BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22814_g2_i4 len=1696 path=[2449:0-140 2681:141-360 2899:361-864
2448:865-1239 98:1240-1695]

Length=1696
                                                                      Score     E

ref|XP_009615028.1|  PREDICTED: uncharacterized protein LOC104107...    342   0.0      
ref|XP_009615027.1|  PREDICTED: uncharacterized protein LOC104107...    328   1e-177   
gb|AIU50930.1|  ARM repeat superfamily protein                          268   6e-140   
gb|AIU50918.1|  ARM repeat superfamily protein                          265   9e-140   
gb|AIU50904.1|  ARM repeat superfamily protein                          263   3e-138   
gb|AIU50900.1|  ARM repeat superfamily protein                          261   5e-138   
gb|AIU50902.1|  ARM repeat superfamily protein                          271   8e-138   
gb|AIU50920.1|  ARM repeat superfamily protein                          258   9e-135   
gb|AIU50916.1|  ARM repeat superfamily protein                          257   2e-133   
gb|AIU50901.1|  ARM repeat superfamily protein                          252   2e-132   
gb|AIU50924.1|  ARM repeat superfamily protein                          256   4e-130   
gb|AIU50897.1|  ARM repeat superfamily protein                          251   7e-130   
gb|AIU50905.1|  ARM repeat superfamily protein                          258   2e-128   
gb|AIU50907.1|  ARM repeat superfamily protein                          246   5e-125   
gb|AIU50923.1|  ARM repeat superfamily protein                          249   3e-123   
gb|AIU50912.1|  ARM repeat superfamily protein                          234   7e-119   
gb|AIU50936.1|  ARM repeat superfamily protein                          229   1e-115   
gb|AIU50917.1|  ARM repeat superfamily protein                          235   4e-114   
gb|AIU50890.1|  ARM repeat superfamily protein                          224   5e-114   
gb|AIU50911.1|  ARM repeat superfamily protein                          221   1e-113   
gb|AIU50894.1|  ARM repeat superfamily protein                          233   2e-113   
gb|AIU50891.1|  ARM repeat superfamily protein                          224   2e-113   
gb|AIU50915.1|  ARM repeat superfamily protein                          220   3e-113   
gb|AIU50910.1|  ARM repeat superfamily protein                          231   6e-113   
gb|AIU50929.1|  ARM repeat superfamily protein                          217   1e-111   
gb|AIU50932.1|  ARM repeat superfamily protein                          229   2e-111   
gb|AIU50903.1|  ARM repeat superfamily protein                          216   2e-111   
gb|AIU50939.1|  ARM repeat superfamily protein                          222   1e-110   
gb|AIU50906.1|  ARM repeat superfamily protein                          214   5e-110   
ref|XP_006348273.1|  PREDICTED: uncharacterized protein LOC102597543    347   1e-108   
ref|XP_011098276.1|  PREDICTED: uncharacterized protein LOC105176972    345   5e-108   
ref|XP_009781372.1|  PREDICTED: uncharacterized protein LOC104230304    345   5e-108   
ref|XP_004244250.1|  PREDICTED: uncharacterized protein LOC101261434    339   2e-105   
emb|CDP05951.1|  unnamed protein product                                337   6e-105   
gb|EYU26362.1|  hypothetical protein MIMGU_mgv1a006403mg                321   2e-99    
gb|AIU50927.1|  ARM repeat superfamily protein                          196   2e-99    
gb|AIU50937.1|  ARM repeat superfamily protein                          197   1e-98    
gb|AIU50928.1|  ARM repeat superfamily protein                          195   3e-98    
gb|AIU50896.1|  ARM repeat superfamily protein                          195   4e-98    
gb|AIU50922.1|  ARM repeat superfamily protein                          193   2e-97    
gb|KCW67106.1|  hypothetical protein EUGRSUZ_F008902                    298   1e-92    
gb|KCW67407.1|  hypothetical protein EUGRSUZ_F01169                     301   5e-92    
gb|AIU50921.1|  ARM repeat superfamily protein                          255   1e-91    
ref|XP_006370213.1|  hypothetical protein POPTR_0001s40690g             303   1e-91    
gb|KCW67408.1|  hypothetical protein EUGRSUZ_F01169                     300   3e-91    
ref|XP_011043841.1|  PREDICTED: uncharacterized protein LOC105139178    301   5e-91    
ref|XP_010060623.1|  PREDICTED: uncharacterized protein LOC104448485    300   1e-90    
ref|XP_004146048.1|  PREDICTED: uncharacterized protein LOC101213054    299   3e-90    
ref|XP_010644176.1|  PREDICTED: uncharacterized protein LOC100260...    298   3e-90    
ref|XP_008463698.1|  PREDICTED: uncharacterized protein LOC103501781    299   3e-90    
ref|XP_010644175.1|  PREDICTED: uncharacterized protein LOC100260...    298   6e-90    
ref|XP_006451778.1|  hypothetical protein CICLE_v10007885mg             295   8e-90    
ref|XP_007211742.1|  hypothetical protein PRUPE_ppa006266mg             294   2e-89    
ref|XP_006451779.1|  hypothetical protein CICLE_v10007885mg             295   2e-88    
ref|XP_006464808.1|  PREDICTED: 26S proteasome non-ATPase regulat...    295   3e-88    
ref|XP_006464807.1|  PREDICTED: 26S proteasome non-ATPase regulat...    295   4e-88    
ref|XP_009341341.1|  PREDICTED: uncharacterized protein LOC103933377    294   6e-88    
gb|KDP45863.1|  hypothetical protein JCGZ_15307                         293   1e-87    
ref|XP_008367106.1|  PREDICTED: 26S proteasome non-ATPase regulat...    292   2e-87    
gb|AIU50931.1|  ARM repeat superfamily protein                          283   2e-87    
ref|XP_009356775.1|  PREDICTED: uncharacterized protein LOC103947585    290   8e-87    
ref|XP_004510024.1|  PREDICTED: uncharacterized protein LOC101495...    290   1e-86    
gb|AIU50935.1|  ARM repeat superfamily protein                          176   2e-86    
gb|KHG14696.1|  26S proteasome non-ATPase regulatory subunit 5          289   2e-86    
ref|XP_006370214.1|  proteasome-related family protein                  290   4e-86    
ref|XP_010542296.1|  PREDICTED: uncharacterized protein LOC104815562    287   9e-86    
ref|XP_007021566.1|  ARM repeat superfamily protein                     287   1e-85    
ref|XP_004291500.1|  PREDICTED: 26S proteasome non-ATPase regulat...    286   2e-85    
ref|XP_010272362.1|  PREDICTED: uncharacterized protein LOC104608165    286   5e-85    
ref|XP_008226495.1|  PREDICTED: 26S proteasome non-ATPase regulat...    285   5e-85    
ref|XP_002532239.1|  26S proteasome non-ATPase regulatory subunit...    287   9e-85    Ricinus communis
gb|KCW67359.1|  hypothetical protein EUGRSUZ_F01141                     283   2e-84    
gb|EPS71300.1|  hypothetical protein M569_03459                         276   5e-84    
ref|XP_003628552.1|  26S proteasome non-ATPase regulatory subunit       282   9e-84    
gb|ACJ85798.1|  unknown                                                 274   3e-83    Medicago truncatula
ref|XP_003527227.1|  PREDICTED: uncharacterized protein LOC100785671    279   2e-82    
ref|XP_004510025.1|  PREDICTED: uncharacterized protein LOC101495...    276   7e-82    
dbj|BAE71213.1|  hypothetical protein                                   275   4e-81    Trifolium pratense [peavine clover]
gb|AIU50934.1|  ARM repeat superfamily protein                          264   5e-80    
ref|XP_010098425.1|  26S proteasome non-ATPase regulatory subunit 5     268   2e-78    
ref|XP_007133203.1|  hypothetical protein PHAVU_011G160300g             267   5e-78    
emb|CDX98531.1|  BnaC05g38440D                                          261   5e-76    
ref|XP_009146281.1|  PREDICTED: uncharacterized protein LOC103869951    258   8e-75    
ref|XP_010675475.1|  PREDICTED: uncharacterized protein LOC104891477    258   1e-74    
emb|CDX97636.1|  BnaA05g24430D                                          255   1e-73    
gb|AIU50893.1|  ARM repeat superfamily protein                          230   9e-73    
ref|XP_002882918.1|  hypothetical protein ARALYDRAFT_478950             253   9e-73    
gb|AIU50889.1|  ARM repeat superfamily protein                          245   1e-72    
ref|XP_006407004.1|  hypothetical protein EUTSA_v10020515mg             252   2e-72    
ref|NP_566503.1|  ARM repeat superfamily protein                        252   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392535.1|  PREDICTED: uncharacterized protein LOC103978467    252   3e-72    
ref|XP_008801497.1|  PREDICTED: uncharacterized protein LOC103715...    251   3e-72    
ref|XP_008801496.1|  PREDICTED: uncharacterized protein LOC103715...    251   4e-72    
ref|XP_006297436.1|  hypothetical protein CARUB_v10013459mg             251   6e-72    
ref|NP_001189898.1|  ARM repeat superfamily protein                     251   9e-72    
gb|AAM65463.1|  unknown                                                 250   9e-72    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02572.1|  unnamed protein product                                251   1e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008386323.1|  PREDICTED: uncharacterized protein LOC103448838    244   2e-71    
ref|XP_010465467.1|  PREDICTED: uncharacterized protein LOC104745812    248   7e-71    
ref|XP_010487337.1|  PREDICTED: uncharacterized protein LOC104765340    248   1e-70    
ref|XP_010917987.1|  PREDICTED: uncharacterized protein LOC105042...    247   2e-70    
gb|KFK38863.1|  hypothetical protein AALP_AA3G170300                    244   2e-69    
ref|XP_010502588.1|  PREDICTED: uncharacterized protein LOC104779866    243   5e-69    
ref|XP_006593223.1|  PREDICTED: uncharacterized protein LOC100782437    239   7e-69    
gb|AIU50933.1|  ARM repeat superfamily protein                          233   6e-68    
gb|AIU50899.1|  ARM repeat superfamily protein                          234   3e-66    
ref|XP_010917995.1|  PREDICTED: uncharacterized protein LOC105042...    233   8e-66    
gb|KCW67107.1|  hypothetical protein EUGRSUZ_F008902                    224   2e-65    
gb|AIU50909.1|  ARM repeat superfamily protein                          225   6e-65    
ref|XP_006859052.1|  hypothetical protein AMTR_s00068p00189110          234   4e-63    
gb|AIU50908.1|  ARM repeat superfamily protein                          201   8e-63    
gb|KCW67108.1|  hypothetical protein EUGRSUZ_F008901                    214   2e-62    
ref|NP_001056287.1|  Os05g0557200                                       225   2e-62    Oryza sativa Japonica Group [Japonica rice]
gb|AIU50892.1|  ARM repeat superfamily protein                          222   8e-62    
emb|CAN62354.1|  hypothetical protein VITISV_022417                     216   2e-61    Vitis vinifera
gb|EEC79675.1|  hypothetical protein OsI_20936                          222   3e-61    Oryza sativa Indica Group [Indian rice]
gb|AIU50925.1|  ARM repeat superfamily protein                          220   4e-61    
ref|XP_002440229.1|  hypothetical protein SORBIDRAFT_09g028070          219   4e-60    Sorghum bicolor [broomcorn]
gb|AIU50913.1|  ARM repeat superfamily protein                          216   4e-60    
gb|EMT14922.1|  26S proteasome non-ATPase regulatory subunit 5          218   7e-60    
ref|NP_001145467.1|  uncharacterized protein LOC100278856               218   1e-59    Zea mays [maize]
gb|AFW79105.1|  hypothetical protein ZEAMMB73_239741                    217   2e-59    
ref|XP_003567925.1|  PREDICTED: uncharacterized protein LOC100830727    216   5e-59    
gb|AIU50895.1|  ARM repeat superfamily protein                          214   6e-59    
ref|XP_008647702.1|  PREDICTED: uncharacterized protein LOC100278...    217   7e-59    
dbj|BAJ87373.1|  predicted protein                                      214   2e-58    
ref|XP_006654765.1|  PREDICTED: uncharacterized protein LOC102715305    213   3e-58    
ref|XP_008360047.1|  PREDICTED: uncharacterized protein LOC103423744    204   3e-58    
gb|EMS59085.1|  26S proteasome non-ATPase regulatory subunit 5          218   3e-58    
gb|AIU50898.1|  ARM repeat superfamily protein                          211   7e-58    
ref|XP_004961264.1|  PREDICTED: uncharacterized protein LOC101757405    213   7e-58    
gb|KDO49244.1|  hypothetical protein CISIN_1g0124482mg                  207   2e-57    
gb|AIU50926.1|  ARM repeat superfamily protein                          210   2e-57    
gb|AIU50938.1|  ARM repeat superfamily protein                          200   2e-55    
gb|ADE76369.1|  unknown                                                 205   4e-55    
gb|AIU50914.1|  ARM repeat superfamily protein                          201   5e-54    
gb|EPS65697.1|  hypothetical protein M569_09080                         187   3e-52    
gb|AIU50940.1|  ARM repeat superfamily protein                          188   1e-50    
gb|AIU50919.1|  ARM repeat superfamily protein                          175   2e-48    
ref|XP_010064455.1|  PREDICTED: uncharacterized protein LOC104451515    159   6e-39    
ref|XP_006478066.1|  PREDICTED: uncharacterized protein LOC102620361    144   9e-37    
gb|KDO49245.1|  hypothetical protein CISIN_1g0124481mg                  135   2e-34    
ref|XP_001766663.1|  predicted protein                                  140   1e-32    
ref|XP_002975709.1|  hypothetical protein SELMODRAFT_442892             134   2e-30    
gb|KHN05308.1|  hypothetical protein glysoja_047203                     122   2e-28    
ref|XP_002973654.1|  hypothetical protein SELMODRAFT_413906           88.2    3e-15    
ref|XP_005846909.1|  hypothetical protein CHLNCDRAFT_134792           57.4    4e-06    
emb|CAN71644.1|  hypothetical protein VITISV_041775                   58.5    7e-06    Vitis vinifera
ref|XP_005651761.1|  ARM repeat-containing protein                    55.8    7e-05    
ref|XP_002609424.1|  hypothetical protein BRAFLDRAFT_114978           52.8    7e-04    Branchiostoma floridae



>ref|XP_009615028.1| PREDICTED: uncharacterized protein LOC104107825 isoform X2 [Nicotiana 
tomentosiformis]
Length=523

 Score =   342 bits (877),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/239 (72%), Positives = 201/239 (84%), Gaps = 1/239 (0%)
 Frame = -3

Query  890  FIYLVQ*LGYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPV  711
            F+++ +  G RN+ISAIDRRF  L S++ADE ECALEA GQIG   KGAA LLS +    
Sbjct  286  FVFIDE-FGIRNLISAIDRRFNLLESENADECECALEALGQIGFSSKGAALLLSGAQPAG  344

Query  710  RHVISAAFDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKL  531
            RHVI AAFD Q HGK+LAALHAL NIVGETR+ NDVLLDG AEESLRRLIY+T+SK+ KL
Sbjct  345  RHVIYAAFDRQQHGKQLAALHALANIVGETRAENDVLLDGVAEESLRRLIYETASKTSKL  404

Query  530  TPSGLLLSVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGME  351
            TPSGLLLSVLQQDSEIR AGYRVIT LV RPWCL+E++SRQEI++I T+  TE +KIGME
Sbjct  405  TPSGLLLSVLQQDSEIRKAGYRVITALVMRPWCLMEVVSRQEIINIATDTCTERDKIGME  464

Query  350  ARHKCCEAVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ARHKCC+++Y+ FTSSSKL++D A SG+ATKLEEAIR GPYLGR+ +EAQP VMTEQRF
Sbjct  465  ARHKCCQSIYKGFTSSSKLIADNALSGVATKLEEAIRRGPYLGRRLSEAQPTVMTEQRF  523


 Score =   329 bits (844),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/245 (70%), Positives = 205/245 (84%), Gaps = 0/245 (0%)
 Frame = -2

Query  1644  MEEEYSVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDAL  1465
             MEEEYSVD AQLL+AATDFAY P   SD SAQ+FL+RFPLPA+INALQ K+++PGLE+AL
Sbjct  1     MEEEYSVDPAQLLEAATDFAYYPGAHSDASAQDFLNRFPLPAIINALQTKAEHPGLENAL  60

Query  1464  CDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLIL  1285
              DCL+++F+T+YGASLIPH+MPFV+VGLGA SQ  RRLAC TVS LL+N DE   V LI 
Sbjct  61    VDCLERLFKTRYGASLIPHYMPFVIVGLGAESQKARRLACQTVSCLLENIDEAIVVQLIH  120

Query  1284  QNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSS  1105
             + GVY LLL+CLI GDE+VAA +  A++ LA  +KG+DIIFP S +E T+L +LA  CS 
Sbjct  121   EYGVYQLLLNCLISGDEEVAATSTDAVRKLASHSKGIDIIFPESGNEATNLVNLATNCSP  180

Query  1104  LGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQ  925
             LGRVRVLALIVKLFSIST+VAS+VYN+NLLSL+E E+ NANDTLVTLS+LELLYEL + Q
Sbjct  181   LGRVRVLALIVKLFSISTSVASRVYNSNLLSLVEVEISNANDTLVTLSSLELLYELADVQ  240

Query  924   HSMEF  910
             HS EF
Sbjct  241   HSTEF  245



>ref|XP_009615027.1| PREDICTED: uncharacterized protein LOC104107825 isoform X1 [Nicotiana 
tomentosiformis]
Length=557

 Score =   328 bits (842),  Expect(2) = 1e-177, Method: Compositional matrix adjust.
 Identities = 171/245 (70%), Positives = 205/245 (84%), Gaps = 0/245 (0%)
 Frame = -2

Query  1644  MEEEYSVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDAL  1465
             MEEEYSVD AQLL+AATDFAY P   SD SAQ+FL+RFPLPA+INALQ K+++PGLE+AL
Sbjct  1     MEEEYSVDPAQLLEAATDFAYYPGAHSDASAQDFLNRFPLPAIINALQTKAEHPGLENAL  60

Query  1464  CDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLIL  1285
              DCL+++F+T+YGASLIPH+MPFV+VGLGA SQ  RRLAC TVS LL+N DE   V LI 
Sbjct  61    VDCLERLFKTRYGASLIPHYMPFVIVGLGAESQKARRLACQTVSCLLENIDEAIVVQLIH  120

Query  1284  QNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSS  1105
             + GVY LLL+CLI GDE+VAA +  A++ LA  +KG+DIIFP S +E T+L +LA  CS 
Sbjct  121   EYGVYQLLLNCLISGDEEVAATSTDAVRKLASHSKGIDIIFPESGNEATNLVNLATNCSP  180

Query  1104  LGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQ  925
             LGRVRVLALIVKLFSIST+VAS+VYN+NLLSL+E E+ NANDTLVTLS+LELLYEL + Q
Sbjct  181   LGRVRVLALIVKLFSISTSVASRVYNSNLLSLVEVEISNANDTLVTLSSLELLYELADVQ  240

Query  924   HSMEF  910
             HS EF
Sbjct  241   HSTEF  245


 Score =   323 bits (829),  Expect(2) = 1e-177, Method: Compositional matrix adjust.
 Identities = 172/273 (63%), Positives = 201/273 (74%), Gaps = 35/273 (13%)
 Frame = -3

Query  890  FIYLVQ*LGYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGL----------------  759
            F+++ +  G RN+ISAIDRRF  L S++ADE ECALEA GQIG                 
Sbjct  286  FVFIDE-FGIRNLISAIDRRFNLLESENADECECALEALGQIGFWLLHNILRKSLFCPLV  344

Query  758  ------------------CKKGaaallssspaPVRHVISAAFDCQHHGKRLAALHALGNI  633
                                KGAA LLS +    RHVI AAFD Q HGK+LAALHAL NI
Sbjct  345  LDMPMLLNSKYWFLHSYRTSKGAALLLSGAQPAGRHVIYAAFDRQQHGKQLAALHALANI  404

Query  632  VGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSEIRLAGYRVITG  453
            VGETR+ NDVLLDG AEESLRRLIY+T+SK+ KLTPSGLLLSVLQQDSEIR AGYRVIT 
Sbjct  405  VGETRAENDVLLDGVAEESLRRLIYETASKTSKLTPSGLLLSVLQQDSEIRKAGYRVITA  464

Query  452  LVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTSSSKLMSDPARS  273
            LV RPWCL+E++SRQEI++I T+  TE +KIGMEARHKCC+++Y+ FTSSSKL++D A S
Sbjct  465  LVMRPWCLMEVVSRQEIINIATDTCTERDKIGMEARHKCCQSIYKGFTSSSKLIADNALS  524

Query  272  GLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            G+ATKLEEAIR GPYLGR+ +EAQP VMTEQRF
Sbjct  525  GVATKLEEAIRRGPYLGRRLSEAQPTVMTEQRF  557



>gb|AIU50930.1| ARM repeat superfamily protein, partial [Vitis vinifera]
Length=465

 Score =   268 bits (685),  Expect(2) = 6e-140, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 171/229 (75%), Gaps = 17/229 (7%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VIS ID R      QDADE E ALE  GQIG    GA  LL  +    RHVI AAFD 
Sbjct  254  KTVISLIDGRL-----QDADECESALETLGQIGSSIHGAELLLLPAA---RHVIDAAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  G+ LAALHALGNI GETRS     L+ DAEESL+ LIY+++SKSPKLTPSGL LSVL
Sbjct  306  QGRGRHLAALHALGNISGETRSE----LNNDAEESLQHLIYESASKSPKLTPSGLFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQD+E+RLAGYRVITGLVARPWCL+EI S+QEIV+I+T    ET KIGMEA++ CC+A++
Sbjct  362  QQDAEVRLAGYRVITGLVARPWCLMEICSKQEIVNIITG---ETTKIGMEAKYNCCKAIH  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
              F SSSKL SDPA +G+A KL+EA+R GPYL RK  EAQPVVMT  RF
Sbjct  419  WVFMSSSKLTSDPALTGIAEKLQEAVRRGPYLARK--EAQPVVMTADRF  465


 Score =   259 bits (662),  Expect(2) = 6e-140, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 174/234 (74%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LLQAA+DF + P   SD SA+ FL RFPLP +IN LQ K+D PG+E  L  CL+++F TK
Sbjct  1     LLQAASDFGHHPGVHSDASAKAFLHRFPLPVIINVLQTKADVPGVESTLVACLERIFCTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             +GASLIP +MPFV VGL A SQ VR LAC TVS LL+N        LI+   +YPLLL C
Sbjct  61    HGASLIPQYMPFVQVGLRADSQVVRCLACKTVSCLLENAQ------LIV---IYPLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+G+EQVA A++ AIK+LAG  +G++IIFP          +LAA+CSSLGRVRVLAL+V
Sbjct  112   LINGNEQVATASMDAIKSLAGSFEGMEIIFP----------NLAARCSSLGRVRVLALVV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS+S++VAS ++N++LL+LLE EV N +DTLVTLS LELLYEL E QH  EF
Sbjct  162   KLFSVSSSVASLIHNSDLLNLLEAEVCNTDDTLVTLSVLELLYELAEIQHGTEF  215



>gb|AIU50918.1| ARM repeat superfamily protein, partial [Manihot esculenta]
Length=465

 Score =   265 bits (677),  Expect(2) = 9e-140, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 173/229 (76%), Gaps = 17/229 (7%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            R VISAIDRR      +D +E ECALEA GQIG    GA  LLS +    RHVI AAFD 
Sbjct  254  RTVISAIDRRL-----EDPNECECALEALGQIGSSIPGAMLLLSPAA---RHVIDAAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  G +LAALH+LGNI GETR+     L+ DAEE+LRRLIY+T+SK+ KLTPSGL LSVL
Sbjct  306  QARGNQLAALHSLGNISGETRTE----LNADAEENLRRLIYETASKTSKLTPSGLFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQDSE+RLA YR+ITGLVARPWCL+EI S+QEIV+IVT+   ET KIGMEAR+ CC+A+ 
Sbjct  362  QQDSEVRLAAYRMITGLVARPWCLMEICSKQEIVNIVTD---ETTKIGMEARYNCCKAIQ  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++F SSS+L ++PA  G+ATKL+EA+  GPYL  K  EAQP +MT  RF
Sbjct  419  KAFVSSSRLSTNPALIGIATKLQEAVSRGPYLTGK--EAQPAIMTADRF  465


 Score =   261 bits (668),  Expect(2) = 9e-140, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 176/234 (75%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL++A+DFAY P  Q+D +A+EFL RFPLP +I+ALQ ++D PGLE+ L  CL+++F+TK
Sbjct  1     LLESASDFAYYPGVQNDTAAKEFLGRFPLPLIISALQTRADVPGLENTLVACLERIFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIP +M FV +GL A SQ VR LAC TV+ LL+N      V LI+   +YPLLL C
Sbjct  61    YGASLIPQYMSFVQLGLRAESQLVRCLACKTVACLLEN------VELII---IYPLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L++G+EQVA+A+  AIK LAGF +G+++IFP          +L+A+CSSLGRVR+LA++V
Sbjct  112   LVNGNEQVASASTEAIKKLAGFAEGVEVIFP----------NLSARCSSLGRVRILAMVV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS+S  VAS VYN+NLL LLE EV N+NDTL TL+ LEL YEL + QH  EF
Sbjct  162   KLFSVSDYVASAVYNSNLLGLLEAEVSNSNDTLATLNILELFYELAQVQHGTEF  215



>gb|AIU50904.1| ARM repeat superfamily protein, partial [Eucalyptus grandis]
Length=465

 Score =   263 bits (672),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 175/229 (76%), Gaps = 17/229 (7%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            R V+SAID R       D DE E +LEA GQIGL  +GA  LLS      RHV+ AAFD 
Sbjct  254  RVVVSAIDGRLL-----DTDECEASLEALGQIGLSTQGAELLLSPVA---RHVVYAAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  GK+LAALHALGN+ GE RS     L+G AEE+LR LIY+ +S+SPKLTPSGL LSVL
Sbjct  306  QGRGKQLAALHALGNLAGEARSD----LNGSAEETLRLLIYEAASRSPKLTPSGLFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ++E RLAGYR IT LVARPWCL+EI S++EIVDIVT+   ET KIGMEAR+ CC+A++
Sbjct  362  QQEAETRLAGYRPITALVARPWCLMEICSKEEIVDIVTD---ETTKIGMEARYGCCQAIH  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++FT S+KLMSDP+ +G+A+KL++A+R GP+L R+  EAQPVVMT +RF
Sbjct  419  KAFTRSTKLMSDPSLAGIASKLQDAVRRGPFLARR--EAQPVVMTAERF  465


 Score =   258 bits (660),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 181/234 (77%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL+AA+DFA  P  Q+D +A+EFLDRFPLP +I+ALQA++D PGLE  L +CL++VF+TK
Sbjct  1     LLEAASDFALYPGVQNDAAAKEFLDRFPLPVIISALQARADVPGLESTLVNCLERVFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIPHFMPFV VGL A SQ VR LAC TVS LL+N      V +I+   +YPLLL C
Sbjct  61    YGASLIPHFMPFVQVGLQAASQEVRCLACKTVSCLLEN------VKIII---IYPLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L++G+EQVAAA++ AIK LA   +G +I+FP          +LAA+CSSLGRVRVLALIV
Sbjct  112   LVNGNEQVAAASMDAIKTLACLQRGTNIVFP----------NLAAQCSSLGRVRVLALIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS+S++VAS +Y++NLLSL E E+ N+ DTLVTLS LELLYE+VE +H+ E 
Sbjct  162   KLFSVSSSVASIIYSSNLLSLFEAEISNSQDTLVTLSVLELLYEMVEIRHATEI  215



>gb|AIU50900.1| ARM repeat superfamily protein, partial [Citrus clementina]
Length=464

 Score =   261 bits (668),  Expect(2) = 5e-138, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 175/234 (75%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL +A+DFAY P  Q+D +A++FLDRFPL  ++N LQ K D PGLED L  CL+++F+TK
Sbjct  1     LLDSASDFAYHPGVQNDAAAKKFLDRFPLSVILNTLQTKPDVPGLEDTLVVCLERIFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIPH+MPFV VGL A S +V+RLAC TV+ LL++      + L++   +YPLLL C
Sbjct  61    YGASLIPHYMPFVQVGLTADSHSVKRLACKTVTCLLED------LQLLI---IYPLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+G+E+VA A++ AIK LAGF  G+DIIFP          +L A+CSSLGRVRVL+LIV
Sbjct  112   LINGNEEVATASMDAIKKLAGFPNGIDIIFP----------NLVAQCSSLGRVRVLSLIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS+S +VAS ++ ANLL+LLE+ V   NDTL TLS LELLYEL E QHS EF
Sbjct  162   KLFSVSRSVASVIFKANLLTLLEEGVSKKNDTLETLSILELLYELAEIQHSAEF  215


 Score =   259 bits (661),  Expect(2) = 5e-138, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 173/229 (76%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VISAID R      QD+DE E ALEA GQIG   +GA  LL  +    RHVI AAFD 
Sbjct  254  KTVISAIDGRL-----QDSDECESALEALGQIGSSIQGATLLLLPAA---RHVIDAAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q HGK+LAALH + NI G+TRS     L+ DAEESLR LIY+ +S+S KLTPSGL LSVL
Sbjct  306  QGHGKQLAALHGIANIAGKTRSE----LNADAEESLRHLIYEVASRSSKLTPSGLFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ +EIRLAGYR+ITGLVARPWCL+E+ S+QEI++ VT+   ET KIGMEAR+ CC+A+ 
Sbjct  362  QQAAEIRLAGYRMITGLVARPWCLMELCSKQEIINTVTD---ETTKIGMEARYNCCKAIC  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++F  SS+L+SDPA +G+  KL+EA+R GPYL RK  EAQPVVMTEQRF
Sbjct  419  KAFV-SSELVSDPAFAGIGEKLDEAVRRGPYLARK--EAQPVVMTEQRF  464



>gb|AIU50902.1| ARM repeat superfamily protein, partial [Carica papaya]
Length=464

 Score =   271 bits (693),  Expect(2) = 8e-138, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 177/234 (76%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL+ A+DF Y P  QSD +A+EFL RFPL  +INALQ +  YPGLEDAL   L+K+F TK
Sbjct  1     LLETASDFGYYPGVQSDAAAEEFLYRFPLAVIINALQTRLQYPGLEDALVAALEKIFETK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIPH+MPFV VGL A S +VRRLAC TV+ LL+N        L++   +YPLLL  
Sbjct  61    YGASLIPHYMPFVQVGLTADSPSVRRLACKTVTCLLENAQ------LVI---IYPLLLDS  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L++G+EQVAAA++ AIK LAGF +G+DIIFP          +LAA+CSS+GRVRVL+LIV
Sbjct  112   LVNGEEQVAAASVDAIKKLAGFPEGMDIIFP----------NLAARCSSVGRVRVLSLIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS+S+ VAS +YN+NLLSLLE EV N NDTLV LS LEL +ELVE +HS+EF
Sbjct  162   KLFSVSSNVASVIYNSNLLSLLEAEVNNTNDTLVVLSVLELFHELVEIRHSIEF  215


