

Query  610   NVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKND  789
             N   +  ++     SG+  G +++  ++  EG+ +    ++       +  G SS++ +D
Sbjct  101   NTTLSEESKVPSFDSGQRSGETVKNSSLAEEGNGSVADDQNTLEANATTSVGNSSSLVSD  160

Query  790   MIG----------ENGSELLRKGRSFYSDCDIFDGEWVR--DDTKPYYPPGSCPFIDRDF  933
             + G          ENGS    + R  Y DCDI+DG WVR  D+T PYYPPGSCP+IDRDF
Sbjct  161   LGGRFVVPANTSKENGSVTEDRSRGSYEDCDIYDGSWVRADDETMPYYPPGSCPYIDRDF  220

Query  934   DCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCIL  1113
             +CH + RPDDAYVKWRW+P+ CDIP  N TDFLE+LRG+KLVFVGDS+NRNMWESL+CIL
Sbjct  221   NCHANGRPDDAYVKWRWQPNGCDIPRLNGTDFLEKLRGKKLVFVGDSINRNMWESLICIL  280

Query  1114  RHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFET  1290
             RH ++DKKRV+EISGR +FKKKGFYAFRFEDYNC+VDFV SPF VRESSFKGVNG + ET
Sbjct  281   RHSLKDKKRVYEISGRREFKKKGFYAFRFEDYNCTVDFVGSPFFVRESSFKGVNGTTLET  340

Query  1291  LRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALY  1470
             LRLD+MDKTTSMY DADI+IFNTGHWWTH+KT  GE+YYQEGN V+PRL+VLEAYKRAL 
Sbjct  341   LRLDMMDKTTSMYRDADILIFNTGHWWTHDKTKLGENYYQEGNVVYPRLKVLEAYKRALI  400

Query  1471  TWARWVDKNVDANRTEVIFRGYSATH  1548
             TWA+WVDKN+D ++T ++FRGYS TH
Sbjct  401   TWAKWVDKNIDRSQTHIVFRGYSVTH  426



>emb|CDY40499.1| BnaC09g14570D [Brassica napus]
Length=493

 Score =   422 bits (1084),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 202/327 (62%), Positives = 247/327 (76%), Gaps = 13/327 (4%)
 Frame = +1

Query  607   KNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKN  786
             KN + +G  E     SG   G ++   T+  +G  +G    +          G SS++ +
Sbjct  52    KNTSLSGEGEVSSFESGPRSGDTVINSTLSEDGKVSGRNDENTLEANATISVGNSSSLVS  111

Query  787   DMIG----------ENGSELLRKGRSFYSDCDIFDGEWVR--DDTKPYYPPGSCPFIDRD  930
             D+ G          +N +    + R  Y DCDI+DG WVR  D+T PYYPPGSCP+IDRD
Sbjct  112   DLGGRFVPANSSNEKNATVEADRSRGSYEDCDIYDGNWVRADDETMPYYPPGSCPYIDRD  171

Query  931   FDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCI  1110
             F+CH +KRPDD YVKW+W+P+ CDIP  N TDFLE+LRG+KLVFVGDS+NRNMWESLVCI
Sbjct  172   FNCHANKRPDDGYVKWKWQPNGCDIPRLNGTDFLEKLRGKKLVFVGDSINRNMWESLVCI  231

Query  1111  LRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFE  1287
             LRH ++DKKRV+EISGR +FKK+GFYAFRFEDYNC+VDFV SPF VRESSF+GVNG + E
Sbjct  232   LRHSLKDKKRVYEISGRREFKKRGFYAFRFEDYNCTVDFVGSPFFVRESSFRGVNGTTLE  291

Query  1288  TLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRAL  1467
             TLRLD+MDKTTSMY DADI++FNTGHWWTH+KT  GE+YYQEGN V+PRL+VLEAYKRAL
Sbjct  292   TLRLDMMDKTTSMYRDADILVFNTGHWWTHDKTKLGENYYQEGNVVYPRLKVLEAYKRAL  351

Query  1468  YTWARWVDKNVDANRTEVIFRGYSATH  1548
              TWA+WVDKN+D N+T V+FRGYS TH
Sbjct  352   TTWAKWVDKNIDRNQTHVVFRGYSETH  378



>ref|XP_003517720.1| PREDICTED: protein YLS7-like [Glycine max]
Length=525

 Score =   422 bits (1086),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 188/235 (80%), Positives = 217/235 (92%), Gaps = 0/235 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             +CDIFDG+WVRD+ KPYYP GSCP +DRDFDCHL+ RPD  YVKW+W+P+ CDIPS NAT
Sbjct  175   ECDIFDGKWVRDEFKPYYPLGSCPNVDRDFDCHLNGRPDSDYVKWKWQPNGCDIPSLNAT  234

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
             DFLE+LRGQKLVFVGDSLNRNMWES+VCILR  V+DKKRVFEISG+++FKKKG YAFRFE
Sbjct  235   DFLEKLRGQKLVFVGDSLNRNMWESMVCILRQSVKDKKRVFEISGKTEFKKKGVYAFRFE  294

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             DYNCSVDFVSSPF+V+ES+FKG+NGSFETLRLDLMD+T++ Y+DADI++FNTGHWWTHEK
Sbjct  295   DYNCSVDFVSSPFIVQESTFKGINGSFETLRLDLMDQTSTTYHDADIIVFNTGHWWTHEK  354

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TSRGEDYYQ GN V+PRL+VL+AY RAL TWARWVDKN+DANRT+V FRGYS TH
Sbjct  355   TSRGEDYYQVGNHVYPRLKVLDAYTRALTTWARWVDKNIDANRTQVFFRGYSVTH  409



>ref|XP_010251171.1| PREDICTED: protein trichome birefringence-like 2 [Nelumbo nucifera]
Length=616

 Score =   426 bits (1094),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/288 (69%), Positives = 235/288 (82%), Gaps = 8/288 (3%)
 Frame = +1

Query  685   ETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDG  864
             E VKS G E    +R +   + ++    SS         N S L+++  S + +CDIFDG
Sbjct  222   ENVKSLGGEKMVSARFQETNLPVTDSDKSSY--------NDSGLVKRVDSSFDNCDIFDG  273

Query  865   EWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLR  1044
             +WVRDD KPYYP GSCP+IDRDFDCHL+ RPDDA+++WRW+P+ CDIPS NATDFLER+R
Sbjct  274   KWVRDDGKPYYPAGSCPYIDRDFDCHLNGRPDDAFLRWRWQPNRCDIPSLNATDFLERMR  333

Query  1045  GQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVD  1224
             G++LVFVGDSLNRNMWESLVCILRH + DK RV EISGR +FK KGFYAFR+EDYNCS+D
Sbjct  334   GKRLVFVGDSLNRNMWESLVCILRHGLPDKSRVLEISGRKEFKTKGFYAFRYEDYNCSLD  393

Query  1225  FVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDY  1404
             FVS PFLVRESS K  NGS ETLRLDLMD TTS+Y +ADIV+FNTGHWWTHEKTSRGEDY
Sbjct  394   FVSCPFLVRESSNKRKNGSIETLRLDLMDTTTSLYREADIVVFNTGHWWTHEKTSRGEDY  453

Query  1405  YQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             YQEGN VHP+L+V+EAYK+AL TWARWVDKN++A+RT+V FRGYS TH
Sbjct  454   YQEGNYVHPKLKVMEAYKKALTTWARWVDKNINASRTQVFFRGYSVTH  501



>emb|CBI28569.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   416 bits (1068),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 188/239 (79%), Positives = 216/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  832   SFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPS  1011
             SFY  CDIFDG WVRDD+KPYYP GSCP+IDRDFDCHL+ RPDD Y+KWRW+P+ CDIPS
Sbjct  4     SFYGGCDIFDGRWVRDDSKPYYPAGSCPYIDRDFDCHLNGRPDDDYLKWRWQPNGCDIPS  63

Query  1012  FNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYA  1191
              NATDFLERLRG+KL+FVGDSLNRNMWES+VCILRH V DKKRV+EISGR +FKKKGFYA
Sbjct  64    LNATDFLERLRGKKLIFVGDSLNRNMWESMVCILRHSVEDKKRVYEISGRKEFKKKGFYA  123

Query  1192  FRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWW  1371
             FRFEDYNCSVDFV++PFLV+ESSF G N +FETLRLD MDK+T+ ++DADI++FNTGHWW
Sbjct  124   FRFEDYNCSVDFVNAPFLVQESSFNGRNRTFETLRLDEMDKSTTTFHDADIIVFNTGHWW  183

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             THEKTSRGE YYQEGN VHPRL+VL+AY +AL TWARWVDKN+++N T+V FRGYS TH
Sbjct  184   THEKTSRGEYYYQEGNYVHPRLKVLKAYTKALTTWARWVDKNINSNMTQVFFRGYSITH  242



>ref|XP_003519825.1| PREDICTED: protein YLS7-like [Glycine max]
Length=535

 Score =   419 bits (1076),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 185/235 (79%), Positives = 214/235 (91%), Gaps = 0/235 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             +CDIFDG+WVRD++KPYYP GSCP +DRDFDCHL+ RPD  YVKW+W+P+ CDIPS NAT
Sbjct  185   ECDIFDGKWVRDESKPYYPLGSCPHVDRDFDCHLNGRPDSEYVKWKWQPNGCDIPSLNAT  244

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
             DFLE+LRGQKLVFVGDSLNRNMWES+VCILR  V+DKK VFEISG+++FKKKG YAFRFE
Sbjct  245   DFLEKLRGQKLVFVGDSLNRNMWESMVCILRQSVKDKKHVFEISGKTEFKKKGVYAFRFE  304

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             DYNCSVDFVSSPF+V+ES+FKG+NGSFETLRLDLMD+T++ Y DADI++FNTGHWWTHEK
Sbjct  305   DYNCSVDFVSSPFIVQESNFKGINGSFETLRLDLMDQTSTTYRDADIIVFNTGHWWTHEK  364

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TSRGEDYYQ GN V+PRL+VL+AY RAL TWA WVD N+DANRT+V FRGYS TH
Sbjct  365   TSRGEDYYQVGNHVYPRLKVLDAYTRALTTWATWVDNNIDANRTQVFFRGYSVTH  419



>ref|XP_010553609.1| PREDICTED: protein trichome birefringence-like 2 [Tarenaya hassleriana]
Length=556

 Score =   419 bits (1077),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 195/268 (73%), Positives = 224/268 (84%), Gaps = 6/268 (2%)
 Frame = +1

Query  763   GTSSTVKNDMIGENGSELLRK----GRSFYSDCDIFDGEWVR--DDTKPYYPPGSCPFID  924
             G+ +  KN   G   SE+        R  Y DCDI+DG WVR  D+T PYYPPGSCP+ID
Sbjct  173   GSETVAKNYEEGNFTSEVKENQSDGTRDSYEDCDIYDGNWVRVDDETMPYYPPGSCPYID  232

Query  925   RDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLV  1104
             RDF+C  + R DDA+VKWRW+P+ CDIP  NATDFLE+LRG+KLVFVGDS+NRNMWESLV
Sbjct  233   RDFNCFANGRTDDAFVKWRWQPNGCDIPRLNATDFLEKLRGKKLVFVGDSINRNMWESLV  292

Query  1105  CILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSF  1284
             CILRH +++KK V+EISGR +FKKKGFYAFRFEDYNC+VDFV SPFLVRESSFKG NG+F
Sbjct  293   CILRHSLKNKKAVYEISGRGEFKKKGFYAFRFEDYNCTVDFVGSPFLVRESSFKGENGTF  352

Query  1285  ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRA  1464
             ETLRLDLMDKTTSMY DADI++FNTGHWWTH+KT  GE+YYQEGN VHPRL+VL+AYKRA
Sbjct  353   ETLRLDLMDKTTSMYQDADILVFNTGHWWTHDKTKLGENYYQEGNYVHPRLKVLKAYKRA  412

Query  1465  LYTWARWVDKNVDANRTEVIFRGYSATH  1548
             L TWARWVD+N+D NRT VIFRGYS TH
Sbjct  413   LMTWARWVDQNIDRNRTHVIFRGYSVTH  440



>ref|XP_008444354.1| PREDICTED: protein trichome birefringence-like 2 [Cucumis melo]
Length=551

 Score =   417 bits (1071),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 198/292 (68%), Positives = 228/292 (78%), Gaps = 2/292 (1%)
 Frame = +1

Query  673   SLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCD  852
             SL   T +     N   +    +  + +  GT+S+   ++   N   +     SFY DCD
Sbjct  147   SLNTNTTQYHKGTNHSSNAEDNLPSQGNPSGTNSSDTIEI--SNTQPVPTSYNSFYEDCD  204

Query  853   IFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFL  1032
             IFDGEWVRDD+KPYYP GSCPFIDRDFDC L+KRPD  YVKW+W+P+ C+IPS NAT FL
Sbjct  205   IFDGEWVRDDSKPYYPLGSCPFIDRDFDCDLNKRPDAGYVKWKWQPYGCNIPSLNATHFL  264

Query  1033  ERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYN  1212
             E LRG+ LVFVGDSLNRNMWESLVCILR  V DKK+V+EISGR++FKKKGFYAFRFEDYN
Sbjct  265   EVLRGKNLVFVGDSLNRNMWESLVCILRQSVSDKKKVYEISGRTEFKKKGFYAFRFEDYN  324

Query  1213  CSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSR  1392
             CSVDFVSSPFLVRESSFK  NG+ ETLRLD MD TT MY DAD+++FNTGHWWTHEKTSR
Sbjct  325   CSVDFVSSPFLVRESSFKRRNGTIETLRLDQMDPTTEMYRDADVLVFNTGHWWTHEKTSR  384

Query  1393  GEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             GEDYYQEGN VH +L+VLEA+KRAL TW RW+D NVD NRT V FRGYS +H
Sbjct  385   GEDYYQEGNHVHSKLKVLEAFKRALTTWGRWIDNNVDKNRTLVFFRGYSYSH  436



>ref|XP_002886589.1| hypothetical protein ARALYDRAFT_475253 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62848.1| hypothetical protein ARALYDRAFT_475253 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   415 bits (1066),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 211/377 (56%), Positives = 259/377 (69%), Gaps = 28/377 (7%)
 Frame = +1

Query  445   APFFNPVVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFT  624
              PF +P++QGL      N     S  + N             +K   +N ++    V   
Sbjct  47    VPFVSPLLQGLKS---SNLNTSSSVKQVN-------------EKPEVVNLTDKVPGVKVP  90

Query  625   GFTEKKGDGS-----GKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKN-  786
              F  +   G+      KN   S EG   K    ++G RS        + ++G  S   + 
Sbjct  91    SFDAEHRSGTTVDAGSKNTTLSEEG---KVSNFDSGQRSGEVVKNSSLPEEGKVSVADDK  147

Query  787   DMIGENGSELLRKGRSFYSDCDIFDGEWVR--DDTKPYYPPGSCPFIDRDFDCHLHKRPD  960
             + +  N +  +    S  SDCDI+DG WVR  D+T PYYP GSCP+IDRDF+CH + RPD
Sbjct  148   NTLEVNATTSVGNSSSLASDCDIYDGSWVRADDETMPYYPSGSCPYIDRDFNCHANGRPD  207

Query  961   DAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKR  1140
             DAY KWRW+P+ CDIP  N TDFL++LRG+KLVFVGDS+NRNMWESLVCILRH ++DKKR
Sbjct  208   DAYAKWRWQPNGCDIPRLNGTDFLDKLRGKKLVFVGDSINRNMWESLVCILRHSLKDKKR  267

Query  1141  VFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKT  1317
             V+EISGR +FKKKGFYAFRFEDYNC+VDFV SPF VRESSFK VNG + ETLRLD+MDKT
Sbjct  268   VYEISGRREFKKKGFYAFRFEDYNCTVDFVGSPFFVRESSFKDVNGTTLETLRLDMMDKT  327

Query  1318  TSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKN  1497
             TSMY DADI+IFNTGHWWTH+KT  GE+YYQEGN V+PRL+VLEAYKRAL TWA+WVDKN
Sbjct  328   TSMYRDADILIFNTGHWWTHDKTKLGENYYQEGNVVYPRLKVLEAYKRALITWAKWVDKN  387

Query  1498  VDANRTEVIFRGYSATH  1548
             +D ++T V+FRGYS TH
Sbjct  388   IDRSQTHVVFRGYSVTH  404



>ref|XP_010026659.1| PREDICTED: protein trichome birefringence-like 2 [Eucalyptus 
grandis]
Length=525

 Score =   413 bits (1062),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 197/309 (64%), Positives = 238/309 (77%), Gaps = 12/309 (4%)
 Frame = +1

Query  643   GDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLR  822
             GD  G+    + +G  V  EG    +R+   G    +++ G+ ++ ++ +  E     LR
Sbjct  108   GDCEGRVLNATRDGANVTREGET--ERNHDEGGNFSVARGGSGNS-RSPLAAEESD--LR  162

Query  823   KGRSFY-------SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWR  981
             KGR           DCDIFDG WVRDD+KPYYP  SCP++DRDF+CHL+ RPDD +VKW+
Sbjct  163   KGRRDSGVLGHRGEDCDIFDGRWVRDDSKPYYPANSCPYVDRDFNCHLNGRPDDGFVKWK  222

Query  982   WRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR  1161
             W+P+ CDIP  NATDFLERLRG++LVFVGDSLNRNMWESLVCILRH V+DKKRV+EISGR
Sbjct  223   WQPNGCDIPRLNATDFLERLRGRRLVFVGDSLNRNMWESLVCILRHSVKDKKRVYEISGR  282

Query  1162  SDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDAD  1341
             S+FKKKG YAFRFE YNCSVDFV +PFLVRESSF   NGSF TLR+DLMD+TT  Y DAD
Sbjct  283   SEFKKKGVYAFRFEGYNCSVDFVGAPFLVRESSFSNGNGSFGTLRIDLMDRTTRTYRDAD  342

Query  1342  IVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEV  1521
             I++FNTGHWWTHEKT+RGE YYQEG  VHPRL+VL+AYKRAL TWA+W+DKN+   RT+V
Sbjct  343   IIVFNTGHWWTHEKTTRGEHYYQEGKYVHPRLKVLDAYKRALRTWAKWIDKNIHQTRTQV  402

Query  1522  IFRGYSATH  1548
             +FRGYS TH
Sbjct  403   LFRGYSVTH  411



>ref|XP_004298485.1| PREDICTED: uncharacterized protein LOC101297725 [Fragaria vesca 
subsp. vesca]
Length=611

 Score =   416 bits (1069),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 214/360 (59%), Positives = 259/360 (72%), Gaps = 18/360 (5%)
 Frame = +1

Query  502   TVCCSPPEGNFSGEAKDGSFGLWKKTHE--------LNRSEIGKNVNFTGFTEKKGDGSG  657
             TV      GN + E KDGS G+ +   E         N SEI K+ +        G+G  
Sbjct  144   TVLEKTEMGNLTEEVKDGSSGVEEGRVEGKDGGLDSRNSSEILKSESL------HGEGGK  197

Query  658   KNGGFSLEG-ETVKSEGSENGDRSR--SRGVGVEISKKGTSSTVKNDMIGENGSELLRKG  828
             + G  S+ G E V +E +  G  S+  S G G        +ST K ++I +  S+     
Sbjct  198   EIGNLSMSGKEDVHAEETVEGSFSKNSSNGDGKVTDDHHGNSTQKTEVI-DFDSQTWEMP  256

Query  829   RSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIP  1008
                   CDIFDG+WVRDD+KPYYP GSCP +D+ ++CH ++RPD+A++KW+W+P+ CDIP
Sbjct  257   SDSDEKCDIFDGKWVRDDSKPYYPGGSCPHVDKVWNCHSNRRPDNAFLKWKWQPNHCDIP  316

Query  1009  SFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFY  1188
             S NATDFLERLRGQ+LVFVGDSLNRNMWESLVCILRH VR KK+V+EISGR+DFKKKG Y
Sbjct  317   SLNATDFLERLRGQRLVFVGDSLNRNMWESLVCILRHSVRHKKKVYEISGRTDFKKKGIY  376

Query  1189  AFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHW  1368
             AFRFE+YNCSVDFV +PFLVR+SSFKG N  FETLRLDLMD TT  Y DAD+++FNTGHW
Sbjct  377   AFRFEEYNCSVDFVVAPFLVRKSSFKGKNSWFETLRLDLMDPTTKTYRDADVLVFNTGHW  436

Query  1369  WTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             WTHEKTS+GEDYYQEGN VHPRL+ LEAYKRAL TWARWVD  ++AN+T V FRGYS TH
Sbjct  437   WTHEKTSKGEDYYQEGNYVHPRLKALEAYKRALTTWARWVDTYINANKTRVFFRGYSVTH  496



>ref|XP_004509571.1| PREDICTED: uncharacterized protein LOC101508086 [Cicer arietinum]
Length=589

 Score =   411 bits (1056),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/309 (63%), Positives = 237/309 (77%), Gaps = 5/309 (2%)
 Frame = +1

Query  631   TEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMI---GE  801
              ++K DG   +  F      V    + +   + +  V VE   +G     KN+ I    +
Sbjct  168   VKRKHDGMKNHSSFITNVRNVIKNVTNDVSYNGNSSVIVEELNEGGLVWNKNETIVTHSD  227

Query  802   NGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWR  981
             N  E ++ G  FY DCDIFDG+WVRD +KPYYP GSCPFIDRDF+CHL+ R D  YVKW+
Sbjct  228   NKMEKMKVG--FYEDCDIFDGKWVRDYSKPYYPLGSCPFIDRDFNCHLNGRLDLEYVKWK  285

Query  982   WRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR  1161
             W+P+ C IPS NATDFLERLRGQ+LVFVGDSLNRNMWESLVCILR  V +KK+VFEISG+
Sbjct  286   WKPNKCHIPSLNATDFLERLRGQRLVFVGDSLNRNMWESLVCILRQSVANKKQVFEISGK  345

Query  1162  SDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDAD  1341
              +FKKKG YAFRFEDYNCSVDFV+SPFLVRESSFKG NGSFETLRLDLMD TT+ Y DA+
Sbjct  346   REFKKKGVYAFRFEDYNCSVDFVASPFLVRESSFKGKNGSFETLRLDLMDHTTTRYQDAN  405

Query  1342  IVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEV  1521
             I++FNTGHWWTH+KTS+GEDYYQEG  V+PRL+ L+AY RAL TWA+WVD  +++N+T++
Sbjct  406   IIVFNTGHWWTHDKTSKGEDYYQEGKHVYPRLKALDAYMRALTTWAKWVDHKINSNQTQI  465

Query  1522  IFRGYSATH  1548
              FRGYS TH
Sbjct  466   FFRGYSVTH  474



>gb|KEH20203.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=526

 Score =   409 bits (1050),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 211/239 (88%), Gaps = 0/239 (0%)
 Frame = +1

Query  832   SFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPS  1011
             + Y  CDIFDG+WVRDD+KPYYP GSCPFIDRDF+CHL+ R D  YVKW+W+P+ C IPS
Sbjct  173   NLYDKCDIFDGKWVRDDSKPYYPLGSCPFIDRDFNCHLNGRLDLEYVKWKWKPNKCHIPS  232

Query  1012  FNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYA  1191
              NATDFLERLRGQ+LVFVGDSLNRNMWESLVCILR  +R KKRVFEISG+ +FKKKG YA
Sbjct  233   LNATDFLERLRGQRLVFVGDSLNRNMWESLVCILRQSLRYKKRVFEISGKREFKKKGVYA  292

Query  1192  FRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWW  1371
             FRFEDYNCSVDFV+SPFLVRES+FKG NGSFETLRLDLMD TTS Y DA+I++FNTGHWW
Sbjct  293   FRFEDYNCSVDFVASPFLVRESTFKGKNGSFETLRLDLMDHTTSRYQDANIIVFNTGHWW  352

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             THEKTS+GE+YYQEGN V+PRL+ L+AY RAL TWA+WVD+ ++AN T+V FRGYS TH
Sbjct  353   THEKTSKGEEYYQEGNHVYPRLKALDAYMRALTTWAKWVDRKINANHTQVFFRGYSVTH  411



>ref|XP_008221854.1| PREDICTED: protein trichome birefringence-like 2 [Prunus mume]
Length=620

 Score =   411 bits (1057),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 208/337 (62%), Positives = 248/337 (74%), Gaps = 29/337 (9%)
 Frame = +1

Query  577   THELNRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEG-ETVKSEGSENGDRSRS-------  732
              H  N SE+ KN +        G+     G FSL G E V +E +  G  S++       
Sbjct  185   AHMGNSSELLKNGSL------HGEEGRVIGNFSLSGVEDVHAEKTIEGSLSKNSSNEDDK  238

Query  733   -----RGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYY  897
                  R   V  +    +S  KN +I +  S+L +     Y  CDIF G+WVRDD+KPYY
Sbjct  239   VTENKRKKSVRETAHLGNSKEKNKII-DYDSQLRKMQTDSYQKCDIFIGKWVRDDSKPYY  297

Query  898   PPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSL  1077
             P GSCP+IDRDF+CHL+ RPD+A++KW+W+P+ C IPS NATDFLERLRG++LVFVGDSL
Sbjct  298   PGGSCPYIDRDFNCHLNGRPDNAFIKWKWQPNECHIPSLNATDFLERLRGKRLVFVGDSL  357

Query  1078  NRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRES  1257
             NRNMWESLVCILR+ +R K         S+FKKKGFYAFRFEDYNCSVDFV+SPFLVRES
Sbjct  358   NRNMWESLVCILRNSLRYK---------SEFKKKGFYAFRFEDYNCSVDFVASPFLVRES  408

Query  1258  SFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRL  1437
             SF G NGSFETLRLDLMD+TTSMY+DAD+++FNTGHWWTHEKTS+GEDYYQEGN VHPRL
Sbjct  409   SFTGRNGSFETLRLDLMDQTTSMYHDADVIVFNTGHWWTHEKTSKGEDYYQEGNYVHPRL  468

Query  1438  EVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +VL+AYKRAL TWARWVDKN+D  RT+V FRGYS TH
Sbjct  469   KVLKAYKRALTTWARWVDKNIDVKRTQVFFRGYSVTH  505



>gb|KHN14559.1| hypothetical protein glysoja_027168 [Glycine soja]
Length=521

 Score =   405 bits (1041),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 182/235 (77%), Positives = 213/235 (91%), Gaps = 4/235 (2%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             +CDIFDG+WVRD+ KPYYP GSCP +DRDFDCHL+ RPD  YVKW+W+P+ CDIPS NAT
Sbjct  175   ECDIFDGKWVRDEFKPYYPLGSCPNVDRDFDCHLNGRPDSDYVKWKWQPNGCDIPSLNAT  234

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
             DFLE+LRGQKLVFVGDSLNRNMWES+VCILR  V+DKKRVFEISG+++FKKKG YAFRFE
Sbjct  235   DFLEKLRGQKLVFVGDSLNRNMWESMVCILRQSVKDKKRVFEISGKTEFKKKGVYAFRFE  294

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
                 ++DFVSSPF+V+ES+FKG+NGSFETLRLDLMD+T++ Y+DADI++FNTGHWWTHEK
Sbjct  295   ----AIDFVSSPFIVQESTFKGINGSFETLRLDLMDQTSTTYHDADIIVFNTGHWWTHEK  350

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TSRGEDYYQ GN V+PRL+VL+AY RAL TWARWVDKN+DANRT+V FRGYS TH
Sbjct  351   TSRGEDYYQVGNHVYPRLKVLDAYTRALTTWARWVDKNIDANRTQVFFRGYSVTH  405



>ref|XP_007044711.1| Uncharacterized protein TCM_010432 [Theobroma cacao]
 gb|EOY00543.1| Uncharacterized protein TCM_010432 [Theobroma cacao]
Length=643

 Score =   407 bits (1047),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 203/364 (56%), Positives = 255/364 (70%), Gaps = 30/364 (8%)
 Frame = +1

Query  517   PPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVK  696
             P  GN  G   DG   +  KT   N SE   NV   G           N    +EGE V 
Sbjct  164   PETGNLLGSNGDGV--ILDKTQLGNFSETVNNVTLVG--------ENVNANKVIEGEFVD  213

Query  697   SEGSENGDRSRSRG----------VGVEISK-KGTSSTVKNDMIGENGS--------ELL  819
             + G  N     +            VG+ + + K    T + +++ EN +        +++
Sbjct  214   NPGDANTVNPENNNVDNLSNNGEVVGLSVGEDKDMELTDQGNLVVENKTINCPGADPQVV  273

Query  820   RKGRSFYSDCDIFDGEWVRDD-TKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHA  996
                   +  CD FDG WVRDD +KPYY PGSCP+IDRDF+C  + RPD+ Y+KWRW+P+ 
Sbjct  274   EGPNGSFETCDFFDGRWVRDDRSKPYYRPGSCPYIDRDFNCQRNGRPDNGYIKWRWQPNR  333

Query  997   CDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKK  1176
             CDIP  NATDFLERLRG++LVFVGDSLNRNMWES+VCILR  ++ KKRV+EISGRSDFKK
Sbjct  334   CDIPRLNATDFLERLRGKRLVFVGDSLNRNMWESMVCILRRSIKKKKRVYEISGRSDFKK  393

Query  1177  KGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFN  1356
             KGFYAFRFEDYNCSVDFV++PFLV+ESSF+G NGS ETLRLDLMD  TSMY+DA++++FN
Sbjct  394   KGFYAFRFEDYNCSVDFVAAPFLVKESSFRGENGSIETLRLDLMDPATSMYHDAELMVFN  453

Query  1357  TGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGY  1536
             TGHWWTHEKTS+GEDYYQEG+ V+PRL+VL+AY++AL TW+RW+DKNVD++R ++ FRGY
Sbjct  454   TGHWWTHEKTSKGEDYYQEGDYVYPRLKVLKAYQKALTTWSRWIDKNVDSSRAQIFFRGY  513

Query  1537  SATH  1548
             S TH
Sbjct  514   SVTH  517



>ref|XP_006602386.1| PREDICTED: protein YLS7-like [Glycine max]
Length=533

 Score =   399 bits (1025),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 221/429 (52%), Positives = 284/429 (66%), Gaps = 32/429 (7%)
 Frame = +1

Query  307   LKKHAFSGQFLQHAFLPRRKFSGCWRLSvaaaffmvgvavLNFSFKAPFFNPVVQGLNGF  486
             +K+ AFS  FL H    RR+    + LSV+A+  +V + +L+ S + P  +  V  L+  
Sbjct  7     VKRVAFSESFLSH----RRRLFTWFSLSVSASLVLVSLFLLSNSLRVPKVSVFVPKLDAV  62

Query  487   GYRNATVCC-----------SPPEGNFSGEAKDGSFGLWKKTHELNRS-EIGKNVNFTGF  630
             G  ++   C           S     F     +GS    ++  E + + EI   VN    
Sbjct  63    GANSSIGPCPLLPFNTSHTFSSESNTFDTSKSNGSESSVQRIEEGSVAMEILHGVNNVSG  122

Query  631   TEKKGDGSGKNGGFSLEGETVKSE---GSENGDRSRSRGVGVEISKKGTSSTVKNDMIGE  801
                K    G+     LE  ++ S     S NG +S+  G G++  K   + TV ++    
Sbjct  123   ENIKSVAEGR----GLENSSLSSNLLPESNNGKQSKHEG-GLDGEKNLKNVTVTHNDEMH  177

Query  802   NGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWR  981
              G         +   CDIFDG+WVRD +KP+YP GSC  IDRDF+CH + RPD  YVKWR
Sbjct  178   VGL--------YDEKCDIFDGKWVRDGSKPHYPLGSCRLIDRDFNCHRNGRPDAEYVKWR  229

Query  982   WRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR  1161
             W+P+ C IPS NATDFLERLRGQ+LVFVGDSLNRNMWESLVCILR  +++KKRVFEISGR
Sbjct  230   WQPNGCKIPSLNATDFLERLRGQRLVFVGDSLNRNMWESLVCILRQSIKNKKRVFEISGR  289

Query  1162  SDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDAD  1341
              +FKKKG YAFRFEDYNCSVDFV SPF+V+ES+F G NGSFETLRLDLMD+TT+ Y DA+
Sbjct  290   REFKKKGVYAFRFEDYNCSVDFVVSPFIVQESTFNGKNGSFETLRLDLMDRTTARYCDAN  349

Query  1342  IVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEV  1521
             I++FNTGHWWTH+KTS+GEDYYQEGN V+PRLEVL+AY RAL TWA+WVD+ ++A++T+V
Sbjct  350   IIVFNTGHWWTHDKTSKGEDYYQEGNHVYPRLEVLDAYTRALTTWAKWVDQKINADQTQV  409

Query  1522  IFRGYSATH  1548
              FRG+S TH
Sbjct  410   FFRGFSVTH  418



>ref|XP_007153754.1| hypothetical protein PHAVU_003G062400g [Phaseolus vulgaris]
 gb|ESW25748.1| hypothetical protein PHAVU_003G062400g [Phaseolus vulgaris]
Length=526

 Score =   397 bits (1019),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 207/238 (87%), Gaps = 0/238 (0%)
 Frame = +1

Query  835   FYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSF  1014
              + +CDIFDG+WV+D +KPYYP GSCP IDRDF+CH + RPD  YVKWRW+P+ C IPS 
Sbjct  174   LHEECDIFDGKWVKDGSKPYYPLGSCPHIDRDFNCHQNGRPDGEYVKWRWQPYGCKIPSL  233

Query  1015  NATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAF  1194
             NATDFLERLRGQ+LVFVGDSLNRNMWESLVCILR  +R+KKRVFEISGR +FKKKG Y+F
Sbjct  234   NATDFLERLRGQRLVFVGDSLNRNMWESLVCILRESIRNKKRVFEISGRREFKKKGVYSF  293

Query  1195  RFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWT  1374
             RFEDYNCSVD V SPF+V+ES+FK  NGSFETLRLDLMD TT+ Y DA+I++FNTGHWWT
Sbjct  294   RFEDYNCSVDLVVSPFIVQESTFKSKNGSFETLRLDLMDWTTTRYEDANIIVFNTGHWWT  353

Query  1375  HEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             H KTS+GEDYYQEGN VH RL+VL+AY RAL TWA+WVD+ ++AN+T+V FRGYS TH
Sbjct  354   HNKTSKGEDYYQEGNHVHARLKVLDAYTRALTTWAKWVDRKINANQTQVFFRGYSVTH  411



>ref|XP_006585942.1| PREDICTED: protein YLS7-like [Glycine max]
Length=534

 Score =   394 bits (1012),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 206/234 (88%), Gaps = 0/234 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CDIFDG+WVRD +KPYYP GSC  IDRDF+CH + RPD  YVKWRW+P+ C IPS NATD
Sbjct  184   CDIFDGKWVRDGSKPYYPLGSCRLIDRDFNCHRNGRPDAEYVKWRWQPNGCIIPSLNATD  243

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
             FLERLRGQ+LVFVGDSLNRNMWESLVCILR  +  KKRVFEISGR +FKKKG YAFRFED
Sbjct  244   FLERLRGQRLVFVGDSLNRNMWESLVCILRQSINKKKRVFEISGRREFKKKGVYAFRFED  303

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKT  1386
             YNCSVDFV SPF+V+ES+FKG NGSFETLRLDLMD+TT+ Y DA+I++FNTGHWWTH+KT
Sbjct  304   YNCSVDFVVSPFIVQESTFKGKNGSFETLRLDLMDRTTARYWDANIIVFNTGHWWTHDKT  363

Query  1387  SRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             S+GEDYYQEGN V+ RLEVL+AY RAL TWA+WVDK ++AN+T+V FRG+S TH
Sbjct  364   SKGEDYYQEGNHVYQRLEVLDAYTRALTTWAKWVDKKINANQTQVFFRGFSLTH  417



>ref|XP_010682517.1| PREDICTED: protein trichome birefringence-like 2 [Beta vulgaris 
subsp. vulgaris]
Length=512

 Score =   385 bits (989),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 209/251 (83%), Gaps = 0/251 (0%)
 Frame = +1

Query  796   GENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVK  975
             G    E+     +   DC+IFDG+WVRDD  P+YPPGSCP+IDRDF+CH++ RPD  +  
Sbjct  145   GRIAKEIYGDAGNLLEDCNIFDGKWVRDDNLPHYPPGSCPYIDRDFNCHINGRPDKGFYT  204

Query  976   WRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEIS  1155
             W+W+P  C+IP  NATDFLER+RG+KLVFVGDSLNRNMWESLVC+L H ++DKKRV+E+S
Sbjct  205   WKWQPIGCNIPRLNATDFLERMRGRKLVFVGDSLNRNMWESLVCMLWHSIKDKKRVYEVS  264

Query  1156  GRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYND  1335
             G+ +FKK+G+YAFRFEDYNC++D+V +PFLVRES+++  NGS  TLRLDLMD+TT MY+D
Sbjct  265   GKKEFKKEGYYAFRFEDYNCTIDYVRAPFLVRESTYQKKNGSLATLRLDLMDQTTQMYHD  324

Query  1336  ADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRT  1515
             A I++FNTGHWWTHEKTSRGE+YYQEG+ VHPRL+ L+AY++AL TW RWVD+++D  +T
Sbjct  325   AHILVFNTGHWWTHEKTSRGEEYYQEGDHVHPRLKALKAYRKALATWGRWVDRHIDYKKT  384

Query  1516  EVIFRGYSATH  1548
              V FRGYS TH
Sbjct  385   LVFFRGYSGTH  395



>ref|XP_010940155.1| PREDICTED: protein trichome birefringence-like 2 [Elaeis guineensis]
Length=619

 Score =   380 bits (976),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 204/235 (87%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CDIFDG WVRD+ +PYYP GSCPFIDRDFDCH + RPDD ++KWRW+P+ CDIP  NATD
Sbjct  270   CDIFDGRWVRDEQEPYYPAGSCPFIDRDFDCHTNGRPDDGFLKWRWQPYHCDIPRLNATD  329

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
             FLERLRG++++FVGDSLNRNMWESLVCILRH V+ KKRV+E SGRS FK +G+Y+F+F+D
Sbjct  330   FLERLRGKRILFVGDSLNRNMWESLVCILRHSVKYKKRVYEASGRSQFKTRGYYSFKFKD  389

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             Y CSVDFV SPFLVRE  +K  NGS  E LRLD++D+TTS Y +ADIV+FNTGHWWTHEK
Sbjct  390   YKCSVDFVRSPFLVRELYYKNANGSEDEKLRLDVLDETTSSYREADIVVFNTGHWWTHEK  449

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS+G DYYQEG+ V+P L+V+EAYK+AL TWARWVDKN+++ +T+V+FRGYS TH
Sbjct  450   TSKGIDYYQEGDHVYPVLKVMEAYKKALTTWARWVDKNINSKKTQVVFRGYSLTH  504



>ref|XP_008812175.1| PREDICTED: protein trichome birefringence-like 2 [Phoenix dactylifera]
Length=612

 Score =   376 bits (966),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 202/235 (86%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CDIF G WVRD+ +PYYP GSCP+ID DF+CH + RPDD ++KWRW+P+ CDIP  NATD
Sbjct  263   CDIFHGRWVRDEHEPYYPAGSCPYIDDDFNCHKNGRPDDGFLKWRWQPYHCDIPRLNATD  322

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
             FLERLRG++++FVGDSLNRNMWESLVCILRH VR KKRV+E+SGRS FK +G+Y+F+F+D
Sbjct  323   FLERLRGKRILFVGDSLNRNMWESLVCILRHSVRYKKRVYEVSGRSQFKTRGYYSFKFKD  382

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             Y CSVDFV SPFLVRE  +K  NGS  E LRLD++D+TTS Y  ADIV+FNTGHWWTHEK
Sbjct  383   YECSVDFVRSPFLVRELYYKNTNGSEDEKLRLDMLDETTSSYRGADIVVFNTGHWWTHEK  442

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS+G DYYQEGN V+P L+V+EAYK+A+ TWARWVDKN+++ +T+VIFRGYS TH
Sbjct  443   TSKGIDYYQEGNHVYPVLKVMEAYKKAITTWARWVDKNINSKQTQVIFRGYSLTH  497



>ref|XP_010100425.1| hypothetical protein L484_027736 [Morus notabilis]
 gb|EXB82559.1| hypothetical protein L484_027736 [Morus notabilis]
Length=500

 Score =   364 bits (934),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 189/354 (53%), Positives = 227/354 (64%), Gaps = 63/354 (18%)
 Frame = +1

Query  529   NFSGEAKDGSFGLWKKTHELNRSEIGK----------NVNFTGFTEKKGDGSGKNGG---  669
             NF+ E K+GS  + +KT + N S  GK          + + + +  +  +G  KN     
Sbjct  84    NFTQEVKNGSSVVEEKTLDGNASFSGKEGAVIEKTIASTSLSDYGNEDNNGGQKNSSLGN  143

Query  670   -FSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSD  846
              F  + E    E S  G+ +    + +          V+ND                Y D
Sbjct  144   VFDKQEEKAIMEASRGGNWTEENSLSIAKVSTNEFGRVQNDS---------------YED  188

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             C+IFDG WVRDD+KPYYP GSCP+IDRDFDC+L++RPDD YVKWRW+P+ CDIPS NATD
Sbjct  189   CNIFDGNWVRDDSKPYYPGGSCPYIDRDFDCYLNRRPDDGYVKWRWQPYGCDIPSLNATD  248

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
             FLERLRG+KLVFVGDSLNRNMWESL                                  D
Sbjct  249   FLERLRGKKLVFVGDSLNRNMWESL----------------------------------D  274

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKT  1386
             YNC+VDFV SPFLVRESSF   NGSFETLR+DLMD+TTSMY+DADI++FNTGHWWTHEKT
Sbjct  275   YNCTVDFVGSPFLVRESSFTRKNGSFETLRIDLMDRTTSMYHDADIIVFNTGHWWTHEKT  334

Query  1387  SRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             SRGEDYYQEGN V+PRL+VLEAYKRAL TWA+WV+KN+D  RT+V FRGYS TH
Sbjct  335   SRGEDYYQEGNHVYPRLKVLEAYKRALKTWAKWVNKNIDTARTKVFFRGYSVTH  388



>ref|XP_006841061.1| hypothetical protein AMTR_s00085p00172090 [Amborella trichopoda]
 gb|ERN02736.1| hypothetical protein AMTR_s00085p00172090 [Amborella trichopoda]
Length=495

 Score =   352 bits (904),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/282 (59%), Positives = 212/282 (75%), Gaps = 5/282 (2%)
 Frame = +1

Query  706   SENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDT  885
             S+  +R +    G      G+ +  K D  G+  S   ++      +CD+F G+WV+D+T
Sbjct  108   SQIEEREKIGNFGETTQLNGSRTAKKRDFNGDLSSGKAKQ----VGECDVFAGKWVKDET  163

Query  886   KPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFV  1065
             KPYYP GSC ++D  FDCH +KRPD  Y KWRW+P  CDIPS NATDFLERLRG++LVFV
Sbjct  164   KPYYPAGSCAYVDEAFDCHRNKRPDFEYEKWRWKPDDCDIPSLNATDFLERLRGKRLVFV  223

Query  1066  GDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFL  1245
             GDSLNRNMWESLVCILRH V +K  V+EISGR +F+ +GFYAFR+E YNCSV+FV +PFL
Sbjct  224   GDSLNRNMWESLVCILRHSVGNKSTVYEISGRREFRTQGFYAFRYEGYNCSVEFVRAPFL  283

Query  1246  VRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNR  1422
             V+E S  G NG+  ETLRLDLMDK T  Y +AD+++FNTGHWWTHEKTS G+DYYQEG+ 
Sbjct  284   VQEWSVNGTNGTEEETLRLDLMDKKTLKYREADVIVFNTGHWWTHEKTSLGKDYYQEGDY  343

Query  1423  VHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             V+P L V+EAY++AL T A+WVD+N+++ +T V FRG+S TH
Sbjct  344   VYPSLNVMEAYRKALTTLAKWVDENINSTKTWVFFRGFSITH  385



>ref|XP_009392183.1| PREDICTED: protein trichome birefringence-like 2 [Musa acuminata 
subsp. malaccensis]
Length=718

 Score =   357 bits (916),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 200/245 (82%), Gaps = 11/245 (4%)
 Frame = +1

Query  847   CDIFDGEWVR-DDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             CDIF G WVR +  +PYYP GSCP++D DF+CH + RPD  ++KWRW+P+ CDIP  NA+
Sbjct  359   CDIFHGRWVRAEKNQPYYPAGSCPYLDDDFNCHKNGRPDSDFLKWRWQPYDCDIPRLNAS  418

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKK---------  1176
             DFL RLRG++LVFVGDSLNRNMWESLVCILRH + +KKRV+E+SGRS FK          
Sbjct  419   DFLGRLRGKRLVFVGDSLNRNMWESLVCILRHSISNKKRVYEVSGRSQFKVKGRRNHFKY  478

Query  1177  KGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIF  1353
             KG+Y+FRFEDY CSVDFV SPFLVRE  +K V+GS  E LRLD++D+TT  Y +AD+++F
Sbjct  479   KGYYSFRFEDYQCSVDFVRSPFLVREMQYKNVHGSEDERLRLDILDETTLAYREADVIVF  538

Query  1354  NTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRG  1533
             NTGHWWTHE+TSRG +YYQEGN V+P L+V+EAYK+AL TW+RW+D N+D+++T+V+FRG
Sbjct  539   NTGHWWTHEQTSRGRNYYQEGNHVYPVLKVMEAYKKALTTWSRWIDMNIDSSKTQVVFRG  598

Query  1534  YSATH  1548
             YS TH
Sbjct  599   YSLTH  603



>gb|KHN00372.1| hypothetical protein glysoja_000040 [Glycine soja]
Length=503

 Score =   348 bits (892),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 191/255 (75%), Gaps = 41/255 (16%)
 Frame = +1

Query  784   NDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDD  963
             ND I  + S LL        +CDIFDG+WVRD++KPYYP GSCP +DRDFDCHL+ RPD 
Sbjct  174   NDSISVSVSGLL-------GECDIFDGKWVRDESKPYYPLGSCPHVDRDFDCHLNGRPDS  226

Query  964   AYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRV  1143
              YVKW+W+P+ CDIPS NATDFLE+LRGQKLVFVGDSLNRNMWES+              
Sbjct  227   EYVKWKWQPNGCDIPSLNATDFLEKLRGQKLVFVGDSLNRNMWESM--------------  272

Query  1144  FEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTS  1323
                                 DYNCSVDFVSSPF+V+ES+FKG+NGSFETLRLDLMD+T++
Sbjct  273   --------------------DYNCSVDFVSSPFIVQESNFKGINGSFETLRLDLMDQTST  312

Query  1324  MYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVD  1503
              Y DADI++FNTGHWWTHEKTSRGEDYYQ GN V+PRL+VL+AY RAL TWA WVD N+D
Sbjct  313   TYRDADIIVFNTGHWWTHEKTSRGEDYYQVGNHVYPRLKVLDAYTRALTTWATWVDNNID  372

Query  1504  ANRTEVIFRGYSATH  1548
             ANRT+V FRGYS TH
Sbjct  373   ANRTQVFFRGYSVTH  387



>ref|NP_001053267.1| Os04g0508000 [Oryza sativa Japonica Group]
 emb|CAE04726.1| OSJNBa0043L24.14 [Oryza sativa Japonica Group]
 emb|CAE75965.1| OSJNBb0002J11.24 [Oryza sativa Japonica Group]
 dbj|BAF15181.1| Os04g0508000 [Oryza sativa Japonica Group]
 gb|EAY94794.1| hypothetical protein OsI_16573 [Oryza sativa Indica Group]
 gb|EAZ31295.1| hypothetical protein OsJ_15402 [Oryza sativa Japonica Group]
Length=711

 Score =   353 bits (907),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 204/268 (76%), Gaps = 10/268 (4%)
 Frame = +1