 Score =   249 bits (635),  Expect(2) = 8e-138, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 173/229 (76%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAIDRRF     QD DE E ALEAFG++G   KGA  +LS +    RHVI+AAFD 
Sbjct  254  KALISAIDRRF-----QDTDECETALEAFGEVGSSIKGATLILSPAA---RHVINAAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q HG++LAA+HAL NI GE+R      L+ +AEESLRRL+Y  +SKS KLTPS L LSVL
Sbjct  306  QRHGRQLAAMHALANIGGESRPE----LNVNAEESLRRLVYGVASKSTKLTPSELFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ +E RLA YR+ITGLV R WCL EI  +QEI++IVT+   E+ KIGME+R+KCC+A++
Sbjct  362  QQAAEFRLAAYRIITGLVVRHWCLTEICLKQEIINIVTD---ESTKIGMESRYKCCKAIH  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++FT SSKL +DPA +G+A KL+EA+RSGPYL +K  E+QP VMT +RF
Sbjct  419  KAFT-SSKLANDPALAGVAEKLQEAVRSGPYLAKK--ESQPAVMTAERF  464



>gb|AIU50920.1| ARM repeat superfamily protein, partial [Populus trichocarpa]
Length=465

 Score =   258 bits (659),  Expect(2) = 9e-135, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 174/234 (74%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LLQ+A++FA  P   +DV+A+EFLDRFPLP +INALQ KS+ PGLE  L  CL+++F+TK
Sbjct  1     LLQSASEFANYPGVPNDVAAKEFLDRFPLPVIINALQTKSEVPGLEATLVACLERIFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
              GASLIPH+MPFV VGL A SQ VR LAC TVS LL N        LI+   VYPLLL C
Sbjct  61    CGASLIPHYMPFVQVGLTADSQLVRCLACKTVSCLLKNAQ------LII---VYPLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+G+EQVA A++ AI+ LAG  KG++I+FP          +L+A+CSSLGRVRVL+LIV
Sbjct  112   LINGNEQVATASMEAIEKLAGSQKGMEIVFP----------NLSARCSSLGRVRVLSLIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS+S  VAS VYN+NLLSLLE ++ + +DTLV+LS  EL YEL E +H+ EF
Sbjct  162   KLFSVSRDVASAVYNSNLLSLLEAKIRDTDDTLVSLSVFELFYELAEVKHATEF  215


 Score =   252 bits (643),  Expect(2) = 9e-135, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 168/229 (73%), Gaps = 17/229 (7%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAID R      QD +E E ALEA GQIG   +GA  LL+ +    RHVI AAFD 
Sbjct  254  KAIISAIDGRL-----QDLNECESALEALGQIGSSNQGATLLLTPAA---RHVIDAAFDK  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
               GK+LA+LH+L NI GETRS     L+GDAEESLR LIY+ +SKS KLTPSGL LSVL
Sbjct  306  HARGKQLASLHSLANISGETRSD----LNGDAEESLRLLIYEAASKSSKLTPSGLFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQDS++RLA YRV+TGLVARPWCL+EI S+QEI++IVT    ET KIGMEAR+KCC A++
Sbjct  362  QQDSQVRLAAYRVLTGLVARPWCLMEICSKQEIINIVTG---ETTKIGMEARYKCCVAIH  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             +F SSSKL  +PA + +A KL+EA+  GPYL  K  EAQP+V+T  RF
Sbjct  419  RAFMSSSKLTGNPALAPIAAKLQEAVSRGPYLADK--EAQPMVVTADRF  465



>gb|AIU50916.1| ARM repeat superfamily protein, partial [Medicago truncatula]
Length=465

 Score =   257 bits (657),  Expect(2) = 2e-133, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 174/229 (76%), Gaps = 17/229 (7%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            ++VIS+ID R +     + DEFE ALE+ GQIGL  +GA  LLS +    RH I AAFD 
Sbjct  254  KSVISSIDGRLS-----NKDEFETALESLGQIGLTIRGAKLLLSPA---ARHAIDAAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q HG++LAALHALGNI GETRS     LD +AEE+L RL+Y+T+S+S KLTPSGL LSVL
Sbjct  306  QGHGRQLAALHALGNISGETRSE----LDAEAEENLLRLLYETASRSSKLTPSGLFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQDSEIR+AGYR+I+GLV+RPWCL+EI SRQEI++IVT+   ET KIGMEAR+ CC  + 
Sbjct  362  QQDSEIRIAGYRMISGLVSRPWCLMEICSRQEIINIVTD---ETTKIGMEARYNCCVRIN  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +S T SS++ +DPA +G+A KL+EA+  GPYL   H EAQP+VMT  RF
Sbjct  419  KSLTQSSRVSADPAFAGIAAKLQEAVGLGPYL--HHREAQPIVMTADRF  465


 Score =   248 bits (634),  Expect(2) = 2e-133, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 170/234 (73%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LLQAATDFA  P   SD SA +FL+RFPLP +INALQ + D PGLE  L  CL+++F+TK
Sbjct  1     LLQAATDFANYPGSHSDDSATDFLNRFPLPLIINALQTQFDVPGLETTLVVCLERLFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             +GASLIP +M FV VGL + SQ VR LAC TV+SLL+N       +LI    +YPLLL C
Sbjct  61    FGASLIPQYMQFVQVGLQSDSQAVRSLACKTVTSLLEN------AHLI---KIYPLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+G+E+VAA AI AIK LA F++GLDIIFP           +A++CSSLGRVRVLAL+V
Sbjct  112   LINGNEEVAAGAIDAIKKLASFSEGLDIIFPI----------IASQCSSLGRVRVLALVV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS+ST+ AS + + NLL LLE E+ + +DTLVTLS  ELLYEL E +H  EF
Sbjct  162   KLFSVSTSAASAICSLNLLKLLEAEIRSTDDTLVTLSVFELLYELAEVEHGTEF  215



>gb|AIU50901.1| ARM repeat superfamily protein, partial [Gossypium raimondii]
Length=463

 Score =   252 bits (643),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 172/229 (75%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            +++ISAID R      QD DE E ALEA G IG   +GA  LL+ +    RH++ AAFD 
Sbjct  253  KSLISAIDVRL-----QDTDERESALEALGGIGSSIQGAVLLLTPAA---RHIVHAAFDR  304

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  GK+LAALHALGNIVGE R      L+GDAEESLRRL+Y+ +S+S KLTPSGLLLSVL
Sbjct  305  QGGGKQLAALHALGNIVGENRPE----LNGDAEESLRRLVYEVASESSKLTPSGLLLSVL  360

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ +E RLAGYRVITGLVAR WCL+EI S+ EI++IVT+   ET KI MEAR+ CC+A++
Sbjct  361  QQAAEFRLAGYRVITGLVARVWCLMEIFSKPEIINIVTD---ETTKIAMEARYNCCKAIH  417

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             SF  SSKL+SDPA SG+A KL+EA++ GPYL RK  EA PVVMT +RF
Sbjct  418  RSFM-SSKLVSDPALSGIAGKLQEAVQRGPYLVRK--EATPVVMTAERF  463


 Score =   250 bits (639),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 176/234 (75%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL +A+DFA+ P   +D + ++FLDRFPLP +I+ALQ KSD PGLE+ L  CL++VF+TK
Sbjct  1     LLDSASDFAHHPGSLNDAAVKDFLDRFPLPVIISALQTKSDVPGLENTLVACLERVFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIP +M FV VGL A SQ VR L+C TVSS L N      + LI+   +Y LLL C
Sbjct  61    YGASLIPQYMTFVQVGLKADSQVVRCLSCKTVSSFLKN------IKLII---IYQLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+GDEQVA AAI AIKNLA F + + IIFP          ++A++CSSLGRVRVL+LIV
Sbjct  112   LINGDEQVATAAIDAIKNLAQFPEAVGIIFP----------NVASRCSSLGRVRVLSLIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS+++AS +YN+NLLSLLE E+ N+NDTLVTLSALELLYEL E QH  EF
Sbjct  162   KLFSISSSIASVIYNSNLLSLLEAEIRNSNDTLVTLSALELLYELTEVQHGAEF  215



>gb|AIU50924.1| ARM repeat superfamily protein, partial [Ricinus communis]
Length=465

 Score =   256 bits (654),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 173/229 (76%), Gaps = 17/229 (7%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VISAID R      QD +E ECALEAFGQIG    GA  LL+ +    RHVI AAFD 
Sbjct  254  KTVISAIDGRL-----QDLNECECALEAFGQIGSSTPGATLLLTPAA---RHVIDAAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  GK+LAALH+LG I GE+RS     L+G+AEE+LRRLIYDT+SK+PKLTPSGL LS+L
Sbjct  306  QARGKQLAALHSLGYISGESRSE----LNGEAEETLRRLIYDTASKTPKLTPSGLFLSIL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQD+E RLA YR+ITGLV RPWCL+EI ++QEIV+IVT+   ET K GM+AR+ CC+A+ 
Sbjct  362  QQDAEARLAAYRMITGLVFRPWCLMEICTKQEIVNIVTD---ETIKRGMDARYNCCKAIN  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++F +S KL ++PA +G+A+KL+EA+R GPY   K  EAQP VMT +RF
Sbjct  419  KAFMASGKLSTNPALAGIASKLQEAVRRGPYFTGK--EAQPTVMTAERF  465


 Score =   238 bits (607),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 168/234 (72%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LLQ+A+DFAY P  Q+D   ++FLD FPLP + +ALQ K+D P LE  L  CL+K+F+TK
Sbjct  1     LLQSASDFAYYPGAQNDAVVKDFLDHFPLPVIFSALQTKADVPDLERTLVACLEKIFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIP +M FV +GL A SQ V+ LAC TVS LL+N        L++   +YPLLL C
Sbjct  61    YGASLIPQYMAFVNLGLKADSQLVKCLACKTVSCLLENAQ------LVI---IYPLLLHC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             ++ G+ +VA A++ AI+  AGF K +++IFP          +L+A+CSSLGRVR+L+L+V
Sbjct  112   VLIGNGEVAIASMEAIQKFAGFPKAIEVIFP----------NLSARCSSLGRVRLLSLVV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLF++S  VA+ V+N+NLLSLLE EV N +DTLVTLS LEL YEL E QH +EF
Sbjct  162   KLFTVSPDVAAVVFNSNLLSLLEAEVSNTDDTLVTLSILELFYELAEVQHGIEF  215



>gb|AIU50897.1| ARM repeat superfamily protein, partial [Theobroma cacao]
Length=463

 Score =   251 bits (641),  Expect(2) = 7e-130, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 169/229 (74%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VISAID R      QD DE E ALEA GQIG   +GA  LLS +    RH++ AAFD 
Sbjct  253  KGVISAIDVRL-----QDTDECESALEALGQIGSSIQGAVLLLSPA---ARHIVHAAFDR  304

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  GK+LAALHALGN+ GE R      L GDAEESLR LIY+ +S S KLTPSGL LS L
Sbjct  305  QGRGKQLAALHALGNVAGENRPE----LSGDAEESLRHLIYEVASHSSKLTPSGLFLSAL  360

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ +E RLAGYRVITGLVAR WCL+EI S+QEI+++VT+   ET KIGMEAR+KCC+A++
Sbjct  361  QQAAEFRLAGYRVITGLVARTWCLMEICSKQEIINMVTD---ETTKIGMEARYKCCKAIH  417

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             +F  SSKL+SDPA SG+A KL+EA++ GPYL RK  EA PVVMT +RF
Sbjct  418  RAFM-SSKLVSDPALSGIAGKLQEAVQRGPYLTRK--EAAPVVMTAERF  463


 Score =   242 bits (618),  Expect(2) = 7e-130, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 177/234 (76%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL +A++FA+ P  Q+D + ++FLDRFPLP +I+ALQ K+D PGLE+ L  CL++VF+TK
Sbjct  1     LLDSASEFAHHPGVQNDATTKDFLDRFPLPVIISALQTKADVPGLENTLAVCLERVFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YG SLIP +MPF+ VGL A SQ VR LAC TVSS L+N      + LI+   +YPLLL C
Sbjct  61    YGGSLIPQYMPFLQVGLKADSQMVRCLACKTVSSFLEN------IQLII---LYPLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI G+E VA+AAI AIKNLA F +G+ IIFP          +LA++CSSLGR RVL+LIV
Sbjct  112   LIYGNELVASAAIDAIKNLAQFPEGMSIIFP----------NLASRCSSLGRARVLSLIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS +VAS +YN+NLLSLLE E+ N+NDTLVTLS+LELLYEL E QH  EF
Sbjct  162   KLFSISGSVASVIYNSNLLSLLEAEIRNSNDTLVTLSSLELLYELTEIQHGTEF  215



>gb|AIU50905.1| ARM repeat superfamily protein, partial [Glycine max]
Length=465

 Score =   258 bits (660),  Expect(2) = 2e-128, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 172/234 (74%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LLQAA+DF + P P SD S+++FL+RFPLP +INALQ + D PGLE+ L  CL+++F TK
Sbjct  1     LLQAASDFVHYPGPHSDDSSRDFLNRFPLPVIINALQTQLDVPGLENTLVACLERLFNTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
              GASLIP +MPFV VGL A SQ VR LAC TV+SLL+N        LI    +YPLLL C
Sbjct  61    LGASLIPQYMPFVQVGLQADSQAVRSLACKTVTSLLENA------CLI---KIYPLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+G+EQVAA A  AIK LAGF +G++IIFP           +A++CSSLGRVRVLAL+V
Sbjct  112   LINGNEQVAAVATDAIKKLAGFPEGMEIIFPI----------IASQCSSLGRVRVLALVV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS+S + AS +Y+ NLL LLE E+ NA+DTLVTLS LEL+YEL E +H  EF
Sbjct  162   KLFSVSRSAASTIYSLNLLQLLEAEIRNADDTLVTLSVLELIYELAEIEHGTEF  215


 Score =   230 bits (587),  Expect(2) = 2e-128, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 171/229 (75%), Gaps = 17/229 (7%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VIS+ID R +     D DE E ALE+ G +G   +GA  LLS +    RHVI+AAF+ 
Sbjct  254  KAVISSIDGRLS-----DRDECETALESLGHMGSSIQGATLLLSPA---ARHVINAAFER  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q HGK+LAALHALGNI GETRS  +     + EE+LRRLIY+T+S+S KLTPSGL LSVL
Sbjct  306  QGHGKQLAALHALGNISGETRSELNA----EEEENLRRLIYETASRSSKLTPSGLFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQDSEIRLAGYR+++GLVARPWCL+EI S+QEI++ VT+   ET KIGME R+ CC+A++
Sbjct  362  QQDSEIRLAGYRMLSGLVARPWCLMEICSKQEIINKVTD---ETTKIGMEGRYNCCKAIH  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +S T SS++ ++PA +G+A K +EA+  GPYL ++  EAQP V+T  RF
Sbjct  419  KSLTVSSRVSANPAFAGIAAKFQEAVGMGPYLVKR--EAQPAVITADRF  465



>gb|AIU50907.1| ARM repeat superfamily protein, partial [Buxus sinica]
Length=465

 Score =   246 bits (627),  Expect(2) = 5e-125, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 170/230 (74%), Gaps = 19/230 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            ++ + AID R      QDADE E ALEA GQIG   +GA+ LLS      RHV+ A+FD 
Sbjct  254  KSALLAIDERL-----QDADECETALEALGQIGSSIQGASLLLSPVA---RHVVDASFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSG-NDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSV  504
            Q  GK+LAALHALGNI GE RS  NDV     AE++LR LIY+ ++KS KLTPSGL LS+
Sbjct  306  QGRGKQLAALHALGNISGENRSDLNDV-----AEQTLRYLIYEMATKSSKLTPSGLFLSI  360

Query  503  LQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAV  324
            L+QD+E+RLA YR+ITGLV+RPWCL EI S+QE+++IVT+   ET K GMEAR+ CC A+
Sbjct  361  LRQDAEVRLAAYRLITGLVSRPWCLTEICSKQEVINIVTD---ETTKKGMEARYNCCRAI  417

Query  323  YESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            + +  +S+KL SDPA SG+ +KL+EA+R GPYL ++  EAQPVVMT +RF
Sbjct  418  FNALAASNKLASDPALSGVGSKLQEAVRRGPYLAKE--EAQPVVMTAERF  465


 Score =   232 bits (591),  Expect(2) = 5e-125, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 163/234 (70%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL AA++FA  P  Q+D   +EFLDRFPLP +INALQ+K++ PGLE  L  CL++VF+TK
Sbjct  1     LLDAASEFANYPGVQNDAVVKEFLDRFPLPVLINALQSKANVPGLESTLVACLERVFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGAS IP FMPFV VGL A SQ VR L+C TVS LL      T+  LI+   +Y LLL C
Sbjct  61    YGASFIPQFMPFVKVGLQADSQIVRCLSCKTVSYLL------TSSQLIV---LYQLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+G+E VA A++ AIK LA   +G  I+FP+          L  + SSLGRVRVLALIV
Sbjct  112   LINGNEDVATASMDAIKKLACSPEGRAIVFPS----------LVTRSSSLGRVRVLALIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS++VAS +YN+NLL L E EV N +D LVTLS LELLYEL +  H  EF
Sbjct  162   KLFSISSSVASLIYNSNLLHLFEAEVKNEDDMLVTLSVLELLYELADVPHGTEF  215



>gb|AIU50923.1| ARM repeat superfamily protein, partial [Phaseolus vulgaris]
Length=461

 Score =   249 bits (637),  Expect(2) = 3e-123, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 168/234 (72%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LLQAA+DF++ P  QSD SA+EFL RFPL  +INALQ K D P LE+ L  CL+K+F TK
Sbjct  1     LLQAASDFSHYPGAQSDDSAREFLSRFPLTLIINALQTKFDVPDLENTLVACLEKLFNTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
              GASLIP +MPFV VGL A SQ VR L+C TVS LL+N       +LI    +YPLLL C
Sbjct  61    LGASLIPQYMPFVQVGLQAESQAVRSLSCKTVSRLLENA------HLI---KIYPLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             +I GDEQVAA A  AI+ LAGF +G++IIFP           +A++CSSLGRVRVLAL+V
Sbjct  112   IIKGDEQVAAVATDAIQKLAGFPEGMEIIFPL----------IASQCSSLGRVRVLALVV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
              LFS+S + AS VY+ NLL LLE E+ NA+DTLVTL+ LELLYEL   +HS EF
Sbjct  162   NLFSVSRSAASIVYSLNLLKLLEAELRNADDTLVTLNVLELLYELSAIEHSTEF  215


 Score =   222 bits (565),  Expect(2) = 3e-123, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 165/229 (72%), Gaps = 21/229 (9%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VI++ID R +     D DE E ALE+FG IG   +GA  LLS +    RHVI+AAF+ 
Sbjct  254  KAVIASIDGRLS-----DIDECETALESFGHIGSSTQGATYLLSPAA---RHVINAAFER  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q HGK+LAALHALGNI GETRS     L+ +AEE+LRRLIY+T+++S KLTPSGL LSV+
Sbjct  306  QGHGKQLAALHALGNISGETRSK----LNAEAEENLRRLIYETAARSSKLTPSGLFLSVM  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQD+EIRLA YR+I+GLVAR WCL+EI S+ +I++ VTN   E+ KIGMEAR+ CC+A+Y
Sbjct  362  QQDAEIRLAVYRMISGLVARSWCLMEICSKDDIINRVTN---ESTKIGMEARYNCCKAIY  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++ T S    S  A +    KLE+A++ GPYL +   E QPVV T +RF
Sbjct  419  QTLTLSD---SVSAFTDAYAKLEKAVKMGPYLVK---EPQPVVETAKRF  461



>gb|AIU50912.1| ARM repeat superfamily protein, partial [Liriodendron tulipifera]
Length=464

 Score =   234 bits (598),  Expect(2) = 7e-119, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 168/229 (73%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            +  + AID R      Q+ DE + ALEA G IG   +GA+ LLS +    RHV+ AAFD 
Sbjct  254  KTALLAIDGRL-----QETDECDSALEALGHIGSANQGASLLLSPA---ARHVVEAAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            +  GK+LAALHAL NI GE RSG    L+ DAEE LRRLIY  +++S KLTPSGL LSVL
Sbjct  306  RGRGKQLAALHALANISGENRSG----LNNDAEECLRRLIYAAAAESSKLTPSGLFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQDSEIRLA YR+ITGLV RPWCL+E+ S+QEI++IVT+   ET K GMEAR+ CC A+ 
Sbjct  362  QQDSEIRLAAYRMITGLVTRPWCLLEVCSKQEIINIVTD---ETTKKGMEARYNCCTAIN  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++ ++S+K+ +D A SG+A+KL+EA++ GPYL ++  EAQPVVMT +RF
Sbjct  419  KTLSASNKI-NDVAFSGIASKLQEAVKRGPYLAKE--EAQPVVMTAERF  464


 Score =   222 bits (566),  Expect(2) = 7e-119, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 163/232 (70%), Gaps = 19/232 (8%)
 Frame = -2

Query  1605  QAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTKYG  1426
             +AA+D+A  P  Q+D SA+EFLD FPLP + +ALQ+  D  GLE  L  CL+++F TKYG
Sbjct  3     EAASDYASYPGTQTDASAKEFLDSFPLPLIFSALQSVGDVSGLESTLVSCLERIFNTKYG  62

Query  1425  ASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSCLI  1246
             ASLIP  MPFV VGL A SQ VR LAC  VS LL+N        L++   VYPLL++CLI
Sbjct  63    ASLIPQNMPFVQVGLQAYSQLVRCLACKAVSCLLENEQ------LVI---VYPLLVNCLI  113

Query  1245  DGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIVKL  1066
             DG+E VA A++ AI NLA F  G+ IIFP          ++AA+CSSL R+RVLALI KL
Sbjct  114   DGNELVATASMDAILNLARFPDGIGIIFP----------NIAARCSSLARIRVLALIAKL  163

Query  1065  FSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             FS+S++ AS VY++NLL LLE EV + ND L+TLSALELLYEL E+ H  EF
Sbjct  164   FSVSSSAASAVYHSNLLGLLEAEVNDTNDMLMTLSALELLYELAESPHGTEF  215



>gb|AIU50936.1| ARM repeat superfamily protein, partial [Houttuynia cordata]
Length=460

 Score =   229 bits (585),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 167/231 (72%), Gaps = 19/231 (8%)
 Frame = -2

Query  1602  AATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTKYGA  1423
             AA+DF+  P  Q+D SA+EFLDRFPLP + + L + +D PGLE AL  CL+++F TKYG+
Sbjct  1     AASDFSSYPGYQTDASAKEFLDRFPLPVIFSVLGSGADVPGLETALVSCLERIFSTKYGS  60

Query  1422  SLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSCLID  1243
             SLIPH+MPFV  GL A S+ +RRLAC  V+ LL+N+       LI    +YPLL++CL+D
Sbjct  61    SLIPHYMPFVQTGLCADSELIRRLACKAVAYLLENSQ-----LLI----IYPLLVNCLVD  111

Query  1242  GDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIVKLF  1063
             G+EQVA AA+ AI NLAG   G+ IIFP          ++AA+CSS  ++RVLALI KLF
Sbjct  112   GNEQVATAAMDAITNLAGSPGGIGIIFP----------NIAAQCSSTAKIRVLALIAKLF  161

Query  1062  SISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             S S+++AS +YN+NLL+L E EV N +D L+TLSALELLYEL ++ H+ EF
Sbjct  162   SASSSLASAIYNSNLLTLFEAEVNNTDDVLMTLSALELLYELADSPHATEF  212


 Score =   216 bits (551),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 157/228 (69%), Gaps = 19/228 (8%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            ++I AID R      +D DE E ALEA G+IG    GAA LLS +    RHV+ A F+ Q
Sbjct  252  SIILAIDERL-----EDTDESESALEALGEIGSSNSGAALLLSPA---ARHVVVAGFEQQ  303

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              GK+LA LHAL NIVGE+R      L  DAEE LRRL+Y  ++ S KLTPS L LS+LQ
Sbjct  304  GRGKQLAGLHALANIVGESRPE----LGNDAEECLRRLMYGVATSSSKLTPSALFLSILQ  359

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QDSEIR+A YRVI+GLV R WCLIEI S+QEI+DIVT+   ET K  MEARH CC A+Y 
Sbjct  360  QDSEIRMAAYRVISGLVIRHWCLIEICSKQEIIDIVTD---ETTKNVMEARHNCCSAIYA  416

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +  +S+  + + + SG+A KL+EA++ GPYL ++  EAQP+V+T  RF
Sbjct  417  ALLASN--IQNKSLSGVAQKLQEAVKRGPYLAKE--EAQPIVVTADRF  460



>gb|AIU50917.1| ARM repeat superfamily protein, partial [Canna indica]
Length=464

 Score =   235 bits (600),  Expect(2) = 4e-114, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 169/235 (72%), Gaps = 21/235 (9%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +L+AA++FA  P  Q+D SA+EFLDRFPL  +   LQ+K+D PG+ED +  CLDK+FRTK
Sbjct  1     ILEAASEFASYPGLQNDASAKEFLDRFPLHELFGVLQSKADVPGVEDTIVSCLDKIFRTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGV-YPLLLS  1255
             YGASL+P + PF+  GL A SQ VR LAC  VS LLD          ILQ  V YPLLL 
Sbjct  61    YGASLLPSYAPFIQAGLQANSQTVRCLACKAVSYLLD----------ILQVIVIYPLLLG  110

Query  1254  CLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALI  1075
             CL+DGDE+ +AA++ AI+++A   +G++IIFP          ++AA+ SSLGR+R+LAL+
Sbjct  111   CLVDGDEKTSAASLEAIQSIAQSPEGINIIFP----------NIAAQSSSLGRIRILALV  160

Query  1074  VKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
              KLFS+ST++A+ VYN+NLL+L E E+ N +D L TLSALELLYELVE+ HS  F
Sbjct  161   AKLFSLSTSMATAVYNSNLLNLFEIEIKNGHDVLTTLSALELLYELVESPHSSMF  215


 Score =   206 bits (523),  Expect(2) = 4e-114, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 149/227 (66%), Gaps = 18/227 (8%)
 Frame = -3

Query  854  VISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQH  675
            V+ AID R      Q +DE E ALEA G IG   +GA  LL       RHV+ AAFD   
Sbjct  256  VVVAIDERL-----QKSDETESALEALGLIGATSQGATLLLKPVA---RHVVEAAFDHHS  307

Query  674  HGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQ  495
             GK+LA LHAL +I G  R      LD  AEESLRRLIY  ++ +PK  PSGL+LS L+Q
Sbjct  308  RGKQLAGLHALASICGADRPE----LDDAAEESLRRLIYTIAANTPKFKPSGLILSTLRQ  363

Query  494  DSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYES  315
            + EIRLAGYR+++ L  R W L+EI S QEI+ IVT+   ETEK GM+ARH+CC ++ ++
Sbjct  364  EPEIRLAGYRLVSVLAVRHWFLVEICSNQEIITIVTD---ETEKNGMDARHQCCVSISKA  420

Query  314  FTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
              SSS L+ D   +G+A KL+EA+RSGPY  R   EAQPVVMT +RF
Sbjct  421  L-SSSNLLQDATFAGIAVKLQEAVRSGPY--RAKDEAQPVVMTAERF  464



>gb|AIU50890.1| ARM repeat superfamily protein, partial [Arabidopsis lyrata]
Length=464

 Score =   224 bits (572),  Expect(2) = 5e-114, Method: Compositional matrix adjust.
 Identities = 125/229 (55%), Positives = 160/229 (70%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISA D         D D  E A++A GQIG   KGA  +LS +    RHV+++AFD 
Sbjct  254  KALISATDGSL-----NDTDAQEAAIDAIGQIGSTTKGADLVLSPAA---RHVVASAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HGK+LAALHAL NI GETR      +DG AEESLR LIYD +++S KLTPSGL LSVL
Sbjct  306  NAHGKQLAALHALANIAGETRPK----VDGKAEESLRCLIYDVAAQSTKLTPSGLFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR +T LVARPWCL+EI+S++EI++IVT+   ET KI MEAR+ CC+A++
Sbjct  362  QQSSEIRLAGYRTLTALVARPWCLVEILSKEEIINIVTD---ETAKIAMEARYNCCKAIH  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+  + DP R     KL+EA+RSGPY+ +K   A+P VMT + F
Sbjct  419  EAFLCSN-FVDDPRRQKTGEKLQEAVRSGPYMSKKG--ARPEVMTGEGF  464


 Score =   216 bits (550),  Expect(2) = 5e-114, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 156/234 (67%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             L  AA +FA+ P  Q++ S +EFLDRFPLP + NALQ   D PG E+ L  CL+++F+TK
Sbjct  1     LFDAAFEFAHYPGAQNEASVKEFLDRFPLPVIFNALQTDPDIPGFENTLVTCLERLFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIP +MP + VGL A S  V+ LAC TV  LL+N      V L++   +YPLLL  
Sbjct  61    YGASLIPQYMPVLQVGLKADSAIVKSLACKTVLCLLEN------VQLVV---IYPLLLDY  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             +I+ D++VA AA   IK+LA F   + +IFP          +LAA+CSSL RVRVL+LIV
Sbjct  112   IINSDDEVAHAASETIKSLARFPDAMSVIFP----------NLAARCSSLARVRVLSLIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS  VAS++  + LL LLE E+    DTLV L+ LEL YEL+E +HS EF
Sbjct  162   KLFSISRLVASEIKKSGLLDLLEAEMKGTKDTLVILNVLELYYELMEVEHSSEF  215



>gb|AIU50911.1| ARM repeat superfamily protein, partial [Chimonanthus praecox]
Length=464

 Score =   221 bits (563),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 163/234 (70%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             L QAA+DFA  P  Q+D+SA+EFLDRFPL  + +ALQ+  D PGLE AL  CL+++F+TK
Sbjct  1     LAQAASDFASFPGLQTDISAKEFLDRFPLSVIFSALQSAPDMPGLESALVSCLERIFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YG+S IP +MPFV  GL A SQ VR LAC   S LL+N      V L++   VYPLLL+C
Sbjct  61    YGSSFIPQYMPFVQGGLQAHSQMVRCLACKAFSFLLEN------VQLVI---VYPLLLNC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+GDE VAAA+  AI NLA   +G+ IIFP           +A  CSSL R+RVLALI 
Sbjct  112   LIEGDELVAAASSDAIMNLARCHEGISIIFPY----------IAGHCSSLARIRVLALIT  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS++VAS +Y + LL+LLE EV N +D L TLSALELLYEL E+ H  +F
Sbjct  162   KLFSISSSVASAIYESKLLNLLEAEVNNTSDILTTLSALELLYELAESPHGTKF  215


 Score =   218 bits (556),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 154/229 (67%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            +N + AID R      QD DE E ALEA GQIG   +GAA LLS      RHV+ AAFD 
Sbjct  254  KNALLAIDARL-----QDTDERESALEALGQIGASSQGAALLLSPI---ARHVVDAAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
                K+LAALHAL NI GE R    + L+ D EE LR+L+Y T++ S KLTPSGL LSVL
Sbjct  306  HGRAKQLAALHALANISGENR----LELNDDTEECLRQLVYATAANSSKLTPSGLFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQDSEIR A YR+I GLV R WCL+E+ S+QEI+ IVT+   ET K GMEAR+KCC A+ 
Sbjct  362  QQDSEIRFAAYRMIAGLVTRLWCLLEVCSKQEIISIVTD---ETAKNGMEARYKCCTAIS  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             +   S+K  SD   S +A KL+EA+R GPYL +   EAQPVVMT +RF
Sbjct  419  RALLVSNK-HSDATFSEIAAKLQEAVRRGPYLAK--GEAQPVVMTAERF  464