Query  766   TSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTK-----PYYPPGSCPFIDRD  930
             TS+   N ++  +G   ++ G   ++ CD+F G WVRDD +     P+YPPGSCP ID D
Sbjct  332   TSTVGDNRVVWTSG---VQSGLVSFAKCDVFSGRWVRDDDEGGGAYPFYPPGSCPHIDDD  388

Query  931   FDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCI  1110
             F+CH + R D  +++WRW+PH CDIP  N  DFLERLRGQ+++FVGDSLNRNMWESLVCI
Sbjct  389   FNCHKNGRADTGFLRWRWQPHGCDIPRLNPIDFLERLRGQRIIFVGDSLNRNMWESLVCI  448

Query  1111  LRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSF--  1284
             LRH VRDK+R++E SGR+ FK +G+Y+FRF DYNCSVDF+ S FLV+E   +   G+   
Sbjct  449   LRHGVRDKRRMYEASGRNQFKTRGYYSFRFRDYNCSVDFIRSIFLVKEMINETKGGAVVD  508

Query  1285  ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRA  1464
               LRLD +D+TT  Y  ADIV+FNTGHWWTH KTSRG +YYQEGN VHP LEV++AYKRA
Sbjct  509   AKLRLDELDETTPAYRTADIVVFNTGHWWTHWKTSRGLNYYQEGNYVHPSLEVMDAYKRA  568

Query  1465  LYTWARWVDKNVDANRTEVIFRGYSATH  1548
             L TWARWVDKN+D+ RT+V+FRGYS TH
Sbjct  569   LTTWARWVDKNIDSTRTQVVFRGYSLTH  596



>emb|CAH67561.1| OSIGBa0101P20.4 [Oryza sativa Indica Group]
Length=711

 Score =   353 bits (907),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 204/268 (76%), Gaps = 10/268 (4%)
 Frame = +1

Query  766   TSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTK-----PYYPPGSCPFIDRD  930
             TS+   N ++  +G   ++ G   ++ CD+F G WVRDD +     P+YPPGSCP ID D
Sbjct  332   TSTVGDNRVVWTSG---VQSGLVSFAKCDVFSGRWVRDDDEGGGAYPFYPPGSCPHIDDD  388

Query  931   FDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCI  1110
             F+CH + R D  +++WRW+PH CDIP  N  DFLERLRGQ+++FVGDSLNRNMWESLVCI
Sbjct  389   FNCHKNGRADTGFLRWRWQPHGCDIPRLNPIDFLERLRGQRIIFVGDSLNRNMWESLVCI  448

Query  1111  LRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSF--  1284
             LRH VRDK+R++E SGR+ FK +G+Y+FRF DYNCSVDF+ S FLV+E   +   G+   
Sbjct  449   LRHGVRDKRRMYEASGRNQFKTRGYYSFRFRDYNCSVDFIRSIFLVKEMINETKGGAVVD  508

Query  1285  ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRA  1464
               LRLD +D+TT  Y  ADIV+FNTGHWWTH KTSRG +YYQEGN VHP LEV++AYKRA
Sbjct  509   AKLRLDELDETTPAYRTADIVVFNTGHWWTHWKTSRGLNYYQEGNYVHPSLEVMDAYKRA  568

Query  1465  LYTWARWVDKNVDANRTEVIFRGYSATH  1548
             L TWARWVDKN+D+ RT+V+FRGYS TH
Sbjct  569   LTTWARWVDKNIDSTRTQVVFRGYSLTH  596



>ref|XP_002448144.1| hypothetical protein SORBIDRAFT_06g022030 [Sorghum bicolor]
 gb|EES12472.1| hypothetical protein SORBIDRAFT_06g022030 [Sorghum bicolor]
Length=720

 Score =   351 bits (901),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/271 (58%), Positives = 204/271 (75%), Gaps = 5/271 (2%)
 Frame = +1

Query  739   VGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPF  918
             VGV  S  G      N ++  +G + L      ++ CD+F G WVRD++  +YPP SC  
Sbjct  339   VGVNASTGGVVGAGNNRVVWTSGVQDLVS----FAKCDVFSGRWVRDESYGFYPPKSCAL  394

Query  919   IDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWES  1098
             ID DF+CH + RPD  +++WRW+PH CDIP  NA +FLERLRGQ+++FVGDSLNRNMWES
Sbjct  395   IDDDFNCHKNGRPDSDFLRWRWQPHGCDIPRLNAAEFLERLRGQRIIFVGDSLNRNMWES  454

Query  1099  LVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG  1278
             LVCILRH VRDK+ V+E SG++ FK +G+Y+F+F +YNCSVDF+ S FLVR+   +G NG
Sbjct  455   LVCILRHGVRDKRNVYEASGKNQFKTRGYYSFKFREYNCSVDFIRSIFLVRQMIREGRNG  514

Query  1279  SFET-LRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAY  1455
             + +  L+LD +D TT  Y  ADI++FNTGHWWTH KTSRG +YYQEGN V+P L+VL+AY
Sbjct  515   TEDAKLKLDELDATTPAYRTADIIVFNTGHWWTHYKTSRGLNYYQEGNHVYPSLDVLDAY  574

Query  1456  KRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KRAL TWARWVDKN+D  RT+V+FRGYS +H
Sbjct  575   KRALVTWARWVDKNIDPRRTQVVFRGYSLSH  605



>ref|XP_004978124.1| PREDICTED: uncharacterized protein LOC101771038 [Setaria italica]
Length=771

 Score =   352 bits (904),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 193/238 (81%), Gaps = 1/238 (0%)
 Frame = +1

Query  838   YSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFN  1017
             ++ CD+F+G WVRD++  +YPP SC  ID DF+CH + RPD  Y+KWRW+P  CDIP  N
Sbjct  397   FARCDVFNGRWVRDESYGFYPPKSCALIDDDFNCHKNGRPDSDYLKWRWQPQGCDIPRLN  456

Query  1018  ATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFR  1197
             AT FLERLRGQ+++FVGDSLNRNMWESLVCILRH VRDK+ V+E SG++ FK +G+Y+FR
Sbjct  457   ATGFLERLRGQRIIFVGDSLNRNMWESLVCILRHGVRDKRNVYEASGKNQFKTRGYYSFR  516

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGSFET-LRLDLMDKTTSMYNDADIVIFNTGHWWT  1374
             F +YNCSVDF+ S FLV+E   +G+NG+ +  L+LD +D TT  Y  ADIV+FNTGHWWT
Sbjct  517   FTEYNCSVDFIRSIFLVKEMIREGINGTEDAKLKLDELDATTPAYQTADIVVFNTGHWWT  576

Query  1375  HEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             H KTSRG +YYQEGN V+  LEVL+AYKRAL TWARWVDKN+D+ RT+V+FRGYS +H
Sbjct  577   HYKTSRGLNYYQEGNHVYRSLEVLDAYKRALTTWARWVDKNIDSRRTQVVFRGYSLSH  634



>ref|XP_006849537.1| hypothetical protein AMTR_s00024p00162030 [Amborella trichopoda]
 gb|ERN11118.1| hypothetical protein AMTR_s00024p00162030 [Amborella trichopoda]
Length=718

 Score =   350 bits (897),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 190/236 (81%), Gaps = 1/236 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             DCD+FDG+WV+DD+ P YP GSCP ID  F+C L++RPD+AY K RW+P  C IP  N T
Sbjct  372   DCDLFDGKWVKDDSYPLYPAGSCPHIDESFNCFLNQRPDNAYEKLRWQPKKCSIPRLNGT  431

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
             DFL RLRG++LVFVGDSLNRNMWESLVC LRH + DK RV+E SGR +F+ +GFYAFRF 
Sbjct  432   DFLRRLRGKRLVFVGDSLNRNMWESLVCTLRHTIADKSRVYEASGRREFRTEGFYAFRFI  491

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             DYNCSV+FV SPFLV+E      NG+  ETLRLD+++ + S Y +ADI++FNTGHWWTHE
Sbjct  492   DYNCSVEFVRSPFLVQEWEIPEPNGTMKETLRLDIIENSASKYKNADIIVFNTGHWWTHE  551

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTSRG+DYYQEGN V+  L V++AY++AL TWA+WVD NV+  +T+V FRGYSA+H
Sbjct  552   KTSRGKDYYQEGNHVYGELNVVDAYRKALKTWAKWVDINVNPKKTQVFFRGYSASH  607



>gb|AFW58807.1| putative DUF231 domain containing family protein [Zea mays]
Length=717

 Score =   347 bits (891),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 192/238 (81%), Gaps = 1/238 (0%)
 Frame = +1

Query  838   YSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFN  1017
             ++ CD+F G WVRD++  +YPP SC  ID DF+CH + R D  +++WRW+PH CDIP  N
Sbjct  363   FAKCDVFSGRWVRDESYGFYPPKSCKLIDDDFNCHKNGRSDSDFLRWRWQPHGCDIPRLN  422

Query  1018  ATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFR  1197
             AT+FLERLRGQ+++FVGDSLNRNMWESLVCILRH VRD++ V+E SG++ FK +G+Y+F 
Sbjct  423   ATEFLERLRGQRIIFVGDSLNRNMWESLVCILRHGVRDRRSVYEASGKNQFKTRGYYSFV  482

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGSFET-LRLDLMDKTTSMYNDADIVIFNTGHWWT  1374
             F DYNCSVDF+ S FLVRE+  +G NG+ +  L+LD +D TT  Y  ADIV+FNTGHWWT
Sbjct  483   FRDYNCSVDFIRSIFLVRETIREGRNGTEDAKLKLDELDATTPAYQTADIVVFNTGHWWT  542

Query  1375  HEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             H KTSRG +YYQEGN V+P L+VL+AY+RAL TWARWVDKN+D  RT+V+FRGYS +H
Sbjct  543   HYKTSRGLNYYQEGNHVYPSLDVLDAYRRALVTWARWVDKNIDPRRTQVVFRGYSLSH  600



>ref|XP_008663376.1| PREDICTED: protein trichome birefringence-like 16 [Zea mays]
Length=715

 Score =   347 bits (890),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 192/238 (81%), Gaps = 1/238 (0%)
 Frame = +1

Query  838   YSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFN  1017
             ++ CD+F G WVRD++  +YPP SC  ID DF+CH + R D  +++WRW+PH CDIP  N
Sbjct  363   FAKCDVFSGRWVRDESYGFYPPKSCKLIDDDFNCHKNGRSDSDFLRWRWQPHGCDIPRLN  422

Query  1018  ATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFR  1197
             AT+FLERLRGQ+++FVGDSLNRNMWESLVCILRH VRD++ V+E SG++ FK +G+Y+F 
Sbjct  423   ATEFLERLRGQRIIFVGDSLNRNMWESLVCILRHGVRDRRSVYEASGKNQFKTRGYYSFV  482

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGSFET-LRLDLMDKTTSMYNDADIVIFNTGHWWT  1374
             F DYNCSVDF+ S FLVRE+  +G NG+ +  L+LD +D TT  Y  ADIV+FNTGHWWT
Sbjct  483   FRDYNCSVDFIRSIFLVRETIREGRNGTEDAKLKLDELDATTPAYQTADIVVFNTGHWWT  542

Query  1375  HEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             H KTSRG +YYQEGN V+P L+VL+AY+RAL TWARWVDKN+D  RT+V+FRGYS +H
Sbjct  543   HYKTSRGLNYYQEGNHVYPSLDVLDAYRRALVTWARWVDKNIDPRRTQVVFRGYSLSH  600



>ref|XP_008789200.1| PREDICTED: protein trichome birefringence [Phoenix dactylifera]
Length=670

 Score =   343 bits (880),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 188/236 (80%), Gaps = 1/236 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             DCDIF G WV+DD+ P YP GSCP ID  FDC+L+ RPD AY K RW+P  CDIP  NAT
Sbjct  321   DCDIFQGNWVKDDSYPLYPEGSCPHIDEPFDCYLNGRPDRAYQKLRWKPSGCDIPRLNAT  380

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
             D LERLRG++LVFVGDSLNRNMWESLVC LRH V+DKK+VFE SGR +F+ +G Y+F F+
Sbjct  381   DMLERLRGKRLVFVGDSLNRNMWESLVCALRHSVKDKKKVFEASGRHEFRTEGSYSFMFK  440

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             DYNCSV+F  SPFLV+E      +G + ETLRLD++++++  Y DADI++FNTGHWWTHE
Sbjct  441   DYNCSVEFFRSPFLVQEWEMPVSSGKTKETLRLDIIERSSPKYKDADILVFNTGHWWTHE  500

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS+G+DYYQEGN V+  L V+EA+ +AL TWA+WVD NV+  +T V FRGYSA+H
Sbjct  501   KTSKGKDYYQEGNHVYSELNVVEAFHKALTTWAKWVDTNVNPKKTLVFFRGYSASH  556



>emb|CCI55362.1| PH01B035L11.7 [Phyllostachys edulis]
Length=696

 Score =   343 bits (881),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 203/274 (74%), Gaps = 5/274 (2%)
 Frame = +1

Query  742   GVEISKKGTSSTVKNDMIGENGSELL----RKGRSFYSDCDIFDGEWVRDDTKPYYPPGS  909
               E S  GT+    +  +G   + ++     + +  ++ CD+F+G WVRD++ P+YPPGS
Sbjct  308   AAEHSNGGTAGVNTSMAVGPGNNRIVWTSGVQNQVSFAKCDVFNGGWVRDESYPFYPPGS  367

Query  910   CPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNM  1089
             C  ID DF+CH + RPD  ++KWRW+PH CDIP  +A DFLERLR Q+++FVGDSLNRNM
Sbjct  368   CSHIDDDFNCHKNGRPDSGFLKWRWQPHGCDIPRLSAIDFLERLRDQRIIFVGDSLNRNM  427

Query  1090  WESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKG  1269
             WESLVCILR  VR+KK ++E SGR+ FK +G+Y+F+F DYNCSVDF+ S FLV+E   + 
Sbjct  428   WESLVCILRQGVRNKKSIYEASGRNQFKTRGYYSFKFRDYNCSVDFIRSIFLVKELISES  487

Query  1270  VNGSFE-TLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVL  1446
              +G+ +  LRLD +D  T  Y  ADIV+FNTGHWWTH KTSRG +YYQEGN V+P LEV 
Sbjct  488   KSGAVDRKLRLDELDGATPAYRTADIVVFNTGHWWTHSKTSRGLNYYQEGNHVYPSLEVT  547

Query  1447  EAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +A+K+AL TWARWVDKN+D+ RT+V+FRGYS  H
Sbjct  548   DAFKKALTTWARWVDKNIDSRRTQVVFRGYSLAH  581



>gb|EMT28814.1| hypothetical protein F775_14799 [Aegilops tauschii]
Length=705

 Score =   342 bits (878),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/381 (46%), Positives = 239/381 (63%), Gaps = 27/381 (7%)
 Frame = +1

Query  445   APFFNPVVQGLNGFGYRN----ATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKN  612
             AP  +PV       G ++      V  +  +   +GE +DGS     K   L  S +   
Sbjct  224   APSASPVKSNAEDGGIQSDKSSGNVASTSNQTAVAGEKEDGSS---TKNQTLAASPVVTK  280

Query  613   VNFTGFTEKKGDGSGKN--------GGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGT  768
              N T      G+GSG N           SL+  + ++  ++ G+ S       E+  KG+
Sbjct  281   QNETSGASSVGNGSGMNKKETHPPVSAGSLKDHSSQTIAAKAGNHS-------EVLAKGS  333

Query  769   SSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLH  948
             S+       G    + +++     + CD+F G WVRDD+ P YP GSCP ID  FDCHL+
Sbjct  334   STKQAGGAGGNKKVDWIKE----MAGCDMFHGNWVRDDSYPLYPGGSCPHIDEPFDCHLN  389

Query  949   KRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVR  1128
              RPD  Y K RW+P  C+IP  N TD LERLRG++LVFVGDSLNRNMWESLVCILRH V+
Sbjct  390   GRPDRGYEKLRWQPSGCNIPRLNPTDMLERLRGKRLVFVGDSLNRNMWESLVCILRHSVK  449

Query  1129  DKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDL  1305
             DK++VFE SGR +FK +G Y+F F DYNCSV+F  SPFLV+E   +  NG+  ETLRLD+
Sbjct  450   DKRKVFEASGRREFKTEGSYSFLFTDYNCSVEFFRSPFLVQEWETRVSNGNKKETLRLDI  509

Query  1306  MDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARW  1485
             +++++  Y DAD +IFNTGHWWTHEKT+ G+DYYQEG+ ++  L V++A+ +AL TW+RW
Sbjct  510   VEQSSPKYKDADFIIFNTGHWWTHEKTALGKDYYQEGSHIYSELNVVDAFHKALITWSRW  569

Query  1486  VDKNVDANRTEVIFRGYSATH  1548
             +D NV+  +T V+FRGYSA+H
Sbjct  570   IDGNVNPKKTTVMFRGYSASH  590



>ref|XP_010265940.1| PREDICTED: protein trichome birefringence-like [Nelumbo nucifera]
Length=617

 Score =   339 bits (870),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 179/390 (46%), Positives = 227/390 (58%), Gaps = 27/390 (7%)
 Frame = +1

Query  460   PVVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVN-------  618
             P+   LN    RN T+         S   K+ S    +    L +S++            
Sbjct  104   PLQSSLNTSASRNTTILTPQGVNGQSSSPKNQSRIAPQTAPRLQQSQVAPPTPTPTPTPL  163

Query  619   FTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVG-VEISKKGTSSTVKNDMI  795
              +   +KK +   K    +      ++E       S S+  G V + K GT   V     
Sbjct  164   ISQSIDKKQENPAKINASAAAVPLSRTENRTESLVSSSKSDGKVGLVKNGTDKVVATQPR  223

Query  796   GENGSELLRKGRSFYS------------------DCDIFDGEWVRDDTKPYYPPGSCPFI  921
               N +  L KG +  S                   C+IFDG WVRDD+ P YPPGSCP I
Sbjct  224   ATNLTASLSKGNNGSSAEGSTVKQVKDNSMESLMHCNIFDGRWVRDDSYPLYPPGSCPHI  283

Query  922   DRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESL  1101
             D  F+C L+ RPD  Y K RW+P+ C+IP  N  D LE LRG++LVFVGDSLNRNMWESL
Sbjct  284   DESFNCFLNSRPDGDYQKLRWQPNGCNIPRLNGRDMLELLRGKRLVFVGDSLNRNMWESL  343

Query  1102  VCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS  1281
             VCILRH V+DK RVFE SGR +F+ +G Y+F F DYNCSVDF  SPFLV+E      NGS
Sbjct  344   VCILRHSVKDKSRVFEASGRHEFRTEGAYSFIFRDYNCSVDFFRSPFLVQEWEMPDTNGS  403

Query  1282  -FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYK  1458
               ETLRLD++++ +  Y  ADI+IFNTGHWWTHEKTS+G+DYYQEG+ V+  L V+EA++
Sbjct  404   KHETLRLDIIERKSDRYKTADIIIFNTGHWWTHEKTSKGKDYYQEGSHVYGELNVVEAFR  463

Query  1459  RALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             RAL TWARWVD  +D  +T V FRGYSA+H
Sbjct  464   RALTTWARWVDAKIDPKKTMVFFRGYSASH  493



>ref|NP_001057100.1| Os06g0207500 [Oryza sativa Japonica Group]
 dbj|BAF19014.1| Os06g0207500, partial [Oryza sativa Japonica Group]
Length=720

 Score =   340 bits (873),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 183/389 (47%), Positives = 236/389 (61%), Gaps = 39/389 (10%)
 Frame = +1

Query  481   GFGYRNAT--VCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGS  654
             G G+ N T  V  SP +GN    AKDG     K +   N +        T    KK  GS
Sbjct  223   GSGHSNHTSDVTVSPAKGN----AKDGGADTNKASG--NVASTSNQTASTAMVAKKAGGS  276

Query  655   GKNGGFSLEGETVK-----SEGSENGDRSRSRGVGVEISKKGTSSTVKN------DMIGE  801
                   S+     K     S G  +G  S +     E + +G+  + K+      +    
Sbjct  277   PSKNQTSVASTNSKNQNQTSAGVASGGSSGTTSKQEETTSQGSVGSSKDHPAQAINSKTS  336

Query  802   NGSELLRKGRSF-------------------YSDCDIFDGEWVRDDTKPYYPPGSCPFID  924
             N SE+L KG                       + CD+F G WVRD++ P YP GSCP ID
Sbjct  337   NYSEVLVKGNGSSTKQASQKQPDKKVDWIKEMASCDMFHGNWVRDESYPLYPEGSCPHID  396

Query  925   RDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLV  1104
               FDC+L+ RPD AY K RW+P +C+IP  N TD LERLRG++LVFVGDSLNRNMWESLV
Sbjct  397   EPFDCYLNGRPDRAYQKLRWQPSSCNIPRLNPTDMLERLRGKRLVFVGDSLNRNMWESLV  456

Query  1105  CILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-S  1281
             CILR+ V+DK++VFE SGR +FK +G Y+F F DYNCSV+F  SPFLV+E   K  NG  
Sbjct  457   CILRNSVKDKRKVFEASGRHEFKTEGSYSFLFTDYNCSVEFFRSPFLVQEWEMKVSNGKK  516

Query  1282  FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKR  1461
              ETLRLD++++++  Y DAD +IFNTGHWWTHEKTS G+DYYQEGN V+  L V++A+ +
Sbjct  517   KETLRLDIVEQSSPKYKDADFLIFNTGHWWTHEKTSLGKDYYQEGNHVYSELNVVDAFHK  576

Query  1462  ALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             AL TW+RW+D NV+  +T V+FRGYSA+H
Sbjct  577   ALVTWSRWIDANVNPKKTTVLFRGYSASH  605



>ref|XP_009414351.1| PREDICTED: protein trichome birefringence-like 1 [Musa acuminata 
subsp. malaccensis]
Length=668

 Score =   338 bits (867),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/355 (47%), Positives = 227/355 (64%), Gaps = 30/355 (8%)
 Frame = +1

Query  538   GEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGSGKNG----------GFSLEGE  687
             G  K G         ++  + +   V  T      GD +G NG          GF+ +G 
Sbjct  212   GPPKTGGDSTAPNPTKIGGASLNDTVLATTNETTTGDAAGANGDLPAENQTGRGFARKGH  271

Query  688   TVKSEGSEN-------GDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSD  846
              V  + ++N         R+R+R    ++ KKG SS+ + + I            S    
Sbjct  272   RVDGDAAKNHFSSGPASTRNRTRTARPKVEKKGVSSSAEAEWI------------SAMKG  319

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CDIF+G WV+DD+ P YP G+CP ID  FDC+ + RPD +Y K RW+P  C IP  NATD
Sbjct  320   CDIFEGRWVKDDSYPLYPEGTCPHIDEPFDCYHNGRPDRSYQKLRWQPSDCQIPRLNATD  379

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LERLRG++LV+VGDSLNRNMWESLVC LR+ V+DK++VFE SGR +F+ +G Y+F FED
Sbjct  380   MLERLRGKRLVYVGDSLNRNMWESLVCALRNSVKDKRKVFEASGREEFRTEGSYSFVFED  439

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YNCSV+F  SPFLV+E      NG   ETLRLD++++++S Y DAD++IFNTGHWWTHEK
Sbjct  440   YNCSVEFFRSPFLVQEWEMPITNGEKRETLRLDIVERSSSKYKDADVIIFNTGHWWTHEK  499

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             T++G+DYYQEGN ++  L V EA ++AL TWA+WVD NV+  ++ V+FRGYS +H
Sbjct  500   TAKGKDYYQEGNHIYSELNVEEALRKALSTWAKWVDTNVNREKSLVVFRGYSNSH  554



>ref|XP_008679266.1| PREDICTED: protein trichome birefringence-like 1 [Zea mays]
 gb|AFW64296.1| putative DUF231 domain containing family protein [Zea mays]
Length=731

 Score =   339 bits (869),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 170/344 (49%), Positives = 227/344 (66%), Gaps = 28/344 (8%)
 Frame = +1

Query  595   SEIGKNVNFTGFTEKKGDGS---GKNGGFSLEG-------ETVKSEGSENGDRSRSRGVG  744
             S + +  +      ++G+G+   G N  F ++         +V S+GS +   ++     
Sbjct  275   SSLNQTASAVAVAAREGNGTATAGNNQTFLIQAPADNKNHSSVASDGSNSSPTNKQNES-  333

Query  745   VEISKKGTSSTVKNDMI-GENGSELL------RKGRSFYSD-------CDIFDGEWVRDD  882
                S +G++STVK+    G   + ++        GR   +D       CD+F G WVRDD
Sbjct  334   -PASPQGSTSTVKDQSARGPTPAAIVPVKADANAGRRMKADWTENMAGCDLFYGNWVRDD  392

Query  883   TKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVF  1062
             + P YP GSCP ID  F+CHL+ RPD AY + RW+P  C IP  N TD LERLRG++LVF
Sbjct  393   SYPLYPAGSCPHIDESFNCHLNGRPDKAYERLRWQPSGCRIPRLNPTDMLERLRGKRLVF  452

Query  1063  VGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPF  1242
             VGDSLNRNMWESL+CILR+ V+DK +VFE+SGRS F+ +G Y+F F+DYNCSV+F  SPF
Sbjct  453   VGDSLNRNMWESLICILRNSVKDKSKVFEVSGRSQFRAEGSYSFLFQDYNCSVEFFRSPF  512

Query  1243  LVRESSFKGVN--GSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEG  1416
             LV+E      N  G+ ETLRLD++D +   Y +ADIVIFNTGHWWTH+KTS G+DYYQEG
Sbjct  513   LVQEWEMPVSNGKGTRETLRLDIIDPSFPRYKNADIVIFNTGHWWTHDKTSLGKDYYQEG  572

Query  1417  NRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             NRV+  L+V +A++RAL TWA+WVD NV+  +T V FRGYSA+H
Sbjct  573   NRVYSELDVHDAFRRALNTWAKWVDSNVNPKKTTVFFRGYSASH  616



>dbj|BAD35858.1| lustrin A-like [Oryza sativa Japonica Group]
 dbj|BAD35885.1| lustrin A-like [Oryza sativa Japonica Group]
 gb|EAZ00091.1| hypothetical protein OsI_22096 [Oryza sativa Indica Group]
Length=847

 Score =   341 bits (875),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/390 (47%), Positives = 237/390 (61%), Gaps = 39/390 (10%)
 Frame = +1

Query  478   NGFGYRNAT--VCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDG  651
             +G G+ N T  V  SP +GN    AKDG     K +   N +        T    KK  G
Sbjct  349   SGSGHSNHTSDVTVSPAKGN----AKDGGADTNKASG--NVASTSNQTASTAMVAKKAGG  402

Query  652   SGKNGGFSLEGETVK-----SEGSENGDRSRSRGVGVEISKKGTSSTVKN------DMIG  798
             S      S+     K     S G  +G  S +     E + +G+  + K+      +   
Sbjct  403   SPSKNQTSVASTNSKNQNQTSAGVASGGSSGTTSKQEETTSQGSVGSSKDHPAQAINSKT  462

Query  799   ENGSELLRKGRSF-------------------YSDCDIFDGEWVRDDTKPYYPPGSCPFI  921
              N SE+L KG                       + CD+F G WVRD++ P YP GSCP I
Sbjct  463   SNYSEVLVKGNGSSTKQASQKQPDKKVDWIKEMASCDMFHGNWVRDESYPLYPEGSCPHI  522

Query  922   DRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESL  1101
             D  FDC+L+ RPD AY K RW+P +C+IP  N TD LERLRG++LVFVGDSLNRNMWESL
Sbjct  523   DEPFDCYLNGRPDRAYQKLRWQPSSCNIPRLNPTDMLERLRGKRLVFVGDSLNRNMWESL  582

Query  1102  VCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-  1278
             VCILR+ V+DK++VFE SGR +FK +G Y+F F DYNCSV+F  SPFLV+E   K  NG 
Sbjct  583   VCILRNSVKDKRKVFEASGRHEFKTEGSYSFLFTDYNCSVEFFRSPFLVQEWEMKVSNGK  642

Query  1279  SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYK  1458
               ETLRLD++++++  Y DAD +IFNTGHWWTHEKTS G+DYYQEGN V+  L V++A+ 
Sbjct  643   KKETLRLDIVEQSSPKYKDADFLIFNTGHWWTHEKTSLGKDYYQEGNHVYSELNVVDAFH  702

Query  1459  RALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +AL TW+RW+D NV+  +T V+FRGYSA+H
Sbjct  703   KALVTWSRWIDANVNPKKTTVLFRGYSASH  732



>ref|XP_010227191.1| PREDICTED: protein trichome birefringence-like 2 [Brachypodium 
distachyon]
Length=733

 Score =   338 bits (867),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 190/246 (77%), Gaps = 2/246 (1%)
 Frame = +1

Query  817   LRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHA  996
             ++K    ++ CD+F G WVR++   +YPPGSCP ID DF+CH + R D  ++ WRW+P  
Sbjct  373   VQKNLVSFAKCDVFSGGWVREEGYAFYPPGSCPLIDDDFNCHKNGRQDTDFLNWRWQPSG  432

Query  997   CDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKK  1176
             CDIP  NA+DFLERLRGQ+++FVGDSLNRNMWESLVC LRH VR+KK V+E SG++ FK 
Sbjct  433   CDIPRMNASDFLERLRGQRIIFVGDSLNRNMWESLVCTLRHGVRNKKSVYEASGKNQFKT  492

Query  1177  KGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSF--ETLRLDLMDKTTSMYNDADIVI  1350
             +G+Y+F+F DYNCSVDF+ S FLV+E   +  NG+     LRLD +D TT  Y  A IV+
Sbjct  493   RGYYSFKFRDYNCSVDFIRSIFLVKELVRESKNGTVLDAKLRLDELDATTPAYQTASIVV  552

Query  1351  FNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFR  1530
             FNTGHWWTH KTS+G +YYQEGN V+P LEV++AYK+AL TWARWVDKNVD  RT+V+FR
Sbjct  553   FNTGHWWTHSKTSKGLNYYQEGNHVYPSLEVMDAYKKALTTWARWVDKNVDPGRTQVVFR  612

Query  1531  GYSATH  1548
             G+S TH
Sbjct  613   GFSLTH  618



>gb|EAZ36212.1| hypothetical protein OsJ_20530 [Oryza sativa Japonica Group]
Length=847

 Score =   341 bits (874),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/390 (47%), Positives = 237/390 (61%), Gaps = 39/390 (10%)
 Frame = +1

Query  478   NGFGYRNAT--VCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDG  651
             +G G+ N T  V  SP +GN    AKDG     K +   N +        T    KK  G
Sbjct  349   SGSGHSNHTSDVTVSPAKGN----AKDGGADTNKASG--NVASTSNQTASTAMVAKKAGG  402

Query  652   SGKNGGFSLEGETVK-----SEGSENGDRSRSRGVGVEISKKGTSSTVKN------DMIG  798
             S      S+     K     S G  +G  S +     E + +G+  + K+      +   
Sbjct  403   SPSKNQTSVASTNSKNQNQTSAGVASGGSSGTTSKQEETTSQGSVGSSKDHPAQAINSKT  462

Query  799   ENGSELLRKGRSF-------------------YSDCDIFDGEWVRDDTKPYYPPGSCPFI  921
              N SE+L KG                       + CD+F G WVRD++ P YP GSCP I
Sbjct  463   SNYSEVLVKGNGSSTKQASQKQPDKKVDWIKEMASCDMFHGNWVRDESYPLYPEGSCPHI  522

Query  922   DRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESL  1101
             D  FDC+L+ RPD AY K RW+P +C+IP  N TD LERLRG++LVFVGDSLNRNMWESL
Sbjct  523   DEPFDCYLNGRPDRAYQKLRWQPSSCNIPRLNPTDMLERLRGKRLVFVGDSLNRNMWESL  582

Query  1102  VCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-  1278
             VCILR+ V+DK++VFE SGR +FK +G Y+F F DYNCSV+F  SPFLV+E   K  NG 
Sbjct  583   VCILRNSVKDKRKVFEASGRHEFKTEGSYSFLFTDYNCSVEFFRSPFLVQEWEMKVSNGK  642

Query  1279  SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYK  1458
               ETLRLD++++++  Y DAD +IFNTGHWWTHEKTS G+DYYQEGN V+  L V++A+ 
Sbjct  643   KKETLRLDIVEQSSPKYKDADFLIFNTGHWWTHEKTSLGKDYYQEGNHVYSELNVVDAFH  702

Query  1459  RALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +AL TW+RW+D NV+  +T V+FRGYSA+H
Sbjct  703   KALVTWSRWIDANVNPKKTTVLFRGYSASH  732



>ref|XP_010932482.1| PREDICTED: protein trichome birefringence-like 1 [Elaeis guineensis]
Length=677

 Score =   336 bits (862),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/363 (48%), Positives = 230/363 (63%), Gaps = 32/363 (9%)
 Frame = +1

Query  538   GEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEK----KGDGSGKNGGFSLEGETVKSEG  705
             G  KDG         E N+S  G  +  +G   K    KG G+  NG    + +  ++  
Sbjct  207   GSKKDGVL------PEKNQSVSGVGLQGSGVPSKNQMEKGIGANGNGVSGNKQKESRTSP  260

Query  706   SENGDRSRSRGV-GVEISKKGTSSTVKNDMIGENGSELLRKGRSFYS-------------  843
              EN   +R++   GV  S K + +  K      N +  LRK     +             
Sbjct  261   QENEVLARNQSAKGVSASPKSSKAPAKAGQKASNLTASLRKQDGAMASTSSSSSSSGKRD  320

Query  844   -------DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACD  1002
                    DCDIF G WV+DD+ P YP G+CP ID  F+C+L+ RPD AY K RW+P  C+
Sbjct  321   EWINALKDCDIFLGNWVKDDSYPLYPEGTCPHIDEPFNCYLNGRPDRAYPKLRWKPSGCN  380

Query  1003  IPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKG  1182
             IP  NATD LERLRG++LVFVGDSLNRNMWESLVC LR+ V+DKK+VFE SGR +F+ +G
Sbjct  381   IPRLNATDMLERLRGKRLVFVGDSLNRNMWESLVCALRYSVKDKKKVFEASGRHEFRTEG  440

Query  1183  FYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNT  1359
              Y+F F+DYNCSV+F  SPFLV+E      NG + ETLRLD++++++  Y DAD+++FNT
Sbjct  441   SYSFIFKDYNCSVEFFRSPFLVQEWEMPVSNGKTKETLRLDIIERSSPKYKDADVLVFNT  500

Query  1360  GHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYS  1539
             GHWWTHEKTS+G+DYYQEG+ V+  L V+EA+ +AL TWA+WVD NV+  +T V FRGYS
Sbjct  501   GHWWTHEKTSKGKDYYQEGDHVYSELNVVEAFHKALTTWAKWVDTNVNPKKTLVFFRGYS  560

Query  1540  ATH  1548
             A+H
Sbjct  561   ASH  563



>gb|EMS61403.1| hypothetical protein TRIUR3_19587 [Triticum urartu]
Length=744

 Score =   337 bits (863),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 175/392 (45%), Positives = 235/392 (60%), Gaps = 32/392 (8%)
 Frame = +1

Query  454   FNPVVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFT  633
              N    G +G G  + T   +P        A++G        H+ +   +    N T   
Sbjct  149   LNNESDGASGSGNVDETHESAPSATPVKSNAEEGGI-----QHDKSSGNVASTSNQTAVA  203

Query  634   EKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGV---EISKKGTSSTVKND-----  789
             E+K D S       +    V  +   +G  S      V   E + + ++S++K+      
Sbjct  204   EEKEDESSTKNQTLVASPIVTKQNQTSGPSSVGSDSAVNKKEATPQVSASSLKDHSSQTI  263

Query  790   -MIGENGSELLRKGRSF-----------------YSDCDIFDGEWVRDDTKPYYPPGSCP  915
                  N SE+L KG S                   + CD+F G WVRDD+ P YP GSCP
Sbjct  264   AAKAGNHSEVLAKGSSTKQAGGAGGNKKVDWIKEMAGCDMFHGNWVRDDSYPLYPGGSCP  323

Query  916   FIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWE  1095
              ID  FDCHL+ RPD AY K RW+P  C+IP  N TD LERLRG++LVFVGDSLNRNMWE
Sbjct  324   HIDEPFDCHLNGRPDRAYEKLRWQPSGCNIPRLNPTDMLERLRGKRLVFVGDSLNRNMWE  383

Query  1096  SLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVN  1275
             SLVCILRH V+D ++VFE SGR +FK +G Y+F F DYNCSV+F  SPFLV+E   +  N
Sbjct  384   SLVCILRHSVKDTRKVFEASGRREFKTEGSYSFLFTDYNCSVEFFRSPFLVQEWETRVSN  443

Query  1276  GS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEA  1452
             G+  ETLRLD++++++  Y DAD +IFNTGHWWTHEKT+ G+DYYQEG+ ++  L V++A
Sbjct  444   GNKKETLRLDIVEQSSPKYKDADFIIFNTGHWWTHEKTALGKDYYQEGSHIYSELNVVDA  503

Query  1453  YKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             + +AL TW+RW+D NV+  +T V+FRGYSA+H
Sbjct  504   FHKALITWSRWIDGNVNPKKTTVMFRGYSASH  535



>ref|XP_004954083.1| PREDICTED: cell wall protein AWA1-like [Setaria italica]
Length=736

 Score =   336 bits (862),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/289 (55%), Positives = 201/289 (70%), Gaps = 4/289 (1%)
 Frame = +1

Query  688   TVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGE  867
             T   +GS +  + +S  V   I+   T+  VK       G           + CD+F G 
Sbjct  335   TASPQGSTSSAKDQSAQVVTPIANNNTTVLVK--AAANAGRRKKVDWIENMASCDMFYGN  392

Query  868   WVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRG  1047
             WV+DD+ P YP GSCP ID  F+CHL+ RPD AY + RW+P AC IP  N  D LERLRG
Sbjct  393   WVQDDSYPLYPAGSCPHIDESFNCHLNGRPDKAYQRLRWQPSACRIPRLNPADMLERLRG  452

Query  1048  QKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDF  1227
             ++LVFVGDSLNRNMWESL+CILR+ V+DK +VFE+SGR  FK +G Y+F F+DYNC+V+F
Sbjct  453   KRLVFVGDSLNRNMWESLICILRNSVKDKSKVFEVSGRHQFKAEGSYSFLFQDYNCTVEF  512

Query  1228  VSSPFLVR--ESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGED  1401
               SPFLV+  E      NG+ ETLRLD++D+    Y +ADI+IFNTGHWWTH+KTS G+D
Sbjct  513   FRSPFLVQEWEMPIGNGNGTRETLRLDIVDRAFPRYKNADIIIFNTGHWWTHDKTSLGKD  572

Query  1402  YYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             YYQEGNRV+  L+V +AY+RAL TWA+WVD NV+  +T V FRGYSA+H
Sbjct  573   YYQEGNRVYSELDVHDAYRRALNTWAKWVDSNVNPKKTTVFFRGYSASH  621



>ref|XP_003560946.2| PREDICTED: protein trichome birefringence-like 1 [Brachypodium 
distachyon]
Length=829

 Score =   338 bits (866),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 185/235 (79%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD+F G WV+D++ P YP GSCP ID  FDCHL+ RPD  Y K RW+P  C IP  N TD
Sbjct  480   CDMFHGSWVQDNSYPLYPGGSCPHIDEPFDCHLNGRPDRGYQKLRWQPSGCSIPRLNPTD  539

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LERLRG++LVFVGDSLNRNMWESLVCILRH VRDK++VFE SGR +FK +G Y+F F D
Sbjct  540   MLERLRGKRLVFVGDSLNRNMWESLVCILRHSVRDKRKVFEASGRREFKTEGSYSFLFTD  599

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YNCSV+F  SPFLV+E   +  NG+  ETLRLD++++++  Y DAD +IFNTGHWWTHEK
Sbjct  600   YNCSVEFFRSPFLVQEWEMRVSNGNKKETLRLDIVEQSSPKYKDADFIIFNTGHWWTHEK  659

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             T+ G+DYYQEGN ++  L V++A+++AL TW++W+D NV+  +T V+FRGYSA+H
Sbjct  660   TALGKDYYQEGNHIYSELNVVDAFRKALVTWSKWIDANVNPKKTTVMFRGYSASH  714



>ref|XP_009391441.1| PREDICTED: protein trichome birefringence-like [Musa acuminata 
subsp. malaccensis]
Length=715

 Score =   334 bits (856),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 174/366 (48%), Positives = 238/366 (65%), Gaps = 21/366 (6%)
 Frame = +1

Query  484   FGYRNATVCCSPPEGNFS----GEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDG  651
                +N TV  +PP+ N +    G A +G      +  +   S++ + +N T  T K G  
Sbjct  247   LAAKNLTVTGAPPKKNETTTAVGSAVNGDLPSKNQIDKGVASKVNQVLNSTA-TPKSG-A  304

Query  652   SGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGR  831
             + KN   S      KS G+    +S  +G     +   +SS VK +  G   +    +G+
Sbjct  305   AAKNQSSSGVPSITKSTGTTTA-KSEEKG-----APSLSSSLVKGN--GPTAASARDEGK  356

Query  832   ------SFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPH  993
                        CDIF G WV+DD+ P YP GSCP ID  FDC+ + RPD +Y K RW+P+
Sbjct  357   RQVDWIGAMKGCDIFQGRWVKDDSYPLYPEGSCPHIDEPFDCYRNGRPDRSYQKLRWQPN  416

Query  994   ACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFK  1173
              C+IP  NATD LERLRG++LVFVGDSLNRNMW+SLVCILR+ V+DKK+VFE SGR +F+
Sbjct  417   GCNIPRLNATDMLERLRGKRLVFVGDSLNRNMWDSLVCILRNSVKDKKKVFEASGRHEFR  476

Query  1174  KKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVI  1350
              +G Y+F F+D+NCSV+F  SPFLV+E      NG   ETLRLD++++++S Y DAD++I
Sbjct  477   TEGSYSFVFKDFNCSVEFFRSPFLVQEWEMPVSNGKKKETLRLDIIERSSSKYKDADVII  536

Query  1351  FNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFR  1530
             FNTGHWWTHEKTS+G+DYYQEGN ++  L V+EA+ +AL TW++WVD NV+  ++ V FR
Sbjct  537   FNTGHWWTHEKTSKGKDYYQEGNHIYSELNVVEAFHKALDTWSKWVDTNVNPKKSLVFFR  596

Query  1531  GYSATH  1548
             GYSA+H
Sbjct  597   GYSASH  602



>ref|XP_006656749.1| PREDICTED: mucin-19-like [Oryza brachyantha]
Length=802

 Score =   335 bits (859),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 184/237 (78%), Gaps = 1/237 (0%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             S CD+F G WV+DD+ P YP GSCP ID  FDC+L+ R D AY K RW+P  C IP  N 
Sbjct  451   SSCDLFHGNWVQDDSYPLYPEGSCPHIDEPFDCYLNSRQDRAYQKLRWKPSGCSIPRLNP  510

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
             TD LERLRG++LVFVGDSLNRNMWESLVCILR+ V+DK++VFE SGR +FK +G Y+F F
Sbjct  511   TDMLERLRGKRLVFVGDSLNRNMWESLVCILRNSVKDKRKVFEASGRHEFKTEGSYSFLF  570

Query  1201  EDYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTH  1377
              DYNCSV+F  SPFLV+E   K  NG   ETLRLD++++++  Y DAD +IFNTGHWWTH
Sbjct  571   TDYNCSVEFFRSPFLVQEWEMKVSNGKKKETLRLDIVEQSSPKYKDADFLIFNTGHWWTH  630

Query  1378  EKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             EKTS G+DYYQEGN V+  L V++A+ +AL TW+RW+D NV+  +T V+FRGYSA+H
Sbjct  631   EKTSLGKDYYQEGNHVYSELNVVDAFHKALVTWSRWIDANVNPKKTTVLFRGYSASH  687



>dbj|BAD16880.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD17136.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ24784.1| hypothetical protein OsJ_08560 [Oryza sativa Japonica Group]
 dbj|BAH01510.1| unnamed protein product [Oryza sativa Japonica Group]
Length=700

 Score =   332 bits (851),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/325 (50%), Positives = 218/325 (67%), Gaps = 12/325 (4%)
 Frame = +1

Query  610   NVNFTGFTEKKGDGSG---KNGGFSLEGETVKSEGS---ENGDRSRSRGVG-----VEIS  756
             ++N TG      DG+G   + GG   + +TV +  +   +N   SR+   G     ++ +
Sbjct  261   SINKTGNAAVATDGNGAAPQRGGAPGKNQTVPNPPAALDQNKSGSRAAASGGSNSTMDAT  320

Query  757   KKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFD  936
              +G +S      +   G +         + CD+F G WVRDD+ P YP GSCP ID  F+
Sbjct  321   PQGIASNTTEAAVDAGGKKKKTHWIEAMASCDMFYGNWVRDDSYPLYPEGSCPHIDESFN  380

Query  937   CHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILR  1116
             C L+ RPD+AY + RW+P  C IP  N +D LERLRG++LVFVGDSLNRNMWESLVCILR
Sbjct  381   CPLNGRPDNAYQRLRWQPSGCSIPRLNPSDMLERLRGKRLVFVGDSLNRNMWESLVCILR  440

Query  1117  HVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFETL  1293
             + V+DK++VFE+SGR  F+ +G Y+F F+DYNCSV+F  SPFLV+E  F    G + ETL
Sbjct  441   NSVKDKRKVFEVSGRQQFRAEGSYSFLFQDYNCSVEFFRSPFLVQEWEFPVRKGLTKETL  500

Query  1294  RLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYT  1473
             RLD++  +   Y DADI+IFNTGHWWTHEKTS G+DYYQEGNRV+  L V +A+++AL T
Sbjct  501   RLDMISNSFPRYKDADIIIFNTGHWWTHEKTSLGKDYYQEGNRVYSELNVDDAFQKALIT  560

Query  1474  WARWVDKNVDANRTEVIFRGYSATH  1548
             WA+WVD +V+  +T V FRGYS++H
Sbjct  561   WAKWVDSSVNPKKTTVFFRGYSSSH  585



>gb|EAY87710.1| hypothetical protein OsI_09124 [Oryza sativa Indica Group]
Length=700

 Score =   331 bits (848),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/325 (50%), Positives = 218/325 (67%), Gaps = 12/325 (4%)
 Frame = +1

Query  610   NVNFTGFTEKKGDGSG---KNGGFSLEGETVKSEGS---ENGDRSRSRGVG-----VEIS  756
             ++N TG      DG+G   + GG   + +TV +  +   +N   SR+   G     ++ +
Sbjct  261   SINKTGNAAVATDGNGAAPQRGGAPGKNQTVPNPPAALDQNKSGSRAAASGGSNSTMDAT  320

Query  757   KKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFD  936
              +G +S      +   G +         + CD+F G WVRDD+ P YP GSCP ID  F+
Sbjct  321   PQGIASNTTEAAVDAGGKKKKTHWIEAMASCDMFYGNWVRDDSYPLYPEGSCPHIDESFN  380

Query  937   CHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILR  1116
             C L+ RPD+AY + RW+P  C IP  N +D LERLRG++LVFVGDSLNRNMWESLVCILR
Sbjct  381   CPLNGRPDNAYQRLRWQPSGCSIPRLNPSDMLERLRGKRLVFVGDSLNRNMWESLVCILR  440

Query  1117  HVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFETL  1293
             + V+DK++VFE+SGR  F+ +G Y+F F+DYNCSV+F  SPFLV+E  F    G + ETL
Sbjct  441   NSVKDKRKVFEVSGRQQFRAEGSYSFLFQDYNCSVEFFRSPFLVQEWEFPVRKGLTKETL  500

Query  1294  RLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYT  1473
             RLD++  +   Y +ADI+IFNTGHWWTHEKTS G+DYYQEGNRV+  L V +A+++AL T
Sbjct  501   RLDMISNSFPRYKNADIIIFNTGHWWTHEKTSLGKDYYQEGNRVYSELNVDDAFQKALIT  560

Query  1474  WARWVDKNVDANRTEVIFRGYSATH  1548
             WA+WVD +V+  +T V FRGYS++H
Sbjct  561   WAKWVDSSVNPKKTTVFFRGYSSSH  585



>ref|XP_002454638.1| hypothetical protein SORBIDRAFT_04g034670 [Sorghum bicolor]
 gb|EES07614.1| hypothetical protein SORBIDRAFT_04g034670 [Sorghum bicolor]
Length=733

 Score =   332 bits (850),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/289 (54%), Positives = 202/289 (70%), Gaps = 4/289 (1%)
 Frame = +1

Query  688   TVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGE  867
             T   +GS +  + +S    + I++  +   VK D     G  +        + CD+F G 
Sbjct  332   TASPQGSTSPVKDQSARGAIPIARNNSVVPVKAD--ANAGRRMKVDWIENMASCDMFYGN  389

Query  868   WVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRG  1047
             WVRDD+ P YP GSCP +D  F+CHL+ RPD  Y + RW+P  C IP  N TD LERLRG
Sbjct  390   WVRDDSYPLYPAGSCPHVDESFNCHLNGRPDKDYERLRWQPSGCRIPRLNPTDMLERLRG  449

Query  1048  QKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDF  1227
             ++LVFVGDSLNRNMWESL+CILR+ V+DK +VFE+SGRS F+ +G Y+F F+DYNCSV+F
Sbjct  450   KRLVFVGDSLNRNMWESLICILRNSVKDKSKVFEVSGRSQFRAEGSYSFLFQDYNCSVEF  509

Query  1228  VSSPFLVRESSFKGVN--GSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGED  1401
               SPFLV+E      N  G+ ETLRLD++D     Y +ADIVIFNTGHWWTH+KTS G+D
Sbjct  510   FRSPFLVQEWEMPISNGKGTRETLRLDIIDSAFPRYKNADIVIFNTGHWWTHDKTSLGKD  569

Query  1402  YYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             YYQEG+RV+  L+V +A++RAL TWA+WVD NV+  +T V FRGYSA+H
Sbjct  570   YYQEGDRVYSELDVHDAFRRALNTWAKWVDSNVNPKKTTVFFRGYSASH  618



>ref|XP_008646340.1| PREDICTED: protein trichome birefringence [Zea mays]
Length=710

 Score =   331 bits (848),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 184/236 (78%), Gaps = 2/236 (1%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD+F G WVRDD+ P YP GSCP +D  F+CHL+ RPD AY + RW+P  C IP  N TD
Sbjct  358   CDMFYGNWVRDDSYPLYPAGSCPHVDESFNCHLNGRPDKAYERLRWQPSGCRIPRLNPTD  417

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LERLRG++LVFVGDSLNRNMWESL+CILR+ V+DK +VFE+SGRS F+ +G Y+F F+D
Sbjct  418   MLERLRGKRLVFVGDSLNRNMWESLICILRNSVKDKSKVFEVSGRSQFRAEGSYSFLFQD  477

Query  1207  YNCSVDFVSSPFLVRESSFKGVN--GSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             YNCSV+F  SPFLV+E      N  G+ ETLRLD++D     Y +ADI+IFNTGHWWTH+
Sbjct  478   YNCSVEFFRSPFLVQEWEMPISNGKGTRETLRLDVIDPAFPRYKNADIIIFNTGHWWTHD  537

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS G+DYYQEGNRV+  L+V +A++RAL TWA+WVD +V+  +T V FRGYSA+H
Sbjct  538   KTSLGKDYYQEGNRVYSELDVHDAFRRALNTWAKWVDSSVNPKKTTVFFRGYSASH  593



>gb|AFW73695.1| putative DUF231 domain containing family protein, partial [Zea 
mays]
Length=706

 Score =   330 bits (847),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 184/236 (78%), Gaps = 2/236 (1%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD+F G WVRDD+ P YP GSCP +D  F+CHL+ RPD AY + RW+P  C IP  N TD
Sbjct  358   CDMFYGNWVRDDSYPLYPAGSCPHVDESFNCHLNGRPDKAYERLRWQPSGCRIPRLNPTD  417

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LERLRG++LVFVGDSLNRNMWESL+CILR+ V+DK +VFE+SGRS F+ +G Y+F F+D
Sbjct  418   MLERLRGKRLVFVGDSLNRNMWESLICILRNSVKDKSKVFEVSGRSQFRAEGSYSFLFQD  477

Query  1207  YNCSVDFVSSPFLVRESSFKGVN--GSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             YNCSV+F  SPFLV+E      N  G+ ETLRLD++D     Y +ADI+IFNTGHWWTH+
Sbjct  478   YNCSVEFFRSPFLVQEWEMPISNGKGTRETLRLDVIDPAFPRYKNADIIIFNTGHWWTHD  537

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS G+DYYQEGNRV+  L+V +A++RAL TWA+WVD +V+  +T V FRGYSA+H
Sbjct  538   KTSLGKDYYQEGNRVYSELDVHDAFRRALNTWAKWVDSSVNPKKTTVFFRGYSASH  593



>ref|XP_009417662.1| PREDICTED: protein trichome birefringence-like [Musa acuminata 
subsp. malaccensis]
Length=719

 Score =   330 bits (847),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 171/358 (48%), Positives = 224/358 (63%), Gaps = 43/358 (12%)
 Frame = +1

Query  604   GKNVNFTGFTEKK-----GDGSGKNGGFSLEGET----------VKSEGSENGDRSRSRG  738
              KN+  TG   K      G GS K+G   ++ +T          V   G E+G  +   G
Sbjct  249   AKNLTVTGAPLKNNETATGVGSLKHGHLPVKNQTGKGVASKANPVPPNGKESGTNAPKNG  308

Query  739   VG--------VEISKKGTSSTVKNDMIGENG---SELLRKGRSFYSD-------------  846
                       +    K T +T K D  G +G   S + R G S  +              
Sbjct  309   AAANNQSSSALPSVTKSTGATPKKDKEGASGLSDSLVKRNGSSVPTSGGDGRKQVDWINA  368

Query  847   ---CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFN  1017
                CDIF G WV+DD+ P YP GSCP ID  FDC+ + RPD AY K RW P+ C IP  N
Sbjct  369   MKGCDIFQGRWVKDDSYPLYPEGSCPHIDEPFDCYHNGRPDRAYQKLRWLPNGCSIPRLN  428

Query  1018  ATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFR  1197
             ATD LERLRG++LVFVGDSLNRNMWESLVCILR+ + D+++VFE SGR +F+ +G Y+F 
Sbjct  429   ATDMLERLRGKRLVFVGDSLNRNMWESLVCILRNSIEDQRKVFEASGRHEFRTEGSYSFV  488

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWT  1374
             FED+NCSV+F  SPFLV+E    G NG+  ETLRLD+++++++ Y DAD+++FNTGHWWT
Sbjct  489   FEDFNCSVEFFRSPFLVQEWETPGSNGNKKETLRLDIIERSSAKYKDADVLVFNTGHWWT  548

Query  1375  HEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             HEKTS+G+DYYQEGN ++  L V+ A+ +AL TWA+WVD NV++  + V FRGYS TH
Sbjct  549   HEKTSKGKDYYQEGNHIYSDLNVVNAFHKALNTWAKWVDANVNSKNSLVFFRGYSVTH  606



>ref|XP_006649087.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=696

 Score =   330 bits (845),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 173/370 (47%), Positives = 232/370 (63%), Gaps = 25/370 (7%)
 Frame = +1

Query  502   TVCCSPPEGNFSGEAKDGSFGLWKKTHELN------RSEIGKNVNFTGFTEKKGDGSGKN  663
              +  S   GN +    +  +   + TH+L        S  G ++ FT  TE     +  +
Sbjct  217   VISSSSESGNVTAVKANARYAA-RSTHQLGGASAIASSSNGTSLPFTNQTENSAVATNSS  275

Query  664   GGFSLEGETVKSEGSEN----GDRSRSRGVGVEISKKGTSSTVKN--DMIGENGSELLR-  822
             G  S  G   K++   N     D+ +S   G  ++  G++ST+      I  N +E    
Sbjct  276   GAASQRGVPGKNQTLPNPPAVNDQIQS---GSRVASVGSNSTMDAIPQRIASNTTEAAAD  332

Query  823   ---KGRSFY----SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWR  981
                K +S +    + CD+F G W+RDD+ P YP GSCP ID  F+C L+ RPD+AY + R
Sbjct  333   AGGKKKSHWIEAMASCDMFYGNWIRDDSYPLYPEGSCPHIDESFNCPLNGRPDNAYQRLR  392

Query  982   WRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR  1161
             W+P  C+IP  N TD LERLRG++LVFVGDSLNRNMWESLVCILR+ V+DK +VFE+SGR
Sbjct  393   WQPSGCNIPRLNPTDMLERLRGKRLVFVGDSLNRNMWESLVCILRNSVKDKSKVFEVSGR  452

Query  1162  SDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDA  1338
               F+ +G Y+F F+DYNCSV+F  SPFLV+E  F    G   ETLRLD++  +   Y  A
Sbjct  453   QRFRAEGSYSFLFQDYNCSVEFFRSPFLVQEWEFPVRKGLIKETLRLDMISNSFPRYKGA  512

Query  1339  DIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTE  1518
             DI+IFNTGHWWTHEKTS G+DYYQEGNRV+  L V +A+++AL TWA+WVD +V+  +T 
Sbjct  513   DIIIFNTGHWWTHEKTSLGKDYYQEGNRVYSELNVDDAFQKALQTWAKWVDSSVNPKKTT  572

Query  1519  VIFRGYSATH  1548
             V FRGYSA+H
Sbjct  573   VFFRGYSASH  582



>gb|KHN26901.1| hypothetical protein glysoja_035540 [Glycine soja]
Length=481

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 182/233 (78%), Gaps = 2/233 (1%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CDIFDG+WVRD +KPYYP GSC  IDRDF+CH + RPD  YVKWRW+P+ C IPS NATD
Sbjct  184   CDIFDGKWVRDGSKPYYPLGSCRLIDRDFNCHRNGRPDAEYVKWRWQPNGCIIPSLNATD  243

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
             FLERLRGQ+LVFVGDSLNRNMWESLVCILR  +  KKRVFEISGR +FKKKG YAFRFED
Sbjct  244   FLERLRGQRLVFVGDSLNRNMWESLVCILRQSINKKKRVFEISGRREFKKKGVYAFRFED  303

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKT  1386
             YNCSVDFV SPF+V+ES+FKG NGSFETLRLDLMD+TT+ Y DA+I++FNTGHWWTH+KT
Sbjct  304   YNCSVDFVVSPFIVQESTFKGKNGSFETLRLDLMDRTTARYWDANIIVFNTGHWWTHDKT  363

Query  1387  SRGEDYYQEGNRVHPRLEVL--EAYKRALYTWARWVDKNVDANRTEVIFRGYS  1539
             S+G   +  G + H   E +  EAY +   +    ++  +   +T V++   S
Sbjct  364   SKGGGQWNSGGQCHKETEPIFNEAYLQRYPSKMLALEHVIQQMKTPVVYMNIS  416



>ref|XP_010917266.1| PREDICTED: protein trichome birefringence [Elaeis guineensis]
Length=678

 Score =   328 bits (841),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/295 (54%), Positives = 209/295 (71%), Gaps = 10/295 (3%)
 Frame = +1

Query  694   KSEGSENGDRS--RSRGVGVEISKKGTSSTV----KNDMIGENGSELLRKGRSFYS---D  846
             K + S NG  S  +S     +  ++ ++ST     +ND      S  ++KG  + +    
Sbjct  270   KKKQSANGVSSSPKSSEAPAKAEQRASNSTASLGKQNDSTASTPSGGIQKGDDWINALKS  329

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CDIF G WV+DD+ P YP GSCP ID  F+C+L+ RPD AY K RW+P  CDIP  NATD
Sbjct  330   CDIFQGNWVKDDSYPLYPEGSCPHIDEPFNCYLNGRPDRAYQKLRWKPDGCDIPRLNATD  389

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LERLR ++LVFVGDSLNRNMWESLVC L + V+DKK+VFE SGR +F+ +G Y+F F+D
Sbjct  390   MLERLREKRLVFVGDSLNRNMWESLVCALSNSVKDKKKVFEASGRHEFRTEGSYSFIFKD  449

Query  1207  YNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YNCSV+F  SPFLV+E      NG + ETLRLD +++++  Y +AD+++FNTGHWWTHEK
Sbjct  450   YNCSVEFFRSPFLVQEWEMPVSNGKTKETLRLDTIERSSPRYKNADVIVFNTGHWWTHEK  509

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS+G+DYYQEG+ V+  L V+EA+ +AL TWA+WVD NV+  +T V FRGYSA+H
Sbjct  510   TSKGKDYYQEGDHVYGELNVVEAFHKALNTWAKWVDTNVNPKKTLVFFRGYSASH  564



>ref|XP_010673529.1| PREDICTED: protein trichome birefringence-like [Beta vulgaris 
subsp. vulgaris]
Length=375

 Score =   318 bits (815),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 184/235 (78%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD+FDG+WV+DD+ P Y PGSCP+ID  F+C+L+ RPD+AY K+RW+PH C+IP  N T 
Sbjct  29    CDLFDGKWVKDDSYPIYEPGSCPYIDEPFNCYLNGRPDNAYEKYRWQPHGCNIPRLNGTH  88

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              L  L G+++VFVGDSLNRNMWESLVC+LR+ V +K RV+E+SGR +F+ +G YAF FED
Sbjct  89    MLGLLTGKRMVFVGDSLNRNMWESLVCLLRNSVENKTRVYEVSGREEFRTEGSYAFIFED  148

Query  1207  YNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YNCSV+F  SPFLVRE      NG   ETLRLDL++ ++  Y DAD +IFNTGHWW+HEK
Sbjct  149   YNCSVEFFRSPFLVREWEIPDENGLKKETLRLDLVESSSEKYKDADFLIFNTGHWWSHEK  208

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TSRGE YYQEG+ V+ +LEV EA +RA+ TW RW+D NV+  +T+V FRGYS +H
Sbjct  209   TSRGESYYQEGSHVYTQLEVNEAIRRAVTTWGRWLDANVNHTKTQVFFRGYSNSH  263



>ref|XP_010257492.1| PREDICTED: protein trichome birefringence [Nelumbo nucifera]
Length=597

 Score =   325 bits (833),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 181/235 (77%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             C+IF G WVRDD+ P YPPGSCP ID  F+C L+ RPD  Y K RW+P  C+IP  N  D
Sbjct  247   CNIFYGRWVRDDSYPLYPPGSCPHIDESFNCFLNSRPDGNYQKLRWQPKGCNIPRLNGRD  306

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LE LRG++LVFVGDSLNRNMWESLVCILRH V+DK RVFE SGR +F+ +G Y+F FED
Sbjct  307   MLELLRGKRLVFVGDSLNRNMWESLVCILRHSVKDKSRVFEASGRREFRTEGSYSFIFED  366

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YNCSV+F  SPFLV+E      NGS  ETLRLD++++    Y  ADI++FNTGHWWTH+K
Sbjct  367   YNCSVEFFRSPFLVQEWEMPDTNGSKKETLRLDVIERKFDKYKTADIIVFNTGHWWTHKK  426

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS+G+DYYQEG+ ++  L V+EA+++AL TWARWVD N+D + T V FRGYSA+H
Sbjct  427   TSKGKDYYQEGSHIYGELNVVEAFRKALTTWARWVDANIDPSNTMVFFRGYSASH  481



>gb|KDO71838.1| hypothetical protein CISIN_1g045325mg, partial [Citrus sinensis]
Length=412

 Score =   319 bits (817),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 186/237 (78%), Gaps = 1/237 (0%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             S CDIF+G+WV D+++P Y PGSCPFID  F+C  + RPD  Y+K++WRP  C +P F+ 
Sbjct  65    SSCDIFNGQWVVDNSEPLYKPGSCPFIDEAFNCFKNGRPDSDYLKYKWRPIGCQLPRFDG  124

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
                LE LRG++LVFVGDSLNRNMWESLVC LR  ++DK RV+E+SGR  F+ +GFY+F+F
Sbjct  125   GKMLEMLRGKRLVFVGDSLNRNMWESLVCALRDSLKDKSRVYEVSGRQRFRTQGFYSFKF  184

Query  1201  EDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTH  1377
              DY CS+DF+ SPFLV+ES F   +G+  ETLRLD++  +++ Y DADI+IFNTGHWWTH
Sbjct  185   RDYMCSIDFIKSPFLVQESKFSDKSGARGETLRLDMIQGSSTKYGDADIIIFNTGHWWTH  244

Query  1378  EKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
              KT +G +Y+QEG+ V+ +LEV EAY +AL TWA+WVD N+D+NRT V FRGYSA+H
Sbjct  245   HKTFKGYNYFQEGSHVYNKLEVKEAYTKALKTWAQWVDANIDSNRTRVFFRGYSASH  301



>ref|NP_001141610.1| uncharacterized protein LOC100273728 [Zea mays]
 gb|ACF86715.1| unknown [Zea mays]
Length=353

 Score =   317 bits (811),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 184/237 (78%), Gaps = 1/237 (0%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             + CD+F G WVRDD+ P YP GSCP ID  FDC+L+ R D AY K RW+P  C IP  N 
Sbjct  2     ASCDMFSGNWVRDDSYPLYPEGSCPHIDEPFDCYLNGRRDLAYQKLRWQPSGCSIPRLNP  61

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
             TD LERLRG++LVFVGDSLNRNMWESLVCILR+ V+DK++VFE SGR +FK +G Y+F F
Sbjct  62    TDMLERLRGKRLVFVGDSLNRNMWESLVCILRNSVKDKRKVFEASGRREFKTEGSYSFLF  121

Query  1201  EDYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTH  1377
              DYNCSV+F  SPFLV+E   +  +G   ETLRLDL+++++  Y DAD +IFNTGHWWTH
Sbjct  122   TDYNCSVEFFRSPFLVQEWEMQVSSGKKKETLRLDLVEQSSLKYKDADFIIFNTGHWWTH  181

Query  1378  EKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             EKT+ G+DYYQEGN V+  L V++A+ +AL TW++W+D NV+  +T V+FRGYSA+H
Sbjct  182   EKTALGKDYYQEGNHVYNELNVMDAFHKALLTWSKWIDANVNPRKTLVLFRGYSASH  238



>ref|XP_006488998.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=457

 Score =   320 bits (820),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 186/237 (78%), Gaps = 1/237 (0%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             S CDIF+G+WV D+++P Y PGSCPFID  F+C  + RPD  Y+K++WRP  C +P F+ 
Sbjct  110   SSCDIFNGQWVVDNSEPLYKPGSCPFIDEAFNCFKNGRPDSDYLKYKWRPIGCQLPRFDG  169

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
                LE LRG++LVFVGDSLNRNMWESLVC LR  ++DK RV+E+SGR  F+ +GFY+F+F
Sbjct  170   GKMLEMLRGKRLVFVGDSLNRNMWESLVCALRDSLKDKSRVYEVSGRQRFRTQGFYSFKF  229

Query  1201  EDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTH  1377
              DY CS+DF+ SPFLV+ES F   +G+  ETLRLD++  +++ Y DADI+IFNTGHWWTH
Sbjct  230   RDYMCSIDFIKSPFLVQESKFSDKSGARGETLRLDMIQGSSTKYGDADIIIFNTGHWWTH  289

Query  1378  EKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
              KT +G +Y+QEG+ V+ +LEV EAY +AL TWA+WVD N+D+NRT V FRGYSA+H
Sbjct  290   HKTFKGYNYFQEGSHVYNKLEVKEAYTKALKTWAQWVDANIDSNRTRVFFRGYSASH  346



>dbj|BAK01401.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=753

 Score =   328 bits (841),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 184/235 (78%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD+F G+WVRDD+ P YP GSCP +D  F+CHL+ RPD AY + RW+P  C IP  N TD
Sbjct  404   CDMFYGDWVRDDSYPLYPEGSCPHVDESFNCHLNGRPDKAYQRLRWQPSGCSIPRLNPTD  463

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LERLRG++LVFVGDSLNRNMWESLVCILR+ ++DK+RVFE+SG   F+ +G Y+F F+D
Sbjct  464   MLERLRGKRLVFVGDSLNRNMWESLVCILRNSIKDKRRVFEVSGNHKFRAEGSYSFVFQD  523

Query  1207  YNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YNC+V+F  SPFLV+E      +G   ETLRLD +D+++S Y +AD+++FNTGHWW HEK
Sbjct  524   YNCTVEFFRSPFLVQEWEMHVTHGKKKETLRLDKIDRSSSRYKNADVIVFNTGHWWIHEK  583

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS G+DYYQEG++V+  L V +AY+RAL TWA+WVD N++  +T V FRGYSA+H
Sbjct  584   TSLGKDYYQEGDQVYSELNVHDAYRRALNTWAKWVDSNINPKKTTVFFRGYSASH  638



>ref|XP_006854129.1| hypothetical protein AMTR_s00048p00162020 [Amborella trichopoda]
 gb|ERN15596.1| hypothetical protein AMTR_s00048p00162020 [Amborella trichopoda]
Length=533

 Score =   322 bits (824),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/236 (61%), Positives = 184/236 (78%), Gaps = 2/236 (1%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CDIFDG+WV D+  PYY  GSCPF+D  F+C  + RPD +Y K RW+P  C IP  +  +
Sbjct  180   CDIFDGKWVSDEAYPYYEAGSCPFLDDAFNCAKNGRPDSSYEKLRWQPRECHIPRLDGLE  239

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LERLRG++LV+VGDSLNRNMWES+VCILR  + DK RVFEISG+  FK +GFYAFRF D
Sbjct  240   MLERLRGKRLVYVGDSLNRNMWESMVCILRAALPDKTRVFEISGKQQFKTEGFYAFRFAD  299

Query  1207  YNCSVDFVSSPFLVRE--SSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             YNC+V+F  +PFLVRE  +   G     ETLRLD++++++S Y DAD++IFNTGHWWTH+
Sbjct  300   YNCTVEFFRAPFLVREWKTPDPGSGARRETLRLDVIERSSSKYIDADMIIFNTGHWWTHD  359

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS+G+DYYQEGN V+  L+V EA++RAL TWA WVD N+D NRT++ FRGYSA+H
Sbjct  360   KTSKGKDYYQEGNHVYSELKVAEAFRRALRTWAEWVDINIDPNRTKLFFRGYSASH  415



>ref|XP_002436669.1| hypothetical protein SORBIDRAFT_10g006800 [Sorghum bicolor]
 gb|EER88036.1| hypothetical protein SORBIDRAFT_10g006800 [Sorghum bicolor]
Length=869

 Score =   330 bits (847),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 221/325 (68%), Gaps = 19/325 (6%)
 Frame = +1

Query  589   NRSEIGKNVNFTGFT----EKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEIS  756
             N+ + G  V  +G T      KGD +  + G S E  + ++  S++G+ S          
Sbjct  444   NQEQTGSQVAPSGSTGTVNNPKGDAAQGSAGSS-ENHSTQANSSKSGNNS----------  492

Query  757   KKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFD  936
              +G  S++K D  G  G++ +   +   S CD+F G WVRDD+ P YP GSCP ID  FD
Sbjct  493   -EGNRSSIKQDG-GSGGNKKVDWFKEVAS-CDMFHGNWVRDDSYPLYPEGSCPHIDEPFD  549

Query  937   CHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILR  1116
             C+L+ R D  Y K RW+P  C IP  N TD LERLRG++LVFVGDSLNRNMWESLVCILR
Sbjct  550   CYLNGRRDLVYQKLRWQPSGCSIPRLNPTDMLERLRGKRLVFVGDSLNRNMWESLVCILR  609

Query  1117  HVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFETL  1293
             + V+DK++VFE SGR +FK +G Y+F F DYNCSV+F  SPFLV+E   K  +G   ETL
Sbjct  610   NSVKDKRKVFEASGRREFKTEGSYSFLFTDYNCSVEFFRSPFLVQEWEMKVSSGKKKETL  669

Query  1294  RLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYT  1473
             RLDL+++++  Y DAD +IFNTGHWWTHEKTS G+DYYQEGN V+  L V++A+ +AL T
Sbjct  670   RLDLVEQSSLKYKDADFLIFNTGHWWTHEKTSLGKDYYQEGNHVYNELNVMDAFHKALLT  729

Query  1474  WARWVDKNVDANRTEVIFRGYSATH  1548
             W++W+D NV+  +T V+FRGYSA+H
Sbjct  730   WSKWIDANVNPRKTAVLFRGYSASH  754



>gb|AFW85381.1| putative DUF231 domain containing family protein [Zea mays]
Length=865

 Score =   330 bits (846),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 224/354 (63%), Gaps = 34/354 (10%)
 Frame = +1

Query  496   NATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGSGKNGGFS  675
             N TV  SPP                 K  E   S++    +       KG+ + +    S
Sbjct  428   NNTVGASPP----------------VKNPEQTWSQVAPGGSSGTVNNPKGNAAAQGSAGS  471

Query  676   LEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSF--YSDC  849
              E  + +   S++G+ S           KG+ S++  D     GS   +KG  +   + C
Sbjct  472   SENHSAQVNSSKSGNNS-----------KGSRSSITQD----GGSGGNKKGDWYKEMASC  516

Query  850   DIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDF  1029
             D+F G WVRDD+ P YP GSCP ID  FDC+L+ R D AY K RW+P  C IP  N TD 
Sbjct  517   DMFSGNWVRDDSYPLYPEGSCPHIDEPFDCYLNGRRDLAYQKLRWQPSGCSIPRLNPTDM  576

Query  1030  LERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDY  1209
             LERLRG++LVFVGDSLNRNMWESLVCILR+ V+DK++VFE SGR +FK +G Y+F F DY
Sbjct  577   LERLRGKRLVFVGDSLNRNMWESLVCILRNSVKDKRKVFEASGRREFKTEGSYSFLFTDY  636

Query  1210  NCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKT  1386
             NCSV+F  SPFLV+E   +  +G   ETLRLDL+++++  Y DAD +IFNTGHWWTHEKT
Sbjct  637   NCSVEFFRSPFLVQEWEMQVSSGKKKETLRLDLVEQSSLKYKDADFIIFNTGHWWTHEKT  696

Query  1387  SRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             + G+DYYQEGN V+  L V++A+ +AL TW++W+D NV+  +T V+FRGYSA+H
Sbjct  697   ALGKDYYQEGNHVYNELNVMDAFHKALLTWSKWIDANVNPRKTLVLFRGYSASH  750



>ref|XP_002271893.1| PREDICTED: protein trichome birefringence-like 4 [Vitis vinifera]
 emb|CBI22916.3| unnamed protein product [Vitis vinifera]
Length=465

 Score =   319 bits (817),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 184/236 (78%), Gaps = 3/236 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             S CDIFDG WV DD++P YPPGSCP+ID  F+C  + RPD  Y+++RW+P  C IP F+ 
Sbjct  115   SSCDIFDGNWVLDDSEPVYPPGSCPYIDDAFNCFKNGRPDSDYLRFRWKPQGCQIPRFDG  174

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
                L+ LRG++L+FVGDSLNRNMWESLVC LR  + DK RVFE+SG+ +F+ +GFY+FRF
Sbjct  175   RKMLKMLRGKRLMFVGDSLNRNMWESLVCALRESLVDKSRVFEVSGKREFRTQGFYSFRF  234

Query  1201  EDYNCSVDFVSSPFLVRESSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
              DY CS+DFV SPFLV+E+  + +     TLRLD++  ++S Y DADI++FNTGHWWTH+
Sbjct  235   LDYKCSIDFVRSPFLVQETISRTLRA---TLRLDVIQDSSSKYRDADIIVFNTGHWWTHQ  291

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KT RG++Y+QEG  V+ +LEV EAY +AL TWA+WVD N+D+NRT V FRG+SA+H
Sbjct  292   KTYRGQNYFQEGKHVYNKLEVTEAYTKALRTWAQWVDANIDSNRTRVFFRGFSASH  347



>ref|XP_004964924.1| PREDICTED: fibroin heavy chain-like [Setaria italica]
Length=907

 Score =   331 bits (848),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 197/264 (75%), Gaps = 3/264 (1%)
 Frame = +1

Query  760   KGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDC  939
             KG  ST K D  G +G++ +   +   S CD+F G WVRDD+ P YP GSCP ID  FDC
Sbjct  531   KGNVSTTKQDG-GSSGNKEVDWFKQVAS-CDMFHGHWVRDDSYPLYPEGSCPHIDEPFDC  588

Query  940   HLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRH  1119
             +L+ R D AY K RW+P  C IP  N TD LERLRG++LVF+GDSLNRNMWESLVCILR+
Sbjct  589   YLNGRRDLAYQKLRWQPSGCSIPRLNPTDMLERLRGKRLVFIGDSLNRNMWESLVCILRN  648

Query  1120  VVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFETLR  1296
              V+DK++VFE SGR +FK +G Y+F F DYNCSV+F  SPFLVRE   K  +G   ETLR
Sbjct  649   SVKDKRKVFEASGRREFKTEGSYSFLFTDYNCSVEFFRSPFLVREWEMKVSDGKKKETLR  708

Query  1297  LDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTW  1476
             LDL+++++  Y DAD +IFNTGHWWTHEKT+ G+DYYQEGN V+  L V++A+ +AL TW
Sbjct  709   LDLVEQSSPKYKDADFLIFNTGHWWTHEKTALGKDYYQEGNHVYSELNVVDAFHKALLTW  768

Query  1477  ARWVDKNVDANRTEVIFRGYSATH  1548
             ++W+D NV+  +T V+FRGYSA+H
Sbjct  769   SKWIDANVNPKKTTVLFRGYSASH  792



>ref|XP_009587467.1| PREDICTED: protein trichome birefringence-like [Nicotiana tomentosiformis]
Length=541

 Score =   321 bits (823),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 160/298 (54%), Positives = 210/298 (70%), Gaps = 18/298 (6%)
 Frame = +1

Query  667   GFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFY--  840
             GFS+    +    SENG+  + +   V  S    S +V+N+   EN     +K   ++  
Sbjct  141   GFSISPSQMNE--SENGEEEKQK---VNFS----SFSVRNETSTEN-----QKNEPWWEV  186

Query  841   -SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFN  1017
              S CD+FDGEWV+DD  P Y PGSCPFID  FDC+ + RPD+ Y K+RW+P  C+IP  N
Sbjct  187   MSHCDVFDGEWVKDDANPLYEPGSCPFIDEPFDCYKNGRPDNGYEKFRWQPKHCNIPRLN  246

Query  1018  ATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFR  1197
             A + LE LRG++LV+VGDSLNRNMWES+VC+LR  V +K RVFE+SGR DFKK+G Y+F 
Sbjct  247   AKEMLELLRGKRLVYVGDSLNRNMWESMVCLLRSSVEEKSRVFEVSGREDFKKEGAYSFI  306

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWT  1374
             F DYNCSV+FV S FLV+E      NGS  ETLRLDL++++   Y  ADI++FNTGHWWT
Sbjct  307   FADYNCSVEFVRSTFLVQEWEMPDGNGSTKETLRLDLVERSCDKYKGADILVFNTGHWWT  366

Query  1375  HEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             HEKTS G+ YYQEG+ V+  L V+EA+++A+ TWARW++ NVD  +T+V FRGYS +H
Sbjct  367   HEKTSEGKGYYQEGSHVYGELNVVEAFRKAMTTWARWIETNVDPLKTDVFFRGYSVSH  424



>ref|XP_008791924.1| PREDICTED: protein trichome birefringence-like 1 [Phoenix dactylifera]
Length=780

 Score =   327 bits (839),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 171/362 (47%), Positives = 226/362 (62%), Gaps = 30/362 (8%)
 Frame = +1

Query  535   SGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGSG-KNGGFSLEG----ETVKS  699
             +G  KDG         E NR+  G  +  +G   +   G G  + G  + G    E+V S
Sbjct  311   AGSKKDGVL------PEKNRTASGVGLQGSGVLSENHTGKGVASNGNGVSGNNQKESVAS  364

Query  700   EGSENGDRSRSRGVGVEISKKGTSSTVK---------------NDMIGENGSELLRKGRS  834
                +   + +    GV  S K + ++ K               ND I    S    KG  
Sbjct  365   PQEKGVLKKKQSSHGVSASPKSSEASTKAEQRASNLTASLGKQNDSIASTPSSGGPKGDD  424

Query  835   FYSD---CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDI  1005
             + +    CDIF G WV+DD+ P YP GSCP +   F+C+L+ RPD AY K RW+P  CDI
Sbjct  425   WINALKGCDIFQGNWVKDDSYPLYPEGSCPHVAEPFNCYLNGRPDRAYQKLRWKPDGCDI  484

Query  1006  PSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGF  1185
             P  NATD LERLRG++LVFVGDSLNRNMWESLVC LRH V+DKK+VFE SGR +F+ +G 
Sbjct  485   PRLNATDMLERLRGKRLVFVGDSLNRNMWESLVCALRHSVKDKKKVFEASGRHEFRAEGS  544

Query  1186  YAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTG  1362
             Y+F F+DYNCSV+F  SPFLV+E      NG + ETLRLD +++++  Y +A +++FNTG
Sbjct  545   YSFIFKDYNCSVEFFRSPFLVQEWEIPVSNGKTKETLRLDTIERSSPKYKNAHVIVFNTG  604

Query  1363  HWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSA  1542
             HWWTHEKTS+G+DYYQEG+ V+  L V+EA+ +AL TWA+WVD  V+  +T V FRGYSA
Sbjct  605   HWWTHEKTSKGKDYYQEGDHVYSELNVVEAFHKALNTWAKWVDAYVNPKKTLVFFRGYSA  664

Query  1543  TH  1548
             +H
Sbjct  665   SH  666



>ref|XP_009783417.1| PREDICTED: protein trichome birefringence-like 4 [Nicotiana sylvestris]
Length=564

 Score =   320 bits (819),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 211/303 (70%), Gaps = 15/303 (5%)
 Frame = +1

Query  664   GGFSLEGETVKSEGSENGDRSRSRGVGVEISKKG----TSSTVKNDMIGENGSELLRKGR  831
              GFS+    +    SENG++     +  E  +K     +  +V+ND   EN     +K  
Sbjct  144   NGFSISPSQMND--SENGEKGLQNSMKNEEEEKKRVNLSPYSVRNDTSTEN-----QKNE  196

Query  832   SFY---SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACD  1002
              ++   S CD+FDG+WV+DD  P Y PGSCPFID  FDC+ + RPD+ Y K+RW+P  C+
Sbjct  197   PWWEVLSHCDVFDGKWVKDDANPLYEPGSCPFIDEPFDCYRNGRPDNGYEKFRWQPKHCN  256

Query  1003  IPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKG  1182
             IP  NA + LE LRG++LV+VGDSLNRNMWES+VC+LR+ V DK RVFE+SGR DFKK+G
Sbjct  257   IPRLNAKEMLELLRGKRLVYVGDSLNRNMWESMVCLLRNSVEDKSRVFEVSGREDFKKEG  316

Query  1183  FYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNT  1359
              Y+F F DYN SV+FV S FLV+E      NGS  ETLRLDL++++   Y  ADI++FNT
Sbjct  317   AYSFIFADYNFSVEFVRSTFLVQEWEMPDGNGSTKETLRLDLVERSCDKYKGADILVFNT  376

Query  1360  GHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYS  1539
             GHWWTHEKTS G+ YYQEG+ V+  L V+EA+++A+ TWARW++ NVD  +T+V FRGYS
Sbjct  377   GHWWTHEKTSEGKGYYQEGSHVYGELNVVEAFRKAMTTWARWIETNVDPLKTDVFFRGYS  436

Query  1540  ATH  1548
              +H
Sbjct  437   VSH  439



>ref|XP_003573026.1| PREDICTED: protein trichome birefringence [Brachypodium distachyon]
Length=753

 Score =   325 bits (832),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 181/235 (77%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD+F G WVRDD+ P YP GSCP +D  F+C+L+ RPD  Y + RW+P  C IP  N +D
Sbjct  404   CDMFYGNWVRDDSYPLYPEGSCPHVDESFNCYLNGRPDKDYQRLRWQPSGCSIPRLNPSD  463

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LERLRG++LVFVGDSLNRNMWESLVCILR+ ++DK++VFE+SG   F+ +G Y+F F+D
Sbjct  464   MLERLRGKRLVFVGDSLNRNMWESLVCILRNSIKDKRKVFEVSGNQKFRAEGSYSFLFQD  523

Query  1207  YNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YNCSV+F  SPFLV+E      +G + ETLRLD++D ++  Y  ADI++FNTGHWWTHEK
Sbjct  524   YNCSVEFFRSPFLVQEWETPARHGKNKETLRLDVIDHSSPRYKSADIIVFNTGHWWTHEK  583

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS G+DYYQEGN V+  L V +AY+RAL TWA+WVD NV+  RT V FRGYSA+H
Sbjct  584   TSLGKDYYQEGNHVYSELNVDDAYRRALNTWAKWVDANVNPRRTTVFFRGYSASH  638



>ref|XP_006357865.1| PREDICTED: uncharacterized protein LOC102596807 [Solanum tuberosum]
Length=673

 Score =   322 bits (826),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/289 (53%), Positives = 202/289 (70%), Gaps = 12/289 (4%)
 Frame = +1

Query  685   ETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDG  864
             + +K+EG  +  R       V +S    S+  KN+   E   E++       S CD+FDG
Sbjct  271   QVLKNEGKSSSKREEKESQKVNLS----SNLEKNETKKEAWWEVM-------SHCDVFDG  319

Query  865   EWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLR  1044
              WV+DD  P Y PGSCPFID  FDC+ + RPD+ Y  +RW+P  C+IP  +A + LE LR
Sbjct  320   MWVKDDANPMYEPGSCPFIDEPFDCYQNGRPDNGYQSFRWQPKHCNIPRLDAKEMLELLR  379

Query  1045  GQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVD  1224
             G++LV+VGDSLNRNMWES+VC+LR+ V DK RVFE+SGR DFKK+G Y+F F DYNCSV+
Sbjct  380   GKRLVYVGDSLNRNMWESMVCLLRNSVEDKNRVFEVSGREDFKKEGAYSFIFADYNCSVE  439

Query  1225  FVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGED  1401
             FV S FLV+E      NGS  ETLRLDL++++   Y  AD+++FNTGHWWTHEKTS G+ 
Sbjct  440   FVRSTFLVQEWEIPDGNGSTKETLRLDLVERSCDKYKGADVLVFNTGHWWTHEKTSEGKG  499

Query  1402  YYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             YYQEG  V+  L V+EA+++A+ TWARW++ NVD  +T+V FRGYS +H
Sbjct  500   YYQEGGHVYGELNVVEAFRKAMTTWARWIEANVDPQKTDVFFRGYSVSH  548



>ref|XP_009393972.1| PREDICTED: protein trichome birefringence-like 4 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   316 bits (809),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/251 (57%), Positives = 182/251 (73%), Gaps = 1/251 (0%)
 Frame = +1

Query  799   ENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKW  978
             E G + L   +   + CD+FDG WV D++ P YPPGSCPFID  FDC  + RPD  Y K 
Sbjct  125   EKGQKALESSKDLAATCDLFDGRWVFDESTPRYPPGSCPFIDSSFDCFGNGRPDQNYTKL  184

Query  979   RWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISG  1158
             RW+P  C IP       L  LRG++LVFVGDSLNRNMWESL+CILRH ++ K RVFE+SG
Sbjct  185   RWKPKGCSIPRLEGKKMLRALRGKRLVFVGDSLNRNMWESLLCILRHPLKRKHRVFEVSG  244

Query  1159  RSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYND  1335
             R +F+    YAFRFEDYNCS++F  SPFLVRESS+    G S ETLRLDL++ ++  Y  
Sbjct  245   RKEFRTDNSYAFRFEDYNCSIEFFRSPFLVRESSWVDSQGKSRETLRLDLIEASSDAYRT  304

Query  1336  ADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRT  1515
             ADI++FN+GHWWTHEKTS+G ++YQEG+ V+P+L   +AY++A+ TW  WVD  V++NRT
Sbjct  305   ADILVFNSGHWWTHEKTSKGRNFYQEGDHVYPQLSAEDAYRKAMRTWGTWVDTRVNSNRT  364

Query  1516  EVIFRGYSATH  1548
              V FRGYS +H
Sbjct  365   RVFFRGYSWSH  375



>ref|XP_004228795.2| PREDICTED: protein trichome birefringence-like [Solanum lycopersicum]
Length=363

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 181/235 (77%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD+FDG WV+DD  P Y PGSCPFID  FDC+ + RPD+ Y  +RW+P  C IP  +A  
Sbjct  4     CDVFDGMWVKDDANPMYEPGSCPFIDEPFDCYQNGRPDNGYQNFRWQPKHCSIPRLDAKQ  63

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LE LRG++LV+VGDSLNRNMWES+VC+LR+ V DK RVFE+SGR DFKK+G Y+F F D
Sbjct  64    MLELLRGKRLVYVGDSLNRNMWESMVCLLRNSVEDKNRVFEVSGREDFKKEGAYSFIFAD  123

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YNCSV+FV S FLV+E      NGS  ETLRLDL++++   Y  AD+++FNTGHWWTHEK
Sbjct  124   YNCSVEFVRSTFLVQEWEIPDGNGSTKETLRLDLVERSCDKYKGADVLVFNTGHWWTHEK  183

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS G+ YYQEG+ V+  L V+EA+++A+ TWARW++ NVD ++T+V FRGYS +H
Sbjct  184   TSEGKGYYQEGSHVYGELNVVEAFRKAMTTWARWIEANVDPSKTDVFFRGYSVSH  238



>ref|XP_002519189.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43053.1| conserved hypothetical protein [Ricinus communis]
Length=474

 Score =   315 bits (807),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/258 (57%), Positives = 194/258 (75%), Gaps = 5/258 (2%)
 Frame = +1

Query  781   KNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDT-KPYYPPGSCPFIDRDFDCHLHKRP  957
             +N    E   ++L  G    S CDIF+G WV DD   P Y PGSCPF+D  F+C  + RP
Sbjct  108   RNSRKEETDDDVLLSG---LSSCDIFNGSWVIDDDFGPIYKPGSCPFVDDSFNCFKNGRP  164

Query  958   DDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKK  1137
             D +Y+++RW+PH C IP F+  +FLE L+G+KLVFVGDSLNRNMWESLVC LR  +++K 
Sbjct  165   DLSYLRYRWKPHGCQIPRFDGRNFLELLKGKKLVFVGDSLNRNMWESLVCALRESLKNKS  224

Query  1138  RVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDK  1314
             R+FE+SGR +F+ +GFY+F+F DYNCS+DFV SPFLV+E       G+  ETLRLD++  
Sbjct  225   RIFEVSGRKEFRTRGFYSFKFIDYNCSIDFVKSPFLVQEVKASEDTGNRRETLRLDMIQG  284

Query  1315  TTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDK  1494
             T S Y+ ADI+IFNTGHWWTH+KT+RG+DY+QEG+ V+ RL+V EAY +AL+TWA WVD 
Sbjct  285   TFSKYHHADIIIFNTGHWWTHQKTNRGKDYFQEGSHVYNRLKVTEAYTKALWTWAHWVDA  344

Query  1495  NVDANRTEVIFRGYSATH  1548
             N++++ T V FRGYSA+H
Sbjct  345   NINSSHTRVFFRGYSASH  362



>ref|XP_011100832.1| PREDICTED: protein trichome birefringence-like 4 [Sesamum indicum]
Length=463

 Score =   314 bits (804),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 196/276 (71%), Gaps = 8/276 (3%)
 Frame = +1

Query  727   RSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRD-DTKPYYPP  903
             RS  V    S   T   +  + +G    E           CD+FDG WV D D +P Y P
Sbjct  80    RSCAVSAAFSPAETCHQIPGNAVGSASVE------EETDSCDVFDGHWVVDEDFEPVYKP  133

Query  904   GSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNR  1083
             GSCPFID  F+C  + RPD  Y++ +W+PHAC+IP F+    L+ L G+K+VFVGDSLNR
Sbjct  134   GSCPFIDDAFNCFKNGRPDSDYLRLKWKPHACEIPRFDGQKMLKMLTGKKMVFVGDSLNR  193

Query  1084  NMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSF  1263
             NMWESLVC LR  + +K+ VFE+SGR  F+ +GFY+F+F+D+NCS+DF+ SPFLV+E  F
Sbjct  194   NMWESLVCALRESLANKRNVFEVSGRRQFRNQGFYSFKFKDFNCSIDFIKSPFLVQEWKF  253

Query  1264  KGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLE  1440
                 G+  ETLRLD+M+ + + Y+DADI++FNTGHWWTH+KT +G+ Y+QEGN V+ +LE
Sbjct  254   SDKAGTRRETLRLDMMEGSYNSYHDADIIVFNTGHWWTHQKTFQGKYYFQEGNHVYRKLE  313

Query  1441  VLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             V +AYK+AL TWARWVD N+++NRT V FRGYS++H
Sbjct  314   VADAYKKALRTWARWVDANINSNRTRVFFRGYSSSH  349



>ref|XP_002308359.2| hypothetical protein POPTR_0006s20840g [Populus trichocarpa]
 gb|EEE91882.2| hypothetical protein POPTR_0006s20840g [Populus trichocarpa]
Length=611

 Score =   316 bits (809),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/297 (51%), Positives = 200/297 (67%), Gaps = 12/297 (4%)
 Frame = +1

Query  691   VKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSF----------Y  840
             V +  SEN   ++S   G  +S   T+S VK        S     G+             
Sbjct  196   VAANQSENTP-TKSGDAGKTVSSNFTASLVKKQSNATKQSNETNSGKEVKQGFDNRVQNL  254

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             ++CD FDGEWV+DD+ P Y PGSC  ID  F+C ++ RPD  Y K++W+P  C +P  N 
Sbjct  255   ANCDFFDGEWVKDDSYPLYKPGSCSLIDEQFNCIINGRPDKDYQKYKWKPKGCTLPRLNP  314

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
                L+ LRG++LVFVGDSLNRNMWESLVCIL+  V+D+ +VFE++GR  F+ +  Y+F F
Sbjct  315   RHMLDMLRGKRLVFVGDSLNRNMWESLVCILKGSVKDQSKVFEVNGRHHFRGEASYSFLF  374

Query  1201  EDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTH  1377
             +DYNC++DF  SPFLV+E      +GS  ETLRLDL+ +++S Y  ADI++FNTGHWWTH
Sbjct  375   KDYNCTIDFFVSPFLVQEWEMHEKDGSMKETLRLDLVGRSSSQYKSADIIVFNTGHWWTH  434

Query  1378  EKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +KTS+G+DYYQEGN V+  L VLEA+++AL TWARWVD NVD  ++ V FRGYSA+H
Sbjct  435   DKTSKGKDYYQEGNHVYNELNVLEAFRKALTTWARWVDANVDPMKSLVFFRGYSASH  491



>ref|XP_007204980.1| hypothetical protein PRUPE_ppa003027mg [Prunus persica]
 gb|EMJ06179.1| hypothetical protein PRUPE_ppa003027mg [Prunus persica]
Length=610

 Score =   315 bits (807),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/252 (58%), Positives = 187/252 (74%), Gaps = 2/252 (1%)
 Frame = +1

Query  799   ENGSELLRKGRSFYS-DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVK  975
             E  S+    G  F++ DCDIFDG WVRDD  P Y PGSCP ID  F+C L+KRPD+ Y K
Sbjct  234   EKQSKQTGPGLDFWTNDCDIFDGRWVRDDFYPLYAPGSCPHIDESFNCFLNKRPDNGYEK  293

Query  976   WRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEIS  1155
             +RW+P  C++P  N  + L  LRG++LVFVGDSLNRNMWESLVC+LR+ V DK RV E S
Sbjct  294   YRWQPKHCNLPRLNGRNMLGLLRGKRLVFVGDSLNRNMWESLVCLLRNSVDDKSRVVEAS  353