>gb|AIU50894.1| ARM repeat superfamily protein, partial [Musa acuminata]
Length=463

 Score =   233 bits (593),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 169/234 (72%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +L+AA++FA  P  Q+D SA+EFLDRFPL  + + LQ K+D PG ED +  CLDK+FRTK
Sbjct  1     VLEAASEFASYPGLQNDASAKEFLDRFPLHTLFSVLQTKADVPGTEDTMVSCLDKIFRTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASL+  + PF+ VGL A SQ VRRLAC  VS LL+N      + +I+   VYPLLLSC
Sbjct  61    YGASLLLDYAPFIQVGLQANSQAVRRLACKAVSYLLEN------LQIIV---VYPLLLSC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L+DGDEQ +AA++ A+K++A   +G+ IIFP          ++A + SSL R+R+LAL+ 
Sbjct  112   LVDGDEQTSAASLEAVKDIAQSPEGISIIFP----------NIAVQSSSLARIRILALVA  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLF++S+++A+ VY++NLL+L E E+ N +D L TLSALELLYELVE+ HS  F
Sbjct  162   KLFALSSSLATAVYSSNLLNLFEVEINNGHDMLTTLSALELLYELVESPHSSMF  215


 Score =   206 bits (525),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 151/227 (67%), Gaps = 19/227 (8%)
 Frame = -3

Query  854  VISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQH  675
            +++AID R      Q+ DE+E ALEA G IG   +GA  LL  +    RHVI +AFD   
Sbjct  256  LLAAIDERL-----QNTDEYESALEALGLIGAISQGATLLLPVA----RHVIESAFDRHS  306

Query  674  HGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQ  495
             GK+LA LHAL +I G  R      LD  AEE+LRRLIY  ++ + KL PSGL+LS+L+Q
Sbjct  307  RGKQLAGLHALASICGVDRPE----LDSKAEENLRRLIYTAAANTSKLNPSGLILSILRQ  362

Query  494  DSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYES  315
            + EIRLAGYR+I+GLV RPWCL+EI    EI+ IVT+   ET K GM+ARH CC  +  +
Sbjct  363  EPEIRLAGYRLISGLVVRPWCLMEICLNPEIITIVTD---ETAKTGMDARHHCCTVISTA  419

Query  314  FTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
              SSS L+ D A +  A KL+EA+R GPY+ ++  EAQP+VMT +RF
Sbjct  420  L-SSSNLLQDAAVARTAAKLQEAVRRGPYVIKE--EAQPIVMTAERF  463



>gb|AIU50891.1| ARM repeat superfamily protein, partial [Arabidopsis thaliana]
Length=464

 Score =   224 bits (570),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 161/229 (70%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAID         D D  E A++A GQ+G   KGA  +LS +    RHV+++AFD 
Sbjct  254  KALISAIDGSL-----NDTDAQEAAIDALGQMGSTTKGADLVLSPAA---RHVVASAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HGK+LAALHAL NI GETR      +DG AEESLR LIYD +++S KLTPSGL LSVL
Sbjct  306  NAHGKQLAALHALANIAGETRPK----VDGKAEESLRCLIYDAAAQSTKLTPSGLFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR +T LVARPWCL+EI++++EI++IVT+   ET KI MEAR+ CC+A++
Sbjct  362  QQSSEIRLAGYRTLTALVARPWCLVEILAKEEIINIVTD---ETAKIAMEARYNCCKAIH  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+  + DP R     KL+EA+RSGPY+ +K   A+P VMT + F
Sbjct  419  EAFLCSN-FVDDPRRLKTGDKLQEAVRSGPYMSKKG--ARPEVMTGEGF  464


 Score =   214 bits (546),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 156/234 (67%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             L  AA +FA+ P  Q++ S +EFLDRFPLP + NALQ   D PG E+ L  CL+++F+TK
Sbjct  1     LFDAAFEFAHYPGAQNETSVKEFLDRFPLPVIFNALQTDPDIPGFENTLVTCLERLFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIP +MP + VGL A S  V+ LAC TV  LL++      V L++   +YPLLL  
Sbjct  61    YGASLIPQYMPVLQVGLKADSAVVKSLACKTVLCLLED------VQLVV---IYPLLLDY  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             +I+ D++VA AA   IK+LA F   + +IFP          +LAA+CSSL RVRVL+LIV
Sbjct  112   IINSDDEVANAASETIKSLARFPDAMSVIFP----------NLAARCSSLARVRVLSLIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS  VAS+V  + LL LLE E+    DTLV L+ LEL YEL+E +HS EF
Sbjct  162   KLFSISRLVASEVKKSGLLDLLEAEMKGTKDTLVILNVLELYYELMEVEHSSEF  215



>gb|AIU50915.1| ARM repeat superfamily protein, partial [Aristolochia tagala]
Length=463

 Score =   220 bits (561),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 155/228 (68%), Gaps = 18/228 (8%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AID R      Q  DE ECALE  G IG   +GA  LL       RHV+ AAFD Q
Sbjct  254  NILLAIDGRL-----QGTDECECALEVLGHIGSSYQGANLLLLPLA---RHVVEAAFDQQ  305

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              GK+LAALHAL +I GE RS     L+ +AEE LR LIY  +  S KLTPSGL +SVL+
Sbjct  306  ARGKQLAALHALADICGEKRSD----LNSNAEECLRHLIYTAARNSSKLTPSGLFVSVLR  361

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QDSE+RLA YR+I+GLV+RPWCL+E+ S+Q+IVD+VTN   E  KIGMEAR  CC+A+  
Sbjct  362  QDSEVRLAAYRMISGLVSRPWCLLEVCSKQDIVDMVTN---ENTKIGMEARFNCCKAINM  418

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +F SS+ L S  A S +ATKL+EA+R GPYL R+  E+ PVV T  RF
Sbjct  419  AFQSSTSL-SGTAFSEVATKLQEAVRRGPYLTRE--ESVPVVATADRF  463


 Score =   218 bits (554),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 164/234 (70%), Gaps = 20/234 (9%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL +A +FA  P  QSD S +EFLDRFPLP +++ LQ ++D P +E  L  CL+++F+TK
Sbjct  1     LLASAAEFASYPGMQSDDSVKEFLDRFPLPVLLSVLQTEADAPEVESTLVSCLERIFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YG+S IP +M FV +GL   SQ VR LAC  VS LL+N      V L++   +YPLL+ C
Sbjct  61    YGSSFIPQYMAFVQIGLQTGSQIVRCLACKVVSGLLEN------VKLLI---IYPLLIDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI GD+Q+++A+  AI  LA   KG+D+IFP+          +AA CSSL R+RVL+LIV
Sbjct  112   LIKGDQQLSSASTDAIIALAKSPKGIDVIFPS----------IAAHCSSLARIRVLSLIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS++ AS VY+++LLSL+E EV N +D LV LSA ELLYEL E+ ++M+F
Sbjct  162   KLFSISSSTASAVYDSDLLSLIESEV-NTSDILVKLSAFELLYELAESPNAMKF  214



>gb|AIU50910.1| ARM repeat superfamily protein, partial [Ceratophyllum demersum]
Length=464

 Score =   231 bits (589),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 167/234 (71%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             L+ AA +FA  P  Q+D SA+EFL R+PLP +I+ LQ++ D PGLE +L  CL++VF+T 
Sbjct  1     LIDAANEFASYPGLQNDDSAKEFLSRYPLPVMISCLQSEEDVPGLEISLVSCLERVFKTN  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIPH+M FV VGL A SQ VR LAC  +S LL+N      V+LI+   +YPLL++C
Sbjct  61    YGASLIPHYMSFVQVGLQATSQPVRCLACKVISYLLEN------VHLII---LYPLLINC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L +GDE VAAA++ +I NLA F +G++IIFP          +LA +CSS  RVRVLALI 
Sbjct  112   LTNGDELVAAASVDSIINLAKFPEGIEIIFP----------NLAFRCSSQARVRVLALIA  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS  +AS VYN+NLL LL  E+ N +D L+TLSALELLYEL E+ H  +F
Sbjct  162   KLFSISVDMASIVYNSNLLDLLVAEIQNTSDVLMTLSALELLYELAESPHGTQF  215


 Score =   206 bits (524),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 154/229 (67%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            +N++ AID R      QD DE+E ALEA G+IG   +GA  L S      RH++ AAF  
Sbjct  254  KNIVLAIDARL-----QDTDEYEIALEALGRIGASTEGATLLFSPIA---RHLVKAAFHH  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            +  GK+LAALHALG+IVG    GN   L  D+EE LR+LIY T++ + KLTPSG+ LSVL
Sbjct  306  KGRGKQLAALHALGDIVG----GNQTELSSDSEECLRQLIYATAADTSKLTPSGMFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ+ E RLA YRVI+GLV R W L+EI S  +I++ +T+   ET K GMEAR+ CC A+ 
Sbjct  362  QQEPEARLAAYRVISGLVGRSWFLLEIFSSNKIINRITD---ETNKRGMEARYDCCIAIS  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++  SSS L++DP+      KLEEAI+ GPYL +   EAQP+V+T +RF
Sbjct  419  KAL-SSSNLLNDPSVKETIAKLEEAIKRGPYLAK--GEAQPIVVTAERF  464



>gb|AIU50929.1| ARM repeat superfamily protein, partial [Eutrema parvulum]
Length=464

 Score =   217 bits (553),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 161/230 (70%), Gaps = 20/230 (9%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGS-QDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFD  684
            + +ISAID      GS  D D  E AL+A GQIG   KGA+ +L+ +    RHV+S+AFD
Sbjct  254  KALISAID------GSLNDTDAQEAALDAIGQIGSSTKGASLVLAPAA---RHVVSSAFD  304

Query  683  CQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSV  504
               HG++LAALHAL  I GETR+     +D  AEESLR LIYD +++S KLTPSGL LSV
Sbjct  305  RNAHGRQLAALHALAYIAGETRAK----VDEKAEESLRCLIYDVAAQSTKLTPSGLFLSV  360

Query  503  LQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAV  324
            LQQ SEIRLAGYR +  LVARPW L+EI+S++EI++IVT+   ET KI MEAR+ CC+++
Sbjct  361  LQQSSEIRLAGYRTLAALVARPWGLMEILSKEEIINIVTD---ETAKIAMEARYNCCKSI  417

Query  323  YESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +E+F SSS  + DP R     KL+EA+RSGPY+ +K  EA P VM  + F
Sbjct  418  HEAFLSSS-FVDDPRRLKTGEKLQEAVRSGPYMSKK--EAIPEVMMAEGF  464


 Score =   216 bits (549),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 155/234 (66%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             L  +A +FA+ P PQ + S +EFLDRFPLP + NALQ ++D PG E  L  CL++VF+TK
Sbjct  1     LFDSAFEFAHYPGPQGEASVKEFLDRFPLPVIFNALQTETDIPGFESTLVTCLERVFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIP +M  +  GL A S  V+ LAC TVS LL+N      V+L++   +YPLLL  
Sbjct  61    YGASLIPQYMAVLQAGLKADSAVVKSLACKTVSCLLEN------VHLVV---IYPLLLEY  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             +I  D++VA AA   IK+LA F   + +IFP          +LAA+ SSL RVRVL+LIV
Sbjct  112   IIKSDDEVAHAASETIKSLARFPDAMSVIFP----------NLAARSSSLARVRVLSLIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS  VAS V  + LL+LLE E+    DTLV L+ LEL YE++E +HS EF
Sbjct  162   KLFSISPDVASAVKKSGLLNLLEAEMKGTKDTLVILNVLELYYEVMEVEHSSEF  215



>gb|AIU50932.1| ARM repeat superfamily protein, partial [Ceratophyllum platyacanthum 
subsp. oryzetorum]
Length=464

 Score =   229 bits (584),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 166/234 (71%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             L+ AA +FA  P  Q+D SA+EFL R+PLP +I+ LQ++ D PGLE +L  CL++VF+T 
Sbjct  1     LIDAANEFASYPGLQNDDSAKEFLSRYPLPVMISCLQSEEDVPGLEISLVSCLERVFKTN  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIPH+M FV VGL A SQ VR LAC  +S LL+N      V+LI+   +YPLL++C
Sbjct  61    YGASLIPHYMSFVQVGLQATSQPVRCLACKVISYLLEN------VHLII---LYPLLINC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L +GDE VAAA++ +I NLA F +G++IIFP+          LA +CSS  RVRVLALI 
Sbjct  112   LTNGDELVAAASVDSIINLAKFPEGIEIIFPS----------LAFRCSSQARVRVLALIA  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS  +AS VYN NLL LL  E+ N +D L+TLSALELLYEL E+ H  +F
Sbjct  162   KLFSISVDMASIVYNFNLLDLLVAEIQNTSDVLMTLSALELLYELAESPHGTQF  215


 Score =   203 bits (516),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 155/229 (68%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            ++++ AID R      QD DE+E  LEA G+IG   +GA  LLS      RH++ AAF  
Sbjct  254  KSIVLAIDARL-----QDTDEYEIGLEALGRIGASTEGATLLLSPIA---RHLVKAAFHH  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            +  GK+LAALHALG+IVG    GN + L  D+EE LR+LIY T++ + KLTPSG+ LSVL
Sbjct  306  KGRGKQLAALHALGDIVG----GNQIELSSDSEECLRQLIYATAADTSKLTPSGMFLSVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ+ E RLA YRVI+GLV R W L+EI S  +I++ +T+   ET K GMEAR+ CC A+ 
Sbjct  362  QQEPEARLAAYRVISGLVGRSWFLLEIFSSNKIINRITD---ETNKRGMEARYDCCIAIS  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++  SSS L++DP+      KLEEAI+ GPYL +   EAQP+V+T +RF
Sbjct  419  KAL-SSSNLLNDPSVKETIAKLEEAIKRGPYLAK--GEAQPIVVTAERF  464



>gb|AIU50903.1| ARM repeat superfamily protein, partial [Capsella rubella]
Length=464

 Score =   216 bits (551),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 156/234 (67%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             L  AA +FA+ P  Q++ S +EFLDRFPLP +  ALQ   D PG E+ L  CL+++F+TK
Sbjct  1     LFDAAFEFAHYPGVQNEASVKEFLDRFPLPVIFKALQTDPDIPGFENTLVTCLERLFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIP +MP + VGL A S  V+ LAC TV  LL+N      V L++   +YPLLL  
Sbjct  61    YGASLIPQYMPVLQVGLKADSAVVKSLACKTVLCLLEN------VQLVV---IYPLLLDY  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             +I+ D++VA AA   IK+LA F   + IIFP          +LAA+CSSL RVRVL+L+V
Sbjct  112   IINSDDEVAHAASETIKSLARFPDAMSIIFP----------NLAARCSSLARVRVLSLVV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS  VAS+V N+ LL LLE E+    DTLV L+ LEL YEL+E +HS EF
Sbjct  162   KLFSISRNVASEVKNSGLLDLLEAEMKGTKDTLVILNVLELYYELMEVEHSSEF  215


 Score =   215 bits (548),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 158/229 (69%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAID         D D  E A++A GQIG   KGA  +LS +    RHV+++AFD 
Sbjct  254  KALISAIDGSL-----NDNDAQEAAIDALGQIGSTTKGAHLVLSPAA---RHVVASAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HGK+LAALHAL NI GETR      +DG AEESLR LIYD +++S KLTPSGL L VL
Sbjct  306  NAHGKQLAALHALANIAGETRPK----VDGKAEESLRCLIYDVAAQSTKLTPSGLFLVVL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR +T LVARPWCL+EI+S+ EI++IVT+   ETEKI MEAR+ CC++++
Sbjct  362  QQSSEIRLAGYRTLTALVARPWCLVEILSKAEIINIVTD---ETEKIAMEARYNCCKSIH  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+    D        KL+EA+++GPY+ +K  +A+P VMT + F
Sbjct  419  EAFLCSN-FADDSRHLKTGEKLQEAVQNGPYMSKK--DARPEVMTGEGF  464



>gb|AIU50939.1| ARM repeat superfamily protein, partial [Trachycarpus fortunei]
Length=463

 Score =   222 bits (565),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 165/234 (71%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL+AA+DFA  P  Q+D SA++FLDR+PL  +   LQ K+D PGLED +  CLD++FRTK
Sbjct  1     LLEAASDFASYPGFQNDASAKQFLDRYPLTVLFGVLQTKADVPGLEDTVVACLDRIFRTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASL+ ++ PF+  GL A S+ VR LAC  VS +L N      V +I+   +YPLL++C
Sbjct  61    YGASLLTNYAPFIQAGLQANSETVRCLACKAVSYILQN------VQIIV---IYPLLINC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L++G+EQ + A++ AI N+A   +G+ IIFP          ++AA+ SSL R+R+LALI 
Sbjct  112   LLEGNEQTSNASLGAITNIAQAPEGISIIFP----------NVAARSSSLARIRILALIA  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS+S++VA+ VYN+NLL+L E E+ + +D L TLSALELLYELV + HS  F
Sbjct  162   KLFSLSSSVATAVYNSNLLNLFEIEINDKHDMLTTLSALELLYELVSSPHSSSF  215


 Score =   207 bits (527),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 153/227 (67%), Gaps = 18/227 (8%)
 Frame = -3

Query  854  VISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQH  675
            ++ AID R      Q+ DE E  LEA G IG   +GAA +L+      RHV  +AFD Q 
Sbjct  255  LLFAIDGRL-----QNTDECESVLEALGLIGATNQGAALVLTVVA---RHVFESAFDRQS  306

Query  674  HGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQ  495
             G +LAALHALG+I G  R      LD  AEE LRR IY T++ SPKLTPSGLLLSVLQQ
Sbjct  307  RGTQLAALHALGSICGVDRPQ----LDDKAEECLRRFIYATAASSPKLTPSGLLLSVLQQ  362

Query  494  DSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYES  315
            + E+RLAGYR+I+ LVAR WCL+ + S+QEI+ IVT+   E  K GMEARH+CC A+ ++
Sbjct  363  EPELRLAGYRLISALVARSWCLMAVCSKQEIITIVTD---EDTKNGMEARHQCCTAISKA  419

Query  314  FTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
              S+S L+ D   + +A KL+EA+R GPYL +K  EAQP+V+T  RF
Sbjct  420  L-SASNLLHDGPIAEIAGKLQEAVRRGPYLAKK--EAQPLVITADRF  463



>gb|AIU50906.1| ARM repeat superfamily protein, partial [Illicium henryi]
Length=458

 Score =   214 bits (544),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 159/229 (69%), Gaps = 20/229 (9%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            +  + AID R      +D DEFE AL+A GQIG   +GA  L S      RHV++AAF  
Sbjct  250  KTALLAIDGRL-----EDMDEFETALDALGQIGSSIQGAELLFSPIA---RHVVAAAFTH  301

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  G++LAALHALGN+ GE R      L+  AEE +R LIY  ++ S KLTPSGL LS+L
Sbjct  302  QGRGRQLAALHALGNVCGENR------LNDYAEEWIRNLIYTAAANSSKLTPSGLFLSIL  355

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ+SEIRLA YR+I GLVAR WCL+E+ S+QEI++IVTN+ T   K GMEARH CC A+ 
Sbjct  356  QQESEIRLACYRLIAGLVARLWCLLEVCSKQEIIEIVTNEKT---KQGMEARHMCCVAIS  412

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++ ++S+KL +D A +  A KL++A+R GPYL ++  EAQPVV+T +RF
Sbjct  413  KALSASNKL-NDLALAETAAKLQDAVRRGPYLAKE--EAQPVVITAERF  458


 Score =   213 bits (543),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 162/230 (70%), Gaps = 19/230 (8%)
 Frame = -2

Query  1599  ATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTKYGAS  1420
             A++FA  P  Q+D SA+ FLDR+PLP +  ALQ+  D PGLE +L  CL+++F+TKYGAS
Sbjct  1     ASEFASYPGVQNDASAKAFLDRYPLPVMFGALQSGVDVPGLESSLVSCLERIFKTKYGAS  60

Query  1419  LIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSCLIDG  1240
             LI  +M FV VGL A SQ VR LAC  VS++L N      V L++   VYPLL++ LIDG
Sbjct  61    LILQYMSFVQVGLQANSQMVRCLACKAVSNVLGN------VQLLV---VYPLLVNSLIDG  111

Query  1239  DEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIVKLFS  1060
             +EQVA A++ AI +LA   KG+DIIFP           +AA+ SSL R+RVLA++ KLFS
Sbjct  112   NEQVAMASMNAIHDLAKSPKGIDIIFPC----------IAARSSSLARIRVLAVMAKLFS  161

Query  1059  ISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             IS+ VA+ VY ++LL L+E+EV N++D L++LSA+E+LYE+  + H  E+
Sbjct  162   ISSNVAAAVYGSDLLILMEEEVNNSDDMLMSLSAIEILYEMAASPHGTEY  211



>ref|XP_006348273.1| PREDICTED: uncharacterized protein LOC102597543 [Solanum tuberosum]
Length=523

 Score =   347 bits (890),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 199/231 (86%), Gaps = 0/231 (0%)
 Frame = -3

Query  866  GYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAF  687
            G RN+ISAI+ RF FL SQ+ADE ECALEA GQIGLC KGAA+LLS +    RHVI A F
Sbjct  293  GCRNLISAINGRFDFLESQNADECECALEALGQIGLCSKGAASLLSGAQPAGRHVIYATF  352

Query  686  DCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLS  507
            D Q HGK+LAALHAL NIVGETR+  DVLLDGDAE++LRRLIY+ +SK+ KLTPSGLLLS
Sbjct  353  DQQQHGKQLAALHALANIVGETRAEKDVLLDGDAEQNLRRLIYEAASKTSKLTPSGLLLS  412

Query  506  VLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEA  327
            VLQQDSEIR AGYRVITGLV RPWCL+E+ISR+EI+DIVT+ + ETEKIGMEARHKCC++
Sbjct  413  VLQQDSEIRKAGYRVITGLVMRPWCLMEVISRREIIDIVTDAFKETEKIGMEARHKCCQS  472

Query  326  VYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +Y+ FTSSSKL++D A SG+ATKLEEAI  GPYLGRK +EAQP VMTEQRF
Sbjct  473  IYKVFTSSSKLIADNALSGIATKLEEAINRGPYLGRKLSEAQPAVMTEQRF  523


 Score =   327 bits (837),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 171/245 (70%), Positives = 204/245 (83%), Gaps = 0/245 (0%)
 Frame = -2

Query  1644  MEEEYSVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDAL  1465
             MEEEYS+D AQLL+AATDFAY P   SD SAQ+FL+RFPLPA+INALQ K+DYPGLE AL
Sbjct  1     MEEEYSMDPAQLLEAATDFAYHPGAHSDASAQDFLNRFPLPAIINALQTKADYPGLESAL  60

Query  1464  CDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLIL  1285
              DCL+K+F+T+YGASLIPH+MPFV+VGLGA SQ VR LAC TVS LL+N DE   + LI 
Sbjct  61    VDCLEKLFKTRYGASLIPHYMPFVIVGLGAESQKVRHLACQTVSCLLENIDEAIVIQLIH  120

Query  1284  QNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSS  1105
             + GVY LLL+CLI GD +VAA++  AI+ LA  +KG+DIIFP S +E T+L +LA  CS 
Sbjct  121   EYGVYQLLLNCLISGDAEVAASSTDAIRKLASHSKGIDIIFPESGNEATNLVNLATNCSP  180

Query  1104  LGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQ  925
             LGRVRVLALIVKLFSIST+VAS+VY++NLLSLLE E+ N+NDTLVTLS+LELLYEL + Q
Sbjct  181   LGRVRVLALIVKLFSISTSVASRVYSSNLLSLLETEISNSNDTLVTLSSLELLYELADVQ  240

Query  924   HSMEF  910
             HS EF
Sbjct  241   HSTEF  245



>ref|XP_011098276.1| PREDICTED: uncharacterized protein LOC105176972 [Sesamum indicum]
Length=523

 Score =   345 bits (886),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 174/245 (71%), Positives = 202/245 (82%), Gaps = 0/245 (0%)
 Frame = -2

Query  1644  MEEEYSVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDAL  1465
             M+EE+SVD +QLL+AA+DFA+ P   SD SAQEFL RFPLPA+I ALQ  +DYPGLE AL
Sbjct  1     MDEEFSVDPSQLLEAASDFAHQPGALSDASAQEFLTRFPLPAIIGALQTNADYPGLETAL  60

Query  1464  CDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLIL  1285
              DCL+++FRTKYGASLIPH+MPFV+VGLG  SQ VRRLAC  +S LL +TD+  AV L+L
Sbjct  61    VDCLERLFRTKYGASLIPHYMPFVLVGLGTDSQKVRRLACIAISCLLGHTDKRIAVQLVL  120

Query  1284  QNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSS  1105
             Q+ VY  LLSCL DGDEQVA AA  AIKNLAG+ +GL I+FPAS +E THLG+LAAKCSS
Sbjct  121   QHDVYSHLLSCLTDGDEQVATAATEAIKNLAGYPEGLGIVFPASVNEATHLGNLAAKCSS  180

Query  1104  LGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQ  925
             LGRVRVLALIVKLFSIS++VAS+V  +NLLSLLE EV N NDTLV LS LELLYEL E +
Sbjct  181   LGRVRVLALIVKLFSISSSVASEVSKSNLLSLLEAEVRNTNDTLVILSVLELLYELTEVR  240

Query  924   HSMEF  910
             HS EF
Sbjct  241   HSTEF  245


 Score =   333 bits (853),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 195/230 (85%), Gaps = 0/230 (0%)
 Frame = -3

Query  863  YRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFD  684
            +R V+SAIDRRF +L SQDADE ECALEA GQIG   +GA  +LS+SP   RHV+ AAFD
Sbjct  294  FRTVLSAIDRRFEYLESQDADECECALEALGQIGSSFQGATLVLSTSPPIARHVVDAAFD  353

Query  683  CQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSV  504
             Q HGK+LAALH+LGNIVGETR+G+ ++L+  AEE+LR LIYD +SK+ KLTP GLLLSV
Sbjct  354  RQQHGKQLAALHSLGNIVGETRTGDTMVLNSSAEENLRSLIYDKASKTSKLTPLGLLLSV  413

Query  503  LQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAV  324
            LQQDSEIR+AGYR+ITGLVAR WCL+EIISR EI++IVT+ YTET+KIGMEARH+CCEA+
Sbjct  414  LQQDSEIRIAGYRLITGLVARTWCLMEIISRPEIINIVTDTYTETKKIGMEARHRCCEAI  473

Query  323  YESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            Y  FTSSSKL+SDPA +G+A+KL+EAIR GPY  RK AEAQPVVMT  RF
Sbjct  474  YRVFTSSSKLISDPAFAGMASKLQEAIRRGPYGARKQAEAQPVVMTADRF  523



>ref|XP_009781372.1| PREDICTED: uncharacterized protein LOC104230304 [Nicotiana sylvestris]
Length=523

 Score =   345 bits (886),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = -3

Query  866  GYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAF  687
            G RN+ISAIDRRF  L S++ADE ECALEA GQIG   KGAA LLS +    RHVI AAF
Sbjct  293  GCRNLISAIDRRFNLLESENADECECALEALGQIGFSSKGAALLLSGAQPAGRHVIYAAF  352

Query  686  DCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLS  507
            D Q HGK+LAALHAL NIVGETR+ NDVLLDG AEESLRRLIY+T+SK+ KLTPSGLLLS
Sbjct  353  DRQQHGKQLAALHALANIVGETRAENDVLLDGVAEESLRRLIYETASKTSKLTPSGLLLS  412

Query  506  VLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEA  327
            VLQQDSEIR AGYRVIT LV RPWCL+E++SRQEI++I T+ +TET+KIGMEARHKCC++
Sbjct  413  VLQQDSEIRKAGYRVITALVMRPWCLMEVVSRQEIINIATDTFTETDKIGMEARHKCCQS  472

Query  326  VYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +Y+ FTSSSKL++D A SG+ATKLEEAIR GPYLGR+ +EAQP VMTEQRF
Sbjct  473  LYKGFTSSSKLIADNALSGVATKLEEAIRRGPYLGRRLSEAQPTVMTEQRF  523


 Score =   328 bits (841),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 171/245 (70%), Positives = 205/245 (84%), Gaps = 0/245 (0%)
 Frame = -2

Query  1644  MEEEYSVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDAL  1465
             MEEEYSVD AQLL+AATDFAY P   SD SAQ+FL+RFPLPA+INALQ K++YPGLE+AL
Sbjct  1     MEEEYSVDPAQLLEAATDFAYYPGAHSDASAQDFLNRFPLPAIINALQTKAEYPGLENAL  60

Query  1464  CDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLIL  1285
              DCL+++F+T+YGASLIPH+M FV+VGLGA SQ VRRLAC TVS LL+N DE   V LI 
Sbjct  61    VDCLERLFKTRYGASLIPHYMTFVIVGLGAESQKVRRLACQTVSCLLENIDEAIVVQLIH  120

Query  1284  QNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSS  1105
             + GVY LLL+CLI GDE+VAA +  A++ LA  +KG+DIIFP S +E T+L +LA  CS 
Sbjct  121   EYGVYQLLLNCLISGDEEVAATSTDAVRKLASHSKGIDIIFPESGNEATNLVNLATSCSP  180

Query  1104  LGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQ  925
             LGRVR+LALIVKLFSIS++VAS+VYN+NLLSLLE E+ NANDTLVTLS+LELLYEL + Q
Sbjct  181   LGRVRLLALIVKLFSISSSVASRVYNSNLLSLLEAEISNANDTLVTLSSLELLYELADVQ  240

Query  924   HSMEF  910
             HS EF
Sbjct  241   HSTEF  245



>ref|XP_004244250.1| PREDICTED: uncharacterized protein LOC101261434 [Solanum lycopersicum]
Length=523

 Score =   339 bits (869),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 197/231 (85%), Gaps = 0/231 (0%)
 Frame = -3

Query  866  GYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAF  687
            G RN+ISAI+ RF  L +Q+ADE ECALEA GQIGL  KGAA LLS +    RHVI AAF
Sbjct  293  GCRNLISAINGRFNLLENQNADECECALEALGQIGLSSKGAALLLSGAQPAERHVIYAAF  352

Query  686  DCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLS  507
            D Q HGK+LAALHAL NIVGETR+  DVLLDGDAE++LRRLIY+ +SK+ KLTPSGLLLS
Sbjct  353  DQQQHGKQLAALHALANIVGETRAEKDVLLDGDAEQNLRRLIYEAASKTSKLTPSGLLLS  412

Query  506  VLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEA  327
            VLQQDSEIR AGYRVI+GLV RPWCL+E+ISR+EI+DIVT+ + ETEKIGMEARHKCC++
Sbjct  413  VLQQDSEIRKAGYRVISGLVMRPWCLMEVISRREIIDIVTDAFKETEKIGMEARHKCCQS  472