Query  1156  GRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYN  1332
             GRS+F+ +G ++F F+DYNCSV+F  SPFLVRE      NGS  ETLRLDL+++++  Y 
Sbjct  354   GRSEFRTEGSHSFIFKDYNCSVEFFRSPFLVREWEMPDANGSLKETLRLDLIERSSDKYK  413

Query  1333  DADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANR  1512
              AD++IFNTGHWWTHEKTSRG+ YYQEG+ ++  L V EA+++AL TWARWV+ N++  +
Sbjct  414   SADVLIFNTGHWWTHEKTSRGKGYYQEGSHIYGELNVKEAFRKALMTWARWVNININLEK  473

Query  1513  TEVIFRGYSATH  1548
             T V FRGYS  H
Sbjct  474   TIVFFRGYSPNH  485



>ref|XP_009369426.1| PREDICTED: protein trichome birefringence [Pyrus x bretschneideri]
Length=628

 Score =   315 bits (808),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 162/340 (48%), Positives = 218/340 (64%), Gaps = 34/340 (10%)
 Frame = +1

Query  577   THELNRSEIGKNVNFTGFTEKKGDGSGKNGGFSL------EGETVKSEGSE--------N  714
             TH  +++ +    N TG T  K   +  NG   L      E ++V  +G E        N
Sbjct  183   THNSDKATVF-TANQTGNTAPKTPVAAGNGSSDLVPKSGLEDKSVAEKGVEKNITASLLN  241

Query  715   GDRSRSR-GVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKP  891
                + ++ GV VE  K G+   VK+ M                 +C++  GEWVRDD+ P
Sbjct  242   KQSNETKSGVSVEQRKPGSDDLVKSLM-----------------NCELLHGEWVRDDSYP  284

Query  892   YYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGD  1071
              Y PGSCP ID  F+C L+ RPD  Y K++W+P  C +P  + +  LE LRG++LVFVGD
Sbjct  285   LYKPGSCPLIDEQFNCILNGRPDKDYQKYKWKPKDCTLPRLDGSHMLELLRGKRLVFVGD  344

Query  1072  SLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVR  1251
             SLNRNMWESLVCILR+  +DK +VFE +GR+ F+ +  Y+F F+DYNC+V+F  SPFLVR
Sbjct  345   SLNRNMWESLVCILRNSAKDKSKVFEANGRTHFRGEASYSFIFKDYNCTVEFFVSPFLVR  404

Query  1252  ESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVH  1428
             E      +GS  ETLRLDL+ +++ +Y DAD+VIFNTGHWWTHEKTS+G+DYYQEG+ V+
Sbjct  405   EWEMPEKDGSKRETLRLDLVGRSSELYKDADVVIFNTGHWWTHEKTSKGKDYYQEGSHVY  464

Query  1429  PRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
               L VLEA+++AL TWARWVD  VD  ++ + FRGYSA+H
Sbjct  465   GELNVLEAFRKALTTWARWVDAKVDPKKSIIFFRGYSASH  504



>ref|XP_008387218.1| PREDICTED: protein trichome birefringence-like [Malus domestica]
Length=629

 Score =   315 bits (807),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 208/328 (63%), Gaps = 33/328 (10%)
 Frame = +1

Query  613   VNFTGFTEKKGDGSGKNGGFSL------EGETVKSEGSENGDRSR---------SRGVGV  747
              N TG T  K   +G NG   L      E ++V  +G E    +            GV +
Sbjct  195   ANQTGITAPKTPVAGVNGSSDLVPKSGLEDKSVAEKGVEKNSTASLLNKQSNETKSGVSM  254

Query  748   EISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDR  927
             E  K G+   VK+ M                 +C++  GEWVRDD+ P Y PGSCP ID 
Sbjct  255   EQRKPGSDDLVKSLM-----------------NCEMLHGEWVRDDSYPLYKPGSCPLIDE  297

Query  928   DFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVC  1107
              F+C L+ RPD  Y K++W+P  C +P  + +  LE LRG++LVFVGDSLNRNMWESLVC
Sbjct  298   QFNCILNGRPDKDYQKYKWKPKDCTLPRLDGSHMLELLRGKRLVFVGDSLNRNMWESLVC  357

Query  1108  ILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-F  1284
             ILR+  +DK +VFE +GR+ F+ +  Y+F F+DYNC+V+F  SPFLVRE      +GS  
Sbjct  358   ILRNSAKDKXKVFEANGRTHFRGEASYSFIFKDYNCTVEFFVSPFLVREWEMPEKDGSKR  417

Query  1285  ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRA  1464
             ETLRLDL+ +++ +Y DAD+VIFNTGHWWTHEKTS G+DYYQEG+ V+  L VLEA+++A
Sbjct  418   ETLRLDLVGRSSELYKDADVVIFNTGHWWTHEKTSXGKDYYQEGSHVYGELNVLEAFRKA  477

Query  1465  LYTWARWVDKNVDANRTEVIFRGYSATH  1548
             L TWARWVD  VD  ++   FRGYSA+H
Sbjct  478   LTTWARWVDAKVDPKKSIXFFRGYSASH  505



>ref|XP_010268038.1| PREDICTED: protein trichome birefringence-like 4 [Nelumbo nucifera]
Length=467

 Score =   309 bits (792),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 183/237 (77%), Gaps = 1/237 (0%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             + CDIFDG+WV D++ P Y PGSCPFID  F+C  + R D  Y+++RW+P+ C IP  + 
Sbjct  123   TSCDIFDGKWVFDNSDPIYQPGSCPFIDDAFNCFKNGRLDSGYMRYRWKPNDCQIPRLDG  182

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
              + LE L+G++L FVGDSLNRNMW+SLVC LR  V +K RVFE+SGR +F+ +GFY+F F
Sbjct  183   KEMLEILKGKRLAFVGDSLNRNMWQSLVCALRESVMNKSRVFEVSGRHEFRTQGFYSFIF  242

Query  1201  EDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTH  1377
              +YNCS++F  SPFLV+E       G+  ETLRLDL+  ++S Y +ADI+IFNTGHWWTH
Sbjct  243   TEYNCSIEFFRSPFLVQEWKINDSTGARKETLRLDLIHGSSSKYFNADIIIFNTGHWWTH  302

Query  1378  EKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +KTSRG+DY+QEG+ VH +L V EAY +AL+TWARWVD N+D++RT V FRGYSA+H
Sbjct  303   QKTSRGKDYFQEGDHVHSKLGVAEAYTKALHTWARWVDGNIDSDRTRVFFRGYSASH  359



>gb|EYU44005.1| hypothetical protein MIMGU_mgv1a026273mg [Erythranthe guttata]
Length=456

 Score =   308 bits (790),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 185/239 (77%), Gaps = 2/239 (1%)
 Frame = +1

Query  838   YSDCDIFDGEWVRDD-TKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSF  1014
             +  CDIFDG WV D+ +KP Y PGSCPF+D  FDC  + RPD  Y+K +W+PHAC IP F
Sbjct  104   FDSCDIFDGSWVIDEGSKPVYEPGSCPFVDDSFDCFKNGRPDSDYLKLKWKPHACKIPRF  163

Query  1015  NATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAF  1194
             +    L+ L+G+++VFVGDSLNRNMWESLVC +R  + DK +VFE+SG   F+ +GFY+F
Sbjct  164   DGVKMLKLLKGKRMVFVGDSLNRNMWESLVCAMRESLSDKTKVFEVSGLRQFRSQGFYSF  223

Query  1195  RFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWW  1371
              F+D+NCS+DFV SPFLV+E  F    G+  ETLRLD+M+ + + Y DAD+++FNTGHWW
Sbjct  224   IFKDFNCSIDFVKSPFLVQEWKFLDKAGTRRETLRLDMMEGSYNKYYDADVIVFNTGHWW  283

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TH+KT +G+ Y+QEGN V+ +L V +AYK+AL TWA+WVD+N+D+++T V FRGYSA+H
Sbjct  284   THQKTFQGKYYFQEGNHVYNKLAVADAYKKALKTWAQWVDENIDSSKTSVFFRGYSASH  342



>ref|XP_010671195.1| PREDICTED: protein trichome birefringence-like 4 [Beta vulgaris 
subsp. vulgaris]
Length=474

 Score =   309 bits (791),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/285 (52%), Positives = 197/285 (69%), Gaps = 13/285 (5%)
 Frame = +1

Query  721   RSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFY------SDCDIFDGEWVRDD  882
             R+   G  V IS     S +  D  G N    L K    +      + CDIFDG+WV D+
Sbjct  82    RTFETGSNVAISH----SPIPLDENGSNSPRTLSKTEHDFVINKNKNSCDIFDGKWVLDN  137

Query  883   TKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVF  1062
             + P YPPGSCPF+D  F+C  + R D  Y+++RW+P+ C+IP F+    LE LRG+++VF
Sbjct  138   SDPIYPPGSCPFLDYTFNCFNNGRSDLRYLRYRWQPNGCNIPRFDGKKMLEILRGKRMVF  197

Query  1063  VGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPF  1242
             VGDSLNRNMWESLVC LR  + DK ++FE+SG+  F+ +GFY+F+F+DYNC+V+F+ SPF
Sbjct  198   VGDSLNRNMWESLVCSLRMSLVDKNKMFEVSGKRQFRTEGFYSFKFQDYNCTVEFIRSPF  257

Query  1243  LVRE---SSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQE  1413
             LV+E    S KGV    E LRLDL+  TTS Y+DAD +IFNTGHWWTH KT +G++++QE
Sbjct  258   LVQEWKFPSVKGVESRREMLRLDLIQATTSNYHDADFLIFNTGHWWTHHKTRKGKNFFQE  317

Query  1414  GNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             G  V  +L+V EAY +AL TWA WVDKNV+ N+T+V F GYS +H
Sbjct  318   GETVLSKLKVTEAYTKALKTWAEWVDKNVNKNKTQVFFAGYSTSH  362



>ref|XP_004296154.1| PREDICTED: uncharacterized protein LOC101303316 [Fragaria vesca 
subsp. vesca]
Length=520

 Score =   310 bits (794),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 182/248 (73%), Gaps = 1/248 (0%)
 Frame = +1

Query  808   SELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWR  987
             +E L  G    + CD+FDG WVRDD+ P Y  GSCPFID  F+C L+ RPD+ Y K+RW+
Sbjct  161   NEGLLAGFKLMNGCDLFDGRWVRDDSYPLYAAGSCPFIDESFNCFLNSRPDNGYEKYRWQ  220

Query  988   PHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSD  1167
             P  C++P  N  + L  LRG++LVFVGDSLNRNMWESLVC+LR+ V DK RVFE SGRS+
Sbjct  221   PKDCNLPRMNGRNMLGLLRGKRLVFVGDSLNRNMWESLVCLLRNSVDDKSRVFEASGRSE  280

Query  1168  FKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADI  1344
             F+  G  +F F+DYNCSV+FV SPFLV+ES     NGS  ETL LD++ ++   Y  +D+
Sbjct  281   FRTAGACSFIFKDYNCSVEFVQSPFLVQESEVLTTNGSKKETLHLDMIHRSLDNYKSSDV  340

Query  1345  VIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVI  1524
             ++FNTGHWWTHEKTSRG+ YYQEG+ V+ +L V EAY +A+ TWARW+D N++  +T V 
Sbjct  341   LVFNTGHWWTHEKTSRGQGYYQEGDHVYDQLNVKEAYGKAIATWARWLDANINPEKTIVF  400

Query  1525  FRGYSATH  1548
             FRGYS  H
Sbjct  401   FRGYSPNH  408



>ref|XP_009757308.1| PREDICTED: protein trichome birefringence-like [Nicotiana sylvestris]
Length=684

 Score =   315 bits (806),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/299 (51%), Positives = 203/299 (68%), Gaps = 21/299 (7%)
 Frame = +1

Query  661   NGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFY  840
             NG    E E VKS  + +  + +S G  +++S K     V   ++               
Sbjct  285   NGSKEKEIEGVKSNFTSSFVKKQSNGTNLDVSAKKKDEDVVKSLL---------------  329

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
              DCD FDG WV+D++ P Y PGSC  ID  F+C L+ RPD  Y+K +W+P+AC +P  N 
Sbjct  330   -DCDFFDGNWVKDESYPLYKPGSCSLIDEQFNCFLNGRPDSNYIKMKWKPNACTLPRLNG  388

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
             T  LE LRG++LVFVGDSLNRNMWESLVCILR+ V+D+K+V+E  GR  F+ +  Y+F F
Sbjct  389   THMLELLRGKRLVFVGDSLNRNMWESLVCILRNSVKDQKKVYEEFGRHHFRTEASYSFLF  448

Query  1201  EDYNCSVDFVSSPFLVRESSF---KGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWW  1371
             E+YNC V+F  SPFLV+E  F   KGV    ETLRLDL+ ++   Y +ADI+IFNTGHWW
Sbjct  449   EEYNCRVEFFVSPFLVQEWEFADKKGVKK--ETLRLDLIGQSADKYKNADILIFNTGHWW  506

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             THEKTS G+DYYQEG+ V+  L+VLEA+++AL TW RW+D +V+ ++T V+FRGYSA+H
Sbjct  507   THEKTSLGKDYYQEGSHVYSELDVLEAFRKALTTWGRWIDSHVNPHKTFVLFRGYSASH  565



>ref|XP_008240911.1| PREDICTED: protein trichome birefringence [Prunus mume]
Length=618

 Score =   312 bits (800),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/272 (54%), Positives = 192/272 (71%), Gaps = 18/272 (7%)
 Frame = +1

Query  736   GVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCP  915
             GV V+  K+G    VK+ M                 +CDI  GEWV+DD+ P Y PGSCP
Sbjct  241   GVSVKKEKQGNDDLVKSLM-----------------NCDILHGEWVKDDSYPLYKPGSCP  283

Query  916   FIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWE  1095
              ID  F+C L+ RPD  + K++W+P  C +P  + +  LE LRG++LVFVGDSLNRNMWE
Sbjct  284   LIDEQFNCILNGRPDKDFQKFKWKPKDCTLPRLDGSHMLELLRGKRLVFVGDSLNRNMWE  343

Query  1096  SLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVN  1275
             SLVCILR+  +DK +VFE +GR+ F+ +  Y+F F+DYNC+V+F  SPFLVRE      +
Sbjct  344   SLVCILRNSAKDKSKVFEANGRTHFRGEASYSFIFKDYNCTVEFFVSPFLVREWEMPEKD  403

Query  1276  GS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEA  1452
             GS  ETLRLDL+ +++ +Y DADIVIFNTGHWWTHEKTS+G+DYYQEG+ V+  L VLEA
Sbjct  404   GSKRETLRLDLVGRSSDLYKDADIVIFNTGHWWTHEKTSKGKDYYQEGSHVYGELNVLEA  463

Query  1453  YKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +++AL TWARWVD  ++  ++ V FRGYSA+H
Sbjct  464   FRKALTTWARWVDAKINPRKSIVFFRGYSASH  495



>ref|XP_010044971.1| PREDICTED: protein trichome birefringence-like 1 [Eucalyptus 
grandis]
 gb|KCW87107.1| hypothetical protein EUGRSUZ_B03636 [Eucalyptus grandis]
Length=520

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 194/286 (68%), Gaps = 11/286 (4%)
 Frame = +1

Query  715   GDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSD-------CDIFDGEWV  873
              DRS   G G      G +   + D  G +G    RK +    +       CD++ G WV
Sbjct  122   ADRS---GSGAAEGPSGAALASREDGGGADGESPWRKKKKGTEEWVQSVKKCDVYAGRWV  178

Query  874   RDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQK  1053
             RD++ P Y PGSCP ID  FDC L+ R D  Y+K+RW+P+ CDIP  +    L  LRG++
Sbjct  179   RDESYPLYLPGSCPHIDEPFDCFLNGRRDSGYLKYRWQPNDCDIPRLSGRKMLMLLRGKR  238

Query  1054  LVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVS  1233
             LVFVGDSLNRNMWESLVCILR+ V DK RVFE SGR +F+ +G Y+F F+DYNCSV+F  
Sbjct  239   LVFVGDSLNRNMWESLVCILRNSVEDKSRVFEASGRQEFRAEGSYSFIFQDYNCSVEFFQ  298

Query  1234  SPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQ  1410
             SPFLVRE      NGS  ETLRLDL + ++  Y DADI+IFNTGHWWTHEKTS+G+DYYQ
Sbjct  299   SPFLVREWETPMANGSKRETLRLDLFEGSSEKYKDADILIFNTGHWWTHEKTSKGKDYYQ  358

Query  1411  EGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             EG+ ++ +L V  A+++AL TW RW+D N+D+++T V FRGYS  H
Sbjct  359   EGSHIYSQLHVKVAFQKALTTWGRWIDTNIDSSKTLVFFRGYSYGH  404



>ref|XP_010557950.1| PREDICTED: protein trichome birefringence-like [Tarenaya hassleriana]
Length=626

 Score =   311 bits (797),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 163/374 (44%), Positives = 232/374 (62%), Gaps = 12/374 (3%)
 Frame = +1

Query  454   FNPVVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFG--LWKKTHELNRSEIGKNVNFTG  627
             F+       G   +N T+  SP   N    AK+ +FG     +T+ + ++   K++N  G
Sbjct  137   FSSTTSSFAGSVPKNETLQ-SPDTDNLGPVAKNSTFGSLATNQTNPVAKNSTDKSLN--G  193

Query  628   FTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTV---KNDMIG  798
              +        +    + +  TV +  S     S++    V   K   ++     +++   
Sbjct  194   SSNHSWSDQTRETPSNPKNGTVIAPNSGKEQASKTNQTAVPPPKSAVTAAPPEKQSNKSS  253

Query  799   ENGS---ELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAY  969
             ++GS   E + + +    +CD FDGEWV+D++ P Y PGSC  ID  F+C L+ RPD  +
Sbjct  254   DSGSLVKEEIVRWKDSLKNCDFFDGEWVKDESYPLYKPGSCNLIDEQFNCILNGRPDKDF  313

Query  970   VKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFE  1149
              K RW+P  CD+P  N +  LE +RG++LVFVGDSLNRNMWESLVCILR  V+D+  VFE
Sbjct  314   QKLRWKPKKCDLPRLNGSHLLEMIRGRRLVFVGDSLNRNMWESLVCILRGSVKDQSNVFE  373

Query  1150  ISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSM  1326
              +GR  F+ +  Y+F F DYNC+V+F  SPFLV+E      NG+  ETLRLDL+ +++  
Sbjct  374   ANGRHHFRGEADYSFVFRDYNCTVEFYVSPFLVQEWEVVDKNGTKKETLRLDLVGRSSDQ  433

Query  1327  YNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDA  1506
             Y  ADI++FNTGHWWTHEKTS+GEDYYQEG+ V+  L VLEA+++AL TW+RWVDKNV+ 
Sbjct  434   YKGADIIVFNTGHWWTHEKTSKGEDYYQEGSHVYDELNVLEAFRKALTTWSRWVDKNVNP  493

Query  1507  NRTEVIFRGYSATH  1548
             N++ V FRGYSA+H
Sbjct  494   NKSLVFFRGYSASH  507



>ref|XP_010498482.1| PREDICTED: protein trichome birefringence-like 1 [Camelina sativa]
Length=552

 Score =   309 bits (791),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 159/372 (43%), Positives = 226/372 (61%), Gaps = 18/372 (5%)
 Frame = +1

Query  463   VVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKK  642
             V   ++ +   N TV       N S    D +F   +     N + + KNV +     +K
Sbjct  63    VAPSISSYVLPNVTVSNL---SNSSPSTLDSNFTTLRAPAPENLTAVTKNVTY-----EK  114

Query  643   GDGSGKNGGFSLEG----ETVKSEGSENGDRS-----RSRGVGVEISKKGTSSTVKNDMI  795
              +   KN  F  +     E +    ++ GD +     + R V   +S+    ++  +   
Sbjct  115   TEPVAKNNTFQFKTDHAQENISCPDNKAGDDTARDLDKHRPVKAPLSEVLAVNSTASPKR  174

Query  796   GENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVK  975
              +     LRK      +C+ F+G+WVRDD+ P Y PGSC  ID  F+C L+ RPD  + K
Sbjct  175   KQRRKSSLRKEIESLKNCEFFEGDWVRDDSYPLYKPGSCNLIDEQFNCILNGRPDVEFQK  234

Query  976   WRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEIS  1155
              +W+P  C++P  N    LE +RG++LVFVGDSLNRNMWESLVCIL+  VRD+ ++FE  
Sbjct  235   LKWKPKKCNLPRLNGGKLLEMIRGRRLVFVGDSLNRNMWESLVCILKGSVRDETQIFEAH  294

Query  1156  GRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYN  1332
             GR  F+ +  Y+F F+DYNC+V+F +SPFLVRE      NG+  ETLRLDL+ K++  Y 
Sbjct  295   GRHQFRWEAEYSFVFKDYNCTVEFYASPFLVREWEIMDKNGTKKETLRLDLVGKSSEQYK  354

Query  1333  DADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANR  1512
              ADI++FNTGHWWTH+KTS+GEDYYQEG+ V+P+L+V EA+++AL TW RWVDKNV+  +
Sbjct  355   GADILVFNTGHWWTHDKTSKGEDYYQEGSNVYPKLDVDEAFRKALTTWGRWVDKNVNPKK  414

Query  1513  TEVIFRGYSATH  1548
             + V FRGYS +H
Sbjct  415   SLVFFRGYSPSH  426



>ref|XP_011039468.1| PREDICTED: protein trichome birefringence-like [Populus euphratica]
Length=619

 Score =   311 bits (796),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 203/305 (67%), Gaps = 12/305 (4%)
 Frame = +1

Query  637   KKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSEL  816
             K G    KN G   +G+ VKS  S        +   V      T S V            
Sbjct  207   KSGPFVKKNSGDQEKGDAVKSVASNFTASYLKKQSNVTKQSNETDSGVD-----------  255

Query  817   LRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHA  996
             +++G     +CD FDG+WV+DD+ P Y PGSC  ID  F+C L+ RPD  Y K++W+P  
Sbjct  256   VKQGIDDLVNCDFFDGKWVKDDSYPLYKPGSCSLIDEQFNCILNGRPDKDYQKYKWKPKG  315

Query  997   CDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKK  1176
             C +P  N    L+ LRG++LVFVGDSLNRNMWESLVCIL+  V+D+ +VFE++GR  F+ 
Sbjct  316   CTLPRLNPGHMLDMLRGKRLVFVGDSLNRNMWESLVCILKSSVKDQSKVFEVNGRLHFRG  375

Query  1177  KGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIF  1353
             +  Y+F F+DYNC+V+F  SPFLV+E      +GS  ETLRLDL+ +++S Y DAD+++F
Sbjct  376   EASYSFVFKDYNCTVEFFVSPFLVQEWELPEKDGSKKETLRLDLVGRSSSQYKDADVIVF  435

Query  1354  NTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRG  1533
             NTGHWWTH+KTS+G+DYYQEG+ V+  L VLEA+++AL TWARWVD NV+  ++ V+FRG
Sbjct  436   NTGHWWTHDKTSKGKDYYQEGSHVYGELNVLEAFRKALTTWARWVDANVNPTKSLVLFRG  495

Query  1534  YSATH  1548
             YSA+H
Sbjct  496   YSASH  500



>ref|XP_011005287.1| PREDICTED: protein trichome birefringence-like [Populus euphratica]
Length=624

 Score =   311 bits (796),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/300 (50%), Positives = 200/300 (67%), Gaps = 15/300 (5%)
 Frame = +1

Query  682   GETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSF--------  837
             G  VK EGS N D+      G  +S   T+S V         S     G+          
Sbjct  209   GSLVK-EGSGNQDKV---DAGKTVSSNFTASLVNKQSNATKQSNETNSGKEAKQGFDNRV  264

Query  838   --YSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPS  1011
                ++CD FDGEWV+DD+ P Y PGSC  ID  F+C ++ RPD  Y K++W+P  C +P 
Sbjct  265   QNLANCDFFDGEWVKDDSYPLYKPGSCSLIDEQFNCIINGRPDKDYQKYKWKPKGCTLPR  324

Query  1012  FNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYA  1191
              N    L+ LRG++LVFVGDSLNRNMWESLVCIL+  V+D+ +VFE++GR  F+ +  Y+
Sbjct  325   LNPRHMLDMLRGKRLVFVGDSLNRNMWESLVCILKGSVKDQSKVFEVNGRHHFRGEASYS  384

Query  1192  FRFEDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHW  1368
             F F+DYNC+++F  SPFLV+E      +GS  ETLRLDL+ +++S Y  ADI++FNTGHW
Sbjct  385   FLFKDYNCTIEFFVSPFLVQEWEMHEKDGSMKETLRLDLVGRSSSQYKSADIIVFNTGHW  444

Query  1369  WTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             WTH+KTS+G+DYYQEG+ V+  L VLEA+++AL TWARWVD NVD  ++ V FRGYSA+H
Sbjct  445   WTHDKTSKGKDYYQEGSHVYNELNVLEAFRKALTTWARWVDANVDPMKSLVFFRGYSASH  504



>ref|XP_004249181.1| PREDICTED: protein trichome birefringence [Solanum lycopersicum]
Length=691

 Score =   312 bits (800),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 167/359 (47%), Positives = 230/359 (64%), Gaps = 25/359 (7%)
 Frame = +1

Query  514   SPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETV  693
             S P  N S  A   S GL +++  +      K+     F +K G+         LE  + 
Sbjct  225   SKPTVNVSAVAPKSSSGLNQESSSVKNQPKSKD-----FDDKVGNLKANQSKNPLEKSSA  279

Query  694   K-SEGSENGDRSRSRGVGVEISKKG-----TSSTVKNDMIGENGSELLRKGR-----SFY  840
               ++ +++G  S+ +    EI++KG     TSS+VK+   G N     +K +        
Sbjct  280   SVNQTAKSGSESKEK----EIAEKGVKGNFTSSSVKSQSDGTNLDVSTKKKKDEDLVKSL  335

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
              +CD FDG WV+D++ P Y PGSC  ID  F+C L+ RPD+ ++K +W+P+ C +P  N 
Sbjct  336   LNCDFFDGNWVKDESYPLYKPGSCSLIDEQFNCFLNGRPDNNHMKMKWKPNGCTLPRLNG  395

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
             T  LE LRG++LVFVGDSLNRNMWESLVCILR+ V+D+K+V+E SGR  F+ +  Y+F F
Sbjct  396   THMLELLRGKRLVFVGDSLNRNMWESLVCILRNSVKDQKKVYEESGRQHFRTEASYSFLF  455

Query  1201  EDYNCSVDFVSSPFLVRE---SSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWW  1371
             E+YN  V+F  SPFLV+E   S  KGV    ETLRLDL+ ++   Y +ADI+IFNTGHWW
Sbjct  456   EEYNFRVEFFVSPFLVQEWEYSDKKGVKK--ETLRLDLIGQSADKYKNADILIFNTGHWW  513

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             THEKTS G+DYYQEG+ V+  L+VLEA+++AL TW RWVD +V+  RT V+FRGYSA+H
Sbjct  514   THEKTSLGKDYYQEGSHVYNELDVLEAFRKALTTWGRWVDSHVNPKRTFVLFRGYSASH  572



>ref|XP_007204224.1| hypothetical protein PRUPE_ppa002919mg [Prunus persica]
 gb|EMJ05423.1| hypothetical protein PRUPE_ppa002919mg [Prunus persica]
Length=621

 Score =   310 bits (794),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 191/272 (70%), Gaps = 18/272 (7%)
 Frame = +1

Query  736   GVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCP  915
             GV V+  K+G    VK+ M                 +CDI  GEWV+DD+ P Y PGSCP
Sbjct  242   GVSVKKGKQGNDDLVKSLM-----------------NCDILHGEWVKDDSYPLYKPGSCP  284

Query  916   FIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWE  1095
              ID  F+C L+ RPD  + K++W+P  C +P  + +  LE LRG++ VFVGDSLNRNMWE
Sbjct  285   LIDEQFNCILNGRPDKDFQKFKWKPKDCTLPRLDGSHMLELLRGKRFVFVGDSLNRNMWE  344

Query  1096  SLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVN  1275
             SLVCILR+  +DK +VFE +GR+ F+ +  Y+F F+DYNC+V+F  SPFLVRE      +
Sbjct  345   SLVCILRNSAKDKSKVFEANGRTHFRGEASYSFIFKDYNCTVEFFVSPFLVREWEMPEKD  404

Query  1276  GS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEA  1452
             GS  ETLRLDL+ +++ +Y DADIVIFNTGHWWTHEKTS+G+DYYQEG+ V+  L VLEA
Sbjct  405   GSKRETLRLDLVGRSSDLYKDADIVIFNTGHWWTHEKTSKGKDYYQEGSHVYGELNVLEA  464

Query  1453  YKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +++AL TWARWVD  ++  ++ V FRGYSA+H
Sbjct  465   FRKALTTWARWVDAKINPRKSIVFFRGYSASH  496



>ref|XP_004249290.1| PREDICTED: protein trichome birefringence-like [Solanum lycopersicum]
Length=578

 Score =   308 bits (790),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 205/309 (66%), Gaps = 12/309 (4%)
 Frame = +1

Query  646   DGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRK  825
             DG  K    S EG   KS  + N  +SR     V I K   S      +  +  S  + K
Sbjct  156   DGIFKANQSSTEGS--KSVAAVNQTKSRDFDDKVGILKGNESKKTAPKLSSKGKSANVEK  213

Query  826   GRSF-----YSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRP  990
              R         +CD FDG WV+D++ P Y PGSC  ID  F+C L+ R D+ Y+K +W+P
Sbjct  214   KRDVDLVKSLLNCDFFDGNWVKDESYPLYKPGSCSLIDEQFNCFLNDRLDNGYLKMKWKP  273

Query  991   HACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDF  1170
             +AC +P  NAT  LE LRG++LVFVGDSLNRNMWESL+CILR+ V++KK+V+E SGR  F
Sbjct  274   NACSLPRLNATHMLELLRGKRLVFVGDSLNRNMWESLICILRNSVKNKKKVYEESGRHHF  333

Query  1171  KKKGFYAFRFEDYNCSVDFVSSPFLVRE---SSFKGVNGSFETLRLDLMDKTTSMYNDAD  1341
             + + FY+F FE+Y C V+F  SPFLV++   +  KG  G  ETLRLDL+ ++   Y DAD
Sbjct  334   RTEAFYSFIFEEYKCRVEFFVSPFLVQQWEVADKKG--GKKETLRLDLIGESADKYKDAD  391

Query  1342  IVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEV  1521
             +++FNTGHWWTHEKTS G+DYYQEGN V+  L VLEA++RAL TW RW+D +++  +T V
Sbjct  392   VLVFNTGHWWTHEKTSLGKDYYQEGNHVYNELNVLEAFRRALTTWGRWIDAHINPKKTFV  451

Query  1522  IFRGYSATH  1548
             +FRGYSA+H
Sbjct  452   LFRGYSASH  460



>gb|EYU17992.1| hypothetical protein MIMGU_mgv1a025478mg [Erythranthe guttata]
Length=485

 Score =   306 bits (783),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/330 (47%), Positives = 214/330 (65%), Gaps = 21/330 (6%)
 Frame = +1

Query  568   WKKTHELNRSEIGKNVNFTGFTEKKGDGSGKNGGFS--LEGETVKSEGSENGDRSRSRGV  741
             W K    NRS++           ++     K+  F+  L    V S GS N   S     
Sbjct  56    WFKNVIKNRSQLSSYFPHHNHLSQQNLSRAKDSVFNPELNQSRVSSNGSRNATLS-----  110

Query  742   GVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFI  921
                   +G S+  K     +   EL+ K       CD+FDG+WVRD++ P+Y PGSCPFI
Sbjct  111   ------EGKSTAAKKKKKKKRWVELMSK-------CDVFDGKWVRDNSPPFYEPGSCPFI  157

Query  922   DRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESL  1101
             D  F+C+L+ RPD  Y K RW+P+ C++P F+    L  L+G+++V+VGDSLNRNM+ES+
Sbjct  158   DESFNCYLNGRPDTGYEKLRWQPNHCNVPRFDGGKMLRFLKGKRIVYVGDSLNRNMYESM  217

Query  1102  VCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS  1281
             VC+LR+ V+DK RVFE SG+ +FKK+G Y+F F DYN SV+++ S FLV+E      NGS
Sbjct  218   VCLLRNSVKDKSRVFEASGKQEFKKEGTYSFLFPDYNVSVEYIRSAFLVQEWEMPIENGS  277

Query  1282  F-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYK  1458
               ETLRLD ++K+  +Y DAD+++FNTG+WWTHEKTS G+ YYQEG+ VH +L+V+EA+ 
Sbjct  278   TKETLRLDRVEKSYDLYKDADVLVFNTGNWWTHEKTSEGKGYYQEGDHVHEKLDVVEAFD  337

Query  1459  RALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +A+ TWARWV+ NVD  +T V FRGYS +H
Sbjct  338   KAMSTWARWVESNVDPKKTRVFFRGYSFSH  367



>emb|CDO98793.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   305 bits (781),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 184/247 (74%), Gaps = 1/247 (0%)
 Frame = +1

Query  811   ELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRP  990
             E +    +  S CDIFDG W+ DD++P Y PGSCPFID  F+C  + RPD  Y++ RW+P
Sbjct  108   ETVATHENIISSCDIFDGNWILDDSEPLYRPGSCPFIDDAFNCFKNGRPDSDYLRLRWKP  167

Query  991   HACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDF  1170
             H C+IP F+    L+ L G++LVFVGDSLNRNMWESLVC LR  + +   V+E+SGR +F
Sbjct  168   HGCEIPRFDGLKMLKMLSGKRLVFVGDSLNRNMWESLVCALRGSLGNTSNVYEVSGRREF  227

Query  1171  KKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIV  1347
             + +GFY+F+F+D+N SVDF+ SPFLV+E       G   ETLRLD++  +++ Y+DADI+
Sbjct  228   RTEGFYSFKFQDFNLSVDFIKSPFLVQEWKLTTKAGMRRETLRLDMIQASSTKYHDADII  287

Query  1348  IFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIF  1527
             IFNTGHWWTH KTS+G +Y+QEGNRV+  L V +A+ +AL TWARWVD N+++++T V F
Sbjct  288   IFNTGHWWTHHKTSKGNNYFQEGNRVYNTLGVTDAFTKALKTWARWVDSNINSSQTTVFF  347

Query  1528  RGYSATH  1548
             RGYSA+H
Sbjct  348   RGYSASH  354



>ref|XP_009611858.1| PREDICTED: protein trichome birefringence-like [Nicotiana tomentosiformis]
Length=648

 Score =   310 bits (794),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 202/299 (68%), Gaps = 21/299 (7%)
 Frame = +1

Query  661   NGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFY  840
             NG    E E VKS  + +  + +S    +++S K     +   ++               
Sbjct  249   NGSKEKEIEGVKSNFTSSFVKKQSNETNLDVSAKNKDGDLVKSLL---------------  293

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
              DCD FDG WV+D++ P Y PGSC  ID  F+C L+ RPD  Y+K +W+P+AC +P  N 
Sbjct  294   -DCDFFDGNWVKDESYPLYKPGSCSLIDEQFNCFLNGRPDSNYIKMKWKPNACTLPRLNG  352

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
             T  LE LRG++LVFVGDSLNRNMWESLVCILR+ V+D+K+V+E  GR  F+ +  Y+F F
Sbjct  353   THMLELLRGKRLVFVGDSLNRNMWESLVCILRNSVKDQKKVYEEFGRHHFRTEASYSFLF  412

Query  1201  EDYNCSVDFVSSPFLVRESSF---KGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWW  1371
             E+Y+C V+F  SPFLV+E  F   KGV    ETLRLDL+ ++   Y +ADI+IFNTGHWW
Sbjct  413   EEYDCRVEFFVSPFLVQEWEFADKKGVKK--ETLRLDLIGQSADKYKNADILIFNTGHWW  470

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             THEKTS G+DYYQEG+ V+  L+VLEA+++AL TW RWVD +V++ +T V+FRGYSA+H
Sbjct  471   THEKTSLGKDYYQEGSHVYSELDVLEAFRKALTTWGRWVDSHVNSQKTFVLFRGYSASH  529



>ref|XP_010464957.1| PREDICTED: protein trichome birefringence-like 1 [Camelina sativa]
Length=547

 Score =   306 bits (784),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 224/374 (60%), Gaps = 15/374 (4%)
 Frame = +1

Query  457   NPVVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTE  636
             +P+    +   Y    V  +    +      D +F  ++     N + + KNV F     
Sbjct  59    SPITVAPSISSYVLPNVTVTNLSNSSPSSTLDSNFTTFRAPSPENLAAVTKNVTF-----  113

Query  637   KKGDGSGKNGGFSLEG----ETVKSEGSENGDRS-----RSRGVGVEISKKGTSSTVKND  789
             +K +   KN  F  +     E +    ++ GD +     + R     +S+    ++  + 
Sbjct  114   EKTEPVAKNNTFHFKTDHAKENISCPDNKTGDDTVRDLDKQRARRPPLSEVLAVNSTASP  173

Query  790   MIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAY  969
                +     +RK      DC+ F+G+WVRDD+ P Y PGSC  ID  F+C L+ RPD  +
Sbjct  174   KRKQRRKSSMRKEIESLKDCEFFEGDWVRDDSYPLYKPGSCNLIDEQFNCILNGRPDVEF  233

Query  970   VKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFE  1149
              K +W+P  C +P  N    LE +RG++LVFVGDSLNRNMWESLVCIL+  VRD+ ++FE
Sbjct  234   QKLKWKPKKCTLPRLNGGKLLEMIRGRRLVFVGDSLNRNMWESLVCILKGSVRDESQIFE  293

Query  1150  ISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSM  1326
               GR  F+ +  Y+F F+DYNC+V+F +SPFLVRE      NG+  ETLRLDL+ K++  
Sbjct  294   AHGRHQFRWEAEYSFVFKDYNCTVEFYASPFLVREWEIMDKNGTKKETLRLDLVGKSSEQ  353

Query  1327  YNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDA  1506
             Y  ADI++FNTGHWWTH+KTS+GEDYYQEG+ V+P+L+V EA+++AL TW RWVDKNV+ 
Sbjct  354   YKGADILVFNTGHWWTHDKTSKGEDYYQEGSNVYPKLDVDEAFRKALTTWGRWVDKNVNP  413

Query  1507  NRTEVIFRGYSATH  1548
              ++ V FRGYS +H
Sbjct  414   KKSLVFFRGYSPSH  427



>ref|XP_009375160.1| PREDICTED: protein trichome birefringence-like [Pyrus x bretschneideri]
Length=454

 Score =   303 bits (775),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 149/296 (50%), Positives = 197/296 (67%), Gaps = 2/296 (1%)
 Frame = +1

Query  667   GFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFY-S  843
             GFS + E  +   S   D     G  V ++ K +    +     E  S   + G  F   
Sbjct  34    GFSGKLEGSRKNESFGKDSDGVLGQAVALTSKKSDDANEALSESEKQSSQTQPGFEFSRD  93

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             DCD+FDG WVRDD+ P Y PGSCP ID  F+C L+KRPD+ Y K+RW+P  C++P  +  
Sbjct  94    DCDLFDGMWVRDDSYPLYAPGSCPLIDESFNCFLNKRPDNRYEKYRWQPKLCNLPRLDGK  153

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
             + L  LRG++LVFVGDSLNRNMWESL+C+LR+ V DK  V E  GRS+F+ +G Y+  F+
Sbjct  154   NMLGLLRGKRLVFVGDSLNRNMWESLLCLLRNSVDDKSGVVEALGRSEFRSEGSYSIVFK  213

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             +YNCSV+F  SPFLV+E      NGS  ETLRLDL+++++  Y  AD++IFNTGHWWTHE
Sbjct  214   EYNCSVEFFRSPFLVQEWEMADANGSIKETLRLDLIERSSDKYKTADVLIFNTGHWWTHE  273

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTSRG+ YYQEG+ ++  L V EA+++AL TWARWVD N++  +T V FR YS  H
Sbjct  274   KTSRGKGYYQEGSYIYDVLNVKEAFRKALTTWARWVDTNLNPEKTIVFFRAYSPNH  329



>ref|XP_007162340.1| hypothetical protein PHAVU_001G143600g [Phaseolus vulgaris]
 gb|ESW34334.1| hypothetical protein PHAVU_001G143600g [Phaseolus vulgaris]
Length=633

 Score =   308 bits (789),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/301 (48%), Positives = 203/301 (67%), Gaps = 2/301 (1%)
 Frame = +1

Query  652   SGKNGGFSLEGETVKSEGSENGDRSRSRGV-GVEISKKGTSSTVKNDMIGENGSELLRKG  828
             S  N   S   + V  + S +    ++  V GV  +   T+S  +  + G++ ++   + 
Sbjct  214   SATNVSVSFPVQEVPHQNSSSNSSVKADSVKGVASNDNYTASLARKHINGKSHAKGNDES  273

Query  829   RSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIP  1008
                   CD FDG+WV+D + P Y PGSC  +D  F+C  + RPD  Y+ ++W+P  C +P
Sbjct  274   MESLMKCDFFDGKWVKDGSYPLYKPGSCSLVDEQFNCIRNGRPDKEYLTYKWKPKGCSLP  333

Query  1009  SFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFY  1188
               NA   LE LRG+KLVFVGDSLNRNMWESL+CIL+  V+DKK+V+E +GR  F+ +  Y
Sbjct  334   RLNAHRMLELLRGKKLVFVGDSLNRNMWESLICILKSAVKDKKKVYEANGRVHFRGEASY  393

Query  1189  AFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGH  1365
             +F F+DY+ SV+   SPFLV+E      NG+  ETLRLDL+ +++S Y DADI+IFNTGH
Sbjct  394   SFIFKDYHFSVELFVSPFLVQEGEMTDKNGTKKETLRLDLVGQSSSQYKDADIIIFNTGH  453

Query  1366  WWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSAT  1545
             WWTH+KTS+G+DYYQEG+ V+  L VLEA++RAL TW+RWVD N++ ++T V FRGYSA+
Sbjct  454   WWTHDKTSKGQDYYQEGSHVYSELNVLEAFRRALTTWSRWVDANINPSKTVVFFRGYSAS  513

Query  1546  H  1548
             H
Sbjct  514   H  514



>ref|XP_011075105.1| PREDICTED: protein trichome birefringence-like [Sesamum indicum]
Length=616

 Score =   307 bits (787),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/296 (50%), Positives = 203/296 (69%), Gaps = 15/296 (5%)
 Frame = +1

Query  697   SEGSENGDRSRSRGVGVEISKKG-----TSSTVK------NDMIGENGSELLRKGRSFYS  843
             S  S +G+++ S    V I++KG     TSS +K      ND  G+ G   L K      
Sbjct  210   SPNSTSGEKNVSGNGQVGIAEKGMVKNLTSSLMKKQNNGTNDSAGKQGIADLIKS---LM  266

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             +CD+FDG WV+DD+ P Y PGSC  ID  F+C L+ RPD+ Y K +W+P  C +P  + +
Sbjct  267   NCDLFDGNWVKDDSYPLYNPGSCSLIDEQFNCFLNGRPDNGYHKLKWKPKGCTLPRLDGS  326

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               LE LRG++LVFVGDSLNRNMWESL+CILR+ V+D+ +V+E  GR  F+ +  Y+F FE
Sbjct  327   HMLELLRGKRLVFVGDSLNRNMWESLICILRNSVKDQNKVYEEFGRHHFRAEASYSFVFE  386

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             +Y C+V+F  +PFLV+E    G NG+  ETLRLDL+ ++   Y +ADI++FNTGHWWTHE
Sbjct  387   EYKCTVEFFVAPFLVQEWEVAGKNGTTKETLRLDLISRSADKYKNADIIVFNTGHWWTHE  446

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS G+DYYQEG+ ++  L VLEA+++AL TW RW+D N++  ++ V FRGYSA+H
Sbjct  447   KTSTGKDYYQEGSHIYKDLNVLEAFRKALTTWGRWIDANINPMKSLVFFRGYSASH  502



>ref|XP_006351352.1| PREDICTED: uncharacterized protein LOC102598735 isoform X2 [Solanum 
tuberosum]
Length=656

 Score =   308 bits (789),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 204/304 (67%), Gaps = 23/304 (8%)
 Frame = +1

Query  685   ETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSF---------  837
             E+ KS  + N   SR     V I K   S+  K     ++  +L  KG+S          
Sbjct  242   ESYKSAAAVNQTESRDFDDKVGIFKANQSTIEK-----KSAPKLSSKGKSANVEKKRDVD  296

Query  838   ----YSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDI  1005
                   +CD FDG WV+D++ P Y PGSC  ID  F+C L+ RPD  Y+K +W+P+AC +
Sbjct  297   LVKSLLNCDFFDGNWVKDESYPLYKPGSCSLIDEQFNCFLNDRPDSGYLKMKWKPNACSL  356

Query  1006  PSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGF  1185
             P  NAT  LE LRG++LVFVGDSLNRNMWESL+CIL++ V+++K+V+E SGR  F+ + F
Sbjct  357   PRLNATHMLELLRGKRLVFVGDSLNRNMWESLICILKNSVKNQKKVYEESGRHHFRTEAF  416

Query  1186  YAFRFEDYNCSVDFVSSPFLVRE---SSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFN  1356
             Y+F F++Y C V+F  SPFLV++   +  KG  G  ETLRLDL+ ++   Y +ADI++FN
Sbjct  417   YSFIFKEYKCRVEFFVSPFLVQQWEVADKKG--GKKETLRLDLIGESADKYKNADILVFN  474

Query  1357  TGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGY  1536
             TGHWWTHEKTS G+DYYQEGN VH  L VLEA++RAL TW RW+D +++  +T V+FRGY
Sbjct  475   TGHWWTHEKTSLGKDYYQEGNHVHNELNVLEAFRRALTTWGRWIDAHINPKKTFVLFRGY  534

Query  1537  SATH  1548
             SA+H
Sbjct  535   SASH  538



>ref|XP_008352661.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=563

 Score =   305 bits (782),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 196/296 (66%), Gaps = 2/296 (1%)
 Frame = +1

Query  667   GFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSF-YS  843
             GFS + E  +   S   D     G  V ++ K +    +     E  S   + G  F   
Sbjct  143   GFSGKLEGSRKNESFAKDSDGVLGQAVALTSKESDDASEALSESEKQSNQTQPGYEFSXD  202

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             DCD+FDG WVRDD+ P Y PGSCP ID  F+C L+KRPD+ Y K+RW+P  C+ P  +  
Sbjct  203   DCDLFDGMWVRDDSYPLYAPGSCPLIDESFNCFLNKRPDNRYEKYRWQPKHCNJPRLDGK  262

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
             + L  LRG++LVFVGDSLNRNMWESL+C+LR+ V DK  V E  GRS+F+ +G Y+F F+
Sbjct  263   NMLGLLRGKRLVFVGDSLNRNMWESLLCLLRNSVDDKSGVVEALGRSEFRSEGSYSFVFK  322

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             +YNCSV+F  SPFLV+E      NGS  ETLRLDL++ ++  Y  AD++IFNTGHWWTHE
Sbjct  323   EYNCSVEFFRSPFLVQEWEMADANGSIKETLRLDLIEXSSDKYKTADVLIFNTGHWWTHE  382

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTSRG+ YYQEG+ ++  L V EA++ AL TWARWVD N++  +T V FRG+S  H
Sbjct  383   KTSRGKGYYQEGSYIYDVLNVKEAFRXALTTWARWVDTNINPEKTIVFFRGFSPNH  438



>ref|XP_006399144.1| hypothetical protein EUTSA_v10012993mg [Eutrema salsugineum]
 gb|ESQ40597.1| hypothetical protein EUTSA_v10012993mg [Eutrema salsugineum]
Length=613

 Score =   306 bits (785),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 161/363 (44%), Positives = 225/363 (62%), Gaps = 20/363 (6%)
 Frame = +1

Query  493   RNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTG---FTEKKGDGSGKN  663
             RN T+    PE N +  AK+ +F    K+  +NR+      N +      +K   GS   
Sbjct  141   RNGTLQAPAPE-NLTPIAKNSTF----KSPIVNRTNPVAKTNTSSHPLLPDKSPTGSSNQ  195

Query  664   GGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSS--TVKNDMIGENG-----SELLR  822
                SL  +  +++ +     S++  V V ++   +SS  +      G  G      + + 
Sbjct  196   ---SLTTDAARNQKTAAPAPSKA-PVSVNLTANSSSSAPSTPEKQTGNGGLVTSVKQEME  251

Query  823   KGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACD  1002
             K      DC+ FDGEW++DD+ P Y PGSC  ID  F+C  + RPD  + K +W+P  C 
Sbjct  252   KWSESLKDCEFFDGEWIKDDSYPLYKPGSCKLIDEQFNCISNGRPDKGFQKLKWKPKKCS  311

Query  1003  IPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKG  1182
             +P  N    LE LRG++LVFVGDSLNRNMWESLVCIL+  V+D+ +V+E SGR  F+ + 
Sbjct  312   LPRLNGGILLEMLRGRRLVFVGDSLNRNMWESLVCILKGSVKDESKVYEASGRHHFRGEA  371

Query  1183  FYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNT  1359
              Y+F F+DYNC+V+F  SPFLV+E+      G+  ETLRLDL+ K++  Y  ADI+IFNT
Sbjct  372   EYSFVFQDYNCTVEFFVSPFLVQETEIVDKKGTKKETLRLDLVGKSSEQYKGADIIIFNT  431

Query  1360  GHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYS  1539
             GHWWTHEKTS+GEDYYQEG+ V+  L VLEA+++AL TW RWV+KNV+ +++ V FRGYS
Sbjct  432   GHWWTHEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPDKSLVFFRGYS  491

Query  1540  ATH  1548
             A+H
Sbjct  492   ASH  494



>ref|XP_008443032.1| PREDICTED: protein trichome birefringence [Cucumis melo]
Length=614

 Score =   306 bits (785),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 179/236 (76%), Gaps = 1/236 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             +CD FDGEWV DD+ P Y PGSC  ID  F+CHL+ RPD  Y K+RW+P  CD+P  +  
Sbjct  264   NCDFFDGEWVLDDSYPLYKPGSCLLIDEQFNCHLNGRPDKNYEKFRWKPKKCDLPRLDGG  323

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               L+ L+G++LVFVGDSLNRNMWESLVCILR+ V+D+  VFE  G+  F+ +  Y+F F+
Sbjct  324   RMLDLLKGKRLVFVGDSLNRNMWESLVCILRNSVKDQSNVFEAHGKQVFRGEAAYSFIFK  383

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             DYN +V+F  SPFLVRE      NG + ETLRLDL+ K++  Y +ADI++FNTGHWWTHE
Sbjct  384   DYNFTVEFFVSPFLVREWEMPDKNGKTKETLRLDLVGKSSDQYKEADIIVFNTGHWWTHE  443

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTSRG+DYYQEG+ V+  L VLEA+++A+ TWARWVDKN++  ++ V FRGYSA+H
Sbjct  444   KTSRGKDYYQEGSHVYEELNVLEAFRKAITTWARWVDKNINPMKSIVFFRGYSASH  499



>ref|XP_010520026.1| PREDICTED: protein trichome birefringence-like [Tarenaya hassleriana]
Length=649

 Score =   307 bits (787),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/252 (55%), Positives = 187/252 (74%), Gaps = 1/252 (0%)
 Frame = +1

Query  796   GENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVK  975
             G +  E + K +    +CD FDG WV+D++ P Y PGSC  ID+ F+C L+ RPD  + K
Sbjct  279   GSSVKEEIEKWKESLKNCDFFDGGWVKDESYPLYKPGSCNLIDQQFNCILNGRPDKDFQK  338

Query  976   WRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEIS  1155
              +W+P  CD+P  N    LE +RG++LVFVGDSLNRNMWESLVCILR  V+D+ +VFE +
Sbjct  339   LKWKPKKCDLPRLNGAHLLEMIRGRRLVFVGDSLNRNMWESLVCILRGSVKDQSKVFEAN  398

Query  1156  GRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYN  1332
             GR  F+ +  Y+F F+DY+C+V+F  SPFLV+E      NG+  ETLRLDL+ +++  Y 
Sbjct  399   GRHHFRGEAEYSFVFKDYDCTVEFYVSPFLVQEWEVVDKNGTKKETLRLDLVGRSSEQYK  458

Query  1333  DADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANR  1512
              ADI+IFNTGHWWTHEKTS+GEDYYQEG+ V+  L VLEA+++AL TW+RWVDKNV+ ++
Sbjct  459   GADIIIFNTGHWWTHEKTSKGEDYYQEGSHVYGELNVLEAFRKALTTWSRWVDKNVNPDK  518

Query  1513  TEVIFRGYSATH  1548
             + V+FRGYSA+H
Sbjct  519   SLVLFRGYSASH  530



>ref|XP_002323329.2| hypothetical protein POPTR_0016s05930g [Populus trichocarpa]
 gb|EEF05090.2| hypothetical protein POPTR_0016s05930g [Populus trichocarpa]
Length=592

 Score =   306 bits (783),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 185/245 (76%), Gaps = 1/245 (0%)
 Frame = +1

Query  817   LRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHA  996
             +++G     +CD FDG+WV+DD+ P Y PGSC  ID  F+C L+ RPD  Y K++W+P  
Sbjct  229   VKQGIDDLVNCDFFDGKWVKDDSYPLYKPGSCSLIDEQFNCILNGRPDKDYQKYKWKPKG  288

Query  997   CDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKK  1176
             C +P  N    L+ LRG++LVFVGDSLNRNMWESLVCIL+  V+D+ +VFE++GR  F+ 
Sbjct  289   CTLPRLNPGHMLDMLRGKRLVFVGDSLNRNMWESLVCILKSSVKDQSKVFEVNGRVHFRG  348

Query  1177  KGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIF  1353
             +  Y+F F+DYNC+V+F  SPFLV+E      +GS  ETLRLDL+ +++S Y  AD+++F
Sbjct  349   EASYSFLFKDYNCTVEFFVSPFLVQEWELPEKDGSKKETLRLDLVGRSSSQYKGADVIVF  408

Query  1354  NTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRG  1533
             NTGHWWTH+KTS+G+DYYQEG+ V+  L VLEA+++AL TWARWVD NV+  ++ V+FRG
Sbjct  409   NTGHWWTHDKTSKGKDYYQEGSHVYDELNVLEAFRKALTTWARWVDANVNPMKSLVLFRG  468

Query  1534  YSATH  1548
             YSA+H
Sbjct  469   YSASH  473



>ref|XP_002882764.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59023.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=559

 Score =   305 bits (780),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 162/384 (42%), Positives = 225/384 (59%), Gaps = 14/384 (4%)
 Frame = +1

Query  427   LNFSFKAPFFNPVVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIG  606
             L FS  +P    +   ++ +   N TV  SP   N      D +F         N + + 
Sbjct  54    LAFS-PSPITVAIAPSISSYILPNITVSNSP---NSPASTLDSNFTTLPTPAPENLTAVT  109

Query  607   KNVNF-TGFTEKKGDGSGKNGGFSLEGETVKSEGS--ENGDRSRSRGVGVEISKKGTSST  777
             KNV F +       D +  +  F  + +  K   S  +N     +R +    ++K   S 
Sbjct  110   KNVTFESPIANGTTDPTATDNTFQFKTDHAKENISCPDNKTDVTARDLDKHGARKAPLSE  169

Query  778   V------KNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDC  939
             V       + M  +     LRK       C+ F+G+WV+DD+ P Y PGSC  ID  F+C
Sbjct  170   VLAVNSSASQMRKQRRKSSLRKVIESLKSCEFFEGDWVKDDSYPLYKPGSCNLIDEQFNC  229

Query  940   HLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRH  1119
               + RPD  + K +W+P  C +P  N    LE +RG++LVFVGDSLNRNMWESLVCIL+ 
Sbjct  230   ISNGRPDVDFQKLKWKPKKCSLPRLNGGKLLEMIRGKRLVFVGDSLNRNMWESLVCILKG  289

Query  1120  VVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLR  1296
              V+D+ +VFE  GR  F+ +  Y+F F+DYNC+V+F + PFLV+E      NG+  ETLR
Sbjct  290   SVKDESQVFEAHGRHQFRWEAEYSFVFKDYNCTVEFFALPFLVQEWEVTENNGTKKETLR  349

Query  1297  LDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTW  1476
             LDL+ K++  Y  ADI++FNTGHWWTHEKTS+GEDYYQEG+ VHP+L+V EA+++AL TW
Sbjct  350   LDLVGKSSEQYKGADILVFNTGHWWTHEKTSKGEDYYQEGSNVHPKLDVDEAFRKALTTW  409

Query  1477  ARWVDKNVDANRTEVIFRGYSATH  1548
              RWVDKNV+  ++ V FRGYS +H
Sbjct  410   GRWVDKNVNPKKSLVFFRGYSPSH  433



>ref|XP_003520540.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN07442.1| hypothetical protein glysoja_012740 [Glycine soja]
Length=622

 Score =   306 bits (784),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 178/235 (76%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD FDGEWV+DD  P Y P SC  ID  F+C  + RPD  Y K++W+P  C +P  +A  
Sbjct  269   CDFFDGEWVKDDAYPLYKPDSCSLIDEQFNCIRNGRPDKDYQKYKWKPKGCTLPRLDAHR  328

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              L+ LRG++LVFVGDSLNRNMWESL+CILR+ V++K  V+E++GR +F+ +  Y+F FED
Sbjct  329   MLQLLRGKRLVFVGDSLNRNMWESLICILRNAVKNKHNVYEVNGRVNFRGEAAYSFVFED  388

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             Y+ SV+   SPFLV+E      NG+  ETLRLDL+ K++S Y DADI++FNTGHWWTH+K
Sbjct  389   YHFSVELFVSPFLVQEGEMTDKNGTKKETLRLDLVGKSSSQYKDADILVFNTGHWWTHDK  448

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS+G+DYYQEGN V+  L VLEA++RAL TW+RWVD N++ ++T V FRGYSA+H
Sbjct  449   TSKGQDYYQEGNHVYSELNVLEAFRRALTTWSRWVDANINPSKTTVFFRGYSASH  503



>ref|XP_006351351.1| PREDICTED: uncharacterized protein LOC102598735 isoform X1 [Solanum 
tuberosum]
Length=713

 Score =   308 bits (790),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 182/238 (76%), Gaps = 5/238 (2%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             +CD FDG WV+D++ P Y PGSC  ID  F+C L+ RPD  Y+K +W+P+AC +P  NAT
Sbjct  360   NCDFFDGNWVKDESYPLYKPGSCSLIDEQFNCFLNDRPDSGYLKMKWKPNACSLPRLNAT  419

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               LE LRG++LVFVGDSLNRNMWESL+CIL++ V+++K+V+E SGR  F+ + FY+F F+
Sbjct  420   HMLELLRGKRLVFVGDSLNRNMWESLICILKNSVKNQKKVYEESGRHHFRTEAFYSFIFK  479

Query  1204  DYNCSVDFVSSPFLVRE---SSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWT  1374
             +Y C V+F  SPFLV++   +  KG  G  ETLRLDL+ ++   Y +ADI++FNTGHWWT
Sbjct  480   EYKCRVEFFVSPFLVQQWEVADKKG--GKKETLRLDLIGESADKYKNADILVFNTGHWWT  537

Query  1375  HEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             HEKTS G+DYYQEGN VH  L VLEA++RAL TW RW+D +++  +T V+FRGYSA+H
Sbjct  538   HEKTSLGKDYYQEGNHVHNELNVLEAFRRALTTWGRWIDAHINPKKTFVLFRGYSASH  595



>ref|XP_008363351.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=563

 Score =   304 bits (779),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 197/296 (67%), Gaps = 2/296 (1%)
 Frame = +1

Query  667   GFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFY-S  843
             GFS + E  +   S   D     G  V ++ K +    +     E  S   + G  F   
Sbjct  143   GFSGKLEGSRKNESFAKDSDGVLGQAVALTSKESDDASEALSESEKQSNQTQPGYEFSRD  202

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             DCD+FDG WVRDD+ P Y PGSCP ID  F+C L+KRPD+ Y K+RW+P  C++P  +  
Sbjct  203   DCDLFDGMWVRDDSYPLYAPGSCPLIDESFNCFLNKRPDNRYEKYRWQPKHCNLPRLDGK  262

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
             + L  LRG++LVFVGDSLNRNMWESL+C+LR+ V DK  V E  GRS+F+ +G Y+F F+
Sbjct  263   NMLGLLRGKRLVFVGDSLNRNMWESLLCLLRNSVDDKSGVVEALGRSEFRSEGSYSFVFK  322

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             +YNCSV+F  SPFLV+E      NGS  ETLRLDL++ ++  Y  AD++IFNTGHWWTHE
Sbjct  323   EYNCSVEFFRSPFLVQEWEMADANGSIKETLRLDLIEXSSDKYKTADVLIFNTGHWWTHE  382

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTSRG+ YYQEG+ ++  L V EA++ AL TWARWVD N++  +T V FRG+S  H
Sbjct  383   KTSRGKGYYQEGSYIYDVLNVKEAFRXALTTWARWVDTNINPEKTIVFFRGFSPNH  438



>emb|CDX98947.1| BnaC09g48880D [Brassica napus]
Length=584

 Score =   305 bits (780),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/332 (45%), Positives = 209/332 (63%), Gaps = 17/332 (5%)
 Frame = +1

Query  589   NRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGT  768
             NR+ + KN  F   T    +   KN       + +  + S  G  +++R    ++  + +
Sbjct  139   NRTPVAKNTTFGSPTINGTNPVAKN-----TSQPLLPDKSPTGSSNQTRTATDDVRNQTS  193

Query  769   SSTVKNDMIGENGS-----------ELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCP  915
             +  V  D+   + S           + + K      +C+ FDGEW+RD+T P Y PGSC 
Sbjct  194   APPVSVDLTANSSSSSKGDSVSLVKQEIEKWSESLKNCEFFDGEWIRDETYPLYKPGSCK  253

Query  916   FIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWE  1095
              ID  F+C  + RPD  + K +W+P  C +P  N    LE LRG++LVFVGDSLNRNMWE
Sbjct  254   LIDEQFNCISNGRPDKDFQKLKWKPKKCSLPRLNGGILLEMLRGRRLVFVGDSLNRNMWE  313

Query  1096  SLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVN  1275
             SLVCIL+  V+D+ +V+E  GR  F+ +  Y+F F+DYNC+V+F  SPFLV+E+      
Sbjct  314   SLVCILKGSVKDESKVYEARGRHHFRGEAEYSFVFQDYNCTVEFFVSPFLVQETEIVDKK  373

Query  1276  GS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEA  1452
             G+  ETLRLDL+ K++  Y  ADI++FNTGHWWTHEKTS+GEDYYQEG+ V+  L VLEA
Sbjct  374   GTKKETLRLDLVGKSSEQYKGADIIVFNTGHWWTHEKTSKGEDYYQEGSNVYHELAVLEA  433

Query  1453  YKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +++AL TW RWV+KNV+ N++ V FRGYSA+H
Sbjct  434   FRKALTTWGRWVEKNVNPNKSLVFFRGYSASH  465



>ref|XP_010486896.1| PREDICTED: protein trichome birefringence-like 1 [Camelina sativa]
Length=546

 Score =   303 bits (776),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 157/372 (42%), Positives = 222/372 (60%), Gaps = 18/372 (5%)
 Frame = +1

Query  463   VVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKK  642
             V   ++ +   N TV       N S    D +F  ++     N + + KNV F     +K
Sbjct  63    VAPSISSYVLPNVTVSNL---SNSSPSTLDSNFTTFRAPAPENLTAVTKNVTF-----EK  114

Query  643   GDGSGKNGGFSLEGETV---------KSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMI  795
              +   KN  F  + +           K++     D  + R V   +S+    ++  +   
Sbjct  115   TEPVAKNNTFQFKTDHAQENISCPDNKTDDDTVRDLDKHRPVKAPLSEVLAVNSTASPKR  174

Query  796   GENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVK  975
              +     LRK      +C+ F+G+WVRDD+ P Y PGSC  ID  F+C L+ RPD  + K
Sbjct  175   KQRRKSSLRKEIESLKNCEFFEGDWVRDDSYPLYKPGSCNLIDEQFNCILNGRPDVEFQK  234

Query  976   WRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEIS  1155
              +W+P  C +P  N    LE +RG++LVFVGDSLNRNMWESLVCIL+  VRD+ ++FE  
Sbjct  235   LKWKPKKCTLPRLNGGKLLEMIRGKRLVFVGDSLNRNMWESLVCILKGSVRDETQIFEAH  294

Query  1156  GRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYN  1332
             GR  F+ +  Y+F F+DY+C+V+F +SPFLVRE      NG   ETLRLDL+ K++  Y 
Sbjct  295   GRHQFRWEAEYSFVFKDYSCTVEFYASPFLVREWEIMDKNGMKKETLRLDLVGKSSEQYK  354

Query  1333  DADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANR  1512
              ADI++FNTGHWWTH+KTS+GEDYYQEG+ V+ +L+V EA+++AL TW RWVDKNV+  +
Sbjct  355   GADILVFNTGHWWTHDKTSKGEDYYQEGSNVYRKLDVDEAFRKALTTWGRWVDKNVNPKK  414

Query  1513  TEVIFRGYSATH  1548
             + V FRGYS +H
Sbjct  415   SLVFFRGYSPSH  426



>ref|XP_002280022.1| PREDICTED: protein trichome birefringence [Vitis vinifera]
Length=659

 Score =   306 bits (784),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 207/309 (67%), Gaps = 5/309 (2%)
 Frame = +1

Query  631   TEKKGDGSGKNGGFSLEGETVKSEGSE-NGDRSRSRGVGVE-ISKKGTSSTVKNDMIGEN  804
             TEK G  +   G    E   VKS  +E +G     +GV  + +    T+S +K    G +
Sbjct  226   TEKNGSETKDKG--VAEKSGVKSPPTEKSGSGKEDKGVAEKGVVSNYTASLLKKQSNGTD  283

Query  805   GSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRW  984
               +          +C++F+G+WV+DD+ P Y PGSC  ID  F+C L+ RPD  Y+K +W
Sbjct  284   SKQRTGDWLESLMNCNLFEGQWVKDDSYPLYKPGSCSLIDEQFNCFLNGRPDKDYMKLKW  343

Query  985   RPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRS  1164
             +P  CD+P  N +  LE LRG++LVFVGDSLNRNMWESLVCILR+ V+D+ +V+E SGR 
Sbjct  344   KPKGCDLPRLNGSHMLELLRGKRLVFVGDSLNRNMWESLVCILRNSVKDRTKVYEASGRH  403

Query  1165  DFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDAD  1341
              F+ +  Y+F FE+Y+CSV+F  SPFLV+E      NGS  ETLRLD +  ++  Y  AD
Sbjct  404   HFRTEASYSFIFEEYHCSVEFFVSPFLVQEWEMPDKNGSKKETLRLDKIPTSSDKYKTAD  463

Query  1342  IVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEV  1521
             I+IFNTGHWWTH+KTS+G+DYYQEG+ V+  L V+EA+++AL TWARWVD NV+  ++ V
Sbjct  464   IIIFNTGHWWTHDKTSKGKDYYQEGSHVYGELNVMEAFRKALTTWARWVDANVNPAKSLV  523

Query  1522  IFRGYSATH  1548
              FRGYS++H
Sbjct  524   FFRGYSSSH  532



>ref|XP_008360191.1| PREDICTED: protein trichome birefringence-like 4 [Malus domestica]
Length=544

 Score =   303 bits (775),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 152/302 (50%), Positives = 202/302 (67%), Gaps = 6/302 (2%)
 Frame = +1

Query  646   DGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRK  825
             + SGK  G     ET K   S +     S G     SKK T S   +       SEL  K
Sbjct  121   EXSGKMEGSRRRNETKKHAHSXSPSSKDSNGK--RGSKKKTDSKXMSSKKQGKQSELKSK  178

Query  826   GRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDI  1005
                  + CDIFDG WVRDD+ P Y PGSCP+ID  FDC L+ RPD+ Y ++RW+P  C+I
Sbjct  179   ---LTNGCDIFDGRWVRDDSYPLYAPGSCPWIDEPFDCFLNGRPDNGYERYRWQPKRCNI  235

Query  1006  PSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGF  1185
             P  N    L  L G++LVFVGDSLNRNMWESL+C+LR+ V DK +V+E+SGR +F+ +G 
Sbjct  236   PRLNGKKMLRLLTGKRLVFVGDSLNRNMWESLLCVLRNSVDDKNKVYEVSGRQEFRTEGS  295

Query  1186  YAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTG  1362
             Y+F FE+YNCSV+F  S FLV+E      +GS  ETLR+DL+++++  Y +AD++IFNTG
Sbjct  296   YSFVFEEYNCSVEFFQSRFLVQEWEMPEPSGSKKETLRIDLIERSSDNYKNADVLIFNTG  355

Query  1363  HWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSA  1542
             HWWTHEKTS G+ YYQEG+ ++  L V +A+++AL TWA+W+D NV+  +T V FRGYS 
Sbjct  356   HWWTHEKTSSGKGYYQEGSHIYGELNVDDAFRKALTTWAQWIDTNVNPKKTAVFFRGYSP  415

Query  1543  TH  1548
             +H
Sbjct  416   SH  417



>ref|XP_006395071.1| hypothetical protein EUTSA_v10005359mg [Eutrema salsugineum]
 gb|ESQ32357.1| hypothetical protein EUTSA_v10005359mg [Eutrema salsugineum]
Length=461

 Score =   300 bits (767),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 185/255 (73%), Gaps = 3/255 (1%)
 Frame = +1

Query  793   IGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYV  972
             +    S+ +   R   S CDIFDG WV DD++P YPPG CPF++  F+C+ + RPD  ++
Sbjct  86    VNNESSKKMDFARKELSSCDIFDGSWVLDDSEPIYPPGYCPFVEDKFNCYKNGRPDSGFL  145

Query  973   KWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEI  1152
               RW+PH C IP F+    L+ LRG++LVFVGDSLNRNMWESLVC LR  + DK RV ++
Sbjct  146   HHRWQPHGCSIPRFDGKKMLKILRGKRLVFVGDSLNRNMWESLVCSLRSTLEDKNRVSKV  205

Query  1153  SGR-SDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESS-FKGVNGSFETLRLDLMDKT-TS  1323
             SG+ SD   +GFY FRF+D+ CS+DF+ SPFLV+ES    G     ETLRLD++ ++ T 
Sbjct  206   SGKQSDLHNEGFYGFRFKDFECSIDFIKSPFLVQESEVLDGYGKRRETLRLDMIQRSITK  265

Query  1324  MYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVD  1503
             +  +ADIVIFNTGHWWTH+KT  G+DY+QEGNRV+ +L+V EAY +AL+TWA WVD N++
Sbjct  266   ISKNADIVIFNTGHWWTHQKTYEGKDYFQEGNRVYEKLQVKEAYTKALHTWADWVDSNIN  325

Query  1504  ANRTEVIFRGYSATH  1548
             + +T V F GYS++H
Sbjct  326   STKTRVFFVGYSSSH  340



>ref|XP_009604045.1| PREDICTED: protein trichome birefringence-like [Nicotiana tomentosiformis]
Length=647

 Score =   305 bits (781),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 149/294 (51%), Positives = 201/294 (68%), Gaps = 16/294 (5%)
 Frame = +1

Query  706   SENGDRSRSRG-----VGVEISKKGTSSTVKNDMIGENGSELLRKG-----RSFYSDCDI  855
             S +GD+S +       +  E+ K  TSS VK    G N    ++KG     +S   +CD 
Sbjct  239   SSSGDKSANGNGEKGIIEKEVKKNFTSSLVKKQRNGTNLDVSVKKGDEDLVKSLL-NCDF  297

Query  856   FDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLE  1035
             FDG WV D++ P Y PGSC  ID  F+C ++ RPD  Y+K +W+P AC +P  NAT  LE
Sbjct  298   FDGNWVTDESYPLYKPGSCSLIDEQFNCVVNGRPDSGYLKMKWKPKACSLPRLNATHMLE  357

Query  1036  RLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNC  1215
              LRG++L FVGDSLNRNMWESL+C LR+ V+D+K+V+E  GR  F+ +  Y+F FEDY C
Sbjct  358   LLRGKRLAFVGDSLNRNMWESLICTLRNSVKDQKKVYEEFGRHHFRTEASYSFIFEDYKC  417

Query  1216  SVDFVSSPFLVRE---SSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKT  1386
              V+F  SPFLV++   +  KG  G  ETLRLDL+ ++   Y +ADI++FNTGHWWTHEKT
Sbjct  418   RVEFFVSPFLVQQWEVADKKG--GKKETLRLDLIGESAEKYKNADIIVFNTGHWWTHEKT  475

Query  1387  SRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             S G+DYYQEG+ VH +L V+EA+++AL TW RWVD +++  +T V+FRGYSA+H
Sbjct  476   SLGKDYYQEGSHVHRQLNVVEAFRKALTTWGRWVDAHINPKKTVVLFRGYSASH  529



>emb|CDP10159.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   304 bits (779),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 160/328 (49%), Positives = 213/328 (65%), Gaps = 21/328 (6%)
 Frame = +1

Query  589   NRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGT  768
             N+S IG  VN    + +K + S  +   SL G+   S   E   R    GVGV   K  T
Sbjct  189   NQSTIGA-VN----SSEKANNSATSSAKSLPGKNNVSGVGEK--RIAENGVGV---KNLT  238

Query  769   SSTVKNDMIGENGS-------ELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDR  927
             SS +K    G + S       + L KG     +C++FDG WV+DD+ P Y PGSC  ID 
Sbjct  239   SSLLKKQSNGASSSVSAKHRMDELVKG---LVNCNLFDGNWVKDDSYPLYKPGSCSLIDE  295

Query  928   DFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVC  1107
              F+C L++RPD  Y K+RW+P  C +P  +    LE L+G++LVFVGDSLNRNMWESL+C
Sbjct  296   QFNCFLNRRPDSNYYKFRWKPKECILPRLDGGHMLELLKGKRLVFVGDSLNRNMWESLIC  355

Query  1108  ILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SF  1284
             ILR+ V+D+K+V+E SGR  F+ +  Y+F FEDY  +V+F  +PFLV+E  F+  NG   
Sbjct  356   ILRNSVKDQKKVYEASGRQHFRTEASYSFVFEDYKFTVEFFVTPFLVQEWEFQDKNGKKK  415

Query  1285  ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRA  1464
             ETLRLDL+  +   Y  ADI+IFNTGHWWTH+KT+ G+DYYQEG+ V+  L VLEA+++A
Sbjct  416   ETLRLDLVGHSADKYKSADIIIFNTGHWWTHDKTALGKDYYQEGSHVYSELNVLEAFRKA  475

Query  1465  LYTWARWVDKNVDANRTEVIFRGYSATH  1548
             L TWARWVD  V+  ++ V FRGYSA+H
Sbjct  476   LTTWARWVDAKVNPAKSLVFFRGYSASH  503



>ref|XP_006362212.1| PREDICTED: uncharacterized protein LOC102599885 [Solanum tuberosum]
Length=691

 Score =   306 bits (784),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 153/296 (52%), Positives = 208/296 (70%), Gaps = 17/296 (6%)
 Frame = +1

Query  697   SEGSENGDRSRSRGVGVEISKKG-----TSSTVKNDMIGENGSELLRKGR------SFYS  843
             ++ +++G  SR +    EI++KG     TSS VK+   G N     +K +      S  S
Sbjct  282   NQTAKSGSGSREK----EIAEKGVKGNFTSSFVKSQSDGTNLDVSTKKKKDEDLVKSLLS  337

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
              CD FDG WV+D++ P Y PGSC  ID  F+C L+ RPD+ ++K +W+P+AC +P  N T
Sbjct  338   -CDFFDGNWVKDESYPLYKPGSCSLIDEQFNCFLNGRPDNNHMKMKWKPNACSLPRLNGT  396

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               LE LRG++LVFVGDSLNRNMWESLVCILR+ V+D+K+V+E SGR  F+ +  Y+F FE
Sbjct  397   HMLELLRGKRLVFVGDSLNRNMWESLVCILRNSVKDQKKVYEESGRQHFRTEASYSFLFE  456

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             +YN  V+F  SPFLV+E  +    G+  ETLRLDL+ ++   Y +ADI+IFNTGHWWTHE
Sbjct  457   EYNFRVEFFVSPFLVQEWEYADKKGTKKETLRLDLIGQSADKYKNADILIFNTGHWWTHE  516

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS G+DYYQEG+ V+  L+VLEA+++AL TW RWVD +V+  +T V+FRGYSA+H
Sbjct  517   KTSLGKDYYQEGSHVYNELDVLEAFRKALTTWGRWVDSHVNPKKTFVLFRGYSASH  572



>ref|XP_010058223.1| PREDICTED: protein trichome birefringence [Eucalyptus grandis]
 gb|KCW90320.1| hypothetical protein EUGRSUZ_A02463 [Eucalyptus grandis]
Length=643

 Score =   305 bits (781),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 177/235 (75%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD FDGEWV+DD+ P Y PGSC  ID  F+C L+ RPD  Y K+RWRP  C++P  NA  
Sbjct  297   CDFFDGEWVKDDSYPLYKPGSCSLIDEQFNCILNGRPDKDYQKYRWRPKGCNLPRLNARH  356

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              +E LRG++LVFVGDSLNRNMWESLVCILR  V+D K+V+E SGR  F+ +  Y+F F+D
Sbjct  357   MIELLRGKRLVFVGDSLNRNMWESLVCILRGAVKDHKKVYEASGRQHFRGEASYSFVFKD  416

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             Y+ +V+F  SPFLVRE      NGS  ETLRLDL+ +++  Y DADI+IFNTGHWWTH+K
Sbjct  417   YDFTVEFFVSPFLVREWEMPDKNGSKKETLRLDLVGRSSDQYKDADIIIFNTGHWWTHDK  476

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS+G+DYYQEG+ V+  L VLEA+++AL TW RWVD NV+  ++ V FRGYS +H
Sbjct  477   TSKGKDYYQEGSHVYGELNVLEAFRKALTTWGRWVDANVNPMKSIVFFRGYSDSH  531



>ref|XP_007207689.1| hypothetical protein PRUPE_ppa023743mg, partial [Prunus persica]
 gb|EMJ08888.1| hypothetical protein PRUPE_ppa023743mg, partial [Prunus persica]
Length=541

 Score =   301 bits (771),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/286 (50%), Positives = 195/286 (68%), Gaps = 16/286 (6%)
 Frame = +1

Query  694   KSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWV  873
             K    ++G + +  G      K+G  + +K++++                 CDIFDG WV
Sbjct  144   KDSNGKHGSKKKIDGKKASSKKQGKQTELKSELMNA---------------CDIFDGSWV  188

Query  874   RDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQK  1053
             RD+  P Y PGSCP ID  F+C L+ RPD+ Y ++RW+P  C+IP  N    L  L G++
Sbjct  189   RDNWYPLYAPGSCPLIDEPFNCFLNGRPDNGYERYRWQPKRCNIPRLNGKKMLRLLTGKR  248

Query  1054  LVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVS  1233
             LVFVGDSLNRNMWESL+CILR+ V +K +V+E+SGR +F+ +G Y+F FEDYNCSV+F  
Sbjct  249   LVFVGDSLNRNMWESLLCILRNSVDNKSKVYEVSGREEFRTEGSYSFIFEDYNCSVEFFQ  308

Query  1234  SPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQ  1410
             S FLV+E      +GS  ETLR+DL+++++  Y +AD++IFNTGHWWTHEKTS G+ YYQ
Sbjct  309   SRFLVQEWEMPEPSGSKKETLRIDLIERSSDNYKNADVLIFNTGHWWTHEKTSSGKGYYQ  368

Query  1411  EGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             EG+ V+  L V +A+++AL TWARWVD NV+ N+T V FRGYS +H
Sbjct  369   EGSHVYGELNVDDAFEKALTTWARWVDTNVNPNKTAVFFRGYSPSH  414



>emb|CDX70077.1| BnaA10g24260D [Brassica napus]
Length=583

 Score =   302 bits (774),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/332 (45%), Positives = 207/332 (62%), Gaps = 17/332 (5%)
 Frame = +1

Query  589   NRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGT  768
             NR+   KN  F        +   KN       + +  + S  G  +++R    ++  + +
Sbjct  138   NRTPAAKNTTFESPVVNGTNPVAKN-----TSQPLLQDKSPTGSSNQTRTATDDVRNQTS  192

Query  769   SSTVKNDMIGENGS-----------ELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCP  915
             +  V  D+   + S           + + K      +C+ FDGEW+RD+T P Y PGSC 
Sbjct  193   APPVSVDLTASSSSSSKGDSVSSVKQEIEKWSESLKNCEFFDGEWIRDETYPLYKPGSCK  252

Query  916   FIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWE  1095
              ID  F+C  + RPD  + K +W+P  C +P  N    LE LRG++LVFVGDSLNRNMWE
Sbjct  253   LIDEQFNCISNGRPDKDFQKLKWKPKKCSLPRLNGGILLEMLRGRRLVFVGDSLNRNMWE  312

Query  1096  SLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVN  1275
             SLVCIL+  V+D+ +V+E  GR  F+ +  Y+F F+DYNC+V+F  SPFLV+E+      
Sbjct  313   SLVCILKGSVKDESKVYEARGRHHFRGEAEYSFVFQDYNCTVEFFVSPFLVQETEIVDKK  372

Query  1276  GS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEA  1452
             G+  ETLRLDL+ K++  Y  ADI+IFNTGHWWTHEKTS+GEDYYQEG+ V+  L VLEA
Sbjct  373   GTKKETLRLDLVGKSSEQYKGADIIIFNTGHWWTHEKTSKGEDYYQEGSNVYHELAVLEA  432

Query  1453  YKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +++AL TW RWV+KNV+ N++ V FRGYSA+H
Sbjct  433   FRKALTTWGRWVEKNVNPNKSLVFFRGYSASH  464



>ref|XP_009130955.1| PREDICTED: protein trichome birefringence-like [Brassica rapa]
 ref|XP_009130956.1| PREDICTED: protein trichome birefringence-like [Brassica rapa]
Length=601

 Score =   303 bits (775),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 206/329 (63%), Gaps = 9/329 (3%)
 Frame = +1

Query  589   NRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRS----RSRGVGVEIS  756
             NR+ + KN  F      + +   K         T  S  S   D++    +S  V V+++
Sbjct  154   NRTPVAKNSTFESPVVNRTEPVAKTNTSQPLLPTGSSNLSRTADKAPSPAKSPPVSVDLT  213

Query  757   KKGTSSTVKNDMIGENGSELLRKGRSFYS----DCDIFDGEWVRDDTKPYYPPGSCPFID  924
                TSS             LL +    +S    DC+ FDG W+ DDT P Y PGSC  ID
Sbjct  214   SNSTSSAPSKPGEQTGSVSLLEQEIEKWSESLKDCEFFDGGWIMDDTYPLYKPGSCNIID  273

Query  925   RDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLV  1104
               F+C  + RPD  + K +W+P  C +P  N    LE LRG++LVFVGDSLNRNMWESLV
Sbjct  274   EQFNCISNGRPDKDFQKLKWKPKKCSLPRLNGGIMLEMLRGRRLVFVGDSLNRNMWESLV  333

Query  1105  CILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-  1281
             C+L+  V+D+ +V+E SGR  F+ +  Y+F F+DYNC+V+F  SPFLV+E+      G+ 
Sbjct  334   CMLKGSVKDESKVYEASGRHHFRGEAEYSFVFQDYNCTVEFFVSPFLVQENEIVDKKGTK  393

Query  1282  FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKR  1461
              ETLRLDL+ K++  Y  ADI++FNTGHWWTHEKTS+GEDYYQEG+ V+  L VLEA+++
Sbjct  394   KETLRLDLVGKSSEQYKGADIIVFNTGHWWTHEKTSKGEDYYQEGSNVYHELAVLEAFRK  453

Query  1462  ALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             AL TW RWV+KNV+ +++ V FRGYSA+H
Sbjct  454   ALTTWGRWVEKNVNPDKSLVFFRGYSASH  482



>ref|XP_004161492.1| PREDICTED: uncharacterized protein LOC101228487 [Cucumis sativus]
Length=613

 Score =   303 bits (776),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 178/236 (75%), Gaps = 1/236 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             +CD FDGEWV DD+ P Y PGSC  ID  F+CHL+ RPD  Y K+RW+P  CD+P  +  
Sbjct  263   NCDFFDGEWVLDDSYPLYKPGSCLLIDEQFNCHLNGRPDKNYEKFRWKPKKCDLPRLDGG  322

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               L+ L+G++LVFVGDSLNRNMWESLVCILR+ V+D++ VFE  G+  F+ +  Y+F F+
Sbjct  323   RMLDLLKGKRLVFVGDSLNRNMWESLVCILRNSVKDQRNVFEAHGKQVFRGEAAYSFIFK  382

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             DYN +V+F  SPFLVRE      NG   ETLRLDL+ K++  Y +AD+++FNTGHWWTHE
Sbjct  383   DYNFTVEFFVSPFLVREWEMPDKNGKKKETLRLDLVGKSSDQYKEADVIVFNTGHWWTHE  442

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS G+DYYQEG+ V+  L VLEA+++A+ TWARWVDKN++  ++ V FRGYSA+H
Sbjct  443   KTSLGKDYYQEGSHVYEELNVLEAFRKAITTWARWVDKNINPMKSIVFFRGYSASH  498



>ref|XP_004136561.1| PREDICTED: uncharacterized protein LOC101220024 [Cucumis sativus]
 gb|KGN59288.1| hypothetical protein Csa_3G800710 [Cucumis sativus]
Length=613

 Score =   303 bits (776),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 178/236 (75%), Gaps = 1/236 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             +CD FDGEWV DD+ P Y PGSC  ID  F+CHL+ RPD  Y K+RW+P  CD+P  +  
Sbjct  263   NCDFFDGEWVLDDSYPLYKPGSCLLIDEQFNCHLNGRPDKNYEKFRWKPKKCDLPRLDGG  322

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               L+ L+G++LVFVGDSLNRNMWESLVCILR+ V+D++ VFE  G+  F+ +  Y+F F+
Sbjct  323   RMLDLLKGKRLVFVGDSLNRNMWESLVCILRNSVKDQRNVFEAHGKQVFRGEAAYSFIFK  382

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             DYN +V+F  SPFLVRE      NG   ETLRLDL+ K++  Y +AD+++FNTGHWWTHE
Sbjct  383   DYNFTVEFFVSPFLVREWEMPDKNGKKKETLRLDLVGKSSDQYKEADVIVFNTGHWWTHE  442

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS G+DYYQEG+ V+  L VLEA+++A+ TWARWVDKN++  ++ V FRGYSA+H
Sbjct  443   KTSLGKDYYQEGSHVYEELNVLEAFRKAITTWARWVDKNINPMKSIVFFRGYSASH  498



>ref|XP_011078818.1| PREDICTED: protein trichome birefringence-like [Sesamum indicum]
Length=634

 Score =   303 bits (776),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/288 (50%), Positives = 196/288 (68%), Gaps = 13/288 (5%)
 Frame = +1

Query  706   SENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSF------YSDCDIFDGE  867
             + NGD+  +    V   K  TSS +K      NG++  +  +          +C++FDG 
Sbjct  234   TANGDKGIAENGAV---KNLTSSLMKKQ---NNGTDTAKAKQGIDDLIKSLMNCNLFDGN  287

Query  868   WVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRG  1047
             WVRD + P Y PGSC  ID  F+C L+ RPD+ Y K +W+P  C +P  + +  LE LRG
Sbjct  288   WVRDHSYPLYKPGSCSLIDEQFNCFLNGRPDNGYYKLKWKPKGCTLPRLDGSHMLELLRG  347

Query  1048  QKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDF  1227
             ++LVFVGDSLNRNMWESL+CILR+ V+D+K+V+E  GR  F+ +  Y+F FEDY C+V+F
Sbjct  348   KRLVFVGDSLNRNMWESLICILRNSVKDQKKVYEEFGRHHFRTEASYSFIFEDYKCTVEF  407

Query  1228  VSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDY  1404
               SPFLV+E      NG+  ETLRLDL+ ++   Y +ADI++FNTGHWWTHEKTS+G+DY
Sbjct  408   FVSPFLVQEWELADRNGTKKETLRLDLVSRSADKYKNADIIVFNTGHWWTHEKTSKGKDY  467

Query  1405  YQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             YQEG+ V+  L VLEA+++A+ TW RWVD N++  +T V FRGYSA+H
Sbjct  468   YQEGSHVYGELNVLEAFRKAITTWGRWVDANINQTKTLVFFRGYSASH  515



>ref|XP_009783309.1| PREDICTED: protein trichome birefringence-like [Nicotiana sylvestris]
Length=658

 Score =   304 bits (778),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/293 (51%), Positives = 200/293 (68%), Gaps = 12/293 (4%)
 Frame = +1

Query  697   SEGSENGDRSRSRGV-GVEISKKGTSSTVKNDMIGENGSELLRKG-----RSFYSDCDIF  858
             S G +N + +  +G+   E+ K  TSS VK      N    ++KG     +S   +CD F
Sbjct  251   SYGDKNANGNGEKGIIEKEVKKNFTSSLVKKQRNETNLDVSVKKGDEDLVKSLL-NCDFF  309

Query  859   DGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLER  1038
             DG WV D++ P Y PGSC  ID  F C L+ RPD  Y+K +W+P AC  P  NAT  LE 
Sbjct  310   DGNWVTDESYPLYKPGSCSLIDEQFSCFLNGRPDSGYLKMKWKPKACTFPRLNATHMLEL  369

Query  1039  LRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCS  1218
             LRG++L FVGDSLNRNMWESL+CILR+ V+D+K+V+E  GR  F+ +  ++F FE+Y C 
Sbjct  370   LRGKRLAFVGDSLNRNMWESLICILRNSVKDQKKVYEEFGRHHFRTEASHSFIFEEYKCR  429

Query  1219  VDFVSSPFLVRE---SSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTS  1389
             V+F  SPFLV++   +  KG  G  ETLRLDL+ ++   Y +ADI++FNTGHWWTHEKTS
Sbjct  430   VEFFVSPFLVQQWEVADKKG--GKKETLRLDLIGESAEKYKNADIIVFNTGHWWTHEKTS  487

Query  1390  RGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
              G+DYYQEG+ VH +L VLEA+++AL TW RWVD +++  +T V+FRGYSA+H
Sbjct  488   LGKDYYQEGSHVHSQLNVLEAFRKALTTWGRWVDAHINPKKTIVLFRGYSASH  540



>emb|CDY05000.1| BnaAnng01820D [Brassica napus]
Length=525

 Score =   300 bits (768),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 200/291 (69%), Gaps = 14/291 (5%)
 Frame = +1

Query  688   TVKSEGSENGDRSRSRG---VGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIF  858
             T+ S+   N   + SR    V V+++   +SS+VK ++  E  SE L+       +C+ F
Sbjct  132   TLTSDDVRNQTAAPSRSEAPVSVDVTA-SSSSSVKQEV--EKWSESLK-------NCEFF  181

Query  859   DGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLER  1038
             DGEW++DDT P Y PGSC  +D  F+C  + RPD  + K +W+P  C +P  N    LE 
Sbjct  182   DGEWIKDDTYPLYEPGSCKIVDEQFNCISNGRPDKDFQKLKWKPKTCTLPRLNGGIMLEM  241

Query  1039  LRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCS  1218
             LRG++L FVGDSLNRNMWESLVC+L+  V+D+ +V+E  GR  F+ +  Y+F F+DYNC+
Sbjct  242   LRGRRLAFVGDSLNRNMWESLVCMLKGSVKDESKVYEARGRYHFRGEAEYSFVFQDYNCT  301

Query  1219  VDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRG  1395
             V+F  SPFLV+ES      G+  ETLRLDL+ K++  Y  ADI++FNTGHWWTHEKTS+G
Sbjct  302   VEFFVSPFLVQESEIVDKKGTKKETLRLDLIGKSSEQYKGADIIVFNTGHWWTHEKTSKG  361

Query  1396  EDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             EDYYQEG+ V+  L VLEA+++AL TW RWV+KNV+  ++ V FRGYSATH
Sbjct  362   EDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPEKSLVFFRGYSATH  412



>gb|KDP24643.1| hypothetical protein JCGZ_25559 [Jatropha curcas]
Length=638

 Score =   303 bits (776),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 208/310 (67%), Gaps = 7/310 (2%)
 Frame = +1

Query  622   TGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGE  801
             T   E +   S  N   S++G+  K    +N   + +      +SKK  + + +++  G 
Sbjct  215   TPVQENQNAKSSTNSVSSVKGKQEKGIAEKNVASNYTSS----LSKKQNNGSKQSN--GT  268

Query  802   NGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWR  981
             N     ++G     +C+ FDGEWV+DD+ P Y PGSC  ID  F+C  + RPD  Y K++
Sbjct  269   NSELSGKQGIESLVNCNFFDGEWVKDDSYPLYKPGSCSLIDEQFNCISNGRPDKDYQKYK  328

Query  982   WRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR  1161
             W+P  C +P  N    L+ LRG++LVFVGDSLNRNMWESLVC+L+  V+D+ +VFE +GR
Sbjct  329   WKPKGCTLPRLNPAKMLDMLRGKRLVFVGDSLNRNMWESLVCMLKGSVKDQSKVFEANGR  388

Query  1162  SDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDA  1338
               F+ +  Y+F F+DY+C+++F  SPFLV+E      NG+  ETLRLDL+ +++ +Y +A
Sbjct  389   VHFRGEASYSFVFKDYDCTIEFFVSPFLVQEWEMPDKNGTKRETLRLDLVGRSSDLYKNA  448

Query  1339  DIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTE  1518
             DI+IFNTGHWWTH+KTS+G+DYYQEG+ ++  L VLEA+++AL TWARWVD NV+  ++ 
Sbjct  449   DIIIFNTGHWWTHDKTSKGKDYYQEGSHIYNELNVLEAFRKALTTWARWVDHNVNPMKSL  508

Query  1519  VIFRGYSATH  1548
             V FRGYSA+H
Sbjct  509   VFFRGYSASH  518



>ref|XP_006355406.1| PREDICTED: uncharacterized protein LOC102580314 [Solanum tuberosum]
Length=457

 Score =   298 bits (762),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 177/236 (75%), Gaps = 2/236 (1%)
 Frame = +1

Query  847   CDIFDGEWVRD-DTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             CDIFDGEW++D D  P Y PGSCPFID  F+C  + R D  Y++ +W+PH C+IP F+  
Sbjct  110   CDIFDGEWIQDNDLHPLYKPGSCPFIDNSFNCFKNGRRDTEYLRLKWKPHGCEIPRFDGL  169

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               L+ L+G++LVFVGDSLNRNMWESLVC LR+ + DK RV E+SG   F+ +GFY+F+F+
Sbjct  170   KMLKMLKGKRLVFVGDSLNRNMWESLVCALRNSLIDKNRVNEVSGHRQFRSQGFYSFKFK  229

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             D+ CS+DF+ SPFLV+E  F    G+  ETLRLD +  + + Y+DADI+IFNTGHWWTH+
Sbjct  230   DFKCSIDFIKSPFLVQEWRFSDKAGARRETLRLDTIHGSLTKYHDADIIIFNTGHWWTHQ  289

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KT +  +Y+QEGN V+ RLEV +AY +AL TWA WVD  +++ RT V FRGYSA+H
Sbjct  290   KTQKVNNYFQEGNHVYNRLEVADAYTKALKTWANWVDTTINSTRTRVFFRGYSASH  345