Query  326  VYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +Y+ FTSSSKL++D A SG+ATKLE+AI  GPYLGRK +EAQP VMTEQRF
Sbjct  473  IYKVFTSSSKLIADNAFSGIATKLEQAISRGPYLGRKLSEAQPAVMTEQRF  523


 Score =   337 bits (865),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 168/245 (69%), Positives = 202/245 (82%), Gaps = 0/245 (0%)
 Frame = -2

Query  1644  MEEEYSVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDAL  1465
             M EEYSVD AQLL+AATDFAY P   SD SAQ+FL+RFPLPA+INALQ K+DYPGLE AL
Sbjct  1     MAEEYSVDPAQLLEAATDFAYHPGALSDASAQDFLNRFPLPAIINALQTKADYPGLESAL  60

Query  1464  CDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLIL  1285
              DCL+K+F+T+YGASLIPH+MPFV+VGLGA SQ VRRLAC TVS LL+N DE   + LI 
Sbjct  61    VDCLEKLFKTRYGASLIPHYMPFVIVGLGAESQKVRRLACQTVSCLLENIDEALVIQLIH  120

Query  1284  QNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSS  1105
             + GVY LLL+CLI GD +VAAA+  AI+ LA  +KG+DIIFP S +E T+L + A  C+ 
Sbjct  121   EYGVYQLLLNCLISGDAEVAAASTDAIRKLASHSKGIDIIFPESGNEATNLLNFATNCAP  180

Query  1104  LGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQ  925
             LGRVRVLALIVKLFSIST+VAS+VY++NLLSLLE E+ N++DTLVT S+LELLYEL + +
Sbjct  181   LGRVRVLALIVKLFSISTSVASRVYSSNLLSLLETEISNSDDTLVTSSSLELLYELADVE  240

Query  924   HSMEF  910
             HS EF
Sbjct  241   HSTEF  245



>emb|CDP05951.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   337 bits (865),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 181/245 (74%), Positives = 205/245 (84%), Gaps = 0/245 (0%)
 Frame = -2

Query  1644  MEEEYSVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDAL  1465
             MEEEYSVD A LL AATDFA  P  QSD SAQEFL+RFPLPA+INALQ K+DYPGLE+AL
Sbjct  1     MEEEYSVDPALLLAAATDFASHPGTQSDASAQEFLNRFPLPAIINALQTKADYPGLENAL  60

Query  1464  CDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLIL  1285
              D L+++F+TKYGASLIPHFMPFVVVGLGA SQ VR LAC TVS LL+N D++TAV+LI 
Sbjct  61    VDSLERIFKTKYGASLIPHFMPFVVVGLGADSQKVRYLACETVSCLLENIDDSTAVHLIH  120

Query  1284  QNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSS  1105
             Q  VYPLLL+C+IDGDEQVA  ++ AIKNL G   GL IIFPA+ SE T LG+LA KCSS
Sbjct  121   QYAVYPLLLNCVIDGDEQVATVSMDAIKNLGGSPNGLAIIFPANISEPTQLGNLAGKCSS  180

Query  1104  LGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQ  925
             LGRVRVLALIVKLFSIS++VAS VY++ LLSLLE+EV N NDTLVTL+ LELLYEL E Q
Sbjct  181   LGRVRVLALIVKLFSISSSVASLVYSSKLLSLLEREVSNTNDTLVTLTVLELLYELAEVQ  240

Query  924   HSMEF  910
             HS EF
Sbjct  241   HSTEF  245


 Score =   317 bits (813),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 187/231 (81%), Gaps = 0/231 (0%)
 Frame = -3

Query  866  GYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAF  687
             +R V+ AIDRRF FL SQDADE ECALEA GQ+GL  +GA  LL+ SP   RHVI AAF
Sbjct  293  SFRAVVLAIDRRFDFLESQDADECECALEALGQVGLSNQGAVLLLTGSPPAARHVIDAAF  352

Query  686  DCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLS  507
            D Q H K+LAALHAL  I GE RS NDV+L G AEE+L+RLIY+ +S++ KLTPSGLL S
Sbjct  353  DRQQHNKQLAALHALATIAGEPRSENDVILTGGAEENLQRLIYEMASRTSKLTPSGLLQS  412

Query  506  VLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEA  327
            +LQQDS++RLAGYR+IT LVARPWCL+EIISRQEI+++V + YTET+KIGME RHKCC+A
Sbjct  413  ILQQDSDLRLAGYRLITALVARPWCLLEIISRQEIINVVIDTYTETKKIGMELRHKCCQA  472

Query  326  VYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +Y + TSSSKL+S+PA + +A KL+EAIR GPYL R   EAQPVVMT +RF
Sbjct  473  IYRALTSSSKLISNPALADIAAKLQEAIRRGPYLVRTRTEAQPVVMTAERF  523



>gb|EYU26362.1| hypothetical protein MIMGU_mgv1a006403mg [Erythranthe guttata]
Length=445

 Score =   321 bits (822),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 188/230 (82%), Gaps = 0/230 (0%)
 Frame = -3

Query  863  YRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFD  684
            +R+V+SAIDRRF FL SQ ADE ECALEA GQIG   +GA  +L+++P   RH++ AAFD
Sbjct  216  FRSVLSAIDRRFDFLESQAADECECALEALGQIGSSFQGATIVLTTAPPTARHIVKAAFD  275

Query  683  CQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSV  504
             Q HGK+LAALH+LGNI GE R+GN VLL+  AE++LR LIYD +SK+ KLTPSGLLLSV
Sbjct  276  RQQHGKQLAALHSLGNIAGENRTGNTVLLNSTAEDTLRSLIYDEASKTSKLTPSGLLLSV  335

Query  503  LQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAV  324
            LQQDSEIR+AGYRVI+GLVARPWCL EIIS+ EI+ +VTN + ET KIGME RH+CCEA+
Sbjct  336  LQQDSEIRIAGYRVISGLVARPWCLTEIISKPEIIALVTNTHRETHKIGMENRHRCCEAI  395

Query  323  YESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            Y+ F  SSKLM DPA + +A+KLEEAIR GPY  RKHAEAQP+V+T  RF
Sbjct  396  YKVFALSSKLMGDPAFADMASKLEEAIRRGPYGARKHAEAQPMVVTADRF  445


 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = -2

Query  1407  FMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSCLIDGDEQV  1228
             F  FV+VGL A SQ VRRLAC  +SSLL+NTD+T AV L+LQ+ VYPLLLSC IDGDEQV
Sbjct  2     FQAFVLVGLVADSQKVRRLACIAISSLLENTDKTIAVQLVLQHDVYPLLLSCCIDGDEQV  61

Query  1227  aaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIVKLFSISTT  1048
             AAA+  AI+NLAG+ +GL I+ PAS+SE THLG++A KCSSLGRVRVLALIV+LFS S +
Sbjct  62    AAASSEAIRNLAGYEEGLGIVLPASTSEATHLGNIAEKCSSLGRVRVLALIVRLFSASRS  121

Query  1047  VASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VAS+V  + +LSLLE EV N NDTLVTLS LEL+YEL E +HS EF
Sbjct  122   VASEVSRSGILSLLEAEVRNTNDTLVTLSVLELIYELAEVEHSAEF  167



>gb|AIU50927.1| ARM repeat superfamily protein, partial [Setaria italica]
Length=464

 Score =   196 bits (499),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 155/234 (66%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +LQAA DFA  P   SD + ++FL+R PLP ++ ALQ+++D PG+ + + +CLDKVF ++
Sbjct  1     MLQAAGDFASYPGLHSDDTVRQFLERCPLPKLLGALQSEADAPGMVETVTECLDKVFSSR  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASL+P +  F+  GL   S+++R+LAC  V  LLD  +            +YP+L++C
Sbjct  61    YGASLLPSYGAFIRTGLLTDSKDIRKLACKAVLHLLDKVETVV---------LYPVLINC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+GDE+++A  + A+K LA   KG +IIFP           +A++ SSL R+R+L+LI 
Sbjct  112   LIEGDEEISAIILDAVKRLAEIPKGAEIIFP----------KVASQSSSLARIRILSLIA  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLF++S+  A+ + ++NLLS+ E E+ +  D L TLSALE+LYELVE  HS  F
Sbjct  162   KLFTVSSYTATAIRDSNLLSIFEDEIKDRRDMLKTLSALEVLYELVEHPHSNIF  215


 Score =   195 bits (496),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 152/228 (67%), Gaps = 18/228 (8%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N+++AID+       Q+ DE E ALE  G IG   +GA  LL++     RHV+ ++FD Q
Sbjct  255  NLLAAIDKIL-----QNTDEIESALETLGLIGTTTQGAHFLLTNVA---RHVVESSFDRQ  306

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              G++LAALHA G+I G  R      LDG AEE L+RL+Y T++ S KLTPS LLLS+LQ
Sbjct  307  GRGRQLAALHAFGSICGVDRQE----LDGQAEEYLKRLVYTTAANSSKLTPSALLLSILQ  362

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD +IR+AGYRVI+GLV R WCL EI    +I+ +VT+   ET K+GMEAR+ CC A+ +
Sbjct  363  QDPDIRIAGYRVISGLVVREWCLREICLNSDIIRLVTD---ETTKLGMEARYNCCVAINK  419

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            S  SSS L+ + + S L  KL +A+R GPYL  +  EA+PVV+  +RF
Sbjct  420  SL-SSSHLLHEKSLSELIGKLNDAVRRGPYLSER--EARPVVVPAERF  464



>gb|AIU50937.1| ARM repeat superfamily protein, partial [Zea mays]
Length=464

 Score =   197 bits (502),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 153/234 (65%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +L+AA DFA  P   SD + ++FL+R PLP ++ ALQ++ D PG+ + + +CLDK+F ++
Sbjct  1     MLRAAADFASYPGLHSDDTVRQFLERCPLPKLLGALQSEEDVPGMVETVTECLDKIFSSR  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASL+P++  F+  GL   S+ +R+LAC  V  LLD  +            +YPLL+ C
Sbjct  61    YGASLLPNYGAFIQAGLLTDSKQIRKLACKAVLHLLDKVETVV---------LYPLLIKC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+GDE+++A  +  +K LA   KG ++IFP           +AA+ SSL R+R+L+LI 
Sbjct  112   LIEGDEEISAIILDTVKRLAQIPKGAEVIFP----------KVAAQSSSLARIRILSLIA  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLF++S+  A+ + ++NLLS+ E+E+ +  D L TLSALE+LYELVE  HS  F
Sbjct  162   KLFTVSSYTATAIRDSNLLSIFEEEIKDRRDMLKTLSALEVLYELVEHPHSNIF  215


 Score =   192 bits (488),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 150/228 (66%), Gaps = 18/228 (8%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AI R       ++ DE E ALE  G IG   +GA  LL++     RHV+ ++FD Q
Sbjct  255  NLLIAIGRIL-----KNTDEIESALETLGLIGTTSQGAHFLLTNVA---RHVVESSFDRQ  306

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              G++LAALHA GNI G  R      LD +AEE+L+RL+Y T++ SPKLTPS LLLSVLQ
Sbjct  307  GRGRQLAALHAFGNICGVGRQE----LDSEAEENLKRLVYTTAANSPKLTPSALLLSVLQ  362

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD ++R+AGYRVITGLV R WCL E+    EI+  VT+   ET K+GME R+ CC A+ +
Sbjct  363  QDPDVRIAGYRVITGLVIREWCLREVCLNSEIIRFVTD---ETTKLGMETRYGCCVAINK  419

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +  SSS L+ + + S L  KL +A++ GPYL  +  EA+PVV T +RF
Sbjct  420  AL-SSSHLLHEASLSELVGKLNDAVKRGPYLSDR--EARPVVDTAERF  464



>gb|AIU50928.1| ARM repeat superfamily protein, partial [Sorghum bicolor]
Length=464

 Score =   195 bits (495),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 153/234 (65%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +L+AA DFA  P   SD + ++FL+R PLP ++ ALQ+++D PG+ + + +CLDK+F ++
Sbjct  1     MLRAAADFASYPGLHSDDTVRQFLERCPLPKLLGALQSEADVPGMVETVTECLDKIFSSR  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASL+P +  F+  GL   S+ +R+LAC  V  LLD  +            ++PL+++C
Sbjct  61    YGASLLPSYGAFIQAGLLTDSKQIRKLACKAVLHLLDKVETVV---------LFPLMINC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+GDE+++A  +  +K LA   KG ++IFP           +AA+ SSL R+R+L+LI 
Sbjct  112   LIEGDEEISAIILDTVKRLAQIPKGAEVIFP----------KVAAQSSSLPRIRILSLIA  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLF++S+  AS + + NLLS+ E+E+ +  D L TLSALE+LYELVE  HS  F
Sbjct  162   KLFTVSSYTASAIRDTNLLSIFEEEIKDTRDMLKTLSALEVLYELVEHPHSNIF  215


 Score =   193 bits (490),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 151/228 (66%), Gaps = 18/228 (8%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AID+       Q+ DE E ALE  G IG   +GA  LL++     RHV+ ++FD Q
Sbjct  255  NLLVAIDKIL-----QNTDEIESALETLGLIGTTSQGAHFLLTNVA---RHVVKSSFDRQ  306

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              G++LAALHA G+I G  R      LD +AE +L+RL+Y T++ SPKLTPS  LLS+LQ
Sbjct  307  GRGRQLAALHAFGSICGMDRQE----LDDEAEGNLKRLVYTTAANSPKLTPSAALLSILQ  362

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD +IR+AGYRVI+GLV R WCL E+    EI+  VT+   ET K+GMEAR+ CC A+ +
Sbjct  363  QDPDIRIAGYRVISGLVIREWCLREVCLNSEIIRFVTD---ETTKLGMEARYNCCVAINK  419

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +  SSS L+ + + SGL  KL +A++ GPYL  +  EA+PVV T +RF
Sbjct  420  AL-SSSHLLHEASLSGLIGKLNDAVKRGPYLSER--EARPVVDTAERF  464



>gb|AIU50896.1| ARM repeat superfamily protein, partial [Brachypodium distachyon]
Length=464

 Score =   195 bits (495),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 154/234 (66%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL+AA DFA  P    D + ++FL++FPLP ++  LQ+++D PG+++ L  CLDKVF ++
Sbjct  1     LLRAAADFASYPGVHCDDTVRQFLEQFPLPKLLGVLQSQADVPGVDETLAACLDKVFSSR  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASL+P++  F+  GL   S+ +R+LAC  V +LLD  D            +YPLL++C
Sbjct  61    YGASLLPNYGEFIQAGLLTNSKIIRQLACKAVLNLLDKLDTFV---------LYPLLINC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+GDE+V+A  +  +K LA   KG DIIFP           +AA+ SS+ R+R+L+LI 
Sbjct  112   LIEGDEEVSAIVLDVLKRLAEIPKGTDIIFP----------KVAAQSSSMARIRILSLIA  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLF++S++ A+ + ++NLLSL E E+ +  D L TLSALE+LYEL E  +S  F
Sbjct  162   KLFAVSSSTATAIRDSNLLSLFEDEIKDRKDMLKTLSALEVLYELAEHPNSNIF  215


 Score =   193 bits (490),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 150/228 (66%), Gaps = 18/228 (8%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AID+       Q+ DE E ALEA G IG   +GA  L ++     +HV+  +F+ Q
Sbjct  255  NLLLAIDKIL-----QNTDEIESALEALGLIGATTQGACFLFTNVA---KHVVQLSFNRQ  306

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              GK+LAALHA G+I G  R      L   AEE L+RL+Y  +S SPKLTPS LLLSVLQ
Sbjct  307  GRGKQLAALHAFGSICGVDRQE----LGDQAEERLKRLVYTVASDSPKLTPSALLLSVLQ  362

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD +IR+AGYRVI+ LV R WCL E+ S+ EI+ +VT+   ET K+GMEAR+ CC A+ +
Sbjct  363  QDPDIRIAGYRVISRLVVREWCLREVCSKSEIIRVVTD---ETTKLGMEARYNCCVAINK  419

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +  SSS L+++ + S L  KL +A+R GPYL  +  EAQPVV T +RF
Sbjct  420  AL-SSSHLLNESSLSELIGKLNDAVRRGPYLSDR--EAQPVVDTAERF  464



>gb|AIU50922.1| ARM repeat superfamily protein, partial [Panicum virgatum]
Length=464

 Score =   193 bits (490),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 152/234 (65%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +LQAA DFA  P   SD + ++FL+R PLP ++ ALQ++ D PG+ + + +CLDKVF ++
Sbjct  1     MLQAAGDFASYPGLHSDDAVRQFLERCPLPKLLGALQSEVDVPGMVETVTECLDKVFCSR  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASL+P +  F+  GL   S+ +R+LAC  V +LLD  +            +YP+L++C
Sbjct  61    YGASLLPGYGAFIQAGLLTDSKGIRKLACKAVLNLLDKVETVV---------LYPVLINC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+GDE+++   + A+K LA   KG +IIFP           +A+  SSL R+R+L+LI 
Sbjct  112   LIEGDEEISTIILDAVKRLAEIPKGAEIIFPR----------VASHSSSLARIRILSLIA  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLF++S+  A+ + ++NLLS+ E E+ +  D L TLSALE+LYELVE  HS  F
Sbjct  162   KLFTVSSYTATAIRDSNLLSIFEDEIKDRRDMLKTLSALEVLYELVEHPHSNIF  215


 Score =   192 bits (488),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 150/228 (66%), Gaps = 18/228 (8%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N+++AID+       Q+ DE E ALE  G IG   +GA  LL++     RHV+  +FD Q
Sbjct  255  NLLAAIDKIL-----QNTDEIESALETLGLIGTTTQGAHFLLTNVA---RHVVETSFDRQ  306

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              G++LAALHA G+I G  R      LDG AEE L+ L+Y T++ S KLTPS LLLS+LQ
Sbjct  307  GRGRQLAALHAFGSICGVDRQE----LDGQAEEYLKPLVYTTAANSSKLTPSALLLSILQ  362

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD +IR+AGYRVI+GLV R WCL E+    EI+ +VT+   ET K+GMEAR+ CC A+ +
Sbjct  363  QDPDIRIAGYRVISGLVVREWCLREVCLNSEIIRLVTD---ETTKLGMEARYNCCVAINK  419

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            S  SSS L+ + + S L  KL +A+R GPYL  +  EA+PVV+  +RF
Sbjct  420  SL-SSSHLLHEKSLSELIGKLNDAVRRGPYLSER--EARPVVVPAERF  464



>gb|KCW67106.1| hypothetical protein EUGRSUZ_F008902, partial [Eucalyptus grandis]
Length=301

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/251 (60%), Positives = 198/251 (79%), Gaps = 3/251 (1%)
 Frame = -2

Query  1653  KTAMEEEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGL  1477
             +  MEEEY + D ++LL+AA+DFA  P  Q+D + +E LDRFPLP +I+ALQ ++D PGL
Sbjct  4     RAPMEEEYLMEDTSRLLEAASDFALYPGVQNDAAVKELLDRFPLPVIISALQTRADVPGL  63

Query  1476  EDALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETT--  1303
             E  L +CL++VF+TKYGASLIPHFMPFV VGL A SQ VR LAC TVS LL+N+DE +  
Sbjct  64    ESTLVNCLERVFKTKYGASLIPHFMPFVQVGLQAASQEVRCLACKTVSCLLENSDEKSLS  123

Query  1302  AVYLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDL  1123
             AV +++   +YPLLL CL++G+E+VAAA++ AIK LA   +G +++FPAS SE THL +L
Sbjct  124   AVKIVIDYNIYPLLLDCLVNGNEEVAAASMDAIKTLACLQRGTNVVFPASDSEVTHLRNL  183

Query  1122  AAKCSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLY  943
             AA+CSSLGRV VLALIVKLF +S++VAS +Y++NLLSL E E+ ++ DTLVTLS LELLY
Sbjct  184   AAQCSSLGRVWVLALIVKLFPVSSSVASIIYSSNLLSLFEAEISDSQDTLVTLSVLELLY  243

Query  942   ELVEAQHSMEF  910
             E+VE +H+ E 
Sbjct  244   EMVEIRHATEI  254



>gb|KCW67407.1| hypothetical protein EUGRSUZ_F01169 [Eucalyptus grandis]
Length=433

 Score =   301 bits (771),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 203/248 (82%), Gaps = 3/248 (1%)
 Frame = -2

Query  1644  MEEEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDA  1468
             MEEEY + D ++LL+AA+DFA  P  Q+D +A+EFLDRFPLP +I+ALQA++D PGLE  
Sbjct  7     MEEEYFMEDTSRLLEAASDFALYPGVQNDAAAKEFLDRFPLPVIISALQARADVPGLEST  66

Query  1467  LCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETT--AVY  1294
             L +CL++VF+TKYGASLIPHFMPFV VGL A SQ VR LAC TVS LL+N+DE +  AV 
Sbjct  67    LVNCLERVFKTKYGASLIPHFMPFVQVGLQAASQEVRCLACKTVSCLLENSDEKSLSAVK  126

Query  1293  LILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAK  1114
             +I++  +YPLLL CL++G+EQVAAA++ AIK LA   +G +I+FPAS SE THL +LAA+
Sbjct  127   IIIEYNIYPLLLDCLVNGNEQVAAASMDAIKTLACLQRGTNIVFPASDSEVTHLRNLAAQ  186

Query  1113  CSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELV  934
             CSSLGRVRVLALIVKLFS+S++VAS +Y++NLLSL E E+ N+ DTLVTLS LELLYE+V
Sbjct  187   CSSLGRVRVLALIVKLFSVSSSVASIIYSSNLLSLFEAEISNSQDTLVTLSVLELLYEMV  246

Query  933   EAQHSMEF  910
             E +H+ E 
Sbjct  247   EIRHATEI  254


 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            R V+SAID R +   + D DE E +LEA GQIGL  +GA  LLSS+    RHV+ AAFD 
Sbjct  304  RVVVSAIDGRLSS-SALDTDECEASLEALGQIGLSTQGAELLLSSTYPVARHVVYAAFDR  362

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  GK+LAALHALGN+ GE RS N V+L+G AEE+LR LIY+ +S+SPKLTPSGL LSVL
Sbjct  363  QGRGKQLAALHALGNLAGEARSDNSVILNGSAEETLRLLIYEAASRSPKLTPSGLFLSVL  422

Query  500  QQDSEIRLA  474
            QQ++E RLA
Sbjct  423  QQEAETRLA  431



>gb|AIU50921.1| ARM repeat superfamily protein, partial [Prunus persica]
Length=354

 Score =   255 bits (651),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 168/234 (72%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LLQAA+DFA  P  Q+D SA++FLDRFPLP ++NALQ K+D PGLE  L   L++VF+TK
Sbjct  1     LLQAASDFANYPGLQNDASAKDFLDRFPLPVILNALQTKADVPGLESTLIAALERVFQTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIPH+MPF+ VGL A S  V+ LAC TV+ LL+N      V LI+   +YPLLL C
Sbjct  61    YGASLIPHYMPFIQVGLTAESHEVKSLACKTVTYLLEN------VRLIV---IYPLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+G+E+VA  +  AI  +A    G+D++FPA          LAA+CSSLGRVRVLALIV
Sbjct  112   LINGNERVATLSTDAIGKMASSPAGMDVVFPA----------LAAQCSSLGRVRVLALIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS+ VAS ++ +NLL L E E+ N NDTL TLS LE++YEL E +H  EF
Sbjct  162   KLFSISSYVASAIHRSNLLRLFEAEINNTNDTLATLSVLEIMYELSEVEHGREF  215


 Score =   111 bits (278),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 79/113 (70%), Gaps = 12/113 (11%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + V+SAIDR       QDADE E ALEA G+IG   +GA  LLS +    RHVI AAFD 
Sbjct  254  KTVVSAIDRIL-----QDADECESALEALGEIGSSIQGAQFLLSPAA---RHVIYAAFDR  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPS  522
            Q  GK+LAALHALGNI GETRS     L  DAEESLRRLIY+T+SKS KLTPS
Sbjct  306  QGRGKQLAALHALGNIFGETRSE----LTSDAEESLRRLIYETASKSSKLTPS  354



>ref|XP_006370213.1| hypothetical protein POPTR_0001s40690g [Populus trichocarpa]
 gb|ABK94767.1| unknown [Populus trichocarpa]
 gb|ERP66782.1| hypothetical protein POPTR_0001s40690g [Populus trichocarpa]
Length=528

 Score =   303 bits (776),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 197/245 (80%), Gaps = 2/245 (1%)
 Frame = -2

Query  1638  EEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EE+S+ D +QLLQ+A++FA  P   +DV+A+EFLDRFPLP +INALQ KS+ PGLE  L 
Sbjct  4     EEFSMEDPSQLLQSASEFANYPGVPNDVAAKEFLDRFPLPVIINALQTKSEVPGLEATLV  63

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDET-TAVYLIL  1285
              CL+++F+TK GASLIPH+MPFV VGL A SQ VR LAC TVS LL N DET +A  LI+
Sbjct  64    ACLERIFKTKCGASLIPHYMPFVQVGLTADSQLVRCLACKTVSCLLKNIDETISAAQLII  123

Query  1284  QNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSS  1105
              NGVYPLLL CLI+G+EQVA A++ AI+ LAG  KG++I+FPA++S+  HLG+L+A+CSS
Sbjct  124   DNGVYPLLLDCLINGNEQVATASMEAIEKLAGSQKGMEIVFPANNSDDMHLGNLSARCSS  183

Query  1104  LGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQ  925
             LGRVRVL+LIVKLFS+S  VAS VYN+NLLSLLE ++ + +DTLV+LS  EL YEL E +
Sbjct  184   LGRVRVLSLIVKLFSVSRDVASAVYNSNLLSLLEAKIRDTDDTLVSLSVFELFYELAEVK  243

Query  924   HSMEF  910
             H+ EF
Sbjct  244   HATEF  248


 Score =   278 bits (710),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 179/233 (77%), Gaps = 2/233 (1%)
 Frame = -3

Query  869  LGYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAA  690
            LG + +ISAID R   L SQD +E E ALEA GQIG   +GA  LL+ SP   RHVI AA
Sbjct  297  LGVKAIISAIDGRLR-LESQDLNECESALEALGQIGSSNQGATLLLTISPPAARHVIDAA  355

Query  689  FDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
            FD    GK+LA+LH+L NI GETRS ++++L+GDAEESLR LIY+ +SKS KLTPSGL L
Sbjct  356  FDKHARGKQLASLHSLANISGETRSDSNIILNGDAEESLRLLIYEAASKSSKLTPSGLFL  415

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            SVLQQDS++RLA YRV+TGLVARPWCL+EI S+QEI++IVT   TET KIGMEAR+KCC 
Sbjct  416  SVLQQDSQVRLAAYRVLTGLVARPWCLMEICSKQEIINIVTGPNTETTKIGMEARYKCCV  475

Query  329  AVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRK-HAEAQPVVMTEQRF  174
            A++ +F SSSKL  +PA + +A KL+EA+  GPYL  K + EAQP+V+T  RF
Sbjct  476  AIHRAFMSSSKLTGNPALAPIAAKLQEAVSRGPYLADKIYREAQPMVVTADRF  528



>gb|KCW67408.1| hypothetical protein EUGRSUZ_F01169 [Eucalyptus grandis]
Length=470

 Score =   300 bits (768),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 203/248 (82%), Gaps = 3/248 (1%)
 Frame = -2

Query  1644  MEEEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDA  1468
             MEEEY + D ++LL+AA+DFA  P  Q+D +A+EFLDRFPLP +I+ALQA++D PGLE  
Sbjct  7     MEEEYFMEDTSRLLEAASDFALYPGVQNDAAAKEFLDRFPLPVIISALQARADVPGLEST  66

Query  1467  LCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETT--AVY  1294
             L +CL++VF+TKYGASLIPHFMPFV VGL A SQ VR LAC TVS LL+N+DE +  AV 
Sbjct  67    LVNCLERVFKTKYGASLIPHFMPFVQVGLQAASQEVRCLACKTVSCLLENSDEKSLSAVK  126

Query  1293  LILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAK  1114
             +I++  +YPLLL CL++G+EQVAAA++ AIK LA   +G +I+FPAS SE THL +LAA+
Sbjct  127   IIIEYNIYPLLLDCLVNGNEQVAAASMDAIKTLACLQRGTNIVFPASDSEVTHLRNLAAQ  186

Query  1113  CSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELV  934
             CSSLGRVRVLALIVKLFS+S++VAS +Y++NLLSL E E+ N+ DTLVTLS LELLYE+V
Sbjct  187   CSSLGRVRVLALIVKLFSVSSSVASIIYSSNLLSLFEAEISNSQDTLVTLSVLELLYEMV  246

Query  933   EAQHSMEF  910
             E +H+ E 
Sbjct  247   EIRHATEI  254


 Score =   142 bits (359),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            R V+SAID R +   + D DE E +LEA GQIGL  +GA  LLSS+    RHV+ AAFD 
Sbjct  304  RVVVSAIDGRLSS-SALDTDECEASLEALGQIGLSTQGAELLLSSTYPVARHVVYAAFDR  362

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  GK+LAALHALGN+ GE RS N V+L+G AEE+LR LIY+ +S+SPKLTPSGL LSVL
Sbjct  363  QGRGKQLAALHALGNLAGEARSDNSVILNGSAEETLRLLIYEAASRSPKLTPSGLFLSVL  422

Query  500  QQDSEIRLA  474
            QQ++E RLA
Sbjct  423  QQEAETRLA  431



>ref|XP_011043841.1| PREDICTED: uncharacterized protein LOC105139178 [Populus euphratica]
Length=528

 Score =   301 bits (771),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 197/245 (80%), Gaps = 2/245 (1%)
 Frame = -2

Query  1638  EEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EE+S+ D +QLLQ+A+DFA  P   +DV+A+EFLDRFPLP +INALQ KS+ PGLE  L 
Sbjct  4     EEFSMEDPSQLLQSASDFANYPGVPNDVAAKEFLDRFPLPFIINALQTKSEVPGLEATLV  63

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDET-TAVYLIL  1285
              CL+++F+TK GASLIP +MPFV VGL A SQ VR LAC TVS LL+N DET +A  LI+
Sbjct  64    ACLERIFKTKCGASLIPLYMPFVQVGLTADSQLVRCLACKTVSCLLENIDETISAAQLII  123

Query  1284  QNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSS  1105
              NGVYPLLL CLI+G+EQVAAA++ AI  LAG  KG++I+FPA++S+  HLG+L+A+CSS
Sbjct  124   DNGVYPLLLDCLINGNEQVAAASMEAIAKLAGSQKGMEIVFPANNSDDMHLGNLSARCSS  183

Query  1104  LGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQ  925
             LGRVRVL+LIVKLFS+S  VAS VYN+NLLSLLE ++ N +DTLV+LS  EL YEL E +
Sbjct  184   LGRVRVLSLIVKLFSVSRDVASAVYNSNLLSLLEAKIRNTDDTLVSLSVFELFYELAEVK  243

Query  924   HSMEF  910
             H+ EF
Sbjct  244   HATEF  248


 Score =   276 bits (705),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 177/233 (76%), Gaps = 2/233 (1%)
 Frame = -3

Query  869  LGYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAA  690
            LG + +ISAID R   L SQD +E E ALEA GQIG   +GA  LL+ SP   RHVI AA
Sbjct  297  LGVKTIISAIDGRLQ-LESQDWNECESALEALGQIGSSNQGATLLLTISPPAARHVIDAA  355