>emb|CDY55774.1| BnaA03g55480D [Brassica napus]
Length=519

 Score =   300 bits (767),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/329 (46%), Positives = 201/329 (61%), Gaps = 9/329 (3%)
 Frame = +1

Query  589   NRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRG----VGVEIS  756
             NR+ + KN  F      +     K         T  S      D + S      V  +++
Sbjct  72    NRTPVAKNSTFESPVVNRTKPVAKTNTSQPLLPTKSSNQPPTADEAPSPAKAPPVSADLT  131

Query  757   KKGTSSTVKNDMIGENGSELLRKGRSFYS----DCDIFDGEWVRDDTKPYYPPGSCPFID  924
                TSS             LL +    +S    DC+ FDG W+ DDT P Y PGSC  ID
Sbjct  132   SNSTSSAPSKPGKQTGSVSLLEQEIEKWSESLKDCEFFDGGWIMDDTYPLYKPGSCKIID  191

Query  925   RDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLV  1104
               F+C  + RPD  + K +W+P  C +P  N    LE LRG++LVFVGDSLNRNMWESLV
Sbjct  192   EQFNCISNGRPDKDFQKLKWKPKKCSLPRLNGGIMLEMLRGRRLVFVGDSLNRNMWESLV  251

Query  1105  CILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-  1281
             C+L+  V+D+ +V+E SGR  F+ +  Y+F F+DYNC+V+F  SPFLV+E+      G+ 
Sbjct  252   CMLKGSVKDESKVYEASGRHHFRGEAEYSFVFQDYNCTVEFFVSPFLVQENEIVDKKGTK  311

Query  1282  FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKR  1461
              ETLRLDL+ K++  Y  ADI++FNTGHWWTHEKTS+GEDYYQEG+ V+  L VLEA+++
Sbjct  312   KETLRLDLVGKSSEQYKGADIIVFNTGHWWTHEKTSKGEDYYQEGSNVYHELAVLEAFRK  371

Query  1462  ALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             AL TW RWV+KNV+ +++ V FRGYSA+H
Sbjct  372   ALTTWGRWVEKNVNPDKSLVFFRGYSASH  400



>ref|XP_008791066.1| PREDICTED: protein trichome birefringence-like 4 [Phoenix dactylifera]
Length=473

 Score =   298 bits (763),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 176/237 (74%), Gaps = 1/237 (0%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             + CD+FDG WV DD  P Y PG+CPFID  FDC  + R D  Y+K RW+P  C IP    
Sbjct  124   ASCDLFDGRWVADDLSPSYSPGTCPFIDNAFDCFGNGRADLNYMKLRWQPKGCRIPRLEG  183

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
                LE LRG++LVF GDSLNRNMWESLVCILR+ +RDK+RVFEI+GR++F+    YA RF
Sbjct  184   KRMLESLRGKRLVFAGDSLNRNMWESLVCILRNSLRDKRRVFEIAGRTEFRTNNSYAVRF  243

Query  1201  EDYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTH  1377
              DYNCS++F  SPFLV+  +     G   ETLRLDL+++++S + DAD+++FN+GHWWTH
Sbjct  244   IDYNCSIEFFRSPFLVQPWARVDAKGRRRETLRLDLIEESSSKFEDADVIVFNSGHWWTH  303

Query  1378  EKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             EKTS+G++YY+E   V+P+L   EAY +A+ TWARW+D ++D+ RT V FRGYS++H
Sbjct  304   EKTSKGKNYYEEDGHVYPQLRAAEAYGKAMRTWARWIDTHIDSKRTRVFFRGYSSSH  360



>ref|XP_007011182.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007011183.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY19992.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY19993.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=602

 Score =   301 bits (772),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 185/269 (69%), Gaps = 3/269 (1%)
 Frame = +1

Query  751   ISKKGTSSTVKNDMIGENGSELLRKGR--SFYSDCDIFDGEWVRDDTKPYYPPGSCPFID  924
             + K   SS V  D   +   E LRKG      S C IFDG+WVRDD+ P Y PGSCP ID
Sbjct  208   LEKGRVSSNVTLDGSSDEFLEKLRKGNFVDIMSHCRIFDGKWVRDDSYPLYAPGSCPHID  267

Query  925   RDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLV  1104
               F+C L+ RPD  Y K+RW+P  C++P  N    LE LRG+++VFVGDSL RNMWESLV
Sbjct  268   ESFNCFLNGRPDRGYEKYRWQPSGCNMPRLNGKHMLELLRGKRVVFVGDSLGRNMWESLV  327

Query  1105  CILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-  1281
             C+L++   +K  VFE S R + + +G Y+  F DYNCS+++  SPFLV+E      NGS 
Sbjct  328   CVLQNSAEEKSNVFEDSDRHELQTEGSYSILFNDYNCSIEYFRSPFLVQEWKSLEKNGSK  387

Query  1282  FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKR  1461
              ETLRLD+MDK +  Y  AD++IFNTGHWWTHEKTS+G+ YYQEG  ++ RL V EA+++
Sbjct  388   RETLRLDMMDKLSYKYKKADVLIFNTGHWWTHEKTSKGKGYYQEGTTIYDRLNVKEAFRK  447

Query  1462  ALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             AL TWARW+D N+D  +T V FRG+SA+H
Sbjct  448   ALTTWARWIDTNIDPMKTLVFFRGFSASH  476



>ref|XP_008229144.1| PREDICTED: protein trichome birefringence-like 4 [Prunus mume]
Length=616

 Score =   302 bits (773),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 152/347 (44%), Positives = 220/347 (63%), Gaps = 21/347 (6%)
 Frame = +1

Query  523   EGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFT----GFTEKKGDGSGKNGGFSLEGET  690
             +GN + +A+  +  L   +   N++     + F+    G  ++KG    K+        +
Sbjct  159   KGNNNEDAQSSNPILSLFSESANQTSSNTEIEFSRKVEGSKKRKGTKEPKDSKVRSHSSS  218

Query  691   VKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEW  870
               S G ++G + +S G      K+G  + +K++++                 CDIFDG W
Sbjct  219   EDSNG-KHGSKKKSDGKMSSSKKQGKQTELKSELMNA---------------CDIFDGSW  262

Query  871   VRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQ  1050
             VRD+  P Y PGSCP ID  F+C L+ RPD+ Y ++RW+P  C+IP  N    L  L G+
Sbjct  263   VRDNWYPLYAPGSCPLIDEPFNCFLNGRPDNGYERYRWQPKHCNIPRLNGKKMLRLLTGK  322

Query  1051  KLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFV  1230
             +LVFVGDSLNRNMWESL+CILR+ V +K +V+E+SGR +F+ +G Y+F FEDYNCSV+F 
Sbjct  323   RLVFVGDSLNRNMWESLLCILRNSVDNKSKVYEVSGREEFRTEGSYSFIFEDYNCSVEFF  382

Query  1231  SSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYY  1407
              S FLV+E      +GS  ETLR+DL+++++  Y +AD++IFNTGHWWTHEKTS G+ YY
Sbjct  383   QSRFLVQEWEMPEPSGSKKETLRIDLIERSSDNYKNADVLIFNTGHWWTHEKTSSGKGYY  442

Query  1408  QEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             QEG+ V+  L V +A+++AL TWARWVD N++  +T V FRGYS +H
Sbjct  443   QEGSHVYGELNVDDAFEKALTTWARWVDTNINPKKTAVFFRGYSPSH  489



>ref|XP_010111373.1| hypothetical protein L484_028030 [Morus notabilis]
 gb|EXC30851.1| hypothetical protein L484_028030 [Morus notabilis]
Length=609

 Score =   301 bits (772),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 163/384 (42%), Positives = 228/384 (59%), Gaps = 32/384 (8%)
 Frame = +1

Query  460   PVVQGLNGFGYRNATVCCS-PPEGNFSGEAKDG--------------SFGLWKKTHELNR  594
             P V   N     NAT+  S PP  N +  A +               S     +   +++
Sbjct  117   PAVPETNSSRSGNATLSSSSPPMDNRTQTASNSDKPELPAKNRHNASSIPSVGQEKSVSK  176

Query  595   SEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETV-KSEGSENGDRSR--SRGVGVEISKKG  765
             ++  ++ N T     +      N   S+  ++   S  S NG ++   S G+  E  KK 
Sbjct  177   NQTSQSSNLTAIVTPESPPPANNTSKSVPQKSASNSTASFNGKQNNETSSGLSAEQDKKK  236

Query  766   TSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDT-KPYYPPGSCPFIDRDFDCH  942
                T      G++  E L K       CD FDGEWVRDD+ + YY PGSC FID  F+C 
Sbjct  237   KEKTNG----GDDSIEALMK-------CDFFDGEWVRDDSYQLYYKPGSCSFIDEQFNCI  285

Query  943   LHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHV  1122
             L+ RPD  Y K++W+P  C++P  +  + LE LRG++LVFVGDSLNRNMWESLVCIL++ 
Sbjct  286   LNGRPDKDYQKFKWKPKGCNLPRLDGKNMLEMLRGKRLVFVGDSLNRNMWESLVCILKNS  345

Query  1123  VRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS--FETLR  1296
              +++  VFE  GR  F+ +  Y+F F+DY+C+V+F  SPFLV+E   K  NG+   ETLR
Sbjct  346   AKNQNNVFEAHGRHFFRGEASYSFIFKDYDCTVEFFVSPFLVQEWELKDKNGTKKKETLR  405

Query  1297  LDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTW  1476
             LDL+ +++  Y  AD ++FNTGHWWTHEKTS+GEDYYQEG+ V+  L VLEA+++A+ TW
Sbjct  406   LDLIGRSSEQYKSADFIVFNTGHWWTHEKTSKGEDYYQEGSHVYKELNVLEAFRKAVTTW  465

Query  1477  ARWVDKNVDANRTEVIFRGYSATH  1548
             ARW+D NV+  ++ V FRGYS +H
Sbjct  466   ARWIDANVNPKKSLVFFRGYSHSH  489



>ref|XP_002311402.2| hypothetical protein POPTR_0008s10790g [Populus trichocarpa]
 gb|EEE88769.2| hypothetical protein POPTR_0008s10790g [Populus trichocarpa]
Length=371

 Score =   294 bits (753),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 178/237 (75%), Gaps = 1/237 (0%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             S CDIF+G WV DD+ P Y PGSCPF+D  F+C  + RPD  Y+++RW+PH C IP F+ 
Sbjct  22    SSCDIFNGNWVLDDSDPIYQPGSCPFLDDAFNCFNNGRPDLDYLRYRWKPHGCQIPRFDG  81

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
                L  LRG+++VFVGDSLNRNMW+SLVC LR  V +K R+FEI GR +F+ +GFY+F F
Sbjct  82    RQMLRMLRGKRMVFVGDSLNRNMWQSLVCALRESVENKSRIFEIEGRREFRARGFYSFNF  141

Query  1201  EDYNCSVDFVSSPFLVRE-SSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTH  1377
              D+NCS+DFV SPFLV+E  S        E LRLD++   +  Y+DADI+IFNTGHWWTH
Sbjct  142   VDHNCSIDFVKSPFLVQEWRSSDRRGNRRERLRLDMIQTPSFNYHDADIIIFNTGHWWTH  201

Query  1378  EKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +KT RG++Y+QEG +V+ RLEV EAYK+AL+TWA+WVD N++ + T V F GYSA+H
Sbjct  202   QKTYRGKNYFQEGRKVYNRLEVNEAYKKALWTWAKWVDSNINRSHTRVFFGGYSASH  258



>ref|XP_010920201.1| PREDICTED: protein trichome birefringence-like 4 [Elaeis guineensis]
Length=475

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 178/242 (74%), Gaps = 1/242 (0%)
 Frame = +1

Query  826   GRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDI  1005
             G    + CD+FDG WV DD  P YPP +CPF+D  FDC  + R D  Y+K RW+P  C I
Sbjct  129   GHGDLASCDLFDGRWVADDLSPSYPPATCPFVDNAFDCFGNGRADLNYMKLRWQPKGCRI  188

Query  1006  PSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGF  1185
             P       LE LRG++LVF GDSLNRNMWESL+CILR+ +R K+RVFEI+GR++F+    
Sbjct  189   PRLEGKRMLELLRGKRLVFAGDSLNRNMWESLLCILRNSLRSKQRVFEIAGRTEFRTNNS  248

Query  1186  YAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTG  1362
             +A RF DYNCS++F  SPFLV+  +    NG   ETLRLDL+++++S + +AD+++FN+G
Sbjct  249   FAVRFIDYNCSIEFFRSPFLVQPWARVDANGQRRETLRLDLIEESSSKFQNADVIVFNSG  308

Query  1363  HWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSA  1542
             HWWTHEKTSRG++YY+E   V+P+L   EAY++A+ TWARWVD ++D+ +T V FRGYS+
Sbjct  309   HWWTHEKTSRGKNYYEEDGHVYPQLSAAEAYRKAMRTWARWVDTHIDSKQTRVFFRGYSS  368

Query  1543  TH  1548
             +H
Sbjct  369   SH  370



>ref|XP_007029023.1| Emb:CAB82953.1, putative [Theobroma cacao]
 gb|EOY09525.1| Emb:CAB82953.1, putative [Theobroma cacao]
Length=650

 Score =   302 bits (774),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 168/394 (43%), Positives = 230/394 (58%), Gaps = 39/394 (10%)
 Frame = +1

Query  430   NFSFKAPFFN-----PVVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNR  594
             N +F++P  N      +V   N        V  +PP  +   E K+ S          ++
Sbjct  152   NTTFQSPKTNKNNTQSLVLHANQTTLSPPPVYKNPPRTSSQTEKKENS----------DK  201

Query  595   SEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKG---  765
             +++ K    T  TEK    + ++     + ++V    S  G++S        +++KG   
Sbjct  202   AQVLKANQTTIVTEKAPVAANQSTNSPAKSDSVNKVSSGKGEKS--------VAQKGVVS  253

Query  766   --TSSTVKNDMIGEN-----GSEL-----LRKGRSFYSDCDIFDGEWVRDDTKPYYPPGS  909
               T+S  K    G+N     GS L     +        +CD+FDGEWV+D++ P Y PGS
Sbjct  254   NYTASLTKKQGNGKNQGNGSGSRLPAKRGIENLIESLMNCDLFDGEWVKDNSYPLYKPGS  313

Query  910   CPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNM  1089
             C FID  F C  + RPD  + K +W+P  C +P  N    LE LRG++LVFVGDSLNRNM
Sbjct  314   CSFIDEQFSCVPNGRPDRDFQKLKWKPKGCTLPRLNGGHMLELLRGKRLVFVGDSLNRNM  373

Query  1090  WESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKG  1269
             WESLVCILR   ++ K VFE  GR  F+ +  Y+F F+DYNC+++F  SPFLVRE     
Sbjct  374   WESLVCILRGAAKNPKNVFEAHGRHYFRGEASYSFIFKDYNCTLEFFVSPFLVREWEMPD  433

Query  1270  VNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVL  1446
              NG+  ETLRLDL+ K++  Y  ADI+IFNTGHWWTHEKTS+G+DYYQEG+ V+  L VL
Sbjct  434   KNGTKKETLRLDLVGKSSDQYKSADILIFNTGHWWTHEKTSKGKDYYQEGSHVYNELNVL  493

Query  1447  EAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             EA++RAL TWARWVD  V+  ++ V FRGYSA+H
Sbjct  494   EAFRRALTTWARWVDARVNPMKSMVFFRGYSASH  527



>ref|XP_006407376.1| hypothetical protein EUTSA_v10020451mg [Eutrema salsugineum]
 gb|ESQ48829.1| hypothetical protein EUTSA_v10020451mg [Eutrema salsugineum]
Length=548

 Score =   299 bits (766),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 209/326 (64%), Gaps = 9/326 (3%)
 Frame = +1

Query  589   NRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRS-----RGVGVEI  753
             N + + KNV F   T    +G+      S      ++    N +++ S     R V + +
Sbjct  101   NLTPVTKNVTFESPT---ANGTKPLAFLSQTDHAGENMSCPNNNKTASISDKHRAVKIPL  157

Query  754   SKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDF  933
             S     ++  + M  ++    +R+      +CD F+G WV+DD+ P Y PGSC  ID  F
Sbjct  158   SDDLAVNSSASPMRKQSRKSSMRREIETLKNCDFFEGVWVKDDSYPLYKPGSCNVIDEQF  217

Query  934   DCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCIL  1113
             +C  + RPD  + K +W+P  C++P  N    LE +RG++LVFVGDSLNRNMWESLVCIL
Sbjct  218   NCISNGRPDVNFHKLKWKPKKCNLPRLNGGKLLEMIRGKRLVFVGDSLNRNMWESLVCIL  277

Query  1114  RHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FET  1290
             +  V+D+ +VFE  GR  F+ +  Y+F F+DY+C+V+F +SPFLV+E      NG+  ET
Sbjct  278   KGSVKDESQVFEAHGRHHFRWEAEYSFVFKDYDCTVEFYASPFLVQEWEVSDKNGTKKET  337

Query  1291  LRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALY  1470
             LRLDLM K++  Y  AD+++FNTGHWWTH+KTS+GEDYYQEGN V+P+L+V EA+++AL 
Sbjct  338   LRLDLMGKSSEQYKGADVLVFNTGHWWTHDKTSKGEDYYQEGNNVYPKLDVDEAFQKALT  397

Query  1471  TWARWVDKNVDANRTEVIFRGYSATH  1548
             TW +WVDKNV   +T V FRGYS +H
Sbjct  398   TWGQWVDKNVKQKKTLVFFRGYSPSH  423



>ref|XP_009376704.1| PREDICTED: protein trichome birefringence-like 4 [Pyrus x bretschneideri]
Length=621

 Score =   301 bits (771),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/348 (46%), Positives = 217/348 (62%), Gaps = 30/348 (9%)
 Frame = +1

Query  574   KTHELNRSEIGKNVNFTGFTEK----KGD---GSGKNGGFSLEGET-VKSEGSENGDRSR  729
             K H++++ +IG     + F EK    KGD       N    L   T ++S G   G R R
Sbjct  154   KGHKVDKHQIG----LSQFPEKNERLKGDNNNAQSSNPILLLSNNTEIESSGKMEGSRRR  209

Query  730   SRGV--------------GVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGE  867
             +                 G   SKK T S   +       SEL  K     + CDIFDG 
Sbjct  210   NENKKHAHSHSPSSKDSNGKHGSKKKTDSKKVSSKKQGKQSELKSK---LMNGCDIFDGR  266

Query  868   WVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRG  1047
             WVRD + P Y PGSCP+ID  FDC L+ RPD+ Y ++RW+P  C+IP  N    L  L G
Sbjct  267   WVRDASYPLYAPGSCPWIDEPFDCFLNGRPDNGYERYRWQPKRCNIPRLNGKKMLRLLTG  326

Query  1048  QKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDF  1227
             +++VFVGDSLNRNMWESL+C+LR+ V DK +V+E+SGR +F+ +G Y+F FE+YNCSV+F
Sbjct  327   KRVVFVGDSLNRNMWESLLCVLRNSVDDKNKVYEVSGRQEFRTEGSYSFVFEEYNCSVEF  386

Query  1228  VSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDY  1404
               S FLV+E      +GS  ETLR+DL+++++  Y +AD++IFNTGHWWTHEKTS G+ Y
Sbjct  387   FQSRFLVQEWEMLEPSGSKKETLRIDLIERSSDNYKNADVLIFNTGHWWTHEKTSSGKGY  446

Query  1405  YQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             YQEG+ ++  L+V  A+++AL TWARW+D NV+  +T V FRGYS +H
Sbjct  447   YQEGSHIYGELKVDNAFRKALTTWARWIDTNVNPKKTAVFFRGYSPSH  494



>gb|EMS48369.1| hypothetical protein TRIUR3_11824 [Triticum urartu]
Length=426

 Score =   295 bits (755),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 180/263 (68%), Gaps = 17/263 (6%)
 Frame = +1

Query  760   KGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDC  939
             KG ++   N   G   ++L          CD+F G WVRDD+ P YP GSCP +D  F+C
Sbjct  66    KGHAAQATNSSAGGQATKL--HSIDAMGRCDMFYGNWVRDDSYPLYPEGSCPHVDESFNC  123

Query  940   HLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRH  1119
             HL+ RPD AY + RW+P  C IP  N TD LERLRG++LVFVGDSLNRNMWESLVCILR+
Sbjct  124   HLNGRPDKAYQRLRWQPRGCSIPRLNPTDMLERLRGKRLVFVGDSLNRNMWESLVCILRN  183

Query  1120  VVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFETLRL  1299
              V+DK+RVFE+SG   F+ +G Y+F F+++   V                     ETLRL
Sbjct  184   SVKDKRRVFEVSGNHKFRAEGSYSFLFQEWEIPVTH---------------GKKKETLRL  228

Query  1300  DLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWA  1479
             D +D+++S Y +AD+++FNTGHWWTHEKTS G+DYYQEGN+V+  L V +A++RAL TWA
Sbjct  229   DKIDQSSSRYKNADVIVFNTGHWWTHEKTSLGKDYYQEGNQVYSELNVHDAFRRALNTWA  288

Query  1480  RWVDKNVDANRTEVIFRGYSATH  1548
             +WVD N++  +T V+FRGYS++H
Sbjct  289   KWVDSNINPKKTTVLFRGYSSSH  311



>emb|CDY00034.1| BnaC09g02670D [Brassica napus]
Length=450

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 177/239 (74%), Gaps = 3/239 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             + CDIFDG WV DDTKP Y PG CPF++  F+C  + RPD  ++++RW+PH C IP F+ 
Sbjct  91    TSCDIFDGSWVFDDTKPVYSPGYCPFVEDKFNCFKNGRPDSGFLRYRWQPHGCSIPRFDG  150

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISG-RSDFKKKGFYAFR  1197
                L+ LRG++LVFVGDSLNRNMWESLVC LR  + DK RV ++S  RS+ + +GFY FR
Sbjct  151   KKMLKILRGKRLVFVGDSLNRNMWESLVCSLRSALEDKNRVSKVSWRRSNLQNEGFYGFR  210

Query  1198  FEDYNCSVDFVSSPFLVRESS-FKGVNGSFETLRLDLMDKTT-SMYNDADIVIFNTGHWW  1371
             F+D+ CSVDF+ SPFLV+ES    G     ETLRLD++  +   +Y DADI++FNTGHWW
Sbjct  211   FKDFGCSVDFIKSPFLVQESEVLDGYGKRKETLRLDVIQGSIKKIYKDADIIVFNTGHWW  270

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TH+KT  G+DYYQEGNRV+ +L V EAY RAL+TW+ WVD N++  +T V F GYS++H
Sbjct  271   THQKTYEGKDYYQEGNRVYEKLGVKEAYTRALHTWSDWVDSNINMTKTRVFFVGYSSSH  329



>ref|XP_011083135.1| PREDICTED: protein trichome birefringence-like 4 [Sesamum indicum]
Length=589

 Score =   299 bits (766),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 153/343 (45%), Positives = 220/343 (64%), Gaps = 17/343 (5%)
 Frame = +1

Query  535   SGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSEN  714
             S  A  GS+ ++     LN +    N    G  E         G   +   +VK+E S++
Sbjct  131   SALAPSGSYSVY-----LNATSSSGNGTLAGNVENNPTVVPSPG---INSVSVKNETSDH  182

Query  715   GDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELL-RKGRS---FYSDCDIFDGEWVRDD  882
             G      G G + +    ++  + D     G  ++ RKG++     S CDI+DG+WVRDD
Sbjct  183   G----MTGNGNQNAGSKNTTLSRGDRNRGGGKPMVKRKGKNWLKMMSKCDIYDGKWVRDD  238

Query  883   TKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVF  1062
               P Y  GSCP ID  F+C+++ RPD  Y  +RW+PH C +P  +    L   RG+++V+
Sbjct  239   RPPLYERGSCPHIDEPFNCYVNGRPDYGYENYRWQPHHCKLPRLDGGKMLNFFRGKRIVY  298

Query  1063  VGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPF  1242
             VGDSLNRNMWES+VC+LR+ V+DK RVFE+SGR+DFKK+G Y+F F DYN SV+++ S F
Sbjct  299   VGDSLNRNMWESMVCLLRNAVKDKNRVFEVSGRNDFKKEGAYSFLFLDYNFSVEYIRSAF  358

Query  1243  LVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGN  1419
             LV+E   +  NGS  ETLRLDL++K+   + DAD++ FNTG+WWTHEKTS G+ YYQEG+
Sbjct  359   LVQEWEVQTANGSTKETLRLDLVEKSYETFKDADVLNFNTGNWWTHEKTSEGKGYYQEGD  418

Query  1420  RVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
              +H +L+V+EA+ +A+ TWARW++ N++  +T V FRGYS +H
Sbjct  419   HIHEQLDVVEAFDKAMTTWARWLEANINPMKTHVFFRGYSFSH  461



>ref|XP_004303340.1| PREDICTED: uncharacterized protein LOC101308299 [Fragaria vesca 
subsp. vesca]
Length=610

 Score =   300 bits (767),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 179/235 (76%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD+F GEWV DD+ P Y PGSCP ID  F+C  + RPD  Y K++W+P  C +P  +A+ 
Sbjct  253   CDLFHGEWVEDDSYPLYEPGSCPLIDEQFNCIRNGRPDKDYQKFKWQPKDCTLPRLDASH  312

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              +E LRG++LVFVGDSLNRNMWESL+CILR+  +DK +V+E  GR+ F+ +  Y+F F+D
Sbjct  313   MIELLRGKRLVFVGDSLNRNMWESLICILRNSAKDKSKVYEAHGRTHFRGEASYSFIFKD  372

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YN +V+F  SPFLVRE      +GS  ETLRLDL+ +++ +Y DADI+IFNTGHWWTH+K
Sbjct  373   YNFTVEFFVSPFLVREWEMPDKDGSKKETLRLDLVGRSSELYKDADILIFNTGHWWTHDK  432

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             T++G+DYYQEG+ V+  L VLEA+++AL TW+RWVD +VD  ++ V FRGYSA+H
Sbjct  433   TAKGKDYYQEGSHVYGELNVLEAFRKALTTWSRWVDASVDTAKSMVFFRGYSASH  487



>ref|XP_009364158.1| PREDICTED: protein trichome birefringence-like 1 [Pyrus x bretschneideri]
Length=620

 Score =   300 bits (767),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/288 (49%), Positives = 199/288 (69%), Gaps = 16/288 (6%)
 Frame = +1

Query  688   TVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGE  867
             + K    + G + +S    V   K+G  S +K+ ++  NG             CDIFDG 
Sbjct  221   STKDSNGKRGSKKKSDRKKVSSKKQGKQSELKSKLM--NG-------------CDIFDGR  265

Query  868   WVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRG  1047
             WVRD++ P Y PGSCP+ID  FDC L+ RPD+ Y ++RW+P +C+IP  N    L  L G
Sbjct  266   WVRDNSYPLYAPGSCPWIDEPFDCFLNGRPDNGYERYRWQPKSCNIPRLNGKKMLRLLTG  325

Query  1048  QKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDF  1227
             ++LVFVGDSLNRNMWESL+CILR+ V +K +V+E+SGR +F+ +G Y+F F++YNCSV+F
Sbjct  326   KRLVFVGDSLNRNMWESLLCILRNSVDNKNKVYEVSGREEFRTEGSYSFIFKEYNCSVEF  385

Query  1228  VSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDY  1404
               S FLV+E      +GS  ETLR+DL+++++  Y +AD++IFNTGHWWTHEKT  G+ Y
Sbjct  386   FQSRFLVQEWEMPEPSGSKKETLRIDLIERSSDNYKNADVLIFNTGHWWTHEKTLSGKGY  445

Query  1405  YQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             YQEG+ ++  L+V +A+++AL TWARW+D NV+  +T V FRGYS +H
Sbjct  446   YQEGSHIYGELDVDDAFRKALSTWARWIDTNVNPKKTAVFFRGYSPSH  493



>emb|CDX81015.1| BnaC03g02690D [Brassica napus]
Length=519

 Score =   296 bits (759),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 204/330 (62%), Gaps = 10/330 (3%)
 Frame = +1

Query  589   NRSEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRS----RSRGVGVEIS  756
             NR+ + KN         +     K         T  S  +   D +    +S  V V   
Sbjct  71    NRTPVAKNATSESPIVNRTKPVAKTNTSQPLLPTKSSNQTRTADEALSPAKSPPVSVADR  130

Query  757   KKGTSSTVKNDMIGENGS-----ELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFI  921
                ++S+  +    + GS     + ++K      DC+ FDGEW+ DD+ P Y PGSC  I
Sbjct  131   TVNSTSSTPSKPGKQTGSVSLLEQEIKKWSESLKDCEFFDGEWIMDDSYPLYKPGSCNII  190

Query  922   DRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESL  1101
             D  F+C  + RPD  + K +W+P  C +P  N    LE LRG++LVFVGDSLNRNMWESL
Sbjct  191   DEQFNCISNGRPDKDFQKLKWKPKKCSLPRLNGGIMLEMLRGRRLVFVGDSLNRNMWESL  250

Query  1102  VCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS  1281
             VC+L+  V+D+ +V+E SGR  F+ +  Y+F F+DYNC+V+F  SPFLV+E+      G+
Sbjct  251   VCMLKGSVKDESKVYEASGRHHFRGEAEYSFVFQDYNCTVEFFVSPFLVQENEIVDKKGT  310

Query  1282  -FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYK  1458
               ETLRLDL+ K++  Y  ADI++FNTGHWWTHEKTS+GEDYYQEG+ V+  L V EA++
Sbjct  311   KKETLRLDLVGKSSEQYKGADIIVFNTGHWWTHEKTSKGEDYYQEGSNVYHELAVHEAFR  370

Query  1459  RALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +AL TW RWV+KNV+ N++ V FRGYSA+H
Sbjct  371   KALTTWGRWVEKNVNPNKSLVFFRGYSASH  400



>ref|XP_009125778.1| PREDICTED: protein trichome birefringence-like [Brassica rapa]
Length=525

 Score =   296 bits (759),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 145/291 (50%), Positives = 200/291 (69%), Gaps = 14/291 (5%)
 Frame = +1

Query  688   TVKSEGSENGDRSRSRG---VGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIF  858
             T+ S+   N   + SR    V V+++   +SS+VK ++  E  SE L+       +C+ F
Sbjct  132   TLTSDDVRNQTAAPSRSEAPVSVDVTA-SSSSSVKQEV--EKWSESLK-------NCEFF  181

Query  859   DGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLER  1038
             DGEW++DDT P Y PGSC  +D  F+C  + RPD  + K +W+P  C +P  N    LE 
Sbjct  182   DGEWIKDDTYPLYEPGSCKIVDEQFNCISNGRPDKDFQKLKWKPKTCTLPRLNGGIMLEM  241

Query  1039  LRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCS  1218
             LRG++L FVGDSLNRNMWESLVC+L+  V+D+ +V+E  GR  F+ +  Y+F F+D+NC+
Sbjct  242   LRGRRLAFVGDSLNRNMWESLVCMLKGSVKDESKVYEARGRYHFRGEAEYSFVFQDFNCT  301

Query  1219  VDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRG  1395
             V+F  SPFLV+ES      G+  ETLRLDL+ K++  Y  ADI++FNTGHWWTHEKTS+G
Sbjct  302   VEFFVSPFLVQESEIVDKKGTKKETLRLDLIGKSSEQYKGADIIVFNTGHWWTHEKTSKG  361

Query  1396  EDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             EDYYQEG+ V+  L VLEA+++AL TW RWV+KNV+  ++ V FRG+SATH
Sbjct  362   EDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPEKSLVFFRGFSATH  412



>gb|ABK28553.1| unknown [Arabidopsis thaliana]
Length=557

 Score =   298 bits (762),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/245 (56%), Positives = 179/245 (73%), Gaps = 1/245 (0%)
 Frame = +1

Query  817   LRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHA  996
             LRK       C+ F+G+WV+DD+ P Y PGSC  ID  F+C  + RPD  + K +W+P  
Sbjct  186   LRKVIESLKSCEFFEGDWVKDDSYPLYKPGSCNLIDEQFNCISNGRPDVDFQKLKWKPKQ  245

Query  997   CDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKK  1176
             C +P  N    LE +RG++LVFVGDSLNRNMWESLVCIL+  V+D+ +VFE  GR  F+ 
Sbjct  246   CSLPRLNGGKLLEMIRGRRLVFVGDSLNRNMWESLVCILKGSVKDESQVFEAHGRHQFRW  305

Query  1177  KGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIF  1353
             +  Y+F F+DYNC+V+F +SPFLV+E      NG+  ETLRLDL+ K++  Y  ADI++F
Sbjct  306   EAEYSFVFKDYNCTVEFFASPFLVQEWEVTEKNGTKKETLRLDLVGKSSEQYKGADILVF  365

Query  1354  NTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRG  1533
             NTGHWWTHEKTS+GEDYYQEG+ VHP+L+V EA+++AL TW RWVDKNV+  ++ V FRG
Sbjct  366   NTGHWWTHEKTSKGEDYYQEGSTVHPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRG  425

Query  1534  YSATH  1548
             YS +H
Sbjct  426   YSPSH  430



>ref|NP_187813.1| protein TRICHOME BIREFRINGENCE-LIKE 1 [Arabidopsis thaliana]
 sp|Q9LHL6.1|TBL1_ARATH RecName: Full=Protein trichome birefringence-like 1 [Arabidopsis 
thaliana]
 gb|AAG51057.1|AC069473_19 unknown protein; 38990-36982 [Arabidopsis thaliana]
 dbj|BAB03118.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE65935.1| unknown [Arabidopsis thaliana]
 gb|AEE75143.1| uncharacterized protein AT3G12060 [Arabidopsis thaliana]
Length=556

 Score =   297 bits (761),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/245 (56%), Positives = 179/245 (73%), Gaps = 1/245 (0%)
 Frame = +1

Query  817   LRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHA  996
             LRK       C+ F+G+WV+DD+ P Y PGSC  ID  F+C  + RPD  + K +W+P  
Sbjct  186   LRKVIESLKSCEFFEGDWVKDDSYPLYKPGSCNLIDEQFNCISNGRPDVDFQKLKWKPKQ  245

Query  997   CDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKK  1176
             C +P  N    LE +RG++LVFVGDSLNRNMWESLVCIL+  V+D+ +VFE  GR  F+ 
Sbjct  246   CSLPRLNGGKLLEMIRGRRLVFVGDSLNRNMWESLVCILKGSVKDESQVFEAHGRHQFRW  305

Query  1177  KGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIF  1353
             +  Y+F F+DYNC+V+F +SPFLV+E      NG+  ETLRLDL+ K++  Y  ADI++F
Sbjct  306   EAEYSFVFKDYNCTVEFFASPFLVQEWEVTEKNGTKKETLRLDLVGKSSEQYKGADILVF  365

Query  1354  NTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRG  1533
             NTGHWWTHEKTS+GEDYYQEG+ VHP+L+V EA+++AL TW RWVDKNV+  ++ V FRG
Sbjct  366   NTGHWWTHEKTSKGEDYYQEGSTVHPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRG  425

Query  1534  YSATH  1548
             YS +H
Sbjct  426   YSPSH  430



>emb|CDY14070.1| BnaC02g01870D [Brassica napus]
Length=460

 Score =   294 bits (753),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 174/236 (74%), Gaps = 1/236 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             DC+ FDGEW++DDT P Y PGSC  +D  F+C  + RPD  + K +W+P  C +P  N  
Sbjct  168   DCEFFDGEWIKDDTYPLYEPGSCKIVDEQFNCISNGRPDKDFQKLKWKPTKCTLPRLNGG  227

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               LE LRG++L FVGDSLNRNMWESLVC+L+  V+D+ +V+E  GR  F+ +  Y+F F+
Sbjct  228   IMLEMLRGRRLAFVGDSLNRNMWESLVCMLKGSVKDESKVYEARGRFHFRGEAEYSFVFQ  287

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             DYNC+V+F  SPFLV+ES      G+  ETLRLDL+ K++  Y  ADI++FNTGHWWTHE
Sbjct  288   DYNCTVEFFVSPFLVQESEIVDKKGTKKETLRLDLIGKSSEQYKGADIIVFNTGHWWTHE  347

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS+GEDYYQEG+ V+  L VLEA+++AL TW RWV+KNV+  ++ V FRG+SATH
Sbjct  348   KTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPEKSLVFFRGFSATH  403



>ref|XP_006282292.1| hypothetical protein CARUB_v10028578mg [Capsella rubella]
 gb|EOA15190.1| hypothetical protein CARUB_v10028578mg [Capsella rubella]
Length=460

 Score =   294 bits (753),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 182/239 (76%), Gaps = 3/239 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             + CDIFDG WV DD++P Y PG CP+++  F+C+ + RPD  +++ RW+PH C IP F+ 
Sbjct  101   TSCDIFDGTWVFDDSEPVYSPGYCPYVEDKFNCYKNGRPDSGFLRHRWQPHGCSIPRFDG  160

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR-SDFKKKGFYAFR  1197
                L+ LRG+++VFVGDSLNRNMWESLVC LR  + DK RV ++SG+ S+   +GFY FR
Sbjct  161   KKMLKILRGKRVVFVGDSLNRNMWESLVCSLRSTLEDKNRVSKVSGKQSNLHNEGFYGFR  220

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKT-TSMYNDADIVIFNTGHWW  1371
             F+D++CSVDF+ SPFLV+ES    V G   ETLRLD++ ++ T +Y +ADIVIFNTGHWW
Sbjct  221   FKDFDCSVDFIKSPFLVQESEVLDVYGKRRETLRLDMVQRSMTKIYKNADIVIFNTGHWW  280

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TH+KT+ G+ Y+QEG RV+ RLEV EAY +AL+TWA WVD N+++ +T V F GYS++H
Sbjct  281   THQKTNEGKGYFQEGKRVYERLEVKEAYTKALHTWADWVDSNINSTKTRVFFVGYSSSH  339



>gb|KFK25082.1| hypothetical protein AALP_AA8G063700 [Arabis alpina]
Length=587

 Score =   298 bits (763),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 151/341 (44%), Positives = 209/341 (61%), Gaps = 23/341 (7%)
 Frame = +1

Query  595   SEIGKNVNFTGFTEKKGDGSGKNGGF--------------SLEGETVKSEGSENGDRSRS  732
             SEI KN        +K     KN  F              SL  +T  ++       +++
Sbjct  128   SEIVKNDTLQAPAPEKQTPVTKNVTFESPIVNRTNPLFSASLSNQTRTNQTKAAPAPTKA  187

Query  733   RGVGVEISKKGTSSTVKNDMIGENGS--------ELLRKGRSFYSDCDIFDGEWVRDDTK  888
               V V++  K  SST  +  + ++G+        + + K      +C+ FDGEW+ DD+ 
Sbjct  188   APVSVDLKAKSNSSTGSSKPVKQSGNSDLGSLVKQEIEKWSESLKNCEFFDGEWIMDDSY  247

Query  889   PYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVG  1068
             P Y PGSC  ID  F+C  + RPD  + K +W+P  C +P  N    LE LRG++LVFVG
Sbjct  248   PLYKPGSCKIIDEQFNCISNGRPDKDFQKLKWKPKKCSLPRLNGPILLEMLRGRRLVFVG  307

Query  1069  DSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLV  1248
             DSLNRNMWESLVC L+  V+D+ +V+E  GR  F+ +  Y+F F+DYNC+V+F  SPFLV
Sbjct  308   DSLNRNMWESLVCFLKGSVKDESKVYEARGRHHFRGEAEYSFVFQDYNCTVEFFVSPFLV  367

Query  1249  RESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRV  1425
             +E+      G+  ETLRLDL+ K++  Y  ADI++FNTGHWWTHEKTS+GEDYYQEG+ V
Sbjct  368   QETEIVDKKGTKKETLRLDLVGKSSEQYKGADIIVFNTGHWWTHEKTSKGEDYYQEGSNV  427

Query  1426  HPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +  L VLEA+++AL TW RWV+KNV+  ++ V FRGYSA+H
Sbjct  428   YHELAVLEAFRKALTTWGRWVEKNVNPEKSLVFFRGYSASH  468



>ref|XP_010672635.1| PREDICTED: protein trichome birefringence-like 1 [Beta vulgaris 
subsp. vulgaris]
Length=602

 Score =   298 bits (764),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/290 (50%), Positives = 197/290 (68%), Gaps = 10/290 (3%)
 Frame = +1

Query  691   VKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYS---DCDIFD  861
             +KS G E G +      GV + K+  SS  +ND       +  +K ++  S   +CD++D
Sbjct  206   IKSGGDEKGVKED----GVVLQKERKSS--RNDTGSGEPQKQEKKEKNLVSSLIECDLYD  259

Query  862   GEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERL  1041
             G+WVRDD+ P Y PGSC  +D  F+C L+ RPD+ Y K +W+P  C +P  N    L+ L
Sbjct  260   GDWVRDDSYPLYEPGSCKIVDEQFNCILNGRPDNDYQKLKWKPKGCTLPRMNGRQMLKLL  319

Query  1042  RGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSV  1221
             RG++LVFVGDSLNRNMWESLVCIL+  V+  K VFE  GR  F+ +  Y+F F+DYNC+V
Sbjct  320   RGKRLVFVGDSLNRNMWESLVCILKSSVKHPKNVFEAYGRHTFRTEASYSFVFKDYNCTV  379

Query  1222  DFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGE  1398
             +F  +PFLV+    K  NG+  ETLRLD++ +    + DAD V+FNTGHWWTHEKTS+GE
Sbjct  380   EFFVAPFLVQPWDVKDKNGTMKETLRLDVVVEEAIHFKDADFVVFNTGHWWTHEKTSKGE  439

Query  1399  DYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             DYYQEG+ V+ +L+V EA+++A+ TW RWVD N++  RT V FRGYS+TH
Sbjct  440   DYYQEGSNVYKQLDVQEAFRKAVTTWGRWVDANINPQRTHVFFRGYSSTH  489



>ref|NP_199745.1| protein TRICHOME BIREFRINGENCE-LIKE [Arabidopsis thaliana]
 sp|Q9FJ06.1|TBL4_ARATH RecName: Full=Protein trichome birefringence-like 4 [Arabidopsis 
thaliana]
 dbj|BAB10352.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95799.1| protein trichome birefringence-like 4 [Arabidopsis thaliana]
Length=457

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 178/239 (74%), Gaps = 3/239 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             + CDIFDG WV DD++P Y PG CPF++  F+C  + RPD  +++ RW+PH C IP F+ 
Sbjct  98    ASCDIFDGTWVFDDSEPVYLPGYCPFVEDKFNCFKNGRPDSGFLRHRWQPHGCSIPRFDG  157

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR-SDFKKKGFYAFR  1197
                L+ LRG+++VFVGDSLNRNMWESLVC LR  + DK RV +I G+ S+   +GFY FR
Sbjct  158   KKMLKMLRGKRVVFVGDSLNRNMWESLVCSLRSTLEDKNRVSKIIGKQSNLPNEGFYGFR  217

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKT-TSMYNDADIVIFNTGHWW  1371
             F D+ CS+DF+ SPFLV+ES    V G   ETLRLD++ ++ T +Y +ADIVIFNTGHWW
Sbjct  218   FNDFECSIDFIKSPFLVQESEVVDVYGKRRETLRLDMIQRSMTKIYKNADIVIFNTGHWW  277

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TH+KT  G+ YYQEGNRV+ RLEV EAY +A++TWA WVD N+++ +T V F GYS++H
Sbjct  278   THQKTYEGKGYYQEGNRVYERLEVKEAYTKAIHTWADWVDSNINSTKTRVFFVGYSSSH  336



>ref|XP_009122281.1| PREDICTED: protein trichome birefringence [Brassica rapa]
Length=644

 Score =   299 bits (766),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 230/387 (59%), Gaps = 28/387 (7%)
 Frame = +1

Query  451   FFNPVVQGLNGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELN-RSEIGKNVNFTG  627
             F +PVV G N    +N+T+    PE   +  AK+ +F     +  +N  + + KN     
Sbjct  146   FESPVVNGTNPVA-KNSTLQSPAPESR-TPVAKNATF----VSPVVNGTNPVAKNSTLQS  199

Query  628   FTEKKGDGSGKNGGF--------SLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVK  783
                +K     KN  F        +   + +  + S  G  +++R    ++  + +   V 
Sbjct  200   PAPEKRTPVAKNTTFVSPVVNGTNPASQPMLPDKSPTGSSNQTRTTD-DVRNETSVPPVS  258

Query  784   NDMIGENGS-----------ELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRD  930
              D+   + S           + + K      +C+ FDGEW+RD+T P Y PGSC  ID  
Sbjct  259   VDLTANSSSSSKGDSVSSVKQEIEKWSESLKNCEFFDGEWIRDETYPLYKPGSCKLIDEQ  318

Query  931   FDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCI  1110
             F+C  + RPD  + K +W+P  C +P  +    LE LRG++LVFVGDSLNRNMWESLVCI
Sbjct  319   FNCISNGRPDKDFQKLKWKPKKCSLPRLSGGILLEMLRGRRLVFVGDSLNRNMWESLVCI  378

Query  1111  LRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FE  1287
             L+  V+D+ +V+E  GR  F+ +  Y+F F+DYNC+V+F  SPFLV+E+      G+  E
Sbjct  379   LKGSVKDESKVYEARGRHHFRGEAEYSFVFQDYNCTVEFFVSPFLVQETEIVDKKGTKKE  438

Query  1288  TLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRAL  1467
             TLRLDL+ K++  Y  ADI++FNTGHWWTHEKTS+GEDYYQEG+ V+  L VLEA+++AL
Sbjct  439   TLRLDLVGKSSEQYKGADIIVFNTGHWWTHEKTSKGEDYYQEGSNVYHELAVLEAFRKAL  498

Query  1468  YTWARWVDKNVDANRTEVIFRGYSATH  1548
              TW RWV+KNV+ N++ V FRGYSA+H
Sbjct  499   TTWGRWVEKNVNPNKSLVFFRGYSASH  525



>ref|XP_002534436.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27946.1| conserved hypothetical protein [Ricinus communis]
Length=566

 Score =   297 bits (761),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 176/235 (75%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             C+IFDG WVRDD+ P + PGSCP I   F+C ++ R D+ Y K+RW+P  C+IP  N  +
Sbjct  214   CNIFDGRWVRDDSYPLFKPGSCPHIAEPFNCFMNGRKDNGYQKYRWQPDHCNIPRLNGRN  273

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LE LRG++LVF+GDSLNRNMWES+VCILR+ V+DK +VFE SGR +FK +G Y+F FED
Sbjct  274   MLEILRGKRLVFIGDSLNRNMWESMVCILRNAVKDKSKVFEASGREEFKTEGSYSFMFED  333

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YNCSV+F  S FLVRE    G NGS  ETLR+D+++ +   Y +AD+++FNTGHWWTHEK
Sbjct  334   YNCSVEFFRSNFLVREWEMLGTNGSKKETLRIDMVESSADKYKNADVLVFNTGHWWTHEK  393

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS G+ YYQEG+ ++  L V  A+++A+ TWA WV+ NVD  +T V+FR YS +H
Sbjct  394   TSSGKGYYQEGDHIYDELNVDVAFRKAMTTWANWVEANVDPVKTLVVFRSYSVSH  448



>gb|EPS66265.1| hypothetical protein M569_08511, partial [Genlisea aurea]
Length=354

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 176/239 (74%), Gaps = 3/239 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDD-TKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFN  1017
             ++CD+FDG+WVRD+  +P Y PGSC  ID  FDC  + RPD  Y K RW+P AC +P  +
Sbjct  5     ANCDLFDGDWVRDEWDEPLYKPGSCSVIDEQFDCFSNGRPDTDYFKLRWKPRACTLPRLD  64