Query  689  FDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
            FD    GK+LA+LH+L NI GETRS ++++L+GDAEESLR LIY+ +SKS KLTPSGL L
Sbjct  356  FDKHARGKQLASLHSLANISGETRSDSNIILNGDAEESLRLLIYEAASKSSKLTPSGLFL  415

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            SVLQQDSE+RLA YRV+TGLVARPWCL+EI S+QEI+ IVT   TET KIGMEAR+ CC 
Sbjct  416  SVLQQDSEVRLAAYRVLTGLVARPWCLMEICSKQEIIKIVTGPNTETTKIGMEARYNCCV  475

Query  329  AVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRK-HAEAQPVVMTEQRF  174
            A++ +F SSSKL  +PA + +A KL+EA+  GPYL  K + EAQP+V+T  RF
Sbjct  476  AIHRAFMSSSKLTGNPALAPIAAKLQEAVIRGPYLADKIYREAQPMVVTADRF  528



>ref|XP_010060623.1| PREDICTED: uncharacterized protein LOC104448485 [Eucalyptus grandis]
 gb|KCW67406.1| hypothetical protein EUGRSUZ_F01169 [Eucalyptus grandis]
Length=531

 Score =   300 bits (769),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 203/248 (82%), Gaps = 3/248 (1%)
 Frame = -2

Query  1644  MEEEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDA  1468
             MEEEY + D ++LL+AA+DFA  P  Q+D +A+EFLDRFPLP +I+ALQA++D PGLE  
Sbjct  7     MEEEYFMEDTSRLLEAASDFALYPGVQNDAAAKEFLDRFPLPVIISALQARADVPGLEST  66

Query  1467  LCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETT--AVY  1294
             L +CL++VF+TKYGASLIPHFMPFV VGL A SQ VR LAC TVS LL+N+DE +  AV 
Sbjct  67    LVNCLERVFKTKYGASLIPHFMPFVQVGLQAASQEVRCLACKTVSCLLENSDEKSLSAVK  126

Query  1293  LILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAK  1114
             +I++  +YPLLL CL++G+EQVAAA++ AIK LA   +G +I+FPAS SE THL +LAA+
Sbjct  127   IIIEYNIYPLLLDCLVNGNEQVAAASMDAIKTLACLQRGTNIVFPASDSEVTHLRNLAAQ  186

Query  1113  CSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELV  934
             CSSLGRVRVLALIVKLFS+S++VAS +Y++NLLSL E E+ N+ DTLVTLS LELLYE+V
Sbjct  187   CSSLGRVRVLALIVKLFSVSSSVASIIYSSNLLSLFEAEISNSQDTLVTLSVLELLYEMV  246

Query  933   EAQHSMEF  910
             E +H+ E 
Sbjct  247   EIRHATEI  254


 Score =   289 bits (740),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 183/229 (80%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            R V+SAID R +   + D DE E +LEA GQIGL  +GA  LLSS+    RHV+ AAFD 
Sbjct  304  RVVVSAIDGRLSS-SALDTDECEASLEALGQIGLSTQGAELLLSSTYPVARHVVYAAFDR  362

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  GK+LAALHALGN+ GE RS N V+L+G AEE+LR LIY+ +S+SPKLTPSGL LSVL
Sbjct  363  QGRGKQLAALHALGNLAGEARSDNSVILNGSAEETLRLLIYEAASRSPKLTPSGLFLSVL  422

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ++E RLAGYR IT LVARPWCL+EI S++EIVDIVT+   ET KIGMEAR+ CC+A++
Sbjct  423  QQEAETRLAGYRPITALVARPWCLMEICSKEEIVDIVTDPSIETTKIGMEARYGCCQAIH  482

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++FT S+KLMSDP+ +G+A+KL++A+R GP+L R+ +EAQPVVMT +RF
Sbjct  483  KAFTRSTKLMSDPSLAGIASKLQDAVRRGPFLARRRSEAQPVVMTAERF  531



>ref|XP_004146048.1| PREDICTED: uncharacterized protein LOC101213054 [Cucumis sativus]
 ref|XP_004162929.1| PREDICTED: uncharacterized protein LOC101228134 [Cucumis sativus]
 gb|KGN55104.1| hypothetical protein Csa_4G629990 [Cucumis sativus]
Length=525

 Score =   299 bits (766),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 198/246 (80%), Gaps = 3/246 (1%)
 Frame = -2

Query  1638  EEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EE+SV D  +LLQAA +FA  P  ++D S +EFLDRFPLPA+INALQ K+++PGLED L 
Sbjct  2     EEFSVNDPTRLLQAAANFANYPGVRTDASVKEFLDRFPLPAIINALQTKAEFPGLEDTLV  61

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDET--TAVYLI  1288
              CLD++F+TKYGASLIPH+MPFV VGL A SQ VR LAC TV+ LL  +DET  + + LI
Sbjct  62    ACLDRIFKTKYGASLIPHYMPFVQVGLQADSQTVRTLACKTVTRLLQESDETALSPIQLI  121

Query  1287  LQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCS  1108
             +  G+YPLLL CL++G+EQVA +++ +IK LA F +G++II P++ +E THLG +A+ CS
Sbjct  122   IDYGIYPLLLDCLLNGNEQVANSSMDSIKTLAAFPQGMEIIIPSNKTEATHLGTVASTCS  181

Query  1107  SLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEA  928
             SLGRVRV+AL+VKLFS+S++VAS VYNANLLSLLE E+ N+ DTLVTLS LELLYELVE 
Sbjct  182   SLGRVRVMALVVKLFSVSSSVASAVYNANLLSLLESEINNSKDTLVTLSVLELLYELVEI  241

Query  927   QHSMEF  910
             +H  +F
Sbjct  242   EHGTKF  247


 Score =   273 bits (697),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 178/232 (77%), Gaps = 6/232 (3%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGS---QDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAA  690
            RN+ISA+D     LGS   +D +  E A+EA GQIG    GA  LLSS P  V+HVI AA
Sbjct  297  RNLISAVD---GILGSSEGEDVNVSEAAIEALGQIGSSTWGATLLLSSFPTCVKHVIYAA  353

Query  689  FDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
            FD   HGK+LAA+HALGNI GE RS ND++L+ +AEE+LR LIY  +S+S K+TPSGL L
Sbjct  354  FDRHEHGKQLAAMHALGNIFGEGRSENDIMLNDNAEENLRDLIYQIASRSSKMTPSGLFL  413

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            +VLQQDSEIRLA YR+ITGLVARPWCL EI S+Q+IV+IV +  +ET KIGMEAR+ CC 
Sbjct  414  AVLQQDSEIRLASYRMITGLVARPWCLTEICSKQDIVNIVGDASSETTKIGMEARYNCCL  473

Query  329  AVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            A++++F SS +L  DPA +G+A+KL+EA+R+GPYL R++ E QP +MT +RF
Sbjct  474  AIHKAFMSSPRLTGDPALAGIASKLQEAVRNGPYLNRRNVETQPAIMTAERF  525



>ref|XP_010644176.1| PREDICTED: uncharacterized protein LOC100260719 isoform X2 [Vitis 
vinifera]
Length=504

 Score =   298 bits (764),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VIS ID R   L SQDADE E ALE  GQIG    GA  LL SSP   RHVI AAFD 
Sbjct  276  KTVISLIDGRLRSLESQDADECESALETLGQIGSSIHGAELLLLSSPPAARHVIDAAFDR  335

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  G+ LAALHALGNI GETRS N ++L+ DAEESL+ LIY+++SKSPKLTPSGL LSVL
Sbjct  336  QGRGRHLAALHALGNISGETRSENKIMLNNDAEESLQHLIYESASKSPKLTPSGLFLSVL  395

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQD+E+RLAGYRVITGLVARPWCL+EI S+QEIV+I+T  ++ET KIGMEA++ CC+A++
Sbjct  396  QQDAEVRLAGYRVITGLVARPWCLMEICSKQEIVNIITGAHSETTKIGMEAKYNCCKAIH  455

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
              F SSSKL SDPA +G+A KL+EA+R GPYL RK  EAQPVVMT  RF
Sbjct  456  WVFMSSSKLTSDPALTGIAEKLQEAVRRGPYLARKLQEAQPVVMTADRF  504


 Score =   253 bits (647),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 137/246 (56%), Positives = 177/246 (72%), Gaps = 24/246 (10%)
 Frame = -2

Query  1638  EEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EEY++D    LLQAA+DF + P   SD SA+ FL RFPLP +IN LQ K+D PG+E  L 
Sbjct  2     EEYTLDDPTLLLQAASDFGHHPGVHSDASAKAFLHRFPLPVIINVLQTKADVPGVESTLV  61

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETT--AVYLI  1288
              CL+++F TK+GASLIP +M                     VS LL+N  E T  A  LI
Sbjct  62    ACLERIFCTKHGASLIPQYM---------------------VSCLLENFGENTVPAAQLI  100

Query  1287  LQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCS  1108
             +++ +YPLLL CLI+G+EQVA A++ AIK+LAG  +G++IIFPA+ +E THL +LAA+CS
Sbjct  101   VEHDIYPLLLDCLINGNEQVATASMDAIKSLAGSFEGMEIIFPANDNEATHLRNLAARCS  160

Query  1107  SLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEA  928
             SLGRVRVLAL+VKLFS+S++VAS ++N++LL+LLE EV N +DTLVTLS LELLYEL E 
Sbjct  161   SLGRVRVLALVVKLFSVSSSVASLIHNSDLLNLLEAEVCNTDDTLVTLSVLELLYELAEI  220

Query  927   QHSMEF  910
             QH  EF
Sbjct  221   QHGTEF  226



>ref|XP_008463698.1| PREDICTED: uncharacterized protein LOC103501781 [Cucumis melo]
Length=525

 Score =   299 bits (765),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 199/246 (81%), Gaps = 3/246 (1%)
 Frame = -2

Query  1638  EEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             E++SV D  QLLQAA +FA  P  ++D S +EFLDRFPLPA+INALQ K+++PG+ED L 
Sbjct  2     EDFSVNDPTQLLQAAANFANYPGVRTDASVKEFLDRFPLPAIINALQTKAEFPGVEDTLV  61

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDET--TAVYLI  1288
              CLD++F+TKYGASLIPH+MPFV VGL A SQ VR LAC TV+ LL  +DET  +A+ LI
Sbjct  62    ACLDRIFKTKYGASLIPHYMPFVQVGLQADSQTVRTLACKTVTRLLQESDETVPSAIQLI  121

Query  1287  LQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCS  1108
             +  G+YPLLL CL++G+EQVA +++ +IK LA F +G++II P++ +E THLG +A+ CS
Sbjct  122   IDYGIYPLLLDCLLNGNEQVANSSMDSIKTLAAFPQGMEIIIPSNKTEATHLGIVASTCS  181

Query  1107  SLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEA  928
             SLGRVRV+AL+VKLFS+S++VAS VYNANLLSLLE E+ N+ DTLVTLS LELLYELVE 
Sbjct  182   SLGRVRVMALVVKLFSVSSSVASAVYNANLLSLLESEINNSKDTLVTLSVLELLYELVEI  241

Query  927   QHSMEF  910
             +H  +F
Sbjct  242   EHGTKF  247


 Score =   270 bits (691),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 177/232 (76%), Gaps = 6/232 (3%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGS---QDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAA  690
            RN+ISA+D     LGS   +D +  E A+EA GQIG    GA  LLSS P  V+H I  A
Sbjct  297  RNLISAVD---GILGSSEGEDVNVSEAAIEALGQIGSSTWGATLLLSSFPTCVKHAIYTA  353

Query  689  FDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
            FD   HGK+LAA+HALGNI GE+RS ND++L+ +AEE+LR LIY  +S+S K+TPSGL L
Sbjct  354  FDRHEHGKQLAAMHALGNIFGESRSENDIVLNDNAEENLRDLIYQIASRSSKMTPSGLFL  413

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            +VLQQDSEIRLA YR+ITGLVARPWCL EI S+QEIV+IV +  +ET KIGMEAR+ CC 
Sbjct  414  AVLQQDSEIRLASYRMITGLVARPWCLTEICSKQEIVNIVCDASSETTKIGMEARYNCCL  473

Query  329  AVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +++++F SS +L  DPA +G+A+KL+EA+R+GPYL R++ E QP +MT +RF
Sbjct  474  SIHKAFMSSPRLTGDPALAGIASKLQEAVRNGPYLNRRNVETQPAIMTAERF  525



>ref|XP_010644175.1| PREDICTED: uncharacterized protein LOC100260719 isoform X1 [Vitis 
vinifera]
 emb|CBI20260.3| unnamed protein product [Vitis vinifera]
Length=525

 Score =   298 bits (764),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VIS ID R   L SQDADE E ALE  GQIG    GA  LL SSP   RHVI AAFD 
Sbjct  297  KTVISLIDGRLRSLESQDADECESALETLGQIGSSIHGAELLLLSSPPAARHVIDAAFDR  356

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  G+ LAALHALGNI GETRS N ++L+ DAEESL+ LIY+++SKSPKLTPSGL LSVL
Sbjct  357  QGRGRHLAALHALGNISGETRSENKIMLNNDAEESLQHLIYESASKSPKLTPSGLFLSVL  416

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQD+E+RLAGYRVITGLVARPWCL+EI S+QEIV+I+T  ++ET KIGMEA++ CC+A++
Sbjct  417  QQDAEVRLAGYRVITGLVARPWCLMEICSKQEIVNIITGAHSETTKIGMEAKYNCCKAIH  476

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
              F SSSKL SDPA +G+A KL+EA+R GPYL RK  EAQPVVMT  RF
Sbjct  477  WVFMSSSKLTSDPALTGIAEKLQEAVRRGPYLARKLQEAQPVVMTADRF  525


 Score =   291 bits (745),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 192/246 (78%), Gaps = 3/246 (1%)
 Frame = -2

Query  1638  EEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EEY++D    LLQAA+DF + P   SD SA+ FL RFPLP +IN LQ K+D PG+E  L 
Sbjct  2     EEYTLDDPTLLLQAASDFGHHPGVHSDASAKAFLHRFPLPVIINVLQTKADVPGVESTLV  61

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETT--AVYLI  1288
              CL+++F TK+GASLIP +MPFV VGL A SQ VR LAC TVS LL+N  E T  A  LI
Sbjct  62    ACLERIFCTKHGASLIPQYMPFVQVGLRADSQVVRCLACKTVSCLLENFGENTVPAAQLI  121

Query  1287  LQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCS  1108
             +++ +YPLLL CLI+G+EQVA A++ AIK+LAG  +G++IIFPA+ +E THL +LAA+CS
Sbjct  122   VEHDIYPLLLDCLINGNEQVATASMDAIKSLAGSFEGMEIIFPANDNEATHLRNLAARCS  181

Query  1107  SLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEA  928
             SLGRVRVLAL+VKLFS+S++VAS ++N++LL+LLE EV N +DTLVTLS LELLYEL E 
Sbjct  182   SLGRVRVLALVVKLFSVSSSVASLIHNSDLLNLLEAEVCNTDDTLVTLSVLELLYELAEI  241

Query  927   QHSMEF  910
             QH  EF
Sbjct  242   QHGTEF  247



>ref|XP_006451778.1| hypothetical protein CICLE_v10007885mg [Citrus clementina]
 gb|ESR65018.1| hypothetical protein CICLE_v10007885mg [Citrus clementina]
Length=446

 Score =   295 bits (756),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 151/250 (60%), Positives = 195/250 (78%), Gaps = 3/250 (1%)
 Frame = -2

Query  1650  TAMEEEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLE  1474
             TAM++E S+D + QLL +A+DFAY P  Q+D +A++FLDRFPL  ++N LQ K D PGLE
Sbjct  36    TAMDDELSMDDSNQLLDSASDFAYHPGVQNDAAAKKFLDRFPLSVILNTLQTKPDVPGLE  95

Query  1473  DALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTD--ETTA  1300
             D L  CL+++F+TKYGASLIPH+MPFV VGL A S +V+RLAC TV+ LL+++D   + A
Sbjct  96    DTLVVCLERIFKTKYGASLIPHYMPFVQVGLTADSHSVKRLACKTVTCLLEDSDLEASCA  155

Query  1299  VYLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLA  1120
             + L++   +YPLLL CLI+G+E+VA A++ AIK LAGF  G+DIIFPA +   T LG+L 
Sbjct  156   LQLLIDYEIYPLLLDCLINGNEEVATASMDAIKKLAGFPNGIDIIFPADNKAATDLGNLV  215

Query  1119  AKCSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYE  940
             A+CSSLGRVRVL+LIVKLFS+S +VAS ++ ANLL+LLE+ V   NDTL TLS LELLYE
Sbjct  216   AQCSSLGRVRVLSLIVKLFSVSRSVASVIFKANLLTLLEEGVSKKNDTLETLSILELLYE  275

Query  939   LVEAQHSMEF  910
             L E QHS EF
Sbjct  276   LAEIQHSAEF  285


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VISAID R  FL SQD+DE E ALEA GQIG   +GA  LL   P   RHVI AAFD 
Sbjct  335  KTVISAIDGRLGFLQSQDSDECESALEALGQIGSSIQGATLLLLCLPPAARHVIDAAFDR  394

Query  680  QHHGKRLAALH  648
            Q HGK+L + H
Sbjct  395  QGHGKQLVSAH  405



>ref|XP_007211742.1| hypothetical protein PRUPE_ppa006266mg [Prunus persica]
 gb|EMJ12941.1| hypothetical protein PRUPE_ppa006266mg [Prunus persica]
Length=420

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 189/246 (77%), Gaps = 3/246 (1%)
 Frame = -2

Query  1638  EEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EE+SVD   QLLQAA+DFA  P  Q+D SA++FLDRFPLP ++NALQ K+D PGLE  L 
Sbjct  2     EEFSVDDPTQLLQAASDFANYPGLQNDASAKDFLDRFPLPVILNALQTKADVPGLESTLI  61

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDE--TTAVYLI  1288
               L++VF+TKYGASLIPH+MPF+ VGL A S  V+ LAC TV+ LL+N +E   +AV LI
Sbjct  62    AALERVFQTKYGASLIPHYMPFIQVGLTAESHEVKSLACKTVTYLLENLNEGAISAVRLI  121

Query  1287  LQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCS  1108
             +++ +YPLLL CLI+G+E+VA  +  AI  +A    G+D++FPA+++E THLG LAA+CS
Sbjct  122   VEHNIYPLLLDCLINGNERVATLSTDAIGKMASSPAGMDVVFPANTNEATHLGALAAQCS  181

Query  1107  SLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEA  928
             SLGRVRVLALIVKLFSIS+ VAS ++ +NLL L E E+ N NDTL TLS LE++YEL E 
Sbjct  182   SLGRVRVLALIVKLFSISSYVASAIHRSNLLRLFEAEINNTNDTLATLSVLEIMYELSEV  241

Query  927   QHSMEF  910
             +H  EF
Sbjct  242   EHGREF  247


 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = -3

Query  869  LGYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAA  690
            L  + V+SAIDR  +   +QDADE E ALEA G+IG   +GA  LLSSSP   RHVI AA
Sbjct  293  LSVKTVVSAIDRILSSSETQDADECESALEALGEIGSSIQGAQFLLSSSPPAARHVIYAA  352

Query  689  FDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPS  522
            FD Q  GK+LAALHALGNI GETRS N ++L  DAEESLRRLIY+T+SKS KLTPS
Sbjct  353  FDRQGRGKQLAALHALGNIFGETRSENSMILTSDAEESLRRLIYETASKSSKLTPS  408



>ref|XP_006451779.1| hypothetical protein CICLE_v10007885mg [Citrus clementina]
 gb|ESR65019.1| hypothetical protein CICLE_v10007885mg [Citrus clementina]
Length=562

 Score =   295 bits (756),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/250 (60%), Positives = 195/250 (78%), Gaps = 3/250 (1%)
 Frame = -2

Query  1650  TAMEEEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLE  1474
             TAM++E S+D + QLL +A+DFAY P  Q+D +A++FLDRFPL  ++N LQ K D PGLE
Sbjct  36    TAMDDELSMDDSNQLLDSASDFAYHPGVQNDAAAKKFLDRFPLSVILNTLQTKPDVPGLE  95

Query  1473  DALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTD--ETTA  1300
             D L  CL+++F+TKYGASLIPH+MPFV VGL A S +V+RLAC TV+ LL+++D   + A
Sbjct  96    DTLVVCLERIFKTKYGASLIPHYMPFVQVGLTADSHSVKRLACKTVTCLLEDSDLEASCA  155

Query  1299  VYLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLA  1120
             + L++   +YPLLL CLI+G+E+VA A++ AIK LAGF  G+DIIFPA +   T LG+L 
Sbjct  156   LQLLIDYEIYPLLLDCLINGNEEVATASMDAIKKLAGFPNGIDIIFPADNKAATDLGNLV  215

Query  1119  AKCSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYE  940
             A+CSSLGRVRVL+LIVKLFS+S +VAS ++ ANLL+LLE+ V   NDTL TLS LELLYE
Sbjct  216   AQCSSLGRVRVLSLIVKLFSVSRSVASVIFKANLLTLLEEGVSKKNDTLETLSILELLYE  275

Query  939   LVEAQHSMEF  910
             L E QHS EF
Sbjct  276   LAEIQHSAEF  285


 Score =   293 bits (750),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 180/229 (79%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VISAID R  FL SQD+DE E ALEA GQIG   +GA  LL   P   RHVI AAFD 
Sbjct  335  KTVISAIDGRLGFLQSQDSDECESALEALGQIGSSIQGATLLLLCLPPAARHVIDAAFDR  394

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q HGK+LAALH + NI G+TRS + ++L+ DAEESLR LIY+ +S+S KLTPSGL LSVL
Sbjct  395  QGHGKQLAALHGIANIAGKTRSEDKIILNADAEESLRHLIYEVASRSSKLTPSGLFLSVL  454

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ +EIRLAGYR+ITGLVARPWCL+E+ S+QEI++ VT+  TET KIGMEAR+ CC+A+ 
Sbjct  455  QQAAEIRLAGYRMITGLVARPWCLMELCSKQEIINTVTDASTETTKIGMEARYNCCKAIC  514

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++F  SS+L+SDPA +G+  KL+EA+R GPYL RK  EAQPVVMTEQRF
Sbjct  515  KAFV-SSELVSDPAFAGIGEKLDEAVRRGPYLARKSVEAQPVVMTEQRF  562



>ref|XP_006464808.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 5-like 
isoform X2 [Citrus sinensis]
Length=558

 Score =   295 bits (755),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 151/250 (60%), Positives = 194/250 (78%), Gaps = 3/250 (1%)
 Frame = -2

Query  1650  TAMEEEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLE  1474
             TAM++E S+D + QLL +A+DFAY P  Q+D +A+ FLDRFPL  ++N LQ K D PGLE
Sbjct  32    TAMDDELSMDDSNQLLDSASDFAYHPGVQNDAAAKNFLDRFPLSVILNTLQTKPDVPGLE  91

Query  1473  DALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTD--ETTA  1300
             D L  CL+++F+TKYGASLIPH+MPFV VGL A S +V+RLAC TV+ LL+++D   + A
Sbjct  92    DTLVVCLERIFKTKYGASLIPHYMPFVQVGLTADSHSVKRLACKTVTCLLEDSDLEASCA  151

Query  1299  VYLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLA  1120
             + L++   +YPLLL CLI+G+E+VA A++ AIK LAGF  G+DIIFPA +   T LG+L 
Sbjct  152   LQLLIDYEIYPLLLDCLINGNEEVATASMDAIKKLAGFPNGIDIIFPADNKAATDLGNLV  211

Query  1119  AKCSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYE  940
             A+CSSLGRVRVL+LIVKLFS+S +VAS ++ ANLL+LLE+ V   NDTL TLS LELLYE
Sbjct  212   AQCSSLGRVRVLSLIVKLFSVSRSVASVIFKANLLTLLEEGVSKKNDTLETLSILELLYE  271

Query  939   LVEAQHSMEF  910
             L E QHS EF
Sbjct  272   LAEIQHSAEF  281


 Score =   295 bits (754),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 180/229 (79%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VISAID R  FL SQD+DE E ALEA GQIG   +GA  LL   P   RHVI AAFD 
Sbjct  331  KTVISAIDGRLGFLQSQDSDECESALEALGQIGSSIQGATLLLLCLPPAARHVIDAAFDR  390

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q HGK+LAALH L NI G+TRS + ++L+ DAEESLR LIY+ +S+S KLTPSGL LSVL
Sbjct  391  QGHGKQLAALHGLANIAGKTRSEDKIILNADAEESLRHLIYEVASRSSKLTPSGLFLSVL  450

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ +EIRLAGYR+ITGLVARPWCL+E+ S+QEI++ VT+  TET KIGMEAR+ CC+A+ 
Sbjct  451  QQAAEIRLAGYRMITGLVARPWCLMELCSKQEIINTVTDASTETTKIGMEARYNCCKAIC  510

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++F  SS+L+SDPA +G+  KL+EA+R GPYL RK  EAQPVVMTEQRF
Sbjct  511  KAFV-SSELVSDPAFAGIGEKLDEAVRRGPYLARKSVEAQPVVMTEQRF  558



>ref|XP_006464807.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 5-like 
isoform X1 [Citrus sinensis]
Length=562

 Score =   295 bits (754),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 180/229 (79%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VISAID R  FL SQD+DE E ALEA GQIG   +GA  LL   P   RHVI AAFD 
Sbjct  335  KTVISAIDGRLGFLQSQDSDECESALEALGQIGSSIQGATLLLLCLPPAARHVIDAAFDR  394

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q HGK+LAALH L NI G+TRS + ++L+ DAEESLR LIY+ +S+S KLTPSGL LSVL
Sbjct  395  QGHGKQLAALHGLANIAGKTRSEDKIILNADAEESLRHLIYEVASRSSKLTPSGLFLSVL  454

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ +EIRLAGYR+ITGLVARPWCL+E+ S+QEI++ VT+  TET KIGMEAR+ CC+A+ 
Sbjct  455  QQAAEIRLAGYRMITGLVARPWCLMELCSKQEIINTVTDASTETTKIGMEARYNCCKAIC  514

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++F  SS+L+SDPA +G+  KL+EA+R GPYL RK  EAQPVVMTEQRF
Sbjct  515  KAFV-SSELVSDPAFAGIGEKLDEAVRRGPYLARKSVEAQPVVMTEQRF  562


 Score =   291 bits (744),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/254 (60%), Positives = 195/254 (77%), Gaps = 7/254 (3%)
 Frame = -2

Query  1650  TAMEEEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLE  1474
             TAM++E S+D + QLL +A+DFAY P  Q+D +A+ FLDRFPL  ++N LQ K D PGLE
Sbjct  32    TAMDDELSMDDSNQLLDSASDFAYHPGVQNDAAAKNFLDRFPLSVILNTLQTKPDVPGLE  91

Query  1473  DALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSS----LLDNTD--  1312
             D L  CL+++F+TKYGASLIPH+MPFV VGL A S +V+RLAC TVS+    LL+++D  
Sbjct  92    DTLVVCLERIFKTKYGASLIPHYMPFVQVGLTADSHSVKRLACKTVSAYVTCLLEDSDLE  151

Query  1311  ETTAVYLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHL  1132
              + A+ L++   +YPLLL CLI+G+E+VA A++ AIK LAGF  G+DIIFPA +   T L
Sbjct  152   ASCALQLLIDYEIYPLLLDCLINGNEEVATASMDAIKKLAGFPNGIDIIFPADNKAATDL  211

Query  1131  GDLAAKCSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALE  952
             G+L A+CSSLGRVRVL+LIVKLFS+S +VAS ++ ANLL+LLE+ V   NDTL TLS LE
Sbjct  212   GNLVAQCSSLGRVRVLSLIVKLFSVSRSVASVIFKANLLTLLEEGVSKKNDTLETLSILE  271

Query  951   LLYELVEAQHSMEF  910
             LLYEL E QHS EF
Sbjct  272   LLYELAEIQHSAEF  285



>ref|XP_009341341.1| PREDICTED: uncharacterized protein LOC103933377 [Pyrus x bretschneideri]
Length=562

 Score =   294 bits (753),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 183/232 (79%), Gaps = 0/232 (0%)
 Frame = -3

Query  869  LGYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAA  690
            L  + V+SAIDR  +   +Q+ DE E ALEA GQIG   +GA  LLSSSP   RHVI AA
Sbjct  331  LNLKTVLSAIDRILSSSETQEIDECESALEALGQIGSSTQGAQRLLSSSPPVARHVIYAA  390

Query  689  FDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
            FD   HGK+LAALHALGNI GETRS N ++L  DAEESLRRLIY+T+SKS KLTPSGL L
Sbjct  391  FDRHGHGKQLAALHALGNISGETRSANSMILTSDAEESLRRLIYETASKSSKLTPSGLFL  450

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            SVL+QDS+IRLAGYR+++GLVARPWCL+EI S+QEI++IVT+  TET K+ MEAR+ CC+
Sbjct  451  SVLKQDSDIRLAGYRMLSGLVARPWCLMEICSKQEIINIVTHPITETTKLAMEARYNCCK  510

Query  329  AVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            A++ +F  SSKL SD + SG+A KL +A++ GPYL RKH EAQPVV+TE RF
Sbjct  511  AIHTAFNMSSKLASDQSPSGIAAKLHDAVKMGPYLARKHLEAQPVVVTEDRF  562


 Score =   240 bits (612),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 151/284 (53%), Positives = 182/284 (64%), Gaps = 41/284 (14%)
 Frame = -2

Query  1638  EEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EEYSVD   QLL+AA+DFA  P  Q+D SA+EFLDRFPLP ++NALQ K D PGLE AL 
Sbjct  2     EEYSVDDPTQLLEAASDFASYPGFQNDASAKEFLDRFPLPVILNALQTKVDVPGLESALV  61

Query  1461  DCLDKVFRTKYGASLIPHFM---PFVV-----------VGLG------------------  1378
               L++VF+TKYGASLIP FM    FVV           V LG                  
Sbjct  62    AVLERVFKTKYGASLIPQFMLCPSFVVLTDFILLMTVFVFLGSSFNEHVALVQSNERSIY  121

Query  1377  ------APSQNVRRLACTTVSSLLDNTDE--TTAVYLILQNGVYPLLLSCLIDGDEQVaa  1222
                   A SQ V+ LAC TVS LL+N +E   +A  LIL + +YPLL  CLI G+E+VA 
Sbjct  122   TSWCVMAESQEVKSLACKTVSCLLENLNEGSISATRLILDHNIYPLLFDCLIHGNEKVAT  181

Query  1221  aaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIVKLFSISTTVA  1042
              A+ AI  + G  +G+DI+FPA++ E THLG LA +CSS+GRVRVLAL+VKLFS+S  VA
Sbjct  182   LAMDAIARINGSPEGIDIVFPANNKEATHLGALADQCSSVGRVRVLALMVKLFSVSANVA  241

Query  1041  SKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             S V  +NLL L E E+ N NDTL TL  LELLYEL E +H  EF
Sbjct  242   SVVQKSNLLGLFEAEINNTNDTLSTLIILELLYELTEIEHGREF  285