Query  1018  ATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFR  1197
                 LE LRG++LVFVGDSLNRNMWESL+CIL++ V D K+VFE  GR  F++   ++F 
Sbjct  65    GRKMLELLRGKRLVFVGDSLNRNMWESLICILKNAVVDPKKVFEQQGRQHFREDASFSFL  124

Query  1198  FEDY-NCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWW  1371
             F+DY N +V+F  SPFLV+E      NG+  ETLRLDLM+K ++ Y DAD+++FNTGHWW
Sbjct  125   FQDYGNFTVEFFVSPFLVQEWHVFDSNGTRKETLRLDLMNKASARYKDADVIVFNTGHWW  184

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             THEKTS G+DYYQEG  VH  L  LEA++RAL TW RWVD NVD +++ V FRGYSA+H
Sbjct  185   THEKTSTGKDYYQEGRHVHQDLNALEAFRRALTTWGRWVDSNVDRDKSLVFFRGYSASH  243



>ref|XP_010535816.1| PREDICTED: protein trichome birefringence-like 5 [Tarenaya hassleriana]
Length=508

 Score =   295 bits (755),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/357 (43%), Positives = 217/357 (61%), Gaps = 34/357 (10%)
 Frame = +1

Query  529   NFSGEAKDGSFGLWKKTHELNR--SEIGKNVNFTGFTEKKGDGSGKNGGFSLEGETVKSE  702
             N S E  DG  G+   +   +R  S  G +V     TE+ GD +G       +G  V++E
Sbjct  56    NPSDEPPDGGDGVSLASEPSSRRDSRAGDDVGVKPETEEGGDSNG-------DGSAVEAE  108

Query  703   GSENGDR--------------SRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFY  840
               + GD                 SRG  V +  K  S     DM      E++ K R   
Sbjct  109   SGDGGDSRATDDFAVKPETEGGESRGGEVSVEGKEESDAKSVDM------EVVEKMRG--  160

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
               CD++ G WV+DD  P Y PGSCP++D  FDC  + R D  Y++WRW+P  CD+P FNA
Sbjct  161   --CDLYKGTWVKDDQYPLYQPGSCPYVDEAFDCQRNGRRDSDYLQWRWKPDDCDLPRFNA  218

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
             TDFL RLRG++L+ VGDS+NRN +ES++C+LR  + +K  ++E++G    K +G+Y F+F
Sbjct  219   TDFLARLRGKRLMLVGDSMNRNQFESMLCVLREGLSNKSSMYEVNGHKITKGRGYYVFKF  278

Query  1201  EDYNCSVDFVSSPFLVRESSFKGVNGSFE-TLRLDLMDKTTSMYNDADIVIFNTGHWWTH  1377
             EDYNC+V+FV S FLV+E       GS   TL +D +DKT + +  ADI++FNTGHWW H
Sbjct  279   EDYNCTVEFVRSHFLVKEGVRINAQGSSNPTLSIDQIDKTNARWKRADILVFNTGHWWVH  338

Query  1378  EKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
              KT+RG++YY+EG+ ++P+ +  EAY+RAL TWA+W+DKNV  ++  V +RGYS+ H
Sbjct  339   GKTARGKNYYKEGDYIYPKFDATEAYRRALRTWAKWIDKNVKPDKKLVFYRGYSSAH  395



>ref|XP_003535115.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN35654.1| hypothetical protein glysoja_041356 [Glycine soja]
Length=588

 Score =   297 bits (761),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/331 (45%), Positives = 210/331 (63%), Gaps = 20/331 (6%)
 Frame = +1

Query  580   HELNRSEIGKNVNFTGFTEK----KGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGV  747
             H + +     N N T  +++    K      NG        V   GS     S   G G 
Sbjct  151   HVVTKEPSSANNNHTRVSDEAKAVKKTNQSSNGVVPAAAPKVSGVGSNKNLSSLVNGGGT  210

Query  748   E---ISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPF  918
             E   +    T+S VK++M+     E L K       CD FDGEWV+DD+ P Y PGSC  
Sbjct  211   EKDVVHSNYTASRVKDEMM-----ESLIK-------CDFFDGEWVKDDSYPLYEPGSCNI  258

Query  919   IDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWES  1098
             +D  F C  + RPD  + K++W+P  C++P  +    L+ LRG++L+FVGDS+NRNMWES
Sbjct  259   VDEQFHCIQNGRPDKDFQKYKWKPKGCNLPRLDGHIMLDMLRGKRLIFVGDSINRNMWES  318

Query  1099  LVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG  1278
             L+CILR+ V+DK +V+E +GR  F+ +  Y+F F+DYN SV+   SPFLV+E   +  NG
Sbjct  319   LICILRNAVKDKSKVYEANGRVHFRGEASYSFVFKDYNFSVELFVSPFLVQEWEVQIKNG  378

Query  1279  S-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAY  1455
             +  ETLRLDL+ K++  Y +ADI+IFNTGHWWTH+KTS+G+DYYQEG+ V+  L VLEA+
Sbjct  379   TKKETLRLDLVGKSSVQYKNADIIIFNTGHWWTHDKTSKGKDYYQEGSHVYDELNVLEAF  438

Query  1456  KRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +RA+ TW+RW+D N++ +++ V FRGYSA+H
Sbjct  439   RRAITTWSRWIDANINPSKSMVFFRGYSASH  469



>ref|XP_003553434.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN45423.1| hypothetical protein glysoja_028430 [Glycine soja]
Length=615

 Score =   298 bits (763),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 176/235 (75%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD FDGEWV+DD  P Y P SC  ID  F+C  + RPD  Y K++W+P  C +P  +A  
Sbjct  262   CDFFDGEWVKDDAYPLYKPDSCSLIDEQFNCIRNGRPDKDYQKYKWKPKDCTLPRLDAHR  321

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              L+ LRG++LVFVGDSLNRNMWESL+CILR+ V++K  VFE +GR  F+ +  Y+F F+D
Sbjct  322   MLQLLRGKRLVFVGDSLNRNMWESLICILRNAVKNKHNVFEANGRVHFRGEAAYSFIFKD  381

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             Y+ SV+   SPFLV+E      NG+  ETLRLDL+ K++S Y DADI++FNTGHWWTH+K
Sbjct  382   YHFSVELFVSPFLVQEGEMTDKNGTKKETLRLDLVGKSSSQYKDADILVFNTGHWWTHDK  441

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS+G+DYYQEG+ V+  L VLEA++RAL TW++WVD N++ ++T V FRGYSA+H
Sbjct  442   TSKGQDYYQEGSHVYAELNVLEAFRRALTTWSKWVDANINPSKTMVFFRGYSASH  496



>gb|KFK26585.1| hypothetical protein AALP_AA8G267500 [Arabis alpina]
Length=457

 Score =   293 bits (750),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 178/239 (74%), Gaps = 3/239 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             S CD+FDG WV D+++P Y PG CPF++  F+C  + RPD  ++ +RW+PH C IP F+ 
Sbjct  97    SSCDLFDGTWVFDNSEPIYSPGLCPFVEDKFNCFKNGRPDSGFLSYRWQPHGCSIPRFDG  156

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR-SDFKKKGFYAFR  1197
                ++ LRG++LVFVGDSLNRNMWESLVC L   + D+ RV + SGR ++ + +GFY FR
Sbjct  157   KTMMDILRGKRLVFVGDSLNRNMWESLVCSLTSTLEDQNRVSKYSGRHNNLQNEGFYGFR  216

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKT-TSMYNDADIVIFNTGHWW  1371
             F D NCS+DF+ SPFLV+ES     NG   ETLRLD++ K+ T +Y +ADIVIFNTGHWW
Sbjct  217   FRDLNCSIDFIKSPFLVQESQVLDGNGKRRETLRLDVIQKSITELYRNADIVIFNTGHWW  276

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TH+KT +G+ YYQEGNRV+ RL V EAY +AL+TWA WVD N+++ +T V F GYS++H
Sbjct  277   THQKTYQGKGYYQEGNRVYERLRVKEAYTKALHTWAHWVDSNINSTKTRVFFVGYSSSH  335



>ref|XP_006299462.1| hypothetical protein CARUB_v10015627mg [Capsella rubella]
 gb|EOA32360.1| hypothetical protein CARUB_v10015627mg [Capsella rubella]
Length=546

 Score =   296 bits (757),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/338 (43%), Positives = 207/338 (61%), Gaps = 5/338 (1%)
 Frame = +1

Query  550   DGSFGLWKKTHELNRSEIGKNVNFT-GFTEKKGDGSGKNGGFSLEGETVKSEGSENG---  717
             D  F   +     N + + KNV F             +N  F  + +       ++    
Sbjct  89    DSDFTTLRAPAPENLAAVTKNVTFEFPIANVTTSPIAENNTFHFQTDHANMSCPDDNTAR  148

Query  718   DRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYY  897
             D ++ R     +S+    ++  +    +     LRK      +C+ F+G+WVRDD+ P Y
Sbjct  149   DLNKHRARKEPLSEVLAVNSTASPNRKQRRKSSLRKEIESLKNCEFFEGDWVRDDSYPLY  208

Query  898   PPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSL  1077
              PGSC  ID  F+C  + RPD  + K +W+P  C +P  N    LE +RG++LVFVGDSL
Sbjct  209   KPGSCNLIDEQFNCISNGRPDVEFQKLKWKPKKCTLPRLNGGKLLEMIRGRRLVFVGDSL  268

Query  1078  NRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRES  1257
             NRNMWESLVCIL+  V+D+ ++FE  GR  F+ +  Y+F F+DYNC+V+F +SPFLVRE 
Sbjct  269   NRNMWESLVCILKGSVKDESQIFEAHGRHQFRWEAEYSFVFKDYNCTVEFYASPFLVREW  328

Query  1258  SFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPR  1434
                  NG+  ETLRLDL+ K++  Y  ADI++FNTGHWWTHEKTS+GEDYYQEG  ++P+
Sbjct  329   EVMDKNGTKKETLRLDLVGKSSEQYRGADILVFNTGHWWTHEKTSKGEDYYQEGRNLYPK  388

Query  1435  LEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             L+V EA+++AL TW RWVDKNV+  ++ V FRGYS +H
Sbjct  389   LDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSH  426



>ref|XP_002534536.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27846.1| conserved hypothetical protein [Ricinus communis]
Length=618

 Score =   298 bits (762),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/289 (50%), Positives = 195/289 (67%), Gaps = 8/289 (3%)
 Frame = +1

Query  688   TVKSEGSENGDRSRSRG-VGVEISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDG  864
             ++ S  S  GD  +  G V  + +   T+S  K    G +  +L++   S    CD+FDG
Sbjct  216   SINSVSSGKGDFGKQEGRVAAKEASNYTASLSKKQSSGMD--DLVKSMLS----CDLFDG  269

Query  865   EWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLR  1044
             EWV+DD+ P Y PGSC  ID  F+C L+ RPD  Y K++W+P  C IP  N  + L+ L+
Sbjct  270   EWVKDDSYPLYKPGSCSLIDEQFNCILNGRPDKDYQKYKWKPKGCTIPRLNPANMLDMLK  329

Query  1045  GQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVD  1224
             G++LVFVGDSLNRNMWESLVC+L+  V+DK +VFE +GR  F+ +  Y+F F+DYN +V+
Sbjct  330   GKRLVFVGDSLNRNMWESLVCMLKGSVKDKSKVFEANGRHHFRGEASYSFIFKDYNFTVE  389

Query  1225  FVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGED  1401
             F  SPFLV+E      NG   ETLRLDL+   +  Y  ADI++FNTGHWWTHEKTS+G+ 
Sbjct  390   FFVSPFLVQEWEVADKNGKKKETLRLDLVGSLSDQYKGADIIVFNTGHWWTHEKTSKGKS  449

Query  1402  YYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             YYQEG  V+  L VLEA+++AL TWARWVD +V+  ++ V FRGYSA+H
Sbjct  450   YYQEGTHVYDELNVLEAFRKALTTWARWVDSHVNPAKSLVFFRGYSASH  498



>ref|XP_008361466.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=621

 Score =   298 bits (762),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 179/235 (76%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CDIFDG WVRD++ P Y PGSCP+ID  FDC L+ RPD+ Y ++RW+P  C+IP  N   
Sbjct  260   CDIFDGRWVRDNSYPLYAPGSCPWIDEPFDCFLNGRPDNGYERYRWQPKHCNIPRLNGKK  319

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              L  L G++LVFVGDSLNRNMWESL+CILR+ V +K +V+E+SGR +F+ +G Y+F FE+
Sbjct  320   MLRLLTGKRLVFVGDSLNRNMWESLLCILRNSVDNKNKVYEVSGRQEFRTEGSYSFIFEE  379

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YNCSV+F  S FLV+E      +GS  ETLR+DL+++++  Y +AD++IFNTGHWWTHEK
Sbjct  380   YNCSVEFFQSRFLVQEWEMPEPSGSKKETLRIDLIERSSBNYKNADVLIFNTGHWWTHEK  439

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             T  G+ YYQEG+ ++  L+V +A+++AL TWARW+D NV+  +T V FRGYS +H
Sbjct  440   TLSGKGYYQEGSHIYGELDVDDAFRKALSTWARWIDTNVNPKKTAVFFRGYSPSH  494



>gb|KHN37297.1| hypothetical protein glysoja_013512 [Glycine soja]
Length=526

 Score =   295 bits (754),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 178/239 (74%), Gaps = 1/239 (0%)
 Frame = +1

Query  835   FYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSF  1014
              + DCD+++G WVRDD+ P Y  GSCP+ID  F+C  + + ++ Y K+RW+P  C++P F
Sbjct  171   MWKDCDMYEGSWVRDDSYPLYIAGSCPYIDEPFNCFRNGKSENLYEKYRWQPKNCNVPRF  230

Query  1015  NATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAF  1194
              A D LE LRG++LVFVGDSLNRNMWESLVC+LR+ V D+ R+FE SGR +F+ +G Y+F
Sbjct  231   KANDMLEMLRGKRLVFVGDSLNRNMWESLVCVLRNSVEDQSRLFEASGREEFRTEGSYSF  290

Query  1195  RFEDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWW  1371
              F+DYNCSV+F  S FLV+E     + GS  ETLRLD+++++   Y DAD++IFNTGHWW
Sbjct  291   IFQDYNCSVEFFRSVFLVQEWETPDLKGSTKETLRLDVLERSCDKYKDADVLIFNTGHWW  350

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             THEK   G+ YYQEGN ++ ++ V EA+ +AL TWA+W+D N+D  +T V FRGYS +H
Sbjct  351   THEKRIEGKGYYQEGNHIYGQMNVEEAFHKALLTWAQWIDSNIDPKKTTVFFRGYSPSH  409



>ref|XP_011037956.1| PREDICTED: protein trichome birefringence-like [Populus euphratica]
Length=554

 Score =   295 bits (756),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/359 (43%), Positives = 218/359 (61%), Gaps = 11/359 (3%)
 Frame = +1

Query  478   NGFGYRNATVCCSPPEGNFSGEAKDGSFGLWKKTHELNRSEIGKNVNFTGFTEKKGDGSG  657
             +   +++ T+   P E   +    D  +G+     E N +     +   G  +       
Sbjct  78    SSLSHQHHTLLHVPNESPLA----DAKYGVHSLFQEYNLTSEKNPLLSAGLNDTVAQHGK  133

Query  658   KNGGFSLEGETVK-SEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRS  834
              + G    GE  + S   ENG++ R+    VE  ++  S  +  D  G + +  + K   
Sbjct  134   MDAGNDSHGEEEQHSLKRENGNKKRA----VE-KERVESDVLALDSKGRDRNTKIEKWVR  188

Query  835   FYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSF  1014
                 C+ FDG+W +DD+ P + PGSCP ID  F+C ++ RPD  Y K+RW+P  C+IP  
Sbjct  189   KMEQCNWFDGKWGKDDSYPIFAPGSCPHIDEPFNCFINGRPDSEYQKYRWQPRHCNIPRM  248

Query  1015  NATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAF  1194
             N    LE LRG++LVFVGDSLNRNMWESLVCILR+ V DK +VFE SGR +F+ +  Y+F
Sbjct  249   NGKIMLEMLRGKRLVFVGDSLNRNMWESLVCILRNSVEDKSKVFEASGREEFRSESSYSF  308

Query  1195  RFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWW  1371
              FEDYN SV+F  SPFLV+E   +G NGS  ETLRLD++++++  Y  AD++IFNTGHWW
Sbjct  309   IFEDYNSSVEFFQSPFLVQEWEMEGKNGSKKETLRLDMLERSSDKYKTADVLIFNTGHWW  368

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             THEKT  G  YYQEG+ V+ +L V +A+++AL TWARWV+   D  +T V FRGYS +H
Sbjct  369   THEKTLDGRGYYQEGSHVYSQLNVDKAFRKALRTWARWVETKTDPFKTLVFFRGYSVSH  427



>ref|XP_006590231.1| PREDICTED: protein YLS7-like [Glycine max]
Length=524

 Score =   295 bits (754),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 178/239 (74%), Gaps = 1/239 (0%)
 Frame = +1

Query  835   FYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSF  1014
              + DCD+++G WVRDD+ P Y  GSCP+ID  F+C  + + ++ Y K+RW+P  C++P F
Sbjct  171   MWKDCDMYEGSWVRDDSYPLYIAGSCPYIDEPFNCFRNGKSENLYEKYRWQPKNCNVPRF  230

Query  1015  NATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAF  1194
              A D LE LRG++L+FVGDSLNRNMWESLVC+LR+ V D+ R+FE SGR +F+ +G Y+F
Sbjct  231   KANDMLEMLRGKRLIFVGDSLNRNMWESLVCVLRNSVEDQSRLFEASGREEFRTEGSYSF  290

Query  1195  RFEDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWW  1371
              F+DYNCSV+F  S FLV+E     + GS  ETLRLD+++++   Y DAD++IFNTGHWW
Sbjct  291   IFQDYNCSVEFFRSVFLVQEWETPDLKGSTKETLRLDVLERSCDKYKDADVLIFNTGHWW  350

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             THEK   G+ YYQEGN ++ ++ V EA+ +AL TWA+W+D N+D  +T V FRGYS +H
Sbjct  351   THEKRIEGKGYYQEGNHIYGQMNVEEAFHKALLTWAQWIDSNIDPKKTTVFFRGYSPSH  409



>ref|XP_010442398.1| PREDICTED: protein trichome birefringence-like 4 [Camelina sativa]
Length=460

 Score =   292 bits (748),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 187/262 (71%), Gaps = 3/262 (1%)
 Frame = +1

Query  772   STVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHK  951
             S+V +  I  N    +       + CDIFDG WV DD++P Y PG CPF++  F+C  + 
Sbjct  78    SSVSHRRIRVNNESKIDPVTKELTSCDIFDGTWVFDDSEPVYSPGYCPFVEDKFNCFKNG  137

Query  952   RPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRD  1131
             RPD  +++ RW+PH C IP F+    L+ LRG+++VFVGDSLNRNMWESLVC LR  + D
Sbjct  138   RPDLGFLRHRWQPHGCSIPRFDGKKMLKILRGKRVVFVGDSLNRNMWESLVCSLRSTLED  197

Query  1132  KKRVFEISGR-SDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDL  1305
             K RV  +SG+ S+ + +GFY FRF+D++CS+DF+ SPFLV+ES    V G   ETLRLD+
Sbjct  198   KNRVSRVSGKQSNLQNEGFYGFRFKDFDCSIDFIKSPFLVQESEALDVYGKRRETLRLDM  257

Query  1306  MDKT-TSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWAR  1482
             + ++ T +Y +ADIVIFNTGHWWTH+KT  G+ Y+QEG RV+ RLEV EAY +AL+TWA 
Sbjct  258   IQRSMTKIYKNADIVIFNTGHWWTHQKTYEGKGYFQEGKRVYERLEVKEAYTKALHTWAD  317

Query  1483  WVDKNVDANRTEVIFRGYSATH  1548
             WVD N+++ RT V F GYS++H
Sbjct  318   WVDSNINSTRTRVFFVGYSSSH  339



>ref|XP_002871228.1| hypothetical protein ARALYDRAFT_487481 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47487.1| hypothetical protein ARALYDRAFT_487481 [Arabidopsis lyrata subsp. 
lyrata]
Length=611

 Score =   296 bits (759),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/255 (53%), Positives = 181/255 (71%), Gaps = 2/255 (1%)
 Frame = +1

Query  787   DMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDA  966
             D++     E+  K R    +C+ FDGEW++DD+ P Y PGSC  ID  F+C  + RPD  
Sbjct  239   DLVSSMKQEI-EKWRDSLKNCEFFDGEWIKDDSYPLYKPGSCKLIDEQFNCISNGRPDKD  297

Query  967   YVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVF  1146
             + K +W+P  C +P  N    LE LRG++LVFVGDSLNRNMWESLVCIL+  V+D+ +V+
Sbjct  298   FQKLKWKPKKCSLPRLNGAILLEMLRGRRLVFVGDSLNRNMWESLVCILKGSVKDETKVY  357

Query  1147  EISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTS  1323
             E  GR  F+ +  Y+F F+DYNC+V+F  SPFLV+E       G+  ETLRLDL+ K++ 
Sbjct  358   EARGRHHFRGEAEYSFVFQDYNCTVEFFVSPFLVQEWEIVDKKGTKKETLRLDLVGKSSE  417

Query  1324  MYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVD  1503
              Y  ADI++FNTGHWWTHEKTS+GEDYYQEG+ V+  L VLEA+++AL TW RWV+KNV+
Sbjct  418   QYKGADIIVFNTGHWWTHEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVN  477

Query  1504  ANRTEVIFRGYSATH  1548
               ++ V FRGYSA+H
Sbjct  478   PAKSLVFFRGYSASH  492



>ref|XP_006492844.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=644

 Score =   297 bits (761),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 147/314 (47%), Positives = 199/314 (63%), Gaps = 22/314 (7%)
 Frame = +1

Query  673   SLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKGRSF-----  837
             S++ +T  SE S      ++       SK   SS++  D +  N +  L K +S      
Sbjct  209   SVKNQTQSSEISVKDQNLKANQSAAPASKSTNSSSLVKDGVTSNYTASLAKKQSDDGKKR  268

Query  838   ----------------YSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAY  969
                               +CD+FDGEWV DD+ P Y   +C FID  F C  + RPD  +
Sbjct  269   RNGNDAGVVVKQWMEDLMNCDLFDGEWVHDDSYPLYKAETCSFIDEQFGCLRNGRPDRDF  328

Query  970   VKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFE  1149
             +K +W+P  C +P  N    LE LRG++LVFVGDSLNRNMWESLVCIL+++ +D K V+E
Sbjct  329   LKMKWKPKGCKLPRLNGAHMLELLRGKRLVFVGDSLNRNMWESLVCILKNLAKDPKNVYE  388

Query  1150  ISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSM  1326
              +GRS F+ +  Y+F F+DYNCSV+F  SPFLV+E      +G+  ETLRLDL+ +++  
Sbjct  389   ANGRSHFRGEASYSFIFKDYNCSVEFFVSPFLVQEWEMPEKDGTKKETLRLDLVGRSSDQ  448

Query  1327  YNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDA  1506
             Y  ADI+IFNTGHWWTH+KT+ G+DYYQEG+ V+  L VLEA++RAL TWARWVD NV+ 
Sbjct  449   YKGADIIIFNTGHWWTHDKTAEGKDYYQEGSHVYGELNVLEAFRRALTTWARWVDANVNP  508

Query  1507  NRTEVIFRGYSATH  1548
              ++ V FRGYSA+H
Sbjct  509   MKSMVFFRGYSASH  522



>ref|XP_004229072.1| PREDICTED: protein trichome birefringence-like 4 [Solanum lycopersicum]
Length=465

 Score =   292 bits (747),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 176/236 (75%), Gaps = 2/236 (1%)
 Frame = +1

Query  847   CDIFDGEWVRD-DTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             CDIFDGEWV+D D  P Y  GSCPFID  F+C  + R D  Y++ +W+PH C+IP F+  
Sbjct  110   CDIFDGEWVQDNDLHPLYKLGSCPFIDNSFNCFKNGRRDTDYLRLKWKPHGCEIPRFDGL  169

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               L+ L+G++LVFVGDSLNRNMWESLVC LR+ + DK RV E+SG   F+ +GFY+F+F+
Sbjct  170   KMLKMLKGKRLVFVGDSLNRNMWESLVCALRNSLIDKNRVNEVSGYRQFRSQGFYSFKFK  229

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             D+ CS+DF+ SPFLV+E  F    G+  ETLRLD +  + + Y+DADI+IFNTGHWWTH+
Sbjct  230   DFKCSIDFIKSPFLVQEWRFSDKAGARRETLRLDTIHGSLTKYHDADIIIFNTGHWWTHQ  289

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KT +  +Y+QEGN V+ RLEV +AY +AL TWA WVD  +++ +T V FRGYSA+H
Sbjct  290   KTHKVSNYFQEGNHVYNRLEVADAYTKALKTWAHWVDTTINSTKTRVFFRGYSASH  345



>ref|XP_011020489.1| PREDICTED: protein trichome birefringence-like 4 [Populus euphratica]
Length=470

 Score =   292 bits (748),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 177/237 (75%), Gaps = 1/237 (0%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             S CDIF+G WV DD+ P Y PGSCPF+D  F+C  + RPD  Y+++RW+PH C IP F+ 
Sbjct  121   SSCDIFNGNWVLDDSDPIYQPGSCPFLDDAFNCFNNGRPDVDYLRYRWKPHGCHIPRFDG  180

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
                L  L+G+++VFVGDSLNRNMW+SLVC LR  V +K R+FEI GR + + +GFY+F F
Sbjct  181   RQMLRMLKGKRMVFVGDSLNRNMWQSLVCALRESVENKSRIFEIEGRRELRTRGFYSFNF  240

Query  1201  EDYNCSVDFVSSPFLVRE-SSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWTH  1377
              D+NCS+DFV SPFLV+E  S        E LRLD++   +  Y+DADI+IFNTGHWWTH
Sbjct  241   VDHNCSIDFVKSPFLVQEWRSSDRRGNRRERLRLDMIQTPSFNYHDADIIIFNTGHWWTH  300

Query  1378  EKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             +KT +G++Y+QEG +V+ RLEV EAYK+AL+TWA+WVD N++ + T V F GYSA+H
Sbjct  301   QKTYKGKNYFQEGRKVYNRLEVNEAYKKALWTWAKWVDSNINRSHTRVFFGGYSASH  357



>emb|CDY08459.1| BnaA05g26950D [Brassica napus]
Length=580

 Score =   295 bits (755),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/245 (54%), Positives = 178/245 (73%), Gaps = 1/245 (0%)
 Frame = +1

Query  817   LRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHA  996
             +R+      +C+ ++GEWV+DD+ P Y PGSC  ID  F C  + RPD  + K +W+P  
Sbjct  181   MRREIKSLKNCEFYEGEWVKDDSYPLYKPGSCNLIDEQFTCISNGRPDAEFQKLKWKPKQ  240

Query  997   CDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKK  1176
             C +P  N    LE +RG++L FVGDSLNRNMWESLVCIL+  V+D+ +VFE  GR  F+ 
Sbjct  241   CTLPRLNGGKLLEMIRGRRLAFVGDSLNRNMWESLVCILKGSVKDESQVFEAHGRHQFRW  300

Query  1177  KGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIF  1353
             +  Y+F F+DYNC+V+F +SPFLV+E      NG+  ETLRLD++ K++  Y  ADI++F
Sbjct  301   EAEYSFVFKDYNCTVEFFASPFLVQEWELTDKNGTKKETLRLDVVGKSSEQYKGADILVF  360

Query  1354  NTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRG  1533
             NTGHWWTH+KTS+GEDYYQEG+ VHP+L+V EA+K+AL TW RWVDKNV+  ++ V FRG
Sbjct  361   NTGHWWTHDKTSKGEDYYQEGSNVHPKLDVDEAFKKALTTWGRWVDKNVNPKKSLVFFRG  420

Query  1534  YSATH  1548
             YS +H
Sbjct  421   YSPSH  425



>ref|XP_010491248.1| PREDICTED: protein trichome birefringence-like [Camelina sativa]
Length=616

 Score =   296 bits (757),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 173/236 (73%), Gaps = 1/236 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             DC+ FDGEW+ DD+ P Y PGSC  ID  F+C  + RPD  + K +W+P  C +P  N  
Sbjct  262   DCEFFDGEWIMDDSYPLYKPGSCKLIDEQFNCISNGRPDKDFQKLKWKPKRCSLPRLNGA  321

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               LE LRG++LVFVGDSLNRNMWESLVCIL+  V+D+ +V+E  GR  F+ +  Y+F F+
Sbjct  322   ILLEMLRGRRLVFVGDSLNRNMWESLVCILKGSVKDETKVYEARGRHHFRGEAEYSFVFQ  381

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             DYNC+V+F  SPFLV+E       G+  ETLRLDL+ K++  Y  ADI++FNTGHWWTHE
Sbjct  382   DYNCTVEFFVSPFLVQEWEIVDKKGTKKETLRLDLVGKSSEQYKGADIIVFNTGHWWTHE  441

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS+GEDYYQEG+ V+  L VLEA+++AL TW RWV+KNV+  ++ V FRGYSA+H
Sbjct  442   KTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPTKSLVFFRGYSASH  497



>ref|XP_004497358.1| PREDICTED: uncharacterized protein LOC101512304 [Cicer arietinum]
Length=517

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 173/235 (74%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD+F+G WV DD+ P Y  GSCP ID  F+C L+ R D+ Y K+RW+P  C++P FN  D
Sbjct  165   CDMFEGSWVLDDSYPLYKSGSCPHIDESFNCFLNGRKDNMYEKFRWQPKNCNMPRFNGKD  224

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LE LRG++LVFVGDSLNRNMWES+VCIL + V +K R+FE SGR +F+ +  Y+F F D
Sbjct  225   MLEILRGKRLVFVGDSLNRNMWESMVCILSNSVENKSRIFEASGRQEFRTEDSYSFIFTD  284

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YNCS++F  SPFLV+E       GS  ETLRLDL++++   Y +AD++IFNTGHWWTHEK
Sbjct  285   YNCSIEFFRSPFLVQEWEIPDRKGSIKETLRLDLVERSCDKYKNADVLIFNTGHWWTHEK  344

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
                G++YYQEGN +H +L V EA+ +AL+TW+ WVD N++  +T V FRGYS +H
Sbjct  345   RIEGKEYYQEGNHIHGQLNVEEAFSKALFTWSHWVDTNINPKKTIVFFRGYSPSH  399



>ref|XP_004493599.1| PREDICTED: uncharacterized protein LOC101511851 [Cicer arietinum]
Length=617

 Score =   295 bits (756),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 178/235 (76%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD FDGEWV+DD+ P Y PGSC  ID  F+C  + RPD  Y K++W+P  C +P  +   
Sbjct  264   CDFFDGEWVKDDSYPLYKPGSCSVIDEQFNCIGNGRPDKDYQKYKWKPKGCSLPRLDGHK  323

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              L+ LRG++LVFVGDSLNRNMWESL+CILR+ V+DK++V+E +GR  F+ +  Y+F F+D
Sbjct  324   MLDLLRGKRLVFVGDSLNRNMWESLICILRNSVKDKRKVYEANGRVHFRGEASYSFVFQD  383

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             Y  SV+   SPFLV+E      NG+  ETLRLDL+ +++  Y DADI++FNTGHWWTH+K
Sbjct  384   YKFSVELFVSPFLVQEWEMPDKNGTKKETLRLDLVGRSSDQYKDADIIVFNTGHWWTHDK  443

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS+G+DYYQEG+ V+  L VLEA++RA+ TW+RWVD NV+ +++ V+FRGYSA+H
Sbjct  444   TSKGKDYYQEGSHVYDELNVLEAFRRAITTWSRWVDANVNPSKSIVLFRGYSASH  498



>ref|NP_568173.2| protein TRICHOME BIREFRINGENCE [Arabidopsis thaliana]
 sp|Q9FG35.1|TBR_ARATH RecName: Full=Protein trichome birefringence [Arabidopsis thaliana]
 dbj|BAB09804.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAF01304.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91052.1| uncharacterized protein AT5G06700 [Arabidopsis thaliana]
Length=608

 Score =   295 bits (756),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 181/255 (71%), Gaps = 2/255 (1%)
 Frame = +1

Query  787   DMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDA  966
             D++     E+ +   S   +C+ FDGEW++DD+ P Y PGSC  ID  F+C  + RPD  
Sbjct  236   DLVSSVKQEIEKWSESL-KNCEFFDGEWIKDDSYPLYKPGSCNLIDEQFNCITNGRPDKD  294

Query  967   YVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVF  1146
             + K +W+P  C +P  N    LE LRG++LVFVGDSLNRNMWESLVCIL+  V+D+ +V+
Sbjct  295   FQKLKWKPKKCSLPRLNGAILLEMLRGRRLVFVGDSLNRNMWESLVCILKGSVKDETKVY  354

Query  1147  EISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTS  1323
             E  GR  F+ +  Y+F F+DYNC+V+F  SPFLV+E       G+  ETLRLDL+ K++ 
Sbjct  355   EARGRHHFRGEAEYSFVFQDYNCTVEFFVSPFLVQEWEIVDKKGTKKETLRLDLVGKSSE  414

Query  1324  MYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVD  1503
              Y  AD+++FNTGHWWTHEKTS+GEDYYQEG+ V+  L VLEA+++AL TW RWV+KNV+
Sbjct  415   QYKGADVIVFNTGHWWTHEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVN  474

Query  1504  ANRTEVIFRGYSATH  1548
               ++ V FRGYSA+H
Sbjct  475   PAKSLVFFRGYSASH  489



>ref|XP_003555633.2| PREDICTED: protein YLS7-like [Glycine max]
Length=525

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 178/239 (74%), Gaps = 1/239 (0%)
 Frame = +1

Query  835   FYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSF  1014
              + +CD+++G WVRDD+ P Y  GSCP+ID  F+C  + + ++ Y K+RW+P  C++P F
Sbjct  170   MWKNCDMYEGSWVRDDSYPLYNAGSCPYIDEPFNCFRNGKRENMYEKYRWQPKNCNVPRF  229

Query  1015  NATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAF  1194
              A + LE LRG++LVFVGDSLNRNMWESLVC+LR+ V+DK R+FE SGR +F+ +G Y+F
Sbjct  230   KANEMLEMLRGKRLVFVGDSLNRNMWESLVCVLRNSVKDKSRLFEASGREEFRTEGSYSF  289

Query  1195  RFEDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWW  1371
              F+DYNCSV+F  S FLV+E       GS  ETLRLDL++++   Y DAD++IFNTGHWW
Sbjct  290   IFQDYNCSVEFFRSVFLVQEWEIPDQKGSTKETLRLDLLERSCDKYKDADVLIFNTGHWW  349

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             THEK   G+ YYQEG+ ++ ++ V EA+ +AL TWA+W+D NVD  +T V FRGYS +H
Sbjct  350   THEKRIEGKGYYQEGDHIYGQMNVEEAFHKALLTWAQWIDSNVDPKKTTVFFRGYSPSH  408



>emb|CDY49608.1| BnaA09g03300D [Brassica napus]
Length=450

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 176/239 (74%), Gaps = 3/239 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             + CDIFDG WV DDTKP Y PG CPF++  F+C  + RPD  ++++RW+PH C IP F+ 
Sbjct  91    TSCDIFDGSWVSDDTKPVYSPGYCPFVEDKFNCFKNGRPDSGFLRYRWQPHGCSIPRFDG  150

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISG-RSDFKKKGFYAFR  1197
                L+ LRG++LVFVGDSLNRNMWESLVC LR  + DK RV ++S  RS+ + +GFY FR
Sbjct  151   KKMLKILRGKRLVFVGDSLNRNMWESLVCSLRSALEDKNRVSKVSWRRSNLRNEGFYGFR  210

Query  1198  FEDYNCSVDFVSSPFLVRESS-FKGVNGSFETLRLDLMDKTT-SMYNDADIVIFNTGHWW  1371
             F+D+ CS+DF+ SPFLV+ES    G     ETLRLD++  +   +Y DAD+++FNTGHWW
Sbjct  211   FKDFGCSLDFIKSPFLVQESEVLDGYGKRKETLRLDVIQGSIKKIYKDADVIVFNTGHWW  270

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TH+KT  G+DY+QEGNRV+ +L V EAY +AL+TWA WVD  ++  +T V F GYS++H
Sbjct  271   THQKTYEGKDYFQEGNRVYEKLGVKEAYTKALHTWADWVDSYINMTKTRVFFVGYSSSH  329



>ref|XP_009111874.1| PREDICTED: protein trichome birefringence-like 4 [Brassica rapa]
Length=450

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 175/239 (73%), Gaps = 3/239 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             S CDIFDG WV DDTKP Y PG CPF++  F C  + RPD  ++++RW+PH C IP F+ 
Sbjct  91    SSCDIFDGSWVSDDTKPVYSPGYCPFVEDKFHCFKNGRPDSGFLRYRWQPHGCSIPRFDG  150

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISG-RSDFKKKGFYAFR  1197
                L+ LRG++LVFVGDSLNRNMWESLVC LR  + DK RV ++S  RS+ + +GFY FR
Sbjct  151   KKMLKILRGKRLVFVGDSLNRNMWESLVCSLRSALEDKNRVSKVSWRRSNLRNEGFYGFR  210

Query  1198  FEDYNCSVDFVSSPFLVRESS-FKGVNGSFETLRLDLMDKTT-SMYNDADIVIFNTGHWW  1371
             F+D+ CSVDF+ SPFLV+ES    G     ETLRLD++  +   +Y +A +++FNTGHWW
Sbjct  211   FKDFECSVDFIKSPFLVQESEVLDGYGKRKETLRLDVIQGSIKKIYRNAAVIVFNTGHWW  270

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TH+KT  G+DY+QEGNRV+ +L V EAY +AL+TWA WVD N++  +T V F GYS++H
Sbjct  271   THQKTYEGKDYFQEGNRVYEKLGVKEAYTKALHTWADWVDSNINMTKTRVFFVGYSSSH  329



>ref|XP_010482212.1| PREDICTED: protein trichome birefringence-like 4 [Camelina sativa]
Length=460

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 186/262 (71%), Gaps = 3/262 (1%)
 Frame = +1

Query  772   STVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHK  951
             S+V +  I  N    +       + CDIFDG WV DD++P Y PG CPF++  F+C  + 
Sbjct  78    SSVSHRRIRVNNESKIDPVTKELTSCDIFDGTWVFDDSEPVYSPGYCPFVEDKFNCFKNG  137

Query  952   RPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRD  1131
             RPD  +++ RW+PH C IP F+    L+ LRG+++VFVGDSLNRNMWESLVC LR  + D
Sbjct  138   RPDLGFLRHRWQPHGCSIPRFDGKKMLKILRGKRVVFVGDSLNRNMWESLVCSLRSTLED  197

Query  1132  KKRVFEISGR-SDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDL  1305
             K RV  +SG+ S+   +GFY FRF+D++CS+DF+ SPFLV+ES    V G   ETLRLD+
Sbjct  198   KNRVSRVSGKQSNLHNEGFYGFRFKDFDCSIDFIKSPFLVQESEALDVYGKRRETLRLDM  257

Query  1306  MDKT-TSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWAR  1482
             + ++ T +Y +ADIVIFNTGHWWTH+KT  G+ Y+QEG RV+ RLEV EAY +AL+TWA 
Sbjct  258   IQRSMTKIYKNADIVIFNTGHWWTHQKTYEGKGYFQEGKRVYERLEVKEAYTKALHTWAD  317

Query  1483  WVDKNVDANRTEVIFRGYSATH  1548
             WVD N+++ +T V F GYS++H
Sbjct  318   WVDSNINSTKTRVFFVGYSSSH  339



>gb|KHG04354.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=552

 Score =   293 bits (750),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 198/316 (63%), Gaps = 6/316 (2%)
 Frame = +1

Query  619   FTGFTEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIG  798
             F G  +      G NG  S        E +E G  +    +    S+         +++ 
Sbjct  110   FHGKNDSSLSSEGTNGTLSEIPAESGKELAEKGLNANGNSIHGSPSRPLDFKESGKELVD  169

Query  799   ENGSELLRKGR-----SFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDD  963
              +  ELL K R        + C IFDG+WVRDD+ P Y PG+CP+I   F+C ++ RPD 
Sbjct  170   GSIDELLEKQRKGDFVEIINQCRIFDGKWVRDDSYPLYAPGTCPYIGESFNCFVNGRPDT  229

Query  964   AYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRV  1143
              Y K+RW+P+ C +P  N    LE LRG++LVFVGDSL RNMWESLVCILR+ + +K  V
Sbjct  230   GYEKYRWQPNECILPRLNGKHMLELLRGKRLVFVGDSLGRNMWESLVCILRNSIEEKSSV  289

Query  1144  FEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTT  1320
             FE+SG+ +  K   ++  F+ YNCS+++  S FLV+E      NGS  ETLRLD++DK+ 
Sbjct  290   FEVSGKQELGKGSSHSIIFKGYNCSIEYFRSAFLVQEWEMVWRNGSKKETLRLDMIDKSA  349

Query  1321  SMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNV  1500
               Y DAD++IFNTGHWWTH+KTS+G  YYQEGN ++ RL V  A+++AL TWA+W+D N+
Sbjct  350   DKYKDADVLIFNTGHWWTHDKTSKGNSYYQEGNTIYNRLHVKVAFRKALTTWAKWIDTNI  409

Query  1501  DANRTEVIFRGYSATH  1548
             D+ +T V FRG+SA+H
Sbjct  410   DSTKTLVFFRGFSASH  425



>ref|XP_003625280.1| hypothetical protein MTR_7g093450 [Medicago truncatula]
 gb|AES81498.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=601

 Score =   294 bits (753),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 198/301 (66%), Gaps = 8/301 (3%)
 Frame = +1

Query  649   GSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKGTSSTVKNDMIGENGSELLRKG  828
              S +    ++EG  +    + + D S     GV++     S   K +    NGS    + 
Sbjct  189   NSNQTTNATVEGVPIVPNKNLSSDSSLK---GVDLHNYTASLARKQN----NGSNKYAEL  241

Query  829   RSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIP  1008
                   CD FDGEW++DD+ P Y PGSC  ID  F+C  + RPD  Y K++W+P  C +P
Sbjct  242   MESLMKCDFFDGEWIKDDSYPLYKPGSCSIIDEQFNCIRNGRPDKDYQKYKWKPKGCSLP  301

Query  1009  SFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFY  1188
               +    L+ LRG++LVFVGDSLNRNMWESL+CIL++ V+DKK+V+E +GR  F+ +  Y
Sbjct  302   RLDGHRMLDLLRGKRLVFVGDSLNRNMWESLICILKNSVKDKKKVYEANGRVHFRGEASY  361

Query  1189  AFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGH  1365
             +F F+DY  SV+   SPFLV+E      NG+  ETLRLDL+ +++  Y DADI++FNTGH
Sbjct  362   SFVFKDYKFSVELFVSPFLVQEWEMPDKNGTKKETLRLDLVGRSSDQYKDADIIVFNTGH  421

Query  1366  WWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSAT  1545
             WWTH+KTS+G+DYYQEG+ V+  L VLEA++RA+ TW RWVD NV+  ++ V+FRGYSA+
Sbjct  422   WWTHDKTSKGKDYYQEGSHVYDELNVLEAFRRAITTWGRWVDANVNPTKSIVLFRGYSAS  481

Query  1546  H  1548
             H
Sbjct  482   H  482



>ref|XP_010452610.1| PREDICTED: protein trichome birefringence [Camelina sativa]
Length=621

 Score =   295 bits (755),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 180/257 (70%), Gaps = 1/257 (0%)
 Frame = +1

Query  781   KNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPD  960
             KND    +  + + K      +C+ FDGEW+ DD+ P Y PGSC  ID  F+C  + RPD
Sbjct  246   KNDDSVSSVKQEIEKWSDSLKNCEFFDGEWIMDDSYPLYKPGSCKLIDEQFNCITNGRPD  305

Query  961   DAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKR  1140
               + K +W+P  C +P  N    LE LRG++LVFVGDSLNRNMWESLVCIL+  V+D+ +
Sbjct  306   KDFQKLKWKPKKCSLPRLNGAILLEMLRGRRLVFVGDSLNRNMWESLVCILKGSVKDETK  365

Query  1141  VFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKT  1317
             V+E  GR  F+ +  Y+F F+DYNC+V+F  SPFLV+E       G+  ETLRLDL+ K+
Sbjct  366   VYEARGRHHFRGEAEYSFVFQDYNCTVEFFVSPFLVQEWEIVDKKGTKKETLRLDLVGKS  425

Query  1318  TSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKN  1497
             +  Y  ADI++FNTGHWWTHEKTS+GEDYYQEG+ V+  L VLEA+++AL TW RWV+KN
Sbjct  426   SEQYKGADIIVFNTGHWWTHEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKN  485

Query  1498  VDANRTEVIFRGYSATH  1548
             V+  ++ V FRGYSA+H
Sbjct  486   VNPTKSLVFFRGYSASH  502



>ref|XP_006287297.1| hypothetical protein CARUB_v10000490mg [Capsella rubella]
 gb|EOA20195.1| hypothetical protein CARUB_v10000490mg [Capsella rubella]
Length=613

 Score =   295 bits (754),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 173/236 (73%), Gaps = 1/236 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             +C+ FDGEW+ DD+ P Y PGSC  ID  F+C  + RPD  + K +W+P  C +P  N  
Sbjct  259   NCEFFDGEWIMDDSYPLYKPGSCKLIDEQFNCISNGRPDKDFQKLKWKPKKCSLPRLNGA  318

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               LE LRG++LVFVGDSLNRNMWESLVCIL+  V+D+ +V+E  GR  F+ +  Y+F F+
Sbjct  319   ILLEMLRGRRLVFVGDSLNRNMWESLVCILKGAVKDETKVYEARGRHHFRGEAEYSFVFQ  378

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             DYNC+V+F  SPFLV+E       G+  ETLRLDL+ K++  Y  ADI++FNTGHWWTHE
Sbjct  379   DYNCTVEFFVSPFLVQEWEIVDKKGTKKETLRLDLVGKSSEQYKGADIIVFNTGHWWTHE  438

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS+GEDYYQEG+ V+  L VLEA+++AL TW RWV+KNV+  ++ V FRGYSA+H
Sbjct  439   KTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPTKSLVFFRGYSASH  494



>ref|XP_006429897.1| hypothetical protein CICLE_v10011263mg [Citrus clementina]
 gb|ESR43137.1| hypothetical protein CICLE_v10011263mg [Citrus clementina]
Length=644

 Score =   295 bits (755),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 174/236 (74%), Gaps = 1/236 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             +CD+FDGEWV DD+ P Y   +C FID  F C  + RPD  ++K +W+P  C +P  N  
Sbjct  287   NCDLFDGEWVHDDSYPLYKAETCSFIDEQFGCLRNGRPDRDFLKMKWKPKGCKLPRLNGA  346

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               LE LRG++LVFVGDSLNRNMWESLVCIL++  +D K V+E +GRS F+ +  Y+F F+
Sbjct  347   HMLELLRGKRLVFVGDSLNRNMWESLVCILKNSAKDPKNVYEANGRSHFRGEASYSFIFK  406

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             DYNCSV+F  SPFLV+E      +G+  ETLRLDL+ +++  Y  ADI+IFNTGHWWTH+
Sbjct  407   DYNCSVEFFVSPFLVQEWEMPEKDGTKKETLRLDLVGRSSDQYKGADIIIFNTGHWWTHD  466

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KT+ G+DYYQEG+ V+  L VLEA++RAL TWARWVD NV+  ++ V FRGYSA+H
Sbjct  467   KTAEGKDYYQEGSHVYGELNVLEAFRRALTTWARWVDANVNPMKSMVFFRGYSASH  522



>gb|EYU39954.1| hypothetical protein MIMGU_mgv1a008556mg [Erythranthe guttata]
Length=369