>gb|KDP45863.1| hypothetical protein JCGZ_15307 [Jatropha curcas]
Length=561

 Score =   293 bits (751),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/229 (66%), Positives = 186/229 (81%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + V+SAID R +F  SQD +E ECALEA GQIGL   GA  LLS SP+P RHVI AAFD 
Sbjct  334  KTVMSAIDGRLSF-ESQDLNECECALEALGQIGLSVPGATLLLSMSPSPARHVIDAAFDR  392

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  GK+LAALH+LGNI GE++S ++ +L+ DAEE+LRRLIY+T+SK+ KLTPSGL LSVL
Sbjct  393  QARGKQLAALHSLGNISGESQSESNKVLNADAEENLRRLIYETASKTSKLTPSGLFLSVL  452

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQDSEIRLA YR+ITGLVARPWCL+EI S+QEIV+I+T+  TET KIGMEAR+ CC+A+ 
Sbjct  453  QQDSEIRLAAYRMITGLVARPWCLMEICSKQEIVNIITDPITETTKIGMEARYNCCKAIQ  512

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++F S+SKL S+P+  G+ATKL+EA+  GPYL  KH EAQP VMT +RF
Sbjct  513  KAFMSASKLSSNPSLVGIATKLQEAVSRGPYLTGKHREAQPAVMTAERF  561


 Score =   284 bits (726),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 190/249 (76%), Gaps = 3/249 (1%)
 Frame = -2

Query  1647  AMEEEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLED  1471
             AM+EE+S+ D   LL++A+DFAY P  Q+D   ++FLDRFPLP +I++LQ K+D PGLE 
Sbjct  36    AMDEEFSLEDPTPLLESASDFAYFPGVQNDAVVKDFLDRFPLPLIISSLQTKTDVPGLEK  95

Query  1470  ALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETT--AV  1297
              L  CL+++F+TKYGASLIP +M FV +GL A SQ VR LAC TV+ LL+N ++ T    
Sbjct  96    TLVACLERIFKTKYGASLIPQYMSFVQLGLKADSQLVRCLACKTVACLLENVNDKTISPA  155

Query  1296  YLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAA  1117
              LI+ + +YPLLL CLI+G+EQVA A+  AI  LAGF KG+++IFPA++ + THL +L+A
Sbjct  156   RLIIDSDIYPLLLDCLINGNEQVATASTEAITKLAGFPKGMEVIFPANNDDITHLRNLSA  215

Query  1116  KCSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYEL  937
             +CSSLGRVRVL+L+VKLFS+S  VAS VY +NLL LLE EV N +DTLVTLS LEL YEL
Sbjct  216   RCSSLGRVRVLSLVVKLFSVSPDVASVVYKSNLLGLLEAEVSNTDDTLVTLSILELFYEL  275

Query  936   VEAQHSMEF  910
                QH +EF
Sbjct  276   AVVQHGVEF  284



>ref|XP_008367106.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 5-like 
[Malus domestica]
Length=524

 Score =   292 bits (747),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 188/246 (76%), Gaps = 3/246 (1%)
 Frame = -2

Query  1638  EEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EEYSVD   QLL+AA+DFA  P  Q+D SA+EFLDRFPLP ++NALQ K+D PGLE  L 
Sbjct  2     EEYSVDDPTQLLEAASDFANYPGFQNDDSAKEFLDRFPLPVILNALQTKADVPGLESTLV  61

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDE--TTAVYLI  1288
               L++VF+TKYGASLIPHFMPFV VGL A SQ V+ LACTTVS LL+N +E   +A  LI
Sbjct  62    AVLERVFKTKYGASLIPHFMPFVQVGLTAESQEVKSLACTTVSCLLENLNEGSVSATRLI  121

Query  1287  LQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCS  1108
             L + +YPLLL CLI G+E+VA  A+ AI+ +AG  +G+DI+FPA+++E THLG L+A+CS
Sbjct  122   LYHNIYPLLLDCLIHGNEKVATLAMDAIEKIAGSPEGIDIVFPANTNEATHLGALSAQCS  181

Query  1107  SLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEA  928
             S+GRVRVLALIVKL S+S  VAS V  +NLL L E E+ N  DTL TLS LELLYEL E 
Sbjct  182   SVGRVRVLALIVKLVSVSADVASVVQKSNLLGLFEAEINNRTDTLSTLSILELLYELSEI  241

Query  927   QHSMEF  910
             +H  EF
Sbjct  242   EHDREF  247


 Score =   285 bits (728),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 179/232 (77%), Gaps = 0/232 (0%)
 Frame = -3

Query  869  LGYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAA  690
            L  + V+SAID   +   +Q+ DE E A+EA GQIG   +GA  LLSSSP   RHVI AA
Sbjct  293  LSVKTVLSAIDGILSSSETQEIDECESAIEALGQIGSSIQGAQFLLSSSPPAARHVIYAA  352

Query  689  FDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
            FD    GK+LAALHALGNI GETR  N ++L  DAEESLRRLIY+T+SKS KLTPSGL L
Sbjct  353  FDRHGXGKQLAALHALGNISGETRPANSMILTSDAEESLRRLIYETASKSSKLTPSGLFL  412

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            SVL+QDSEIRLAGYR+++GLVARPWCL+EI S+QEI++IVT+  TET K+GMEAR+ CC+
Sbjct  413  SVLKQDSEIRLAGYRMLSGLVARPWCLMEICSKQEIINIVTDPITETTKLGMEARYNCCK  472

Query  329  AVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            A++ +F  SSKL SD + SG+A KL EA++ GPYL  KH EAQP V+TE RF
Sbjct  473  AIHTAFNMSSKLASDQSLSGIAAKLHEAVKMGPYLASKHLEAQPXVVTEDRF  524



>gb|AIU50931.1| ARM repeat superfamily protein, partial [Lactuca sativa]
Length=281

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/234 (64%), Positives = 176/234 (75%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LLQAA+DF++DP  +S+ + +EFL  FPLP +INALQ K D PGLEDAL DCL+K+F+TK
Sbjct  1     LLQAASDFSFDPGTRSEAAVKEFLASFPLPVIINALQTKGDVPGLEDALIDCLEKIFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIPHFMPF++VGL A SQ VR L+C T+SSLL NT       LI    VYPLLL C
Sbjct  61    YGASLIPHFMPFILVGLQAYSQRVRTLSCETISSLLKNTS------LI---KVYPLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L+DGDEQVA AA  +I++LA   +G++IIFP          +LAA+CSSLGRVRVLALIV
Sbjct  112   LVDGDEQVAVAATDSIRDLACSQQGIEIIFP----------NLAARCSSLGRVRVLALIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS S  VAS VYN+NLL LLE EV N NDTL TLS LELLYEL E QH ME+
Sbjct  162   KLFSTSNAVASLVYNSNLLGLLEAEVRNVNDTLATLSVLELLYELAEVQHGMEY  215



>ref|XP_009356775.1| PREDICTED: uncharacterized protein LOC103947585 [Pyrus x bretschneideri]
 ref|XP_009339297.1| PREDICTED: uncharacterized protein LOC103931510 [Pyrus x bretschneideri]
Length=524

 Score =   290 bits (742),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 186/246 (76%), Gaps = 3/246 (1%)
 Frame = -2

Query  1638  EEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EEYSVD   QLL+AA+DFA     Q+D SA+EFL+RFPLP ++NALQ K+D PGLE  L 
Sbjct  2     EEYSVDDPTQLLEAASDFANYAGFQNDDSAKEFLNRFPLPVILNALQTKTDVPGLESTLV  61

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDE--TTAVYLI  1288
               L++VF+TKYGASLIP FMPFV VGL A SQ V+ LACTTVS LL+N +E   +A  LI
Sbjct  62    AVLERVFKTKYGASLIPQFMPFVQVGLTAESQEVKSLACTTVSCLLENLNEGSVSATRLI  121

Query  1287  LQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCS  1108
             L + +YPLLL CLI G+E+VA  A+ AI+ +AG  KG+DI+FPA++ E THLG LAA+CS
Sbjct  122   LDHDIYPLLLDCLIHGNEKVATLAMDAIEKIAGSPKGMDIVFPANTKEATHLGALAAQCS  181

Query  1107  SLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEA  928
             S+GRVRVLALIVKLFS+S  VAS V  +NLL L E E+ N  DTL TLS LELLYEL E 
Sbjct  182   SVGRVRVLALIVKLFSVSADVASVVQKSNLLGLFEAEINNTTDTLSTLSILELLYELSEI  241

Query  927   QHSMEF  910
             +H  EF
Sbjct  242   EHGREF  247


 Score =   289 bits (740),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 181/232 (78%), Gaps = 0/232 (0%)
 Frame = -3

Query  869  LGYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAA  690
            L  + V+SAID   +   +Q+ DE E ALEA GQIG   +GA  LLSSSP   RHVI AA
Sbjct  293  LSVKTVLSAIDGILSSSDTQEIDECESALEALGQIGSSIQGAQFLLSSSPPAARHVIYAA  352

Query  689  FDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
            FD    GK+LAALHALGNI GETR  N ++L  DAEESLRRLIY+T+SKS KLTPSGL L
Sbjct  353  FDRHGRGKQLAALHALGNISGETRPVNSMILTSDAEESLRRLIYETASKSSKLTPSGLFL  412

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            SVL+QDSEIRLAGYR+++GLVARPWCL+EI S+QEI++IVT+  TET K+GMEAR+ CC+
Sbjct  413  SVLKQDSEIRLAGYRMLSGLVARPWCLMEICSKQEIINIVTDPVTETTKLGMEARYNCCK  472

Query  329  AVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            A++ +F  SSKL SD + SG+A KL EA++ GPYL RKH EAQPVV+TE RF
Sbjct  473  AIHTAFNMSSKLASDQSLSGIAAKLHEAVKMGPYLARKHLEAQPVVVTEDRF  524



>ref|XP_004510024.1| PREDICTED: uncharacterized protein LOC101495060 isoform X1 [Cicer 
arietinum]
Length=523

 Score =   290 bits (742),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 182/232 (78%), Gaps = 3/232 (1%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            ++VIS+ID R   L + D DEFE ALE+ GQIGL  +GA  LLS S    RHVI AAFD 
Sbjct  292  KSVISSIDGRLQSLDTSDRDEFETALESLGQIGLSIRGATLLLSGSSPAARHVIDAAFDQ  351

Query  680  Q---HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
            Q    HG++LAALHALGNI GETRS ND++LD +AEE+L RL+Y+ +SKS KLTPSGL L
Sbjct  352  QGPERHGRQLAALHALGNISGETRSENDIILDAEAEENLLRLLYEAASKSSKLTPSGLFL  411

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            SVLQQDSEIR+AGYR+I+GLVARPWCL+EI SRQEI+++V +  TET KIGMEAR+ CC+
Sbjct  412  SVLQQDSEIRIAGYRMISGLVARPWCLMEICSRQEIINLVADPSTETTKIGMEARYNCCK  471

Query  329  AVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             +++S T SS++ +DP+ +G+A KL+EA+  GPYL RK  EAQP+VMT  RF
Sbjct  472  RIHKSLTHSSRVSADPSFAGIAAKLQEAVGMGPYLNRKRVEAQPIVMTADRF  523


 Score =   276 bits (705),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 181/238 (76%), Gaps = 2/238 (1%)
 Frame = -2

Query  1617  AQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFR  1438
             +QLLQAATDFAY P   SD SA EFL+RFPLP +INALQ + D PGLE AL  CL+++F+
Sbjct  5     SQLLQAATDFAYYPGSHSDDSATEFLNRFPLPLIINALQTQFDVPGLESALVACLERLFK  64

Query  1437  TKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDET--TAVYLILQNGVYPL  1264
             TK GASLIP +MPFV VGL A SQ VR LAC TVS LL+N D +   A +LI +  +YPL
Sbjct  65    TKLGASLIPEYMPFVQVGLQADSQAVRSLACKTVSCLLENLDNSHKVAAHLIKEFNMYPL  124

Query  1263  LLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVL  1084
             LL CLI+G+E+VAA AI AIK LA   +G+DIIFP++    T LG +A++CSSLGRVRVL
Sbjct  125   LLDCLINGNEEVAAGAIDAIKKLASCPEGIDIIFPSNKGGDTDLGIIASQCSSLGRVRVL  184

Query  1083  ALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             AL+VKLFS+ST+ AS + + NLL LLE E+ +A+DTLVTLS  ELLYEL E +H  EF
Sbjct  185   ALVVKLFSVSTSAASAICSLNLLKLLEAEIRSADDTLVTLSVFELLYELAEVEHGTEF  242



>gb|AIU50935.1| ARM repeat superfamily protein, partial [Ginkgo biloba]
Length=464

 Score =   176 bits (446),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 142/223 (64%), Gaps = 19/223 (9%)
 Frame = -2

Query  1578  PSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTKYGASLIPHFMP  1399
             P P +D +A+EFL+RFPLP + +AL++  + P LE +L  CL+++F+T YG SL+P  MP
Sbjct  12    PGPPTDATAKEFLERFPLPVIFSALKSSFEVPRLESSLVSCLERIFKTSYGVSLLPQSMP  71

Query  1398  FVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSCLIDGDEQVaaa  1219
             +   GL + S   R+LAC  ++ LL+N              +YP +++ L DGD  VA A
Sbjct  72    YAQAGLRSNSPLTRQLACNAIAQLLENVQAIV---------IYPSVIASLADGDANVATA  122

Query  1218  aiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIVKLFSISTTVAS  1039
             A  A+KNLA  ++GL++IFP          +LA   SSL R+RVLA+ V LF IS   A+
Sbjct  123   AAEAVKNLAKSSRGLELIFP----------ELAMNSSSLVRIRVLAVAVALFGISDAAAA  172

Query  1038  KVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
              VY+++LLS+ E+E+ N +D L TL+ALE+LYEL  +Q+  ++
Sbjct  173   AVYHSSLLSMFEEELNNKSDILATLNALEVLYELAASQNGAKY  215


 Score =   172 bits (437),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 140/229 (61%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            ++VI A D         ++ E E AL+A GQ+G+  +GA  LL  +    RH++ A F  
Sbjct  254  KHVIQAFDANLT-----ESTELEVALDALGQLGMVARGAELLLCPT---ARHIVEATFCN  305

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q    +LA  HAL +I GE R+     L+  AE  LR LIY  +  S K +PSGL  S+L
Sbjct  306  QGRNIQLAGAHALASISGEKRTE----LNDQAEACLRNLIYSAAENSSKRSPSGLFWSLL  361

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ+ EIRLA YR+I GLV RPWCL E+ S+QEI+++VT+   E+ K GME RH CC A+ 
Sbjct  362  QQEPEIRLAAYRLIVGLVVRPWCLWEVCSKQEIINLVTD---ESTKEGMEFRHSCCVAIS  418

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             +  +S+   +D   S +A KL+ A+R GPYL R+  E +P+V+ E+RF
Sbjct  419  NALMASN-YKNDATFSEVAEKLQAAVRRGPYLARE--EPKPIVVAEERF  464



>gb|KHG14696.1| 26S proteasome non-ATPase regulatory subunit 5 [Gossypium arboreum]
Length=524

 Score =   289 bits (740),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/248 (63%), Positives = 199/248 (80%), Gaps = 3/248 (1%)
 Frame = -2

Query  1644  MEEEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDA  1468
             M+EE+S+D   QLL++A+DFA+ P   +D + ++FLDRFPLP +I+ALQ KSD PGLE+ 
Sbjct  1     MDEEFSLDDPTQLLESASDFAHHPGSLNDAAVKDFLDRFPLPVIISALQTKSDVPGLENT  60

Query  1467  LCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETT--AVY  1294
             L  CL++VF+TKYGASLIP +M FV VGL A SQ VR L+C TVSS L N D+ +  A+ 
Sbjct  61    LVACLERVFKTKYGASLIPQYMTFVQVGLKADSQIVRCLSCKTVSSFLKNFDDKSIYAIK  120

Query  1293  LILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAK  1114
             LI+   +YPLLL CL++GDEQVA AAI AIKNLA F + + IIFP++ +E THLG++A++
Sbjct  121   LIIDCDIYPLLLDCLVNGDEQVATAAIDAIKNLAQFPEAMGIIFPSNFNEATHLGNVASR  180

Query  1113  CSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELV  934
             CSSLGRVRVL+LIVKLFSIS+++AS +YN+NLLSLLE E+ N+NDTLVTLSALELLYEL 
Sbjct  181   CSSLGRVRVLSLIVKLFSISSSIASVIYNSNLLSLLETEIKNSNDTLVTLSALELLYELT  240

Query  933   EAQHSMEF  910
             E QH  +F
Sbjct  241   EVQHGAQF  248


 Score =   281 bits (719),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 180/229 (79%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            +++ISAID R   L SQD DE E ALEA G IG   +GA  LL+S P   RH++ AAFD 
Sbjct  297  KSLISAIDVRLGLLDSQDTDERESALEALGGIGSSIQGAVLLLTSFPPAARHIVHAAFDR  356

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  GK+LAALHALGNI+GE R  + ++L+GDAEESLRRL+Y+ +S+S KLTPSGLLLSVL
Sbjct  357  QGGGKQLAALHALGNILGENRPEDGLILNGDAEESLRRLVYEVASESSKLTPSGLLLSVL  416

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ +E RLAGYRVITGLVAR WCL+EI S+ EI++IVT+   ET KI MEAR+ CC+A++
Sbjct  417  QQAAEFRLAGYRVITGLVARLWCLMEICSKLEIINIVTDPTAETTKIAMEARYNCCKAIH  476

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +SF  SSKL+SDPA SG+A KL+EA++ GPYL RKH EA PVVMT +RF
Sbjct  477  KSFM-SSKLVSDPALSGIAGKLQEAVQRGPYLVRKHTEATPVVMTAERF  524



>ref|XP_006370214.1| proteasome-related family protein [Populus trichocarpa]
 gb|ERP66783.1| proteasome-related family protein [Populus trichocarpa]
Length=573

 Score =   290 bits (741),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 150/236 (64%), Positives = 191/236 (81%), Gaps = 2/236 (1%)
 Frame = -2

Query  1638  EEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EE+S+ D +QLLQ+A++FA  P   +DV+A+EFLDRFPLP +INALQ KS+ PGLE  L 
Sbjct  4     EEFSMEDPSQLLQSASEFANYPGVPNDVAAKEFLDRFPLPVIINALQTKSEVPGLEATLV  63

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDET-TAVYLIL  1285
              CL+++F+TK GASLIPH+MPFV VGL A SQ VR LAC TVS LL N DET +A  LI+
Sbjct  64    ACLERIFKTKCGASLIPHYMPFVQVGLTADSQLVRCLACKTVSCLLKNIDETISAAQLII  123

Query  1284  QNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSS  1105
              NGVYPLLL CLI+G+EQVA A++ AI+ LAG  KG++I+FPA++S+  HLG+L+A+CSS
Sbjct  124   DNGVYPLLLDCLINGNEQVATASMEAIEKLAGSQKGMEIVFPANNSDDMHLGNLSARCSS  183

Query  1104  LGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYEL  937
             LGRVRVL+LIVKLFS+S  VAS VYN+NLLSLLE ++ + +DTLV+LS  EL YE+
Sbjct  184   LGRVRVLSLIVKLFSVSRDVASAVYNSNLLSLLEAKIRDTDDTLVSLSVFELFYEV  239


 Score =   278 bits (710),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 149/249 (60%), Positives = 187/249 (75%), Gaps = 7/249 (3%)
 Frame = -3

Query  905  QELHFF----IYLVQ*LGYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaa  738
            ++LHF     ++L   LG + +ISAID R   L SQD +E E ALEA GQIG   +GA  
Sbjct  327  KKLHFICKCTVFLSD-LGVKAIISAIDGRLR-LESQDLNECESALEALGQIGSSNQGATL  384

Query  737  llssspaPVRHVISAAFDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIY  558
            LL+ SP   RHVI AAFD    GK+LA+LH+L NI GETRS ++++L+GDAEESLR LIY
Sbjct  385  LLTISPPAARHVIDAAFDKHARGKQLASLHSLANISGETRSDSNIILNGDAEESLRLLIY  444

Query  557  DTSSKSPKLTPSGLLLSVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKY  378
            + +SKS KLTPSGL LSVLQQDS++RLA YRV+TGLVARPWCL+EI S+QEI++IVT   
Sbjct  445  EAASKSSKLTPSGLFLSVLQQDSQVRLAAYRVLTGLVARPWCLMEICSKQEIINIVTGPN  504

Query  377  TETEKIGMEARHKCCEAVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRK-HAEAQ  201
            TET KIGMEAR+KCC A++ +F SSSKL  +PA + +A KL+EA+  GPYL  K + EAQ
Sbjct  505  TETTKIGMEARYKCCVAIHRAFMSSSKLTGNPALAPIAAKLQEAVSRGPYLADKIYREAQ  564

Query  200  PVVMTEQRF  174
            P+V+T  RF
Sbjct  565  PMVVTADRF  573



>ref|XP_010542296.1| PREDICTED: uncharacterized protein LOC104815562 [Tarenaya hassleriana]
Length=522

 Score =   287 bits (735),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 189/248 (76%), Gaps = 3/248 (1%)
 Frame = -2

Query  1644  MEEEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDA  1468
             M EEY++ DA QLL +A+DFA+ P  Q++ S +EFL RFPLP + +ALQ KSD PGLE A
Sbjct  1     MVEEYAMEDANQLLDSASDFAHYPGVQNESSVREFLHRFPLPVIFSALQTKSDMPGLEMA  60

Query  1467  LCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN--TDETTAVY  1294
             L  CL+++F TKYGASLIPH+M FV VGLGA S  VR LAC TV+ LL+N  T++   + 
Sbjct  61    LVGCLERIFETKYGASLIPHYMAFVQVGLGAESPAVRALACKTVTCLLENFDTEDVLPIK  120

Query  1293  LILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAK  1114
             L++ NG+YPLLL  +I+GDEQVA AA  AIK+LA F   L +IFPA +++ THLG LAA+
Sbjct  121   LVINNGIYPLLLDSMINGDEQVAHAATNAIKSLARFPDALSVIFPADTNDATHLGHLAAR  180

Query  1113  CSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELV  934
             CSSLGRVRVL+LIVKLFS+S +V+S + N+ LL LLE E+ N NDTLV L+ LEL +ELV
Sbjct  181   CSSLGRVRVLSLIVKLFSVSPSVSSLIKNSKLLDLLEAEIKNTNDTLVILNVLELYFELV  240

Query  933   EAQHSMEF  910
             E +HS EF
Sbjct  241   EIEHSSEF  248


 Score =   255 bits (652),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 167/229 (73%), Gaps = 4/229 (2%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +IS +D     + S D D +E ALEA GQIG   KGA  LLS+SP   RHV+++AFD 
Sbjct  298  KALISTVDSS---VESLDTDAYESALEALGQIGSTTKGATLLLSTSPPAARHVVASAFDR  354

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HGK+LAALHAL NI GE R  +  ++D  AEESLR LIYD +++S KLTPSGL LSVL
Sbjct  355  HAHGKQLAALHALANIAGEARPQDMRVVDDKAEESLRHLIYDVAAQSTKLTPSGLFLSVL  414

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRL GYR  T LVARPWCL+EI+S++EI++ VT+  TET KIGMEAR+ CC+A+ 
Sbjct  415  QQSSEIRLGGYRTFTALVARPWCLVEILSKEEIINTVTDSTTETSKIGMEARYNCCKAIL  474

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  SS+ ++DP R+    KL+EA+RSGPYL + H EA+P VMT + F
Sbjct  475  EAFV-SSRFINDPLRAKTVEKLQEAVRSGPYLSKNHREARPEVMTAEGF  522



>ref|XP_007021566.1| ARM repeat superfamily protein [Theobroma cacao]
 gb|EOY13091.1| ARM repeat superfamily protein [Theobroma cacao]
Length=524

 Score =   287 bits (734),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 177/229 (77%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VISAID R   L SQD DE E ALEA GQIG   +GA  LLSS P   RH++ AAFD 
Sbjct  297  KGVISAIDVRLGLLDSQDTDECESALEALGQIGSSIQGAVLLLSSFPPAARHIVHAAFDR  356

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  GK+LAALHALGN+ GE R  + V+L GDAEESLR LIY+ +S S KLTPSGL LS L
Sbjct  357  QGRGKQLAALHALGNVAGENRPEDSVILSGDAEESLRHLIYEVASHSSKLTPSGLFLSAL  416

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ +E RLAGYRVITGLVAR WCL+EI S+QEI+++VT+  TET KIGMEAR+KCC+A++
Sbjct  417  QQAAEFRLAGYRVITGLVARTWCLMEICSKQEIINMVTDPATETTKIGMEARYKCCKAIH  476

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             +F  SSKL+SDPA SG+A KL+EA++ GPYL RKH EA PVVMT +RF
Sbjct  477  RAFM-SSKLVSDPALSGIAGKLQEAVQRGPYLTRKHTEAAPVVMTAERF  524


 Score =   278 bits (711),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 197/248 (79%), Gaps = 3/248 (1%)
 Frame = -2

Query  1644  MEEEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDA  1468
             M+EE+SVD   QLL +A++FA+ P  Q+D + ++FLDRFPLP +I+ALQ K+D PGLE+ 
Sbjct  1     MDEEFSVDDPTQLLDSASEFAHHPGVQNDATTKDFLDRFPLPVIISALQTKADVPGLENT  60

Query  1467  LCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETT--AVY  1294
             L  CL++VF+TKYG SLIP +MPF+ VGL A SQ VR LAC TVSS L+N D+ +  A+ 
Sbjct  61    LAVCLERVFKTKYGGSLIPQYMPFLQVGLKADSQMVRCLACKTVSSFLENFDDKSISAIQ  120

Query  1293  LILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAK  1114
             LI+   +YPLLL CLI G+E VA+AAI AIKNLA F +G+ IIFPA+ +E  HLG+LA++
Sbjct  121   LIINYDLYPLLLDCLIYGNELVASAAIDAIKNLAQFPEGMSIIFPANINEVAHLGNLASR  180

Query  1113  CSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELV  934
             CSSLGR RVL+LIVKLFSIS +VAS +YN+NLLSLLE E+ N+NDTLVTLS+LELLYEL 
Sbjct  181   CSSLGRARVLSLIVKLFSISGSVASVIYNSNLLSLLEAEIRNSNDTLVTLSSLELLYELT  240

Query  933   EAQHSMEF  910
             E QH  EF
Sbjct  241   EIQHGTEF  248



>ref|XP_004291500.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 5-like 
[Fragaria vesca subsp. vesca]
Length=523

 Score =   286 bits (732),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 173/229 (76%), Gaps = 0/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + V+SAIDR  +   S D DE E ALEA GQIG   +GA  LLS SP   RHVI  AFD 
Sbjct  295  KTVVSAIDRILSSSESHDTDECETALEALGQIGSSMEGAQLLLSGSPPAARHVIYFAFDR  354

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q HG++LAALHAL NI GETRS N V+L  DAEESLRRLIY+T+SKS KLTPSGL LSV+
Sbjct  355  QGHGRKLAALHALANISGETRSENSVILTNDAEESLRRLIYETASKSSKLTPSGLFLSVI  414

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQD E RLAGYRV+TGL ARPWCL EI S+QEI+++VT+  +ET K+GMEAR+ CC+ ++
Sbjct  415  QQDPETRLAGYRVLTGLGARPWCLTEICSKQEIINVVTDAASETTKLGMEARYNCCKTIH  474

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             +F  SSKL SDPA  G+A KL E++R GPYL RKH EAQP V+T  RF
Sbjct  475  TAFNMSSKLSSDPALGGIAAKLHESVRLGPYLARKHREAQPTVVTADRF  523


 Score =   281 bits (720),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 184/247 (74%), Gaps = 3/247 (1%)
 Frame = -2

Query  1644  MEEEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDA  1468
             M EEYSVD   QLL+A+++FA  P  Q+D SA EFLDRFPLP ++NALQ K+D PGLE+ 
Sbjct  1     MAEEYSVDDPTQLLEASSEFANYPGVQNDASAHEFLDRFPLPVILNALQTKADVPGLENT  60

Query  1467  LCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN-TDETTAVYL  1291
             L D L+ +F+T+YG SLIP +MPF+ VGL A SQ V+ LAC TV+ LL++  D   + +L
Sbjct  61    LVDVLESIFKTRYGTSLIPQYMPFIQVGLTANSQKVKALACKTVTRLLESVNDYAVSAHL  120

Query  1290  ILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKC  1111
             I+ N +YPLL+ CLI+G+EQV   A  AI  +AG   G+DI+FPA ++E THLG LA++C
Sbjct  121   IIDNNIYPLLIDCLINGNEQVTTLATEAIAKIAGSPAGIDIVFPADANEATHLGKLASQC  180

Query  1110  SSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVE  931
             SSLGRVR+LALIVKLFS+S  VAS V  +NLL+L E E+ N+NDTL TL+ +ELLYEL E
Sbjct  181   SSLGRVRILALIVKLFSVSHHVASVVSKSNLLTLFEAEI-NSNDTLATLNVMELLYELSE  239

Query  930   AQHSMEF  910
              +H   F
Sbjct  240   IKHGRVF  246



>ref|XP_010272362.1| PREDICTED: uncharacterized protein LOC104608165 [Nelumbo nucifera]
Length=564

 Score =   286 bits (733),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 191/236 (81%), Gaps = 3/236 (1%)
 Frame = -2

Query  1638  EEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EE++V D AQL++AA+DFAY P  Q+D SA+EFLDRFPLP +INALQ+K+D   LE+ L 
Sbjct  2     EEFAVEDTAQLMEAASDFAYYPGVQNDASAKEFLDRFPLPVIINALQSKADVRNLEETLV  61

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAV--YLI  1288
              CL+++F TKYGASLIP +M FV VGL A SQ VR LAC TVS LL+N D++T++   L+
Sbjct  62    ACLERIFGTKYGASLIPQYMSFVKVGLLADSQIVRCLACKTVSFLLENADKSTSIASRLV  121

Query  1287  LQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCS  1108
             ++  +Y LLL CLI+G+EQVAAA++ AIKNLA + +G+DIIFPA+  E T L +LA+ CS
Sbjct  122   IEYDIYQLLLDCLINGNEQVAAASMDAIKNLATYPRGMDIIFPANGDEVTQLRNLASHCS  181

Query  1107  SLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYE  940
             SLGRVRVLALIVKLFSIS++VAS ++N+NLLSLLE+E+ N ND L+TLS LELLYE
Sbjct  182   SLGRVRVLALIVKLFSISSSVASTIFNSNLLSLLEEEIHNTNDMLMTLSVLELLYE  237


 Score =   262 bits (669),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 172/226 (76%), Gaps = 0/226 (0%)
 Frame = -3

Query  851  ISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHH  672
            +SAI  R   L  QD DE E ALEA GQIGL  +GA  LLS+S    +HV+  AFD    
Sbjct  339  VSAISGRLESLKDQDTDECETALEALGQIGLSLQGAELLLSNSSCVAKHVVDVAFDHNGR  398

Query  671  GKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQD  492
             K+LAALH+LGNIVGE+R    ++L+ +AEESLR LI +T+SKS KLTPSGLLLSVLQQD
Sbjct  399  TKQLAALHSLGNIVGESRPDESIILNDEAEESLRHLINETASKSLKLTPSGLLLSVLQQD  458