 Score =   286 bits (733),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 173/236 (73%), Gaps = 1/236 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             +CD+FDG WV+D++ P Y PGSC  ID  F+C  + R D+ Y K +W+P AC +P  +  
Sbjct  22    NCDLFDGNWVKDESYPLYKPGSCSLIDDQFNCFANGRLDNGYHKLKWKPKACTLPRLDGG  81

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               LE LR ++LVFVGDSLNRNMWESL+CILR+ V+DKK+V+E  GR  F+ +  Y+F FE
Sbjct  82    HMLELLREKRLVFVGDSLNRNMWESLICILRNSVKDKKKVYEEFGRHHFRAEASYSFVFE  141

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             +Y C V+F  SPFLV E   KG NG+  ETLRLDL++     Y +AD+++FNTGHWWTHE
Sbjct  142   EYKCRVEFFVSPFLVEEWESKGKNGTKKETLRLDLVNGFADKYKNADVIVFNTGHWWTHE  201

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS G+DYYQEG+ V+  L VLEA+++AL TW RW+D NV+  ++ V FRGYSA+H
Sbjct  202   KTSTGKDYYQEGSHVYSDLNVLEAFRKALTTWGRWIDANVNPMKSHVFFRGYSASH  257



>ref|XP_007035738.1| Trichome birefringence-like 4 [Theobroma cacao]
 gb|EOY06664.1| Trichome birefringence-like 4 [Theobroma cacao]
Length=453

 Score =   289 bits (739),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 136/248 (55%), Positives = 183/248 (74%), Gaps = 11/248 (4%)
 Frame = +1

Query  817   LRKGRSFYSD---CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWR  987
             ++ GR    D   CDIF+G WV DD+ P Y PGSCP+ID  F+C+ + R D +Y+++RW+
Sbjct  107   VKDGRYVIKDLGSCDIFNGNWVLDDSDPVYQPGSCPYIDDSFNCYKNGRVDFSYLRYRWK  166

Query  988   PHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSD  1167
             P  C IP F+    L+ LRG++LVFVGDSLNRNMWESLVC LR   +D++R+FE+     
Sbjct  167   PFDCQIPRFDGRKMLKMLRGKRLVFVGDSLNRNMWESLVCALRESSKDRRRIFEV-----  221

Query  1168  FKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADI  1344
             F+ +G Y+FRF+DY CS+DFV SPFLV+E       G+  ETLRLD++    S Y+DADI
Sbjct  222   FRTQGLYSFRFKDYKCSIDFVKSPFLVQEWKISDKIGTRRETLRLDIIQG--SKYSDADI  279

Query  1345  VIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVI  1524
             ++FNTGHWWTH+KT++G++Y+QEG+ V+ RLEV EA+ +AL TWA+WVD N+D NRT V 
Sbjct  280   IVFNTGHWWTHQKTNKGKNYFQEGSHVYSRLEVKEAFAKALRTWAKWVDVNIDRNRTRVF  339

Query  1525  FRGYSATH  1548
             F GYSA+H
Sbjct  340   FVGYSASH  347



>gb|KFK38572.1| hypothetical protein AALP_AA3G130900 [Arabis alpina]
Length=530

 Score =   291 bits (745),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 208/322 (65%), Gaps = 5/322 (2%)
 Frame = +1

Query  589   NRSEIGKNVNFTGF-TEKKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEISKKG  765
             N + + KN+ F      +  + + K+  F       +       +  + R V   +SK  
Sbjct  86    NLTPVTKNLTFDSLLVNETTNTTAKHETFQSRTCHARENMLCPDNSDKPRAVEQPLSKVI  145

Query  766   TSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHL  945
             T ++  + M  ++     R+      +C+ F+GEWV+DD+ P Y PGSC  ID  F+C  
Sbjct  146   TVNSTASSMRKQSKR---RREIESLRNCEFFEGEWVKDDSYPLYKPGSCNLIDEQFNCVP  202

Query  946   HKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVV  1125
             + RPD  + KW+W+P  C +P  N    LE +RG++LVFVGDS+NRNMWESLVCIL+  V
Sbjct  203   NGRPDLDFQKWKWKPKKCSLPRLNGGRLLEMIRGRRLVFVGDSMNRNMWESLVCILKGSV  262

Query  1126  RDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLD  1302
             +D+ +VFE  G+  F+ +  Y+F F+DY+C+V+F +SPFLV+E   +  NG+  ETLRLD
Sbjct  263   KDESQVFEAHGKHHFRWEAEYSFVFKDYDCTVEFYASPFLVQEWEVEDKNGTKKETLRLD  322

Query  1303  LMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWAR  1482
             L+ K++  Y  ADI++FNTGHWWTHEKTS+GEDYYQEG+ V+P+L+  EA+++AL TW+R
Sbjct  323   LVGKSSKQYKGADILVFNTGHWWTHEKTSKGEDYYQEGSNVYPKLDADEAFRKALTTWSR  382

Query  1483  WVDKNVDANRTEVIFRGYSATH  1548
             W+DKNV+  ++ V FRG + +H
Sbjct  383   WIDKNVNPKKSLVFFRGLAPSH  404



>emb|CDY72094.1| BnaCnng75930D [Brassica napus]
Length=535

 Score =   291 bits (745),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 178/245 (73%), Gaps = 1/245 (0%)
 Frame = +1

Query  817   LRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHA  996
             +R+      +C+ ++GEWV+DD+ P Y PGSC  ID  F C  + RPD  + K +W+P  
Sbjct  168   MRREIKSLKNCEFYEGEWVKDDSYPLYKPGSCNLIDEQFTCISNGRPDAEFQKLKWKPKQ  227

Query  997   CDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKK  1176
             C +P  N    LE +RG++L FVGDSLNRNMWESLVCIL+  V+DK +VFE  GR  F+ 
Sbjct  228   CTLPRLNGGKLLEMIRGRRLAFVGDSLNRNMWESLVCILKGSVKDKSQVFEAHGRHQFRW  287

Query  1177  KGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIF  1353
             +  Y+F F+DYNC+V+F +SPFLV+E      NG+  ETLRLD++ K++  Y  ADI++F
Sbjct  288   EAEYSFVFKDYNCTVEFFASPFLVQEWEVSDKNGTKKETLRLDVVGKSSEQYKGADILVF  347

Query  1354  NTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRG  1533
             NTGHWWTH+KTS+GEDYYQEG+ VHP+L+V EA+++AL TW +WVD+NV+  ++ V FRG
Sbjct  348   NTGHWWTHDKTSKGEDYYQEGSNVHPKLDVDEAFRKALTTWGQWVDENVNPKKSLVFFRG  407

Query  1534  YSATH  1548
             YS +H
Sbjct  408   YSPSH  412



>ref|XP_002865730.1| hypothetical protein ARALYDRAFT_331346 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41989.1| hypothetical protein ARALYDRAFT_331346 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 178/239 (74%), Gaps = 3/239 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             + CDIFDG WV DD++P Y PG CPFI+  F+C  + RPD  +++ RW+PH C IP F+ 
Sbjct  100   TSCDIFDGTWVFDDSEPVYLPGYCPFIEDKFNCFKNGRPDSGFLRHRWQPHGCSIPRFDG  159

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR-SDFKKKGFYAFR  1197
                L+ LRG+++VFVGDSLNRNMWESLVC LR  + DK RV  +SG+ S+   +GFY FR
Sbjct  160   KKMLKILRGKRVVFVGDSLNRNMWESLVCSLRSTLEDKNRVSRVSGKQSNLHNEGFYGFR  219

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTT-SMYNDADIVIFNTGHWW  1371
             F+D+ CS+DF+ SPFLV+ES    V G   ETLRLD++ ++   ++ +ADIVIFNTGHWW
Sbjct  220   FKDFECSIDFIKSPFLVQESEVLDVYGKRRETLRLDMIQRSIKKIHKNADIVIFNTGHWW  279

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TH+KT  G+ Y+QEGNRV+ RLEV EAY +AL+TWA WVD ++++ +T V F GYS++H
Sbjct  280   THQKTYEGKGYFQEGNRVYERLEVKEAYTKALHTWADWVDSSINSTKTRVFFVGYSSSH  338



>ref|XP_006575204.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN41712.1| hypothetical protein glysoja_041257 [Glycine soja]
Length=596

 Score =   293 bits (749),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 179/235 (76%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             C+ FDGEW+++D+ P Y PGSC  ID  F+C  + RPD A+ K++W+P  C +P  +   
Sbjct  245   CEFFDGEWIKEDSYPLYEPGSCNIIDEQFNCIQNGRPDKAFQKYKWKPKGCSLPRLDGHR  304

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              L+ LRG++L+FVGDS+NRNMWESL+CILR+ V+DK +V+E +GR  F+ +  Y+F F+D
Sbjct  305   MLDMLRGKRLIFVGDSINRNMWESLICILRNAVKDKSKVYEANGRVHFRGEASYSFIFKD  364

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YN SV+   SPFLV+E   +  NG+  ETLRLDL+ K++  Y +ADI+IFNTGHWWTH+K
Sbjct  365   YNFSVELFVSPFLVQEWEVQVKNGTKKETLRLDLVGKSSVQYKNADIIIFNTGHWWTHDK  424

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS+G+DYYQEG+ V+  L VLEA++RA+ TW+RW+D N++ +++ V FRGYSA+H
Sbjct  425   TSKGKDYYQEGSHVYDELNVLEAFRRAITTWSRWIDANINQSKSMVFFRGYSASH  479



>gb|KEH16599.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=526

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 176/235 (75%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD FDG+W++D++ P Y PGSC  ID  F C  + RPD  Y K +W+P  C +P  +   
Sbjct  170   CDFFDGKWIKDESYPLYKPGSCNLIDEQFSCINNGRPDKDYQKLKWKPKGCSLPRLDGHK  229

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              L+ LRG++LVFVGDS+NRNMWESL+CILR+ V+DK +VFE +GR  FK +  Y+F F+D
Sbjct  230   MLDLLRGKRLVFVGDSINRNMWESLICILRNSVKDKSKVFEANGRVHFKGESSYSFIFKD  289

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YN SV+   SPFLV+E      NG+  ETLRLDL+ ++++ Y DADI+IFNTGHWWTH+K
Sbjct  290   YNFSVELFVSPFLVQEWEMLVKNGTKKETLRLDLVGRSSNQYKDADIIIFNTGHWWTHDK  349

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TS+G+DYYQEG+ V+  L VLEA+++A+ TW+RWVD N++ +++ V FRGYS++H
Sbjct  350   TSKGKDYYQEGSHVYNELNVLEAFRKAITTWSRWVDANINTSKSMVFFRGYSSSH  404



>gb|ADI48429.1| trichome birefringence [Arabidopsis thaliana]
Length=608

 Score =   292 bits (748),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 180/255 (71%), Gaps = 2/255 (1%)
 Frame = +1

Query  787   DMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDA  966
             D++     E+ +   S   +C+ FDGEW++DD+ P Y PGSC  ID  F+C  + RPD  
Sbjct  236   DLVSSVKQEIEKWSESL-KNCEFFDGEWIKDDSYPLYKPGSCNLIDEQFNCITNGRPDKD  294

Query  967   YVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVF  1146
             + K +W+P  C +P  N    LE LRG++LVFVGDSLNRNMWESLVCIL+  V+D+ +V+
Sbjct  295   FQKLKWKPKKCSLPRLNGAILLEMLRGRRLVFVGDSLNRNMWESLVCILKGSVKDETKVY  354

Query  1147  EISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTS  1323
             E  GR  F+ +  Y+F F+DYNC+V+F  SPFLV+E       G+  ETLRLDL+ K++ 
Sbjct  355   EARGRHHFRGEAEYSFVFQDYNCTVEFFVSPFLVQEWEIVDKKGTKKETLRLDLVGKSSE  414

Query  1324  MYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVD  1503
              Y  AD+++FNT HWWTHEKTS+GEDYYQEG+ V+  L VLEA+++AL TW RWV+KNV+
Sbjct  415   QYKGADVIVFNTEHWWTHEKTSKGEDYYQEGSNVYHELAVLEAFRKALTTWGRWVEKNVN  474

Query  1504  ANRTEVIFRGYSATH  1548
               ++ V FRGYSA+H
Sbjct  475   PAKSLVFFRGYSASH  489



>emb|CDY05635.1| BnaC02g39020D [Brassica napus]
Length=452

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 176/239 (74%), Gaps = 3/239 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             + CDIFDG WV DD+ P Y PG CP+++  F+C  + RPD  +++ RW+PH C +P F+ 
Sbjct  93    TSCDIFDGAWVSDDSDPVYLPGYCPYVEDKFNCFKNGRPDSGFLRHRWQPHGCSVPRFDG  152

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR-SDFKKKGFYAFR  1197
                L+ LRG++LVFVGDSLNRNMWESLVC LR  + DK RV  + G+ S+   +GFY FR
Sbjct  153   EKMLKILRGKRLVFVGDSLNRNMWESLVCSLRSTLEDKNRVSRVFGKQSNLHNEGFYGFR  212

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLM-DKTTSMYNDADIVIFNTGHWW  1371
             F D++CS+DF+ SPFLV+ES      G   ETLRLD++ +  T +Y +ADIV+FNTGHWW
Sbjct  213   FRDFDCSIDFIKSPFLVQESVVLDAYGKRKETLRLDVIQEPITKIYRNADIVVFNTGHWW  272

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TH+KT+ G+DY+QEG+RV+ +LEV EAY +AL TWA WVD N+++ RT V F GYS++H
Sbjct  273   THQKTNEGKDYFQEGDRVYEKLEVKEAYTKALRTWADWVDSNINSTRTRVFFVGYSSSH  331



>ref|XP_004497886.1| PREDICTED: uncharacterized protein LOC101512080 [Cicer arietinum]
Length=529

 Score =   290 bits (742),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/268 (50%), Positives = 192/268 (72%), Gaps = 11/268 (4%)
 Frame = +1

Query  748   EISKKGTSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDR  927
             + S +  SS +K+++   +  E LRK       CD FDGEWV+D++ P Y PGSC  +D 
Sbjct  153   QTSNQNLSSLLKDEI---HMMESLRK-------CDFFDGEWVKDESYPLYEPGSCNLVDE  202

Query  928   DFDCHLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVC  1107
              F+C  + RPD  Y K++W+P  C +P  +    L+ LRG++LVFVGDS+NRNMWESL+C
Sbjct  203   QFNCIHNGRPDKDYQKYKWKPKGCSLPRLDGKRMLDLLRGKRLVFVGDSINRNMWESLIC  262

Query  1108  ILRHVVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-F  1284
             ILR+ V+DK +VFE +GR  F+ +  Y+F F+DYN S++F   PFLV+E      NG+  
Sbjct  263   ILRNSVKDKSKVFEANGRVHFRGEASYSFIFKDYNFSIEFFVLPFLVQEWEVLVKNGTKK  322

Query  1285  ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRA  1464
             ETLRLDL+ +++  Y DADI+IFNTGHWWTH+KTS+G+DYYQEG+ ++  L VLEA+++A
Sbjct  323   ETLRLDLVGRSSDQYKDADIIIFNTGHWWTHDKTSKGKDYYQEGSHIYNELNVLEAFRKA  382

Query  1465  LYTWARWVDKNVDANRTEVIFRGYSATH  1548
             + TW+RWVD N++ +++ V FRGYS++H
Sbjct  383   ITTWSRWVDANINTSKSMVFFRGYSSSH  410



>gb|KDP44302.1| hypothetical protein JCGZ_19169 [Jatropha curcas]
Length=419

 Score =   286 bits (732),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 177/236 (75%), Gaps = 1/236 (0%)
 Frame = +1

Query  844   DCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNAT  1023
             +C+IFDG WV+DD+ P Y PGSCP ID  F+C ++ RPD+ Y ++RW+P+ C+IP  N  
Sbjct  58    NCNIFDGRWVKDDSYPLYEPGSCPHIDEPFNCFVNGRPDNGYERYRWQPNHCNIPRLNGK  117

Query  1024  DFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFE  1203
               LE LRG+++VF+GDSLNRNMWES+VC LR+  +DK +V+E SG  +FKK+G Y+F F+
Sbjct  118   YMLEILRGKRVVFIGDSLNRNMWESMVCTLRNAAKDKNKVYEASGIDEFKKEGSYSFVFQ  177

Query  1204  DYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHE  1380
             DYN +V+F  S FLV E      NGS  ETLR+D+++++   Y +AD+++FNTGHWWTHE
Sbjct  178   DYNFTVEFSRSNFLVEEWEIPQTNGSVKETLRIDMLERSVDKYKNADVLVFNTGHWWTHE  237

Query  1381  KTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             KTS G+D+YQEG+ V+  L+V  A+++A+ TW RWV+ NVD  +T V+FR YS +H
Sbjct  238   KTSSGKDFYQEGDHVYDELKVEIAFRKAMTTWVRWVEANVDPFKTLVVFRSYSVSH  293



>ref|XP_009146650.1| PREDICTED: protein trichome birefringence-like 1 [Brassica rapa]
Length=535

 Score =   290 bits (741),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 178/245 (73%), Gaps = 1/245 (0%)
 Frame = +1

Query  817   LRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHA  996
             +R+      +C+ ++GEWV+DD+ P Y PGSC  ID  F C  + RPD  + K +W+P  
Sbjct  168   MRREIKSLKNCEFYEGEWVKDDSYPLYKPGSCNLIDEQFTCVSNGRPDVEFQKLKWKPKQ  227

Query  997   CDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKK  1176
             C +P  N    LE +RG+++VFVGDSLNRNMWESLVCIL+  V+D+ +VFE  GR  F+ 
Sbjct  228   CTLPRLNGGKLLEMIRGRRIVFVGDSLNRNMWESLVCILKGSVKDESQVFEAHGRHQFRW  287

Query  1177  KGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIF  1353
             +  Y+F F+DYNC+V+F +SPFLV+E      NG+  ETLRLD++ K++  Y  ADI++F
Sbjct  288   EAEYSFVFKDYNCTVEFFASPFLVQEWELTDKNGTKKETLRLDVVGKSSEQYKGADILVF  347

Query  1354  NTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRG  1533
             NTGHWWTH+KTS+GEDYYQEGN V+P+L+V EA+ +AL TW +WVDKNV+  ++ V FRG
Sbjct  348   NTGHWWTHDKTSKGEDYYQEGNNVYPKLDVDEAFGKALTTWGQWVDKNVNPKKSFVFFRG  407

Query  1534  YSATH  1548
             YS +H
Sbjct  408   YSPSH  412



>ref|XP_011017737.1| PREDICTED: LOW QUALITY PROTEIN: protein trichome birefringence-like 
5 [Populus euphratica]
Length=521

 Score =   289 bits (739),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 142/311 (46%), Positives = 203/311 (65%), Gaps = 12/311 (4%)
 Frame = +1

Query  637   KKGDGSGKNGGFSLEGETVKSEGS-ENGDRSRSRGVGVEISKKGTSSTVKN-----DMIG  798
             K GD S K    S E E    +G  E+G  S      VE+S +      +N     D+ G
Sbjct  85    KTGDDSTK-VEVSAENEKDNPDGDFESGGGSSDNSTNVEVSSENEKDPDRNLESGADLNG  143

Query  799   ENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKW  978
              +  +L+   +S    CD++ G WV+D+  P Y  GSCP++D  FDC  + R D  Y+KW
Sbjct  144   NDDDKLMESLKS----CDLYMGTWVKDEEYPIYEAGSCPYVDEAFDCQGNGRKDSDYLKW  199

Query  979   RWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISG  1158
             RW+P+ CD+P FNATDFL RLRG++L+ VGDS+NRN +ES++C+LR  + DK ++FEI G
Sbjct  200   RWKPYDCDLPRFNATDFLTRLRGKRLMLVGDSVNRNQFESMLCLLREGLPDKSKMFEIHG  259

Query  1159  RSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFE-TLRLDLMDKTTSMYND  1335
                 K +G+Y F+F DY C+V+FV S FLV+E       GS   TL +D++DKT   +  
Sbjct  260   NKITKGRGYYVFKFVDYECTVEFVRSHFLVKEGVRINAQGSSNPTLSIDVIDKTAGRWKR  319

Query  1336  ADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRT  1515
             ADI++FNTGHWWTH KT+RG++YY+EG+ ++P+ + +EAY+RAL TWA+W+D+NVD  + 
Sbjct  320   ADILVFNTGHWWTHGKTARGKNYYKEGDYLYPKFDAVEAYRRALKTWAKWIDQNVDPKKQ  379

Query  1516  EVIFRGYSATH  1548
              V +RGYS+ H
Sbjct  380   LVFYRGYSSAH  390



>gb|AES97753.2| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
 gb|AES63045.2| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=528

 Score =   289 bits (740),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 177/246 (72%), Gaps = 1/246 (0%)
 Frame = +1

Query  814   LLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPH  993
             +++      ++CDI++G WV DD+ P Y  GSCP ID  F+C L+ R D+ Y K+RW+P 
Sbjct  164   VIQSDEHLRNNCDIYEGSWVLDDSFPLYKSGSCPHIDEPFNCFLNGRRDNKYEKFRWQPK  223

Query  994   ACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFK  1173
              C++P  N    L+ LRG++LVFVGDSLNRNMW+SLVCIL + V++K R+FE SGR +F+
Sbjct  224   NCNMPRLNGKYMLKMLRGKRLVFVGDSLNRNMWDSLVCILSNSVKNKSRIFEASGRQEFQ  283

Query  1174  KKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVI  1350
              +  Y+F F DYNCS++F  SPFLV+E    G  GS  ETLRLDL++++   Y +AD++I
Sbjct  284   TEDSYSFIFTDYNCSIEFFRSPFLVQEWEMPGKKGSKKETLRLDLVERSCDKYKNADVLI  343

Query  1351  FNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFR  1530
             FNTGHWWTHEKT  G++YYQEGN +H +L V EA  +A  TW+RWVD N+D  +T V FR
Sbjct  344   FNTGHWWTHEKTMEGKEYYQEGNHIHGQLNVEEAISKAFLTWSRWVDTNIDPKKTIVFFR  403

Query  1531  GYSATH  1548
             GYS +H
Sbjct  404   GYSPSH  409



>ref|XP_007145701.1| hypothetical protein PHAVU_007G261000g [Phaseolus vulgaris]
 gb|ESW17695.1| hypothetical protein PHAVU_007G261000g [Phaseolus vulgaris]
Length=670

 Score =   292 bits (748),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/264 (51%), Positives = 186/264 (70%), Gaps = 3/264 (1%)
 Frame = +1

Query  766   TSSTVKNDMIG--ENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDC  939
             T+S VK    G  E  S++  +       CD FDGEW++DD+ P Y PGSC  ID  F C
Sbjct  288   TASVVKKQKNGNKEEDSKVEDETIKALIKCDFFDGEWIKDDSYPLYEPGSCNLIDEQFSC  347

Query  940   HLHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRH  1119
               + R D  Y K++W+P  C +P  +    LE LRG++L+FVGDS+NRNMWESL+CILR+
Sbjct  348   IQNGRADKDYQKYKWKPKGCSLPRLHGQRMLEMLRGKRLIFVGDSINRNMWESLICILRN  407

Query  1120  VVRDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLR  1296
              V+DK +V+E  GR  F+ +  Y+F F+DYN S +   SPFLV+E   +  NG+  ETLR
Sbjct  408   SVKDKSKVYEAKGRVHFRGEASYSFIFKDYNFSAELFVSPFLVQEWEVQVKNGTKKETLR  467

Query  1297  LDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTW  1476
             LDL+ K++  Y +ADI+IFNTGHWWTH+KTS+G+DYYQEG+ V+  L VLEA+++A+ TW
Sbjct  468   LDLVGKSSVQYKNADIIIFNTGHWWTHDKTSKGKDYYQEGSHVYNELNVLEAFRKAITTW  527

Query  1477  ARWVDKNVDANRTEVIFRGYSATH  1548
             +RW+D NVD++++ + FRGYSA+H
Sbjct  528   SRWIDANVDSSKSMIFFRGYSASH  551



>ref|XP_003592794.1| hypothetical protein MTR_1g116130 [Medicago truncatula]
 ref|XP_003614795.1| hypothetical protein MTR_5g059400 [Medicago truncatula]
Length=555

 Score =   289 bits (739),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 177/246 (72%), Gaps = 1/246 (0%)
 Frame = +1

Query  814   LLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPH  993
             +++      ++CDI++G WV DD+ P Y  GSCP ID  F+C L+ R D+ Y K+RW+P 
Sbjct  164   VIQSDEHLRNNCDIYEGSWVLDDSFPLYKSGSCPHIDEPFNCFLNGRRDNKYEKFRWQPK  223

Query  994   ACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFK  1173
              C++P  N    L+ LRG++LVFVGDSLNRNMW+SLVCIL + V++K R+FE SGR +F+
Sbjct  224   NCNMPRLNGKYMLKMLRGKRLVFVGDSLNRNMWDSLVCILSNSVKNKSRIFEASGRQEFQ  283

Query  1174  KKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVI  1350
              +  Y+F F DYNCS++F  SPFLV+E    G  GS  ETLRLDL++++   Y +AD++I
Sbjct  284   TEDSYSFIFTDYNCSIEFFRSPFLVQEWEMPGKKGSKKETLRLDLVERSCDKYKNADVLI  343

Query  1351  FNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFR  1530
             FNTGHWWTHEKT  G++YYQEGN +H +L V EA  +A  TW+RWVD N+D  +T V FR
Sbjct  344   FNTGHWWTHEKTMEGKEYYQEGNHIHGQLNVEEAISKAFLTWSRWVDTNIDPKKTIVFFR  403

Query  1531  GYSATH  1548
             GYS +H
Sbjct  404   GYSPSH  409



>ref|XP_004502134.1| PREDICTED: uncharacterized protein LOC101510392 [Cicer arietinum]
Length=449

 Score =   286 bits (731),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 193/269 (72%), Gaps = 9/269 (3%)
 Frame = +1

Query  766   TSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDT-KPYYPPGSCPFIDRDFDCH  942
             +S + +N       +E  R+  S  + CDIFDG W++DD+ +P Y  GSCPF+D  F+C 
Sbjct  67    SSQSQRNTFSTVTAAERTREN-STNNSCDIFDGSWIQDDSLEPIYQHGSCPFLDDAFNCF  125

Query  943   LHKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHV  1122
              ++R D  ++K+RW+PH C+IP F+    L  LRG+++VFVGDSLNRNMW+SLVC LR  
Sbjct  126   KNRRSDFEFLKYRWKPHGCEIPRFDGLKMLNMLRGKRVVFVGDSLNRNMWQSLVCALRSS  185

Query  1123  VRDKK--RVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSF----  1284
             ++DK   R++++SGR +F+ +GF++F+F+DY CS+DFV SPFLV+E      +G+     
Sbjct  186   LKDKSKSRIYQVSGRREFRIQGFFSFKFKDYGCSIDFVKSPFLVQEWKVLRKDGASVSLQ  245

Query  1285  -ETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKR  1461
              ETLRLD++  + S+Y++ADI+IFNTGHWW H+KT  G +Y+QEGN V+ +L+V EA ++
Sbjct  246   RETLRLDMIQASKSLYHNADIIIFNTGHWWNHDKTKNGRNYFQEGNHVYEKLQVSEALRK  305

Query  1462  ALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             AL TWA+WVD  VD+ +T V F G+SA+H
Sbjct  306   ALKTWAKWVDSKVDSRKTRVFFTGFSASH  334



>ref|XP_002308095.2| hypothetical protein POPTR_0006s07090g [Populus trichocarpa]
 gb|EEE91618.2| hypothetical protein POPTR_0006s07090g [Populus trichocarpa]
Length=495

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 205/310 (66%), Gaps = 11/310 (4%)
 Frame = +1

Query  637   KKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEIS---KKGTSSTVKN--DMIGE  801
             K GD S +N   S E E     G ++G+        VE+S   KK     +++  D+ G 
Sbjct  85    KTGDDS-RNMEVSTENEDDPDGGVDSGEDLIYNSTNVEVSSENKKDPDVDLESGGDLSGN  143

Query  802   NGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWR  981
              G +L+   +S    CD++ G WV+D+  P Y  GSCP++D  FDC  + R D  Y+KWR
Sbjct  144   GGDKLMESLKS----CDLYRGTWVKDEEYPIYKAGSCPYVDEAFDCQGNGRKDSDYLKWR  199

Query  982   WRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR  1161
             W+P+ CD+P FNATDFL RLRG++L+ VGDS+NRN +ES++C+LR  + DK ++FEI GR
Sbjct  200   WKPNDCDLPRFNATDFLTRLRGKRLMLVGDSMNRNQFESMLCLLREGLPDKSKMFEIHGR  259

Query  1162  SDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFE-TLRLDLMDKTTSMYNDA  1338
                K +G+Y F+F D+ C+V+FV S FLV+E       GS   TL +D++DKT   +  A
Sbjct  260   RITKGRGYYVFKFVDFKCTVEFVRSHFLVKEGVRINAQGSSNPTLSIDVIDKTAGRWKRA  319

Query  1339  DIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTE  1518
             DI++FNTGHWWTH KT+RG++YY+EG+ ++P+ + +EAY+RAL TW +W+DKNV+  +  
Sbjct  320   DILVFNTGHWWTHGKTARGKNYYKEGDYLYPKFDAVEAYRRALRTWGKWIDKNVNPKKQL  379

Query  1519  VIFRGYSATH  1548
             V +RGYS+ H
Sbjct  380   VFYRGYSSAH  389



>gb|AES91931.2| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=466

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 176/239 (74%), Gaps = 3/239 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDT-KPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFN  1017
             S CDIFDG W++DD+ +  Y  GSCPF+D  F+C  + R D  ++K+RW+PH C IP F+
Sbjct  112   SSCDIFDGSWIQDDSHETVYQHGSCPFLDDTFNCFKNGRSDFEFLKYRWKPHGCQIPRFD  171

Query  1018  ATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFR  1197
                 L  LRG+++VFVGDSLNRNMW+SLVC LR  ++DK R++E+SGR +F+ +GF++F+
Sbjct  172   GLKMLHMLRGKRVVFVGDSLNRNMWQSLVCALRASLKDKSRLYEVSGRREFRIQGFFSFK  231

Query  1198  FEDYNCSVDFVSSPFLVRE--SSFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWW  1371
             F+DY CS+DFV SPFLV+E   S        +TLRLD++  + S Y DADI+IFNTGHWW
Sbjct  232   FKDYGCSIDFVKSPFLVQEWKVSRDDEVPQRDTLRLDMIQASKSQYYDADIIIFNTGHWW  291

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
              H+KT  G +Y+QEGN V+ RLEV EA ++AL TWA+WVD  VD+ RT V F G+SA+H
Sbjct  292   NHDKTKNGRNYFQEGNHVYDRLEVSEALQKALKTWAKWVDSTVDSTRTRVFFTGFSASH  350



>emb|CDY33914.1| BnaA02g30730D [Brassica napus]
Length=452

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 176/239 (74%), Gaps = 3/239 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             + CDIFDG WV DD+ P Y PG CP+++  F+C  + RPD  +++ RW+PH C +P F+ 
Sbjct  93    TSCDIFDGAWVSDDSDPVYLPGYCPYVEDKFNCFKNGRPDSGFLRHRWQPHGCSVPRFDG  152

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEI-SGRSDFKKKGFYAFR  1197
                LE LRG++LVFVGDSLNRNMWESLVC LR  + DK RV  +   +S+   +GFY FR
Sbjct  153   EKMLEILRGKRLVFVGDSLNRNMWESLVCSLRSTLEDKNRVSRVFVKQSNLHNEGFYGFR  212

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKT-TSMYNDADIVIFNTGHWW  1371
             F+D+ CS+DF+ SPFLV+ES      G   ETLRLD++ ++ T +Y +ADIV+FNTGHWW
Sbjct  213   FKDFECSIDFIKSPFLVQESEVLDAYGKRKETLRLDVIQESITKIYRNADIVVFNTGHWW  272

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TH+KT+ G+DY+QEG+RV+ +LEV EAY +AL TWA WVD ++++ RT V F GYS++H
Sbjct  273   THQKTNEGKDYFQEGDRVYEKLEVKEAYTKALRTWADWVDSSINSTRTRVFFVGYSSSH  331



>ref|XP_009129778.1| PREDICTED: protein trichome birefringence-like 4 [Brassica rapa]
Length=452

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 176/239 (74%), Gaps = 3/239 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             + CDIFDG WV DD+ P Y PG CP+++  F+C  + RPD  +++ RW+PH C +P F+ 
Sbjct  93    TSCDIFDGAWVSDDSDPVYLPGYCPYVEDKFNCFKNGRPDSGFLRHRWQPHGCSVPRFDG  152

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEI-SGRSDFKKKGFYAFR  1197
                LE LRG++LVFVGDSLNRNMWESLVC LR  + DK RV  +   +S+   +GFY FR
Sbjct  153   EKMLEILRGKRLVFVGDSLNRNMWESLVCSLRSTLEDKNRVSRVFVKQSNLHNEGFYGFR  212

Query  1198  FEDYNCSVDFVSSPFLVRESSFKGVNGSF-ETLRLDLMDKT-TSMYNDADIVIFNTGHWW  1371
             F+D+ CS+DF+ SPFLV+ES      G   ETLRLD++ ++ T +Y +ADIV+FNTGHWW
Sbjct  213   FKDFECSIDFIKSPFLVQESEVLDAYGKRKETLRLDVIQESITKIYRNADIVVFNTGHWW  272

Query  1372  THEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             TH+KT+ G+DY+QEG+RV+ +LEV EAY +AL TWA WVD ++++ RT V F GYS++H
Sbjct  273   THQKTNEGKDYFQEGDRVYEKLEVKEAYTKALRTWADWVDSSINSTRTRVFFVGYSSSH  331



>ref|XP_011020096.1| PREDICTED: protein trichome birefringence-like 5 [Populus euphratica]
Length=494

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 205/310 (66%), Gaps = 11/310 (4%)
 Frame = +1

Query  637   KKGDGSGKNGGFSLEGETVKSEGSENGDRSRSRGVGVEIS---KKGTSSTVKN--DMIGE  801
             K GD S +N   S E E     G ++G+        VE+S   KK     +++  D+ G 
Sbjct  84    KTGDDS-RNMEVSPENEDDPDGGVDSGEDLIYNSTNVEVSSENKKDLDVDLESGGDLSGN  142

Query  802   NGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWR  981
              G +L+   +S    CD++ G WV+D+  P Y  GSCP++D  FDC  + R D  Y+KWR
Sbjct  143   GGDKLMESLKS----CDLYRGTWVKDEEYPIYKAGSCPYVDEAFDCQGNGRKDSDYLKWR  198

Query  982   WRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR  1161
             W+P+ CD+P FNATDFL RLRG++L+ VGDS+NRN +ES++C+LR  + DK ++FEI GR
Sbjct  199   WKPNDCDLPRFNATDFLTRLRGKRLMLVGDSMNRNQFESMLCLLREGLPDKSKMFEIHGR  258

Query  1162  SDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFE-TLRLDLMDKTTSMYNDA  1338
                K +G+Y F+F D+ C+V+FV S FLV+E       GS   TL +D++DKT   +  A
Sbjct  259   RITKGRGYYVFKFVDFKCTVEFVRSHFLVKEGVRINAQGSSNPTLSIDVIDKTAGRWKRA  318

Query  1339  DIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTE  1518
             DI++FNTGHWWTH KT+RG++YY+EG+ ++P+ + +EAY+RAL TW +W+DKNV+  +  
Sbjct  319   DILVFNTGHWWTHGKTARGKNYYKEGDYLYPKFDAVEAYRRALRTWGKWIDKNVNPKKQL  378

Query  1519  VIFRGYSATH  1548
             V +RGYS+ H
Sbjct  379   VFYRGYSSAH  388



>ref|XP_009763711.1| PREDICTED: protein trichome birefringence-like 5 [Nicotiana sylvestris]
Length=520

 Score =   287 bits (735),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 177/235 (75%), Gaps = 2/235 (1%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             CD++ G WV+D+  P Y  GSCP++D  FDC  + RPD  Y+ WRW+PH CD+P F+ATD
Sbjct  176   CDLYKGRWVKDEKHPIYKAGSCPYVDEAFDCQSNGRPDSEYLNWRWKPHGCDLPRFSATD  235

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
             FL+RL+G++L+ VGDS+NRN +ESL+C+LR  + +K +++EI G    K +G+Y F+FED
Sbjct  236   FLKRLKGKRLMLVGDSMNRNQFESLLCLLREGLVNKSKMYEIHGYKITKGRGYYVFKFED  295

Query  1207  YNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YNC+V+FV S FLVRE       G S  TL +D +DK+++ +  ADIV+FNTGHWWTH K
Sbjct  296   YNCTVEFVRSHFLVREGVRINAQGNSNPTLSIDRIDKSSNRWKKADIVVFNTGHWWTHGK  355

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             T+RG++YY+EG+ V+P+ + LEAY+RAL TWA+W+D+N+   +  +I+RGYS+ H
Sbjct  356   TARGKNYYKEGDHVYPKFDALEAYRRALKTWAKWIDENMSHEKL-IIYRGYSSAH  409



>ref|XP_002297655.2| hypothetical protein POPTR_0001s04810g, partial [Populus trichocarpa]
 gb|EEE82460.2| hypothetical protein POPTR_0001s04810g, partial [Populus trichocarpa]
Length=535

 Score =   287 bits (735),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 173/235 (74%), Gaps = 1/235 (0%)
 Frame = +1

Query  847   CDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNATD  1026
             C+ FDG+W +DD+ P + PGSCP ID  F+C ++ R D  Y K+RW+P  C+IP  N   
Sbjct  181   CNWFDGKWGKDDSYPIFAPGSCPHIDEPFNCFINGRLDSEYQKYRWQPRHCNIPRMNGKI  240

Query  1027  FLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRFED  1206
              LE LRG++LVFVGDSLNRNMWESLVCILR+ V DK +VFE SGR +F+ +  Y+F FED
Sbjct  241   MLEMLRGKRLVFVGDSLNRNMWESLVCILRNSVEDKSKVFEASGREEFRSESSYSFIFED  300

Query  1207  YNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTHEK  1383
             YN SV+F  SPFLV+E   +G NGS  ETLRLD++++++  Y  AD++IFNTGHWWTHEK
Sbjct  301   YNSSVEFFQSPFLVQEWEMEGKNGSKKETLRLDMLERSSDNYKTADVLIFNTGHWWTHEK  360

Query  1384  TSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             T  G  YYQEG+ V+ +L V +A+++AL TWARWV+   D  +T V FRGYS +H
Sbjct  361   TLDGRGYYQEGSHVYSQLNVDKAFRKALRTWARWVETKTDPFKTLVFFRGYSVSH  415



>ref|XP_006366199.1| PREDICTED: uncharacterized protein LOC102583948 isoform X2 [Solanum 
tuberosum]
Length=499

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 186/262 (71%), Gaps = 9/262 (3%)
 Frame = +1

Query  766   TSSTVKNDMIGENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHL  945
             TS T K+ ++        +K R     CD+F G WV+D+  P Y PGSCP++D  FDC  
Sbjct  145   TSETPKSSLVE-------KKSRPIGESCDLFKGSWVKDENHPIYKPGSCPYVDEAFDCQT  197

Query  946   HKRPDDAYVKWRWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVV  1125
             + RPD  Y+KW W+PH C +P F+ +DFL+RL+G++L+ VGDS+NRN +ESL+C+LR  +
Sbjct  198   NGRPDSQYLKWTWKPHGCHLPRFSPSDFLKRLKGKRLMLVGDSMNRNQFESLLCLLREGL  257

Query  1126  RDKKRVFEISGRSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFE-TLRLD  1302
              +K +++EI G    K +G+Y F+FEDYNC+V+FV S FL RE       GS   TL +D
Sbjct  258   ANKSKMYEIHGYKITKGRGYYVFKFEDYNCTVEFVRSHFLAREGVRINPQGSSNPTLSID  317

Query  1303  LMDKTTSMYNDADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWAR  1482
              +DKT+  +  ADI+IFNTGHWWTH KT+RG++YY+EG++V+P+ + +EAY+RAL TWA+
Sbjct  318   RIDKTSKRWKGADILIFNTGHWWTHGKTARGKNYYKEGDQVYPKFDAVEAYRRALKTWAK  377

Query  1483  WVDKNVDANRTEVIFRGYSATH  1548
             W+D+N++  +  +I+RGYS+ H
Sbjct  378   WIDENMNREKL-IIYRGYSSAH  398



>gb|KHG05807.1| Pyridoxal-phosphate-dependent serine hydroxymethyltransferase 
[Gossypium arboreum]
Length=412

 Score =   283 bits (723),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 179/250 (72%), Gaps = 1/250 (0%)
 Frame = +1

Query  802   NGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWR  981
             +G++ L         CD++ G WV+DD  P Y PGSCP++D  FDC  + RPD  Y++WR
Sbjct  56    DGNQTLDTAHENREMCDLYTGTWVKDDDYPIYKPGSCPYVDEAFDCQSNGRPDSNYLRWR  115

Query  982   WRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGR  1161
             W+P  CD+P FNATDFLERLRG++L+ VGDS+NRN +ES++C+LR  + +K +++E+ G 
Sbjct  116   WKPDGCDLPRFNATDFLERLRGKRLMLVGDSMNRNQFESILCLLREGLANKSKMYEVHGY  175

Query  1162  SDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNG-SFETLRLDLMDKTTSMYNDA  1338
                K++G++ F+FEDYNC+V FV S FLV+E       G S  TL +D +DKT+  +  A
Sbjct  176   KITKERGYFIFKFEDYNCTVVFVRSHFLVKEGIRINEQGNSNPTLSIDKIDKTSDRWKQA  235

Query  1339  DIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTE  1518
             DI+IFNT HWW H KT+RG +YY+EG+ ++P+L+ +EAY+RAL TWARW+D+N+      
Sbjct  236   DILIFNTAHWWVHGKTARGINYYKEGDYLYPKLDAVEAYRRALKTWARWIDENIKPEAKL  295

Query  1519  VIFRGYSATH  1548
             V++RGYS+ H
Sbjct  296   VLYRGYSSAH  305



>ref|XP_006657213.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=386

 Score =   282 bits (721),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 174/238 (73%), Gaps = 2/238 (1%)
 Frame = +1

Query  841   SDCDIFDGEWVRDD-TKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFN  1017
             + CD++DGEWVRD+  +P Y PG+CP++D  + C  + RPD AY +WRW P  C +P FN
Sbjct  33    ATCDLYDGEWVRDEGARPLYAPGTCPYVDEAYACASNGRPDAAYTRWRWAPRRCRLPRFN  92

Query  1018  ATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFR  1197
             ATDFL RLRG++L+ VGDS+NRN +ESL+CILR  + DK R+FE  G    K +G++ F+
Sbjct  93    ATDFLARLRGKRLMLVGDSMNRNQFESLLCILREALPDKTRMFETHGYKITKGRGYFVFK  152

Query  1198  FEDYNCSVDFVSSPFLVRES-SFKGVNGSFETLRLDLMDKTTSMYNDADIVIFNTGHWWT  1374
             F DY+C+V+FV S FLVRE   +     S   L++D +DKT S +  AD+++FNTGHWWT
Sbjct  153   FVDYDCTVEFVRSHFLVREGVRYNRQRNSNPILQIDRIDKTASRWRKADVLVFNTGHWWT  212

Query  1375  HEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             H KT+RG++YY+EGN ++P+ +  EAY+RAL TWARW+DKNV+  ++ V +RGYS  H
Sbjct  213   HGKTARGKNYYKEGNTLYPQFDSTEAYRRALRTWARWIDKNVNPAKSVVFYRGYSTAH  270



>ref|XP_002324663.2| hypothetical protein POPTR_0018s13290g [Populus trichocarpa]
 gb|EEF03228.2| hypothetical protein POPTR_0018s13290g [Populus trichocarpa]
Length=501

 Score =   285 bits (730),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 141/311 (45%), Positives = 200/311 (64%), Gaps = 12/311 (4%)
 Frame = +1

Query  637   KKGDGSGKNGGFSLEGETVKSEGS-ENGDRSRSRGVGVEISKKGTSSTVKN-----DMIG  798
             K GD S K    S E E    +G  E+G  S      VE+S +       N     D+ G
Sbjct  85    KTGDDSTK-VEVSAENEKDNPDGDFESGGGSSDNSTNVEVSSENEKDPDGNLETGADLDG  143

Query  799   ENGSELLRKGRSFYSDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKW  978
                 +L+   +S    CD++ G WV+D+  P Y  GSCP++D  FDC  + R D  Y+KW
Sbjct  144   NGDDKLMASLKS----CDLYMGTWVKDEEYPIYEAGSCPYVDEAFDCQGNGRKDSDYLKW  199

Query  979   RWRPHACDIPSFNATDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISG  1158
             RW+P+ CD+P FNATDFL RLRG++L+ VGDS+NRN +ES++C+LR  + DK ++FEI G
Sbjct  200   RWKPYDCDLPRFNATDFLTRLRGKRLMLVGDSMNRNQFESMLCLLREGLPDKSKMFEIHG  259

Query  1159  RSDFKKKGFYAFRFEDYNCSVDFVSSPFLVRESSFKGVNGSFE-TLRLDLMDKTTSMYND  1335
                 K +G+Y F+F DY C+V+FV S FLV+E       GS   TL +D++DKT   +  
Sbjct  260   NKITKGRGYYVFKFVDYECTVEFVRSHFLVKEGVRINAQGSSNPTLSIDVIDKTAGRWKR  319

Query  1336  ADIVIFNTGHWWTHEKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRT  1515
             ADI++FNTGHWW H KT+RG++YY+EG+ ++P+ + +EAY+RAL TWA+W+D+NVD  + 
Sbjct  320   ADILVFNTGHWWAHGKTARGKNYYKEGDYLYPKFDAVEAYRRALKTWAKWIDQNVDPKKQ  379

Query  1516  EVIFRGYSATH  1548
              V +RGYS+ H
Sbjct  380   LVFYRGYSSAH  390



>ref|XP_004296155.1| PREDICTED: uncharacterized protein LOC101303602 [Fragaria vesca 
subsp. vesca]
Length=797

 Score =   293 bits (749),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 170/237 (72%), Gaps = 1/237 (0%)
 Frame = +1

Query  841   SDCDIFDGEWVRDDTKPYYPPGSCPFIDRDFDCHLHKRPDDAYVKWRWRPHACDIPSFNA  1020
             +DCD+FDG WVRDD+ P Y  G+CP+ID  F+C  + RPD+ Y K+RW+P  C++P  + 
Sbjct  443   NDCDLFDGTWVRDDSYPLYAAGTCPYIDEAFNCFPNGRPDNDYEKYRWQPKHCNVPRLDG  502

Query  1021  TDFLERLRGQKLVFVGDSLNRNMWESLVCILRHVVRDKKRVFEISGRSDFKKKGFYAFRF  1200
                L  L G++LVFVGDSLNRNMWESL+C+LR+ V DK +V E+SGR +F+ +  Y+F F
Sbjct  503   RKMLRLLAGKRLVFVGDSLNRNMWESLLCVLRNSVEDKNKVNEVSGRKEFRTEKSYSFIF  562

Query  1201  EDYNCSVDFVSSPFLVRESSFKGVNGS-FETLRLDLMDKTTSMYNDADIVIFNTGHWWTH  1377
             +DYNCSV+F  S FLV+E   K  NGS  ETLR+DLM+     Y DAD +IFNTGHWWTH
Sbjct  563   QDYNCSVEFFQSQFLVQEWEGKDKNGSKKETLRIDLMESAADNYKDADFLIFNTGHWWTH  622

Query  1378  EKTSRGEDYYQEGNRVHPRLEVLEAYKRALYTWARWVDKNVDANRTEVIFRGYSATH  1548
             EKTS G  YYQEG+ V+  L   EAY+RAL TW RW+D  VD  +T V FRGYS +H
Sbjct  623   EKTSNGLGYYQEGDHVYDELNGEEAYRRALSTWGRWLDTKVDPKKTAVFFRGYSLSH  679



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4282802373808