Query  491  SEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESF  312
            +EIRLA YR+ITGLVAR WCLIEI S+QEI+ IV + + ET+K GMEAR+ CC A+++  
Sbjct  459  AEIRLAAYRLITGLVARSWCLIEICSKQEIIKIVIDPHIETKKKGMEARYNCCRAIHKYL  518

Query  311  TSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++++KL+SDP  +G+A+KL+EA+R GPYL  + AEAQ VV+T +RF
Sbjct  519  STANKLVSDPVLAGIASKLQEAVRRGPYLALERAEAQLVVVTAERF  564



>ref|XP_008226495.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 5 [Prunus 
mume]
Length=523

 Score =   285 bits (730),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 185/246 (75%), Gaps = 3/246 (1%)
 Frame = -2

Query  1638  EEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EE+SVD   QLLQAA+DFA  P  Q+D S +EFLDRFPLP ++NALQ K+D PGLE  L 
Sbjct  2     EEFSVDDPTQLLQAASDFANYPGLQNDASVKEFLDRFPLPVILNALQTKADVPGLESTLI  61

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDE--TTAVYLI  1288
               L++VF+TKYGASLIPH+MPF+ VGL A S  V+ LAC TV+ LL+N +E   +A  LI
Sbjct  62    AALERVFQTKYGASLIPHYMPFIQVGLTAESHEVKSLACKTVTYLLENLNEGAVSAARLI  121

Query  1287  LQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCS  1108
             +++ +YPLLL CLI+G+E+VA  +  AI  +A    G+D++FPA+++E T LG LAA+CS
Sbjct  122   VEHNIYPLLLDCLINGNEKVATLSTDAIGKMASSPAGMDVVFPANTNEATDLGALAAQCS  181

Query  1107  SLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEA  928
              LGRVRVLALIVKLFSIS+ VAS ++ +NLL L E E+ N NDTL TLS LE++YEL E 
Sbjct  182   PLGRVRVLALIVKLFSISSCVASAIHRSNLLRLFEAEINNTNDTLATLSVLEIMYELSEV  241

Query  927   QHSMEF  910
             +H  EF
Sbjct  242   EHGREF  247


 Score =   284 bits (727),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = -3

Query  869  LGYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAA  690
            L  + V+SAIDR  +   +QDADE E ALEA GQIG   +GA  LLSSSP   RHVI AA
Sbjct  293  LSVKTVVSAIDRILSSSETQDADECESALEALGQIGSSIQGAQFLLSSSPPAARHVIYAA  352

Query  689  FDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
            FD Q  GK+LAALHALGNI GETRS N ++L  D EESLRRLIY+T+SKS KLTPSG+ L
Sbjct  353  FDRQGRGKQLAALHALGNISGETRSENSMILTSDGEESLRRLIYETASKSSKLTPSGIFL  412

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            SVL+QDSE RLAGYR++TGLVARPWCL+EI S+QEI++IVT+  TET K+GMEAR+ CC+
Sbjct  413  SVLKQDSETRLAGYRMLTGLVARPWCLMEICSKQEIINIVTDATTETTKLGMEARYNCCK  472

Query  329  AVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            A+ ++F  SSK+ SDPA +GLA KL +A+R GPY+  K  EAQP V+T+ RF
Sbjct  473  AIQKAFIMSSKVSSDPALAGLAEKLYDAVRKGPYVA-KRLEAQPTVVTDDRF  523



>ref|XP_002532239.1| 26S proteasome non-ATPase regulatory subunit, putative [Ricinus 
communis]
 gb|EEF30133.1| 26S proteasome non-ATPase regulatory subunit, putative [Ricinus 
communis]
Length=612

 Score =   287 bits (735),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 183/231 (79%), Gaps = 1/231 (0%)
 Frame = -3

Query  866  GYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAF  687
            G + VISAID R   + SQD +E ECALEAFGQIG    GA  LL+ SP   RHVI AAF
Sbjct  383  GVKTVISAIDGRLG-VESQDLNECECALEAFGQIGSSTPGATLLLTMSPPAARHVIDAAF  441

Query  686  DCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLS  507
            D Q  GK+LAALH+LG I GE+RS ++++L+G+AEE+LRRLIYDT+SK+PKLTPSGL LS
Sbjct  442  DRQARGKQLAALHSLGYISGESRSESNIILNGEAEETLRRLIYDTASKTPKLTPSGLFLS  501

Query  506  VLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEA  327
            +LQQD+E RLA YR+ITGLV RPWCL+EI ++QEIV+IVT+  TET K GM+AR+ CC+A
Sbjct  502  ILQQDAEARLAAYRMITGLVFRPWCLMEICTKQEIVNIVTDPTTETIKRGMDARYNCCKA  561

Query  326  VYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            + ++F +S KL ++PA +G+A+KL+EA+R GPY   KH EAQP VMT +RF
Sbjct  562  INKAFMASGKLSTNPALAGIASKLQEAVRRGPYFTGKHREAQPTVMTAERF  612


 Score =   277 bits (708),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 190/251 (76%), Gaps = 3/251 (1%)
 Frame = -2

Query  1653  KTAMEEEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGL  1477
             K AM+EE+S+ D   LLQ+A+DFAY P  Q+D   ++FLD FPLP + +ALQ K+D P L
Sbjct  85    KEAMDEEFSMEDPTPLLQSASDFAYYPGAQNDAVVKDFLDHFPLPVIFSALQTKADVPDL  144

Query  1476  EDALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETT--  1303
             E  L  CL+K+F+TKYGASLIP +M FV +GL A SQ V+ LAC TVS LL+N ++ T  
Sbjct  145   ERTLVACLEKIFKTKYGASLIPQYMAFVNLGLKADSQLVKCLACKTVSCLLENVNDKTIS  204

Query  1302  AVYLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDL  1123
                L++ NG+YPLLL C++ G+ +VA A++ AI+  AGF K +++IFPA++ + THL +L
Sbjct  205   PAQLVIDNGIYPLLLHCVLIGNGEVAIASMEAIQKFAGFPKAIEVIFPANNEDFTHLRNL  264

Query  1122  AAKCSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLY  943
             +A+CSSLGRVR+L+L+VKLF++S  VA+ V+N+NLLSLLE EV N +DTLVTLS LEL Y
Sbjct  265   SARCSSLGRVRLLSLVVKLFTVSPDVAAVVFNSNLLSLLEAEVSNTDDTLVTLSILELFY  324

Query  942   ELVEAQHSMEF  910
             EL E QH +EF
Sbjct  325   ELAEVQHGIEF  335



>gb|KCW67359.1| hypothetical protein EUGRSUZ_F01141 [Eucalyptus grandis]
Length=506

 Score =   283 bits (725),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 197/251 (78%), Gaps = 3/251 (1%)
 Frame = -2

Query  1653  KTAMEEEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGL  1477
             +  MEEEY + D ++LL+AA+DFA  P  Q+D +A+EFLDRFPLP +I+ALQ ++D PGL
Sbjct  4     RAPMEEEYFMEDTSRLLEAASDFALYPGVQNDAAAKEFLDRFPLPVIISALQTRADVPGL  63

Query  1476  EDALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDET--T  1303
             E  L +CL++VF+TKYGASLIPHFMPFV VGL A SQ VR LAC TVS LL+N+DE   +
Sbjct  64    ESTLVNCLERVFKTKYGASLIPHFMPFVQVGLQAASQEVRCLACKTVSCLLENSDEKSLS  123

Query  1302  AVYLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDL  1123
             AV +++   +YPL L CL++G+EQV AA++ AIK LA   +G +++FPAS SE T L +L
Sbjct  124   AVKIVIDYNIYPLFLDCLVNGNEQVTAASMDAIKTLACLQRGTNVVFPASDSEVTRLRNL  183

Query  1122  AAKCSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLY  943
             AA+CSSLGRV VLA IVKLFS+S++VAS +Y++NLLSL E E+ ++ DTLVTLS LELLY
Sbjct  184   AAQCSSLGRVWVLASIVKLFSVSSSVASIIYSSNLLSLFEAEISDSQDTLVTLSVLELLY  243

Query  942   ELVEAQHSMEF  910
             E+VE +H+ + 
Sbjct  244   EMVEIRHATKI  254


 Score =   233 bits (595),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 157/229 (69%), Gaps = 26/229 (11%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            R V+SAID R +   S D DE E ALEA GQIGL  +GA  LLSS+    RHV+ AAFD 
Sbjct  304  RIVVSAIDGRLSLSESLDTDECEAALEALGQIGLSTQGAELLLSSTYRVARHVVYAAFDR  363

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  GK+LAALHALGN+ G+ RS N+             LIY+ +S+SPKL PSGL LSVL
Sbjct  364  QGRGKQLAALHALGNLAGDARSDNN------------SLIYEAASRSPKLIPSGLFLSVL  411

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ++E RLAGYR IT LVARPWCL+EI S++EIVDIVT+   ET KI             
Sbjct  412  QQEAETRLAGYRRITALVARPWCLMEICSKEEIVDIVTDPSIETTKIA------------  459

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
              FT S+KLM+DP+ +G+A+KL++A+R GP+L R+  EAQPVVMT +RF
Sbjct  460  --FTRSTKLMNDPSLAGIASKLQDAVRRGPFLARRRPEAQPVVMTAERF  506



>gb|EPS71300.1| hypothetical protein M569_03459, partial [Genlisea aurea]
Length=332

 Score =   276 bits (707),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 179/239 (75%), Gaps = 1/239 (0%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKS-DYPGLEDALCDCLDK  1447
             D + LL+AA+DF+  P   SD SAQ FL RFPLP +I++LQ K  DYPGLED + DCL K
Sbjct  1     DPSLLLEAASDFSRQPGVVSDASAQSFLTRFPLPLIIHSLQTKGEDYPGLEDVVVDCLGK  60

Query  1446  VFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYP  1267
             +FRT+YG+SLIP +M FV+VGLGA SQ VR LAC  +  LL+NT+E TA+ ++ Q   Y 
Sbjct  61    IFRTRYGSSLIPQYMNFVLVGLGAVSQKVRCLACVAIQCLLENTNEVTALQIVRQYDAYT  120

Query  1266  LLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRV  1087
             LLL CLI GDE V+AAA  AI +LAG+  GL IIFPAS+ E T L +   KCSS+GRVRV
Sbjct  121   LLLDCLIHGDELVSAAATNAITSLAGYPDGLGIIFPASTDEATRLENEYMKCSSMGRVRV  180

Query  1086  LALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             LALI +LFS+S+TVAS++  +NLL+L E EV N +DTLVTLS LELLYELVE QHS  F
Sbjct  181   LALIQRLFSLSSTVASEIAKSNLLNLFESEVKNTDDTLVTLSVLELLYELVEVQHSAVF  239



>ref|XP_003628552.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula]
 gb|AET03028.1| 26S proteasome non-ATPase regulatory subunit 5 [Medicago truncatula]
 gb|KEH19414.1| 26S proteasome non-ATPase regulatory subunit 5 [Medicago truncatula]
Length=526

 Score =   282 bits (722),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 180/233 (77%), Gaps = 4/233 (2%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            ++VIS+ID R   L   + DEFE ALE+ GQIGL  +GA  LLS +    RH I AAFD 
Sbjct  294  KSVISSIDGRLQSLDPSNKDEFETALESLGQIGLTIRGAKLLLSGTSPAARHAIDAAFDR  353

Query  680  Q---HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
            Q    HG++LAALHALGNI GETRS NDV+LD +AEE+L RL+Y+T+S+S KLTPSGL L
Sbjct  354  QGPERHGRQLAALHALGNISGETRSENDVILDAEAEENLLRLLYETASRSSKLTPSGLFL  413

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            SVLQQDSEIR+AGYR+I+GLV+RPWCL+EI SRQEI++IVT+  TET KIGMEAR+ CC 
Sbjct  414  SVLQQDSEIRIAGYRMISGLVSRPWCLMEICSRQEIINIVTDPSTETTKIGMEARYNCCV  473

Query  329  AVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYL-GRKHAEAQPVVMTEQRF  174
             + +S T SS++ +DPA +G+A KL+EA+  GPYL  RK  EAQP+VMT  RF
Sbjct  474  RINKSLTQSSRVSADPAFAGIAAKLQEAVGLGPYLHHRKRVEAQPIVMTADRF  526


 Score =   273 bits (699),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 148/247 (60%), Positives = 185/247 (75%), Gaps = 5/247 (2%)
 Frame = -2

Query  1644  MEEEYSVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDAL  1465
             M+E+ S    QLLQAATDFA  P   SD SA +FL+RFPLP +INALQ + D PGLE  L
Sbjct  1     MDEQSS---QQLLQAATDFANYPGSHSDDSATDFLNRFPLPLIINALQTQFDVPGLETTL  57

Query  1464  CDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDE--TTAVYL  1291
               CL+++F+TK+GASLIP +M FV VGL + SQ VR LAC TV+SLL+N D   T A +L
Sbjct  58    VVCLERLFKTKFGASLIPQYMQFVQVGLQSDSQAVRSLACKTVTSLLENLDNSYTVAAHL  117

Query  1290  ILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKC  1111
             I +  +YPLLL CLI+G+E+VAA AI AIK LA F++GLDIIFP++    T LG +A++C
Sbjct  118   IKEFNIYPLLLDCLINGNEEVAAGAIDAIKKLASFSEGLDIIFPSTKGGDTDLGIIASQC  177

Query  1110  SSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVE  931
             SSLGRVRVLAL+VKLFS+ST+ AS + + NLL LLE E+ + +DTLVTLS  ELLYEL E
Sbjct  178   SSLGRVRVLALVVKLFSVSTSAASAICSLNLLKLLEAEIRSTDDTLVTLSVFELLYELAE  237

Query  930   AQHSMEF  910
              +H  EF
Sbjct  238   VEHGTEF  244



>gb|ACJ85798.1| unknown [Medicago truncatula]
Length=324

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 148/247 (60%), Positives = 185/247 (75%), Gaps = 5/247 (2%)
 Frame = -2

Query  1644  MEEEYSVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDAL  1465
             M+E+ S    QLLQAATDFA  P   SD SA +FL+RFPLP +INALQ + D PGLE  L
Sbjct  1     MDEQSS---QQLLQAATDFANYPGSHSDDSATDFLNRFPLPLIINALQTQFDVPGLETTL  57

Query  1464  CDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDE--TTAVYL  1291
               CL+++F+TK+GASLIP +M FV VGL + SQ VR LAC TV+SLL+N D   T A +L
Sbjct  58    VVCLERLFKTKFGASLIPQYMQFVQVGLQSDSQAVRSLACKTVTSLLENLDNSYTVAAHL  117

Query  1290  ILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKC  1111
             I +  +YPLLL CLI+G+E+VAA AI AIK LA F++GLDIIFP++    T LG +A++C
Sbjct  118   IKEFNIYPLLLDCLINGNEEVAAGAIDAIKKLASFSEGLDIIFPSTKGGDTDLGIIASQC  177

Query  1110  SSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVE  931
             SSLGRVRVLAL+VKLFS+ST+ AS + + NLL LLE E+ + +DTLVTLS  ELLYEL E
Sbjct  178   SSLGRVRVLALVVKLFSVSTSAASAICSLNLLKLLEAEIRSTDDTLVTLSVFELLYELAE  237

Query  930   AQHSMEF  910
              +H  EF
Sbjct  238   VEHGTEF  244



>ref|XP_003527227.1| PREDICTED: uncharacterized protein LOC100785671 [Glycine max]
 gb|KHN45837.1| 26S proteasome non-ATPase regulatory subunit 5 [Glycine soja]
Length=525

 Score =   279 bits (713),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 182/242 (75%), Gaps = 4/242 (2%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D++QLLQAA+DF + P P SD S+++FL+RFPLP +INALQ + D PGLE+ L  CL+++
Sbjct  3     DSSQLLQAASDFVHYPGPHSDDSSRDFLNRFPLPVIINALQTQLDVPGLENTLVACLERL  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVY----LILQNG  1276
             F TK GASLIP +MPFV VGL A SQ VR LAC TV+SLL+N D    V     LI    
Sbjct  63    FNTKLGASLIPQYMPFVQVGLQADSQAVRSLACKTVTSLLENLDNDHKVAASACLIKDFN  122

Query  1275  VYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGR  1096
             +YPLLL CLI+G+EQVAA A  AIK LAGF +G++IIFP+   + T L  +A++CSSLGR
Sbjct  123   IYPLLLDCLINGNEQVAAVATDAIKKLAGFPEGMEIIFPSDKGDDTDLEIIASQCSSLGR  182

Query  1095  VRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSM  916
             VRVLAL+VKLFS+S + AS +Y+ NLL LLE E+ NA+DTLVTLS LEL+YEL E +H  
Sbjct  183   VRVLALVVKLFSVSRSAASTIYSLNLLQLLEAEIRNADDTLVTLSVLELIYELAEIEHGT  242

Query  915   EF  910
             EF
Sbjct  243   EF  244


 Score =   271 bits (692),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 179/232 (77%), Gaps = 3/232 (1%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VIS+ID R   L + D DE E ALE+ G +G   +GA  LLS S    RHVI+AAF+ 
Sbjct  294  KAVISSIDGRLQSLEASDRDECETALESLGHMGSSIQGATLLLSGSSPAARHVINAAFER  353

Query  680  QH---HGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
            Q    HGK+LAALHALGNI GETRS N+++L+ + EE+LRRLIY+T+S+S KLTPSGL L
Sbjct  354  QGPTGHGKQLAALHALGNISGETRSENNIILNAEEEENLRRLIYETASRSSKLTPSGLFL  413

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            SVLQQDSEIRLAGYR+++GLVARPWCL+EI S+QEI++ VT+  TET KIGME R+ CC+
Sbjct  414  SVLQQDSEIRLAGYRMLSGLVARPWCLMEICSKQEIINKVTDPSTETTKIGMEGRYNCCK  473

Query  329  AVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            A+++S T SS++ ++PA +G+A K +EA+  GPYL ++H EAQP V+T  RF
Sbjct  474  AIHKSLTVSSRVSANPAFAGIAAKFQEAVGMGPYLVKRHVEAQPAVITADRF  525



>ref|XP_004510025.1| PREDICTED: uncharacterized protein LOC101495060 isoform X2 [Cicer 
arietinum]
Length=487

 Score =   276 bits (706),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 181/238 (76%), Gaps = 2/238 (1%)
 Frame = -2

Query  1617  AQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFR  1438
             +QLLQAATDFAY P   SD SA EFL+RFPLP +INALQ + D PGLE AL  CL+++F+
Sbjct  5     SQLLQAATDFAYYPGSHSDDSATEFLNRFPLPLIINALQTQFDVPGLESALVACLERLFK  64

Query  1437  TKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDET--TAVYLILQNGVYPL  1264
             TK GASLIP +MPFV VGL A SQ VR LAC TVS LL+N D +   A +LI +  +YPL
Sbjct  65    TKLGASLIPEYMPFVQVGLQADSQAVRSLACKTVSCLLENLDNSHKVAAHLIKEFNMYPL  124

Query  1263  LLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVL  1084
             LL CLI+G+E+VAA AI AIK LA   +G+DIIFP++    T LG +A++CSSLGRVRVL
Sbjct  125   LLDCLINGNEEVAAGAIDAIKKLASCPEGIDIIFPSNKGGDTDLGIIASQCSSLGRVRVL  184

Query  1083  ALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             AL+VKLFS+ST+ AS + + NLL LLE E+ +A+DTLVTLS  ELLYEL E +H  EF
Sbjct  185   ALVVKLFSVSTSAASAICSLNLLKLLEAEIRSADDTLVTLSVFELLYELAEVEHGTEF  242


 Score =   254 bits (649),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 150/182 (82%), Gaps = 3/182 (2%)
 Frame = -3

Query  710  RHVISAAFDCQ---HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKS  540
            RHVI AAFD Q    HG++LAALHALGNI GETRS ND++LD +AEE+L RL+Y+ +SKS
Sbjct  306  RHVIDAAFDQQGPERHGRQLAALHALGNISGETRSENDIILDAEAEENLLRLLYEAASKS  365

Query  539  PKLTPSGLLLSVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKI  360
             KLTPSGL LSVLQQDSEIR+AGYR+I+GLVARPWCL+EI SRQEI+++V +  TET KI
Sbjct  366  SKLTPSGLFLSVLQQDSEIRIAGYRMISGLVARPWCLMEICSRQEIINLVADPSTETTKI  425

Query  359  GMEARHKCCEAVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQ  180
            GMEAR+ CC+ +++S T SS++ +DP+ +G+A KL+EA+  GPYL RK  EAQP+VMT  
Sbjct  426  GMEARYNCCKRIHKSLTHSSRVSADPSFAGIAAKLQEAVGMGPYLNRKRVEAQPIVMTAD  485

Query  179  RF  174
            RF
Sbjct  486  RF  487



>dbj|BAE71213.1| hypothetical protein [Trifolium pratense]
Length=524

 Score =   275 bits (703),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 179/231 (77%), Gaps = 4/231 (2%)
 Frame = -3

Query  854  VISAIDRRFAFL-GSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            VIS+ID R   L    + DEFE ALE+ GQIGL  +GA  LLS +    RHVI AAFD Q
Sbjct  294  VISSIDGRLQSLEDPSNRDEFETALESLGQIGLFIRGAKLLLSGTSPAARHVIDAAFDRQ  353

Query  677  ---HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLS  507
                HG++LAALHALGNI GETRS +D++LD +AE++L RL+Y+T+S+S KLTPSGL LS
Sbjct  354  GPERHGRQLAALHALGNISGETRSESDIILDAEAEDNLLRLLYETASRSSKLTPSGLFLS  413

Query  506  VLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEA  327
            VLQQDSEIR+AGYR+I+GLV+RPWCL+EI SRQEI++IVT+  TET KIGMEAR+ CC+ 
Sbjct  414  VLQQDSEIRIAGYRMISGLVSRPWCLMEICSRQEIINIVTDPSTETTKIGMEARYNCCKR  473

Query  326  VYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +++S T SS + +DPA + +A KL+EA+  GPYL RK  EAQP+VMT  RF
Sbjct  474  IHKSLTQSSGVSADPAFAVIAAKLQEAVGMGPYLHRKRVEAQPIVMTADRF  524


 Score =   270 bits (690),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 145/240 (60%), Positives = 180/240 (75%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             + +QLL+AATDFA+ P   SD SA +FL+RFPLP +INALQ + D PGLE  L  CL ++
Sbjct  3     EQSQLLEAATDFAHYPGSHSDHSATQFLNRFPLPLIINALQTQFDVPGLESTLVQCLQRL  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTD--ETTAVYLILQNGVY  1270
             F+TK GASLIP +MPFV VGL A SQ VR LAC TV+ LL N D   T A +LI +  +Y
Sbjct  63    FKTKLGASLIPQYMPFVQVGLQADSQAVRSLACKTVTCLLKNLDNSHTVAAHLIKEFNIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
              LLL CLI+G+E VAAAAI AIK LA F +G+DI+FP++    T LG +A++CSSLGRVR
Sbjct  123   SLLLDCLINGNEDVAAAAINAIKKLASFPEGMDIVFPSTKGGDTDLGIIASQCSSLGRVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VLAL+VKLFS+ST+ AS +Y+ NLL LLE E+ +A+DTLVTLS  ELLYEL E +H  EF
Sbjct  183   VLALVVKLFSVSTSAASAIYSLNLLKLLEAEIRSADDTLVTLSVFELLYELAEVEHGAEF  242



>gb|AIU50934.1| ARM repeat superfamily protein, partial [Platanus x acerifolia]
Length=281

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 175/234 (75%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL AA++FAY P  Q+D SA++FLDRFPLPA+I+ALQ+K D P LE  L  CL+++FRTK
Sbjct  1     LLDAASEFAYYPGVQNDASAKDFLDRFPLPAIISALQSKVDVPSLESTLVACLERIFRTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YG SLIP +MPF+ VGL A S  +R LAC TVS LL +        L++   VYPLLL C
Sbjct  61    YGTSLIPQYMPFIQVGLRADSHLIRCLACKTVSYLLADAQ------LVI---VYPLLLDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+G+EQVAAA++ AIKNLA F +G+DIIFP          +LAA CSSLGR+RVLALIV
Sbjct  112   LINGNEQVAAASMDAIKNLASFPEGMDIIFP----------NLAASCSSLGRIRVLALIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIST+VAS +YN+NLLSLLE EV N ND L+TLS LELLYEL E  H+ +F
Sbjct  162   KLFSISTSVASIIYNSNLLSLLEAEVSNRNDMLMTLSVLELLYELAEIPHATQF  215



>ref|XP_010098425.1| 26S proteasome non-ATPase regulatory subunit 5 [Morus notabilis]
 gb|EXB75016.1| 26S proteasome non-ATPase regulatory subunit 5 [Morus notabilis]
Length=517

 Score =   268 bits (685),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 179/229 (78%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            R VI+AIDR      ++D DE E ALEA GQIG   +GA  LLSSSP   RH+I+AAFD 
Sbjct  290  RTVIAAIDRILDSSETRDMDECESALEALGQIGSSIQGAQLLLSSSPPSARHIINAAFDR  349

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q  GK+LAALHALGNI GET   N+++LD  +EE+LRRLI++T+SK+ KLTPSGL+LS+L
Sbjct  350  QGRGKQLAALHALGNISGETHPENNMILDNHSEENLRRLIFETASKTSKLTPSGLILSLL  409

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR+ITGLVARPW L+EI S+QEI++IVT+  TET KIGMEAR+ CC+A+ 
Sbjct  410  QQASEIRLAGYRMITGLVARPWFLMEICSKQEIINIVTDANTETTKIGMEARYNCCKAIQ  469

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++  SSSK+ SD + + +A K+ +A++ GPYL RK  EAQPVVMT +RF
Sbjct  470  KALMSSSKVTSDASLAAIAEKVHKAVKMGPYLARK-LEAQPVVMTAERF  517


 Score =   233 bits (594),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 134/245 (55%), Positives = 168/245 (69%), Gaps = 6/245 (2%)
 Frame = -2

Query  1638  EEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EEYSVD   QLLQAA+DFAY    Q+D SA+ FLDRFPLP VINALQ K+D PGLE+ L 
Sbjct  2     EEYSVDDPTQLLQAASDFAYFSGVQNDDSAKNFLDRFPLPVVINALQTKADVPGLENTLV  61

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN-TDETTAVYLIL  1285
              CL+++F+TKYGA LIP +MPFV VGL A SQ VR LAC TV+ LL++  +ET+AV LI 
Sbjct  62    ACLERIFQTKYGAYLIPQYMPFVQVGLKADSQIVRCLACKTVTYLLEHLNEETSAVQLIS  121

Query  1284  QNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSS  1105
                VYPLLL CL++G +Q     +   K    +     +    +++    +  LA     
Sbjct  122   DYDVYPLLLDCLVNGKKQETFGPLNLRKKQETWIGNEQV----ATASMDAIKKLAGFPQG  177

Query  1104  LGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQ  925
             +GRVRVLAL+VKLFS+S++VAS +Y  NLL L E+E+ N NDTLVTL+ LELLYEL E Q
Sbjct  178   MGRVRVLALMVKLFSVSSSVASIIYKLNLLRLFEEEINNTNDTLVTLNVLELLYELSEIQ  237

Query  924   HSMEF  910
             H  EF
Sbjct  238   HGREF  242



>ref|XP_007133203.1| hypothetical protein PHAVU_011G160300g [Phaseolus vulgaris]
 gb|ESW05197.1| hypothetical protein PHAVU_011G160300g [Phaseolus vulgaris]
Length=522

 Score =   267 bits (682),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 177/242 (73%), Gaps = 4/242 (2%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D +QLLQAA+DF++ P  QSD SA+EFL RFPL  +INALQ K D P LE+ L  CL+K+
Sbjct  3     DLSQLLQAASDFSHYPGAQSDDSAREFLSRFPLTLIINALQTKFDVPDLENTLVACLEKL  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAV----YLILQNG  1276
             F TK GASLIP +MPFV VGL A SQ VR L+C TVS LL+N D    V    +LI    
Sbjct  63    FNTKLGASLIPQYMPFVQVGLQAESQAVRSLSCKTVSRLLENIDNDDKVAASAHLIKDFN  122

Query  1275  VYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGR  1096
             +YPLLL C+I GDEQVAA A  AI+ LAGF +G++IIFP+    +T L  +A++CSSLGR
Sbjct  123   IYPLLLDCIIKGDEQVAAVATDAIQKLAGFPEGMEIIFPSGKVGETDLELIASQCSSLGR  182

Query  1095  VRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSM  916
             VRVLAL+V LFS+S + AS VY+ NLL LLE E+ NA+DTLVTL+ LELLYEL   +HS 
Sbjct  183   VRVLALVVNLFSVSRSAASIVYSLNLLKLLEAELRNADDTLVTLNVLELLYELSAIEHST  242

Query  915   EF  910
             EF
Sbjct  243   EF  244


 Score =   249 bits (636),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 170/232 (73%), Gaps = 6/232 (3%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFD-  684
            + VI++ID R   L   D DE E ALE+FG IG   +GA  LLS S    RHVI+AAF+ 
Sbjct  294  KAVIASIDGRLQSLDPSDIDECETALESFGHIGSSTQGATYLLSGSSPAARHVINAAFER  353

Query  683  --CQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
               Q HGK+LAALHALGNI GETRS N+++L+ +AEE+LRRLIY+T+++S KLTPSGL L
Sbjct  354  QGPQGHGKQLAALHALGNISGETRSKNNIILNAEAEENLRRLIYETAARSSKLTPSGLFL  413

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            SV+QQD+EIRLA YR+I+GLVAR WCL+EI S+ +I++ VTN   E+ KIGMEAR+ CC+
Sbjct  414  SVMQQDAEIRLAVYRMISGLVARSWCLMEICSKDDIINRVTNPIIESTKIGMEARYNCCK  473

Query  329  AVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            A+Y++ T S    S  A +    KLE+A++ GPYL + H E QPVV T +RF
Sbjct  474  AIYQTLTLSD---SVSAFTDAYAKLEKAVKMGPYLVKSHGEPQPVVETAKRF  522



>emb|CDX98531.1| BnaC05g38440D [Brassica napus]
Length=519

 Score =   261 bits (668),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 171/240 (71%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  AA +FA+ P PQ D S +EFLDRFPLP + NALQ ++D PG E+ L  CL++V
Sbjct  3     DVNQLFDAAFEFAHYPGPQGDSSVKEFLDRFPLPVIFNALQTETDIPGFENTLVTCLERV  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTD--ETTAVYLILQNGVY  1270
             F+TKYGASLIPH+MP +  GL + S  V+ LAC TV+SLL+N D  + + V LI+ NG+Y
Sbjct  63    FKTKYGASLIPHYMPVLQAGLKSNSAVVKSLACKTVTSLLENRDANDVSPVQLIVSNGIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I  D++VA AA   IK+LA F   + +IFP  +++ THLG+LAA+ SSL RVR
Sbjct  123   PLLLEYIIKSDDEVANAASETIKSLARFPDAMSVIFPTDTNDATHLGNLAARSSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+LIVKLFSIS  VAS V N+ LL LLE E+    DTLV L+ LEL YELVE  HS EF
Sbjct  183   VLSLIVKLFSISPHVASAVKNSGLLDLLEAEMKGTKDTLVILNVLELYYELVEVVHSSEF  242


 Score =   228 bits (580),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 161/229 (70%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAID         D D  E AL+A GQIG   +GA  +LS++P   RHV+++AFD 
Sbjct  292  KALISAIDASLESPEMNDTDAHEAALDALGQIGSTTRGANLVLSTTPPAARHVVASAFDR  351

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
               GK+LAALHAL  I GETR  +  ++D  AEE+LR LIYD +++S KLTPSGL LSVL
Sbjct  352  SALGKQLAALHALAYIAGETRPKSSRIVDEKAEENLRCLIYDVAAQSTKLTPSGLFLSVL  411

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SE+RLAGYR +  LV+RPW L+EI+S++EI++IVT+  TET KI ME R+ CC+A++
Sbjct  412  QQSSEMRLAGYRTLAALVSRPWGLMEILSKEEIINIVTDATTETAKIAMEGRYNCCKAIH  471

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+  + DP R     KL+EA+RSGPY+ +K+ +A+P VM  + F
Sbjct  472  EAFLCSN-FVDDPRRLKTGEKLQEAVRSGPYMSKKYRDARPEVMMAEGF  519



>ref|XP_009146281.1| PREDICTED: uncharacterized protein LOC103869951 [Brassica rapa]
Length=519

 Score =   258 bits (660),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 169/240 (70%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  AA +FA+ P PQ D S +EFLDRFPLP + NALQ ++D PG E  L  CL++V
Sbjct  3     DVNQLFDAAFEFAHYPGPQGDSSVKEFLDRFPLPVIFNALQRETDIPGFETTLVTCLERV  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTD--ETTAVYLILQNGVY  1270
             F+TKYGASLIPH+MP +  GL + S  V+ LAC TV+ LL+N D  + + V LI+ NG+Y
Sbjct  63    FKTKYGASLIPHYMPVLQAGLKSDSAVVKSLACKTVTRLLENRDANDVSPVQLIVSNGIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I  D++VA AA   IK+LA F     +IFP  +++ THLG+LAA+ SSL RVR
Sbjct  123   PLLLEYIIKSDDEVAHAASETIKSLASFPDATSVIFPTDTNDATHLGNLAARSSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+LIVKLFSIS  VAS V N+ LL LLE E+    DTLV L+ LEL YEL+E +HS EF
Sbjct  183   VLSLIVKLFSISPHVASAVKNSGLLDLLEAEMKGTKDTLVILNVLELYYELMEVEHSSEF  242


 Score =   231 bits (588),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 163/229 (71%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + ++SAID         D +  E AL+A GQIG   KGA  +LS++P   RHV+++AFD 
Sbjct  292  KALVSAIDASLESPEMNDTNAHEAALDALGQIGSTTKGANLVLSTTPPAARHVVASAFDR  351

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
               GK+LAALHAL  I GETR  +  ++D  +EE+LR LIYD +++S KLTPSGL LSVL
Sbjct  352  NALGKQLAALHALAYIAGETRPKSSRIVDEKSEENLRCLIYDVAAQSTKLTPSGLFLSVL  411

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SE+RLAGYR +T LVARPW L+EI+S++EI++IVT+  TET KI MEAR+ CC+A++
Sbjct  412  QQSSEMRLAGYRTLTALVARPWGLMEILSKEEIINIVTDATTETAKIAMEARYNCCKAIH  471

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+  + DP R     KL+EA+RSGPY+ +K+ +A+P VM  + F
Sbjct  472  EAFLCSN-FVDDPRRLKTGEKLQEAVRSGPYMSKKYRDARPEVMMAEGF  519



>ref|XP_010675475.1| PREDICTED: uncharacterized protein LOC104891477 [Beta vulgaris 
subsp. vulgaris]
Length=524

 Score =   258 bits (659),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/247 (55%), Positives = 179/247 (72%), Gaps = 2/247 (1%)
 Frame = -2

Query  1644  MEEEYSVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDAL  1465
             M E  + D  QLLQAATDF++ P   +D S +EFLDRFPLP +INALQ K++ PGLE+AL
Sbjct  1     MAEFAAADTDQLLQAATDFSFYPGEYNDASVKEFLDRFPLPVIINALQTKAEVPGLENAL  60

Query  1464  CDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAV--YL  1291
               CL+++F+++YG SLIP +MPF+ VGL A S  VR LAC  VS L +N+++   +   L
Sbjct  61    VTCLERIFKSRYGCSLIPQYMPFLQVGLQANSDAVRCLACKIVSFLFENSNDKAVLPSQL  120

Query  1290  ILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKC  1111
             I+   +YPLLL CLI+GDE+VA A++ AIKN A   +G+  IFPA SSE T L  LAAK 
Sbjct  121   IITYDIYPLLLHCLINGDERVANASMDAIKNFASSPEGIATIFPAESSEATDLRHLAAKY  180

Query  1110  SSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVE  931
              S+GRVR+LALIVKLFS+S  VA+ + ++NLL LLE EV   +DTL TL+ LELL+E+ E
Sbjct  181   PSMGRVRILALIVKLFSVSHAVAAVISSSNLLGLLEAEVRKTDDTLATLNILELLFEMAE  240

Query  930   AQHSMEF  910
              +++ EF
Sbjct  241   TEYATEF  247


 Score =   229 bits (583),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 160/227 (70%), Gaps = 1/227 (0%)
 Frame = -3

Query  854  VISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQH  675
            ++S I  R     + D +E E A+E  G+IG    GA  L+  S   VR + + AFD Q 
Sbjct  299  ILSEIGGRLGSPETIDDNECESAIEVVGEIGSSTSGAELLVLKSLELVRFLSNTAFDRQR  358

Query  674  HGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQ  495
            HGK+LAALHALGNI G  RS   +LL  +AE+ L+RLIY+ +SK+ KLTPSGL LSVLQQ
Sbjct  359  HGKQLAALHALGNIAGANRSEKSILLKREAEDILQRLIYEIASKTSKLTPSGLFLSVLQQ  418

Query  494  DSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYES  315
            DSE R+AGYR+I+ LVARPWCL+E+  RQEI+ +VT+ YTET KIGMEAR+ CC +++++
Sbjct  419  DSENRMAGYRLISSLVARPWCLMEVCLRQEIISMVTHAYTETTKIGMEARYNCCFSIHKA  478

Query  314  FTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
               ++   SD A +G+  KL+EA++ GP+L  ++ +AQP + T+QRF
Sbjct  479  LAITNP-KSDSALAGVLEKLQEAVKRGPFLAERNRDAQPTITTDQRF  524



>emb|CDX97636.1| BnaA05g24430D [Brassica napus]
Length=519

 Score =   255 bits (652),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 168/240 (70%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  AA +FA  P PQ D S +EFLDRFPLP + NALQ ++D PG E  L  CL++V
Sbjct  3     DVNQLFDAAFEFANYPGPQGDSSVKEFLDRFPLPVIFNALQRETDIPGFETTLVTCLERV  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTD--ETTAVYLILQNGVY  1270
             F+TKYGASLIPH+MP +  GL + S  V+ LAC TV+ LL+N D  + + V LI+ NG+Y
Sbjct  63    FKTKYGASLIPHYMPVLQAGLKSDSAVVKSLACKTVTCLLENRDANDVSPVQLIVSNGIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I  D++VA AA   IK+LA F     +IFP  +++ THLG+LAA+ SSL RVR
Sbjct  123   PLLLEYIIKSDDEVAHAASETIKSLARFPDATSVIFPTDTNDATHLGNLAARSSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+LIVKLFSIS  VAS V N+ LL LLE E+    DTLV L+ LEL YEL+E +HS EF
Sbjct  183   VLSLIVKLFSISPHVASAVKNSGLLDLLEAEMKGTKDTLVILNVLELYYELMEVEHSSEF  242


 Score =   230 bits (586),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 163/229 (71%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + ++SAID         D +  E AL+A GQIG   KGA  +LS++P   RHV+++AFD 
Sbjct  292  KALVSAIDASLESPEMNDTNAHEAALDALGQIGSTTKGANLVLSTTPPAARHVVASAFDR  351

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
               GK+LAALHAL  I GETR  +  ++D  +EE+LR LIYD +++S KLTPSGL LSVL
Sbjct  352  NALGKQLAALHALAYIAGETRPKSSRIVDERSEENLRCLIYDVAAQSTKLTPSGLFLSVL  411

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SE+RLAGYR +T LVARPW L+EI+S++EI++IVT+  TET KI MEAR+ CC+A++
Sbjct  412  QQSSEMRLAGYRTLTALVARPWGLMEILSKEEIINIVTDATTETAKIAMEARYNCCKAIH  471

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+  + DP R     KL+EA+RSGPY+ +K+ +A+P VM  + F
Sbjct  472  EAFLCSN-FVDDPRRLKTGEKLQEAVRSGPYMSKKYRDARPEVMMAEGF  519



>gb|AIU50893.1| ARM repeat superfamily protein, partial [Magnolia denudata]
Length=314

 Score =   230 bits (587),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 164/229 (72%), Gaps = 18/229 (8%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            +  + AID R      QD DE E ALEA G IG   +GA+ LLS +   VRHV+ AAFD 
Sbjct  104  KTALLAIDGRL-----QDTDECESALEALGHIGSSNQGASLLLSPA---VRHVVEAAFDR  155

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q   K+LAALHAL NI GE R      L+ DAEE LRRLIY  +++S KLTPSGL LSVL
Sbjct  156  QVRLKQLAALHALANISGENRPR----LNDDAEEFLRRLIYAAAAESSKLTPSGLFLSVL  211

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQDSEIRLA YR+ITGLV RPWCL+E+ S+QEI++IVT+   ET K GMEAR+ CC A+ 
Sbjct  212  QQDSEIRLAAYRMITGLVTRPWCLLEVCSKQEIINIVTD---ETTKKGMEARYNCCTAIN  268

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            ++ ++S+K ++D A SG+ +KL+EA++ GPYL +   EAQPVVMT +RF
Sbjct  269  KALSASNK-VNDAACSGIVSKLQEAVKRGPYLAKD--EAQPVVMTAERF  314


 Score = 73.2 bits (178),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  1101  GRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQH  922
              R+RVLALI KLFSIS++VAS VY++NLL LLE EV + ND L+TLSALELLYEL E+ H
Sbjct  2     ARIRVLALIAKLFSISSSVASAVYHSNLLGLLEAEVNDTNDMLMTLSALELLYELAESPH  61

Query  921   SMEF  910
               EF
Sbjct  62    GTEF  65



>ref|XP_002882918.1| hypothetical protein ARALYDRAFT_478950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59177.1| hypothetical protein ARALYDRAFT_478950 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   253 bits (645),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 167/229 (73%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISA D     +   D D  E A++A GQIG   KGA  +LS+S    RHV+++AFD 
Sbjct  292  KALISATDGSLESVEMNDTDAQEAAIDAIGQIGSTTKGADLVLSTSLPAARHVVASAFDR  351

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HGK+LAALHAL NI GETR  ++ ++DG AEESLR LIYD +++S KLTPSGL LSVL
Sbjct  352  NAHGKQLAALHALANIAGETRPKSNRIVDGKAEESLRCLIYDVAAQSTKLTPSGLFLSVL  411

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR +T LVARPWCL+EI+S++EI++IVT+  TET KI MEAR+ CC+A++
Sbjct  412  QQSSEIRLAGYRTLTALVARPWCLVEILSKEEIINIVTDATTETAKIAMEARYNCCKAIH  471

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+  + DP R     KL+EA+RSGPY+ +KH  A+P VMT + F
Sbjct  472  EAFLCSN-FVDDPRRQKTGEKLQEAVRSGPYMSKKHRGARPEVMTGEGF  519


 Score =   246 bits (629),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 170/240 (71%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  AA +FA+ P  Q++ S +EFLDRFPLP + NALQ   D PG E+ L  CL+++
Sbjct  3     DVNQLFDAAFEFAHYPGAQNEASVKEFLDRFPLPVIFNALQTDPDIPGFENTLVTCLERL  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN--TDETTAVYLILQNGVY  1270
             F+TKYGASLIP +MP + VGL A S  V+ LAC TV  LL+N  T++ + V L++ N +Y
Sbjct  63    FKTKYGASLIPQYMPVLQVGLKADSAIVKSLACKTVLCLLENCDTNDVSPVQLVVSNCIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I+ D++VA AA   IK+LA F   + +IFP+ +++ THL +LAA+CSSL RVR
Sbjct  123   PLLLDYIINSDDEVAHAASETIKSLARFPDAMSVIFPSETNDATHLRNLAARCSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+LIVKLFSIS  VAS++  + LL LLE E+    DTLV L+ LEL YEL+E +HS EF
Sbjct  183   VLSLIVKLFSISRLVASEIKKSGLLDLLEAEMKGTKDTLVILNVLELYYELMEVEHSSEF  242



>gb|AIU50889.1| ARM repeat superfamily protein, partial [Aquilegia coerulea]
Length=280

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 168/234 (72%), Gaps = 20/234 (9%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL+AA+DFA  P  Q+D + ++FLD+FPLP +I+ALQ K D P LE  L  CL++VF TK
Sbjct  1     LLEAASDFASYPGFQNDEAVKKFLDKFPLPVIISALQCKGDVPSLETTLVACLERVFNTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIP FM FV VGL A SQ VRRLAC TVS  L+N        L++   +YPLLL C
Sbjct  61    YGASLIPQFMSFVQVGLQAESQIVRRLACKTVSCFLENA-------LVI---IYPLLLDC  110

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L++ DE VA A+  AIK+LA + +G+++IF           +LA++CSSLGR+RVL+LIV
Sbjct  111   LVNSDELVAKASTDAIKSLAKYPEGMEVIF----------DNLASRCSSLGRIRVLSLIV  160

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS+STTVAS +YN+NLLSL E E+ NAND L TLS LELLYEL E+ H  +F
Sbjct  161   KLFSVSTTVASTIYNSNLLSLFEAEILNANDMLATLSVLELLYELSESPHGTDF  214



>ref|XP_006407004.1| hypothetical protein EUTSA_v10020515mg [Eutrema salsugineum]
 gb|ESQ48457.1| hypothetical protein EUTSA_v10020515mg [Eutrema salsugineum]
Length=519

 Score =   252 bits (644),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 170/240 (71%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  +A +FA+ P PQ + S +EFLDRFPLP + NALQ ++D PG E  L  CL++V
Sbjct  3     DVNQLFDSAFEFAHYPGPQGEASVKEFLDRFPLPVIFNALQTETDIPGFESTLVTCLERV  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTD--ETTAVYLILQNGVY  1270
             F+TKYGASLIP +M  +  GL A S  V+ LAC TVS LL+N D  + + V+L++ NG+Y
Sbjct  63    FKTKYGASLIPQYMAVLQAGLKADSAVVKSLACKTVSCLLENCDANDGSPVHLVVSNGIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I  D++VA AA   IK+LA F   + +IFPA +++ THLG+LAA+ SSL RVR
Sbjct  123   PLLLEYIIKSDDEVAHAASETIKSLARFPDAMSVIFPAETNDSTHLGNLAARSSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+LIVKLFSIS  VAS V  + LL+LLE E+    DTLV L+ LEL YE++E +HS EF
Sbjct  183   VLSLIVKLFSISPDVASAVKKSGLLNLLEAEMKGTKDTLVILNVLELYYEVMEVEHSSEF  242


 Score =   238 bits (607),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/229 (55%), Positives = 164/229 (72%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAID         D D  E AL+A GQIG   KGA+ +L++SP   RHV+S+AFD 
Sbjct  292  KALISAIDGSLESPDMNDTDAQEAALDAIGQIGSSTKGASLVLANSPPAARHVVSSAFDR  351

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HG++LAALHAL  I GETR+ +  ++D  AEESLR LIYD +++S KLTPSGL LSVL
Sbjct  352  NAHGRQLAALHALAYIAGETRAKSSRIVDEKAEESLRCLIYDVAAQSTKLTPSGLFLSVL  411

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR +  LVARPW L+EI+S++EI++IVT+   ET KI MEAR+ CC++++
Sbjct  412  QQSSEIRLAGYRTLAALVARPWGLMEILSKEEIINIVTDSTIETAKIAMEARYNCCKSIH  471

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F SSS  + DP R     KL+EA+RSGPY+ +K+ EA P VM  + F
Sbjct  472  EAFLSSS-FVDDPRRLKTGEKLQEAVRSGPYMSKKYREAIPEVMMAEGF  519



>ref|NP_566503.1| ARM repeat superfamily protein [Arabidopsis thaliana]
 gb|AAP21298.1| At3g15180 [Arabidopsis thaliana]
 dbj|BAE99435.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75628.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=519

 Score =   252 bits (644),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAID     +   D D  E A++A GQ+G   KGA  +LS+SP   RHV+++AFD 
Sbjct  292  KALISAIDGSLESVEMNDTDAQEAAIDALGQMGSTTKGADLVLSTSPPAARHVVASAFDR  351

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HGK+LAALHAL NI GETR  ++ ++DG AEESLR LIYD +++S KLTPSGL LSVL
Sbjct  352  NAHGKQLAALHALANIAGETRPKSNRIVDGKAEESLRCLIYDAAAQSTKLTPSGLFLSVL  411

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR +T LVARPWCL+EI++++EI++IVT+  TET KI MEAR+ CC+A++
Sbjct  412  QQSSEIRLAGYRTLTALVARPWCLVEILAKEEIINIVTDATTETAKIAMEARYNCCKAIH  471

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+  + DP R     KL+EA+RSGPY+ +KH  A+P VMT + F
Sbjct  472  EAFLCSN-FVDDPRRLKTGDKLQEAVRSGPYMSKKHRGARPEVMTGEGF  519


 Score =   249 bits (637),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 172/240 (72%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  AA +FA+ P  Q++ S +EFLDRFPLP + NALQ   D PG E+ L  CL+++
Sbjct  3     DVNQLFDAAFEFAHYPGAQNETSVKEFLDRFPLPVIFNALQTDPDIPGFENTLVTCLERL  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN--TDETTAVYLILQNGVY  1270
             F+TKYGASLIP +MP + VGL A S  V+ LAC TV  LL++  T++ ++V L++ NG+Y
Sbjct  63    FKTKYGASLIPQYMPVLQVGLKADSAVVKSLACKTVLCLLEDCDTNDVSSVQLVVNNGIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I+ D++VA AA   IK+LA F   + +IFP+ +++ THL +LAA+CSSL RVR
Sbjct  123   PLLLDYIINSDDEVANAASETIKSLARFPDAMSVIFPSETNDPTHLRNLAARCSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+LIVKLFSIS  VAS+V  + LL LLE E+    DTLV L+ LEL YEL+E +HS EF
Sbjct  183   VLSLIVKLFSISRLVASEVKKSGLLDLLEAEMKGTKDTLVILNVLELYYELMEVEHSSEF  242



>ref|XP_009392535.1| PREDICTED: uncharacterized protein LOC103978467 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   252 bits (643),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 179/246 (73%), Gaps = 1/246 (0%)
 Frame = -2

Query  1644  MEEEYSVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDAL  1465
             ME +  +D A +L+AA++FA  P  Q+D SA+EFLDRFPL  + + LQ K+D PG ED +
Sbjct  1     MEVDPPLDLAPVLEAASEFASYPGLQNDASAKEFLDRFPLHTLFSVLQTKADVPGTEDTM  60

Query  1464  CDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNT-DETTAVYLI  1288
               CLDK+FRTKYGASL+  + PF+ VGL A SQ VRRLAC  VS LL+NT D   A+ +I
Sbjct  61    VSCLDKIFRTKYGASLLLDYAPFIQVGLQANSQAVRRLACKAVSYLLENTGDRVGALQII  120

Query  1287  LQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCS  1108
             +   VYPLLLSCL+DGDEQ +AA++ A+K++A   +G+ IIFP        + ++A + S
Sbjct  121   VAYNVYPLLLSCLVDGDEQTSAASLEAVKDIAQSPEGISIIFPGHGEGPFLIKNIAVQSS  180

Query  1107  SLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEA  928
             SL R+R+LAL+ KLF++S+++A+ VY++NLL+L E E+ N +D L TLSALELLYELVE+
Sbjct  181   SLARIRILALVAKLFALSSSLATAVYSSNLLNLFEVEINNGHDMLTTLSALELLYELVES  240

Query  927   QHSMEF  910
              HS  F
Sbjct  241   PHSSMF  246


 Score =   236 bits (601),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 160/227 (70%), Gaps = 2/227 (1%)
 Frame = -3

Query  854  VISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQH  675
            +++AID R   LG Q+ DE+E ALEA G IG   +GA  LLSSSP   RHVI +AFD   
Sbjct  298  LLAAIDERLKVLGGQNTDEYESALEALGLIGAISQGATLLLSSSPVA-RHVIESAFDRHS  356

Query  674  HGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQ  495
             GK+LA LHAL +I G  R  + +LLD  AEE+LRRLIY  ++ + KL PSGL+LS+L+Q
Sbjct  357  RGKQLAGLHALASICGVDRPEDKMLLDSKAEENLRRLIYTAAANTSKLNPSGLILSILRQ  416

Query  494  DSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYES  315
            + EIRLAGYR+I+GLV RPWCL+EI    EI+ IVT+   ET K GM+ARH CC  +  +
Sbjct  417  EPEIRLAGYRLISGLVVRPWCLMEICLNPEIITIVTDAKIETAKTGMDARHHCCTVISTA  476

Query  314  FTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
              SSS L+ D A +  A KL+EA+R GPY+ ++H EAQP+VMT +RF
Sbjct  477  L-SSSNLLQDAAVARTAAKLQEAVRRGPYVIKEHVEAQPIVMTAERF  522



>ref|XP_008801497.1| PREDICTED: uncharacterized protein LOC103715588 isoform X2 [Phoenix 
dactylifera]
Length=502

 Score =   251 bits (641),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 176/237 (74%), Gaps = 1/237 (0%)
 Frame = -2

Query  1617  AQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFR  1438
             A LL+AA+DFA  P  Q+D SA++FLDR+PL  +   LQ K+D PGLED +  CLD++FR
Sbjct  12    APLLEAASDFASYPGFQNDASAKQFLDRYPLTVLFGVLQTKADVPGLEDTVVACLDRIFR  71

Query  1437  TKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVY-LILQNGVYPLL  1261
             TKYGASL+ ++ PF+  GL A SQ VR LAC  VS +L NT+++ AV  +I+   +YPLL
Sbjct  72    TKYGASLLTNYAPFIQAGLQANSQTVRCLACKAVSYILQNTEDSAAVVQIIVGYNIYPLL  131

Query  1260  LSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLA  1081
             ++CL++G+EQ + A++ AI N+A   +G+ IIFPA S+E   L ++AA+ SSL R+R+LA
Sbjct  132   INCLLEGNEQTSKASLDAITNIAQAPEGIGIIFPAHSAESMQLNNVAARSSSLARIRILA  191

Query  1080  LIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             LI KLFS+S++VA+ VYN+NLL+L E E+ N +D L TLSALELLYELV + HS  F
Sbjct  192   LIAKLFSLSSSVATAVYNSNLLNLFEIEINNKHDMLTTLSALELLYELVSSPHSSSF  248


 Score =   202 bits (515),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 135/187 (72%), Gaps = 0/187 (0%)
 Frame = -3

Query  854  VISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQH  675
            ++ AID R   LG Q+ DE E ALEA G IG   +GAA LL++     RHV  +AFD Q 
Sbjct  300  LLFAIDGRLKLLGGQNTDECESALEALGLIGATNQGAALLLTNPSVVARHVFESAFDRQS  359

Query  674  HGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQ  495
             G++LAALHALG+I G  R  +++LL+  AEE LRR IY T++ SPKLTPSGLLLSVLQQ
Sbjct  360  RGRQLAALHALGSICGVDRPQDNMLLNDKAEECLRRFIYATAAGSPKLTPSGLLLSVLQQ  419

Query  494  DSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYES  315
            + E+RLAGYR+I+ LVAR WCL E+ S+QEI+ IVT+   E  K GMEARH+CC A+ E+
Sbjct  420  EPELRLAGYRLISALVARSWCLREVCSKQEIITIVTDATIEDTKNGMEARHQCCTAISEA  479

Query  314  FTSSSKL  294
             ++S+ L
Sbjct  480  LSTSNLL  486



>ref|XP_008801496.1| PREDICTED: uncharacterized protein LOC103715588 isoform X1 [Phoenix 
dactylifera]
Length=525

 Score =   251 bits (641),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 176/237 (74%), Gaps = 1/237 (0%)
 Frame = -2

Query  1617  AQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFR  1438
             A LL+AA+DFA  P  Q+D SA++FLDR+PL  +   LQ K+D PGLED +  CLD++FR
Sbjct  12    APLLEAASDFASYPGFQNDASAKQFLDRYPLTVLFGVLQTKADVPGLEDTVVACLDRIFR  71

Query  1437  TKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVY-LILQNGVYPLL  1261
             TKYGASL+ ++ PF+  GL A SQ VR LAC  VS +L NT+++ AV  +I+   +YPLL
Sbjct  72    TKYGASLLTNYAPFIQAGLQANSQTVRCLACKAVSYILQNTEDSAAVVQIIVGYNIYPLL  131

Query  1260  LSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLA  1081
             ++CL++G+EQ + A++ AI N+A   +G+ IIFPA S+E   L ++AA+ SSL R+R+LA
Sbjct  132   INCLLEGNEQTSKASLDAITNIAQAPEGIGIIFPAHSAESMQLNNVAARSSSLARIRILA  191

Query  1080  LIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             LI KLFS+S++VA+ VYN+NLL+L E E+ N +D L TLSALELLYELV + HS  F
Sbjct  192   LIAKLFSLSSSVATAVYNSNLLNLFEIEINNKHDMLTTLSALELLYELVSSPHSSSF  248


 Score =   246 bits (627),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 164/227 (72%), Gaps = 1/227 (0%)
 Frame = -3

Query  854  VISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQH  675
            ++ AID R   LG Q+ DE E ALEA G IG   +GAA LL++     RHV  +AFD Q 
Sbjct  300  LLFAIDGRLKLLGGQNTDECESALEALGLIGATNQGAALLLTNPSVVARHVFESAFDRQS  359

Query  674  HGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQ  495
             G++LAALHALG+I G  R  +++LL+  AEE LRR IY T++ SPKLTPSGLLLSVLQQ
Sbjct  360  RGRQLAALHALGSICGVDRPQDNMLLNDKAEECLRRFIYATAAGSPKLTPSGLLLSVLQQ  419

Query  494  DSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYES  315
            + E+RLAGYR+I+ LVAR WCL E+ S+QEI+ IVT+   E  K GMEARH+CC A+ E+
Sbjct  420  EPELRLAGYRLISALVARSWCLREVCSKQEIITIVTDATIEDTKNGMEARHQCCTAISEA  479

Query  314  FTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
              S+S L+ D   + +A KL+EA+R GPYL +KH EAQP+V+T +RF
Sbjct  480  L-STSNLLRDTHIAEIAGKLQEAVRRGPYLAKKHTEAQPLVITAERF  525



>ref|XP_006297436.1| hypothetical protein CARUB_v10013459mg [Capsella rubella]
 gb|EOA30334.1| hypothetical protein CARUB_v10013459mg [Capsella rubella]
Length=519

 Score =   251 bits (640),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 171/240 (71%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  AA +FA+ P  Q++ S +EFLDRFPLP +  ALQ   D PG E+ L  CL+++
Sbjct  3     DVNQLFDAAFEFAHYPGVQNEASVKEFLDRFPLPVIFKALQTDPDIPGFENTLVTCLERL  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN--TDETTAVYLILQNGVY  1270
             F+TKYGASLIP +MP + VGL A S  V+ LAC TV  LL+N  T++ + V L++ NG+Y
Sbjct  63    FKTKYGASLIPQYMPVLQVGLKADSAVVKSLACKTVLCLLENCDTNDVSPVQLVVSNGIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I+ D++VA AA   IK+LA F   + IIFP+ +++ THL +LAA+CSSL RVR
Sbjct  123   PLLLDYIINSDDEVAHAASETIKSLARFPDAMSIIFPSETNDATHLRNLAARCSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+L+VKLFSIS  VAS+V N+ LL LLE E+    DTLV L+ LEL YEL+E +HS EF
Sbjct  183   VLSLVVKLFSISRNVASEVKNSGLLDLLEAEMKGTKDTLVILNVLELYYELMEVEHSSEF  242


 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 166/229 (72%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAID     +   D D  E A++A GQIG   KGA  +LS+SP   RHV+++AFD 
Sbjct  292  KALISAIDGSLEAVEMNDNDAQEAAIDALGQIGSTTKGAHLVLSTSPPAARHVVASAFDR  351

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HGK+LAALHAL NI GETR  ++ ++DG AEESLR LIYD +++S KLTPSGL L VL
Sbjct  352  NAHGKQLAALHALANIAGETRPKSNRIVDGKAEESLRCLIYDVAAQSTKLTPSGLFLVVL  411

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR +T LVARPWCL+EI+S+ EI++IVT+  TETEKI MEAR+ CC++++
Sbjct  412  QQSSEIRLAGYRTLTALVARPWCLVEILSKAEIINIVTDATTETEKIAMEARYNCCKSIH  471

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+    D        KL+EA+++GPY+ +K+ +A+P VMT + F
Sbjct  472  EAFLCSN-FADDSRHLKTGEKLQEAVQNGPYMSKKYRDARPEVMTGEGF  519



>ref|NP_001189898.1| ARM repeat superfamily protein [Arabidopsis thaliana]
 gb|AEE75629.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=551

 Score =   251 bits (641),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAID     +   D D  E A++A GQ+G   KGA  +LS+SP   RHV+++AFD 
Sbjct  324  KALISAIDGSLESVEMNDTDAQEAAIDALGQMGSTTKGADLVLSTSPPAARHVVASAFDR  383

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HGK+LAALHAL NI GETR  ++ ++DG AEESLR LIYD +++S KLTPSGL LSVL
Sbjct  384  NAHGKQLAALHALANIAGETRPKSNRIVDGKAEESLRCLIYDAAAQSTKLTPSGLFLSVL  443

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR +T LVARPWCL+EI++++EI++IVT+  TET KI MEAR+ CC+A++
Sbjct  444  QQSSEIRLAGYRTLTALVARPWCLVEILAKEEIINIVTDATTETAKIAMEARYNCCKAIH  503

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+  + DP R     KL+EA+RSGPY+ +KH  A+P VMT + F
Sbjct  504  EAFLCSN-FVDDPRRLKTGDKLQEAVRSGPYMSKKHRGARPEVMTGEGF  551


 Score =   248 bits (634),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 172/240 (72%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  AA +FA+ P  Q++ S +EFLDRFPLP + NALQ   D PG E+ L  CL+++
Sbjct  3     DVNQLFDAAFEFAHYPGAQNETSVKEFLDRFPLPVIFNALQTDPDIPGFENTLVTCLERL  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN--TDETTAVYLILQNGVY  1270
             F+TKYGASLIP +MP + VGL A S  V+ LAC TV  LL++  T++ ++V L++ NG+Y
Sbjct  63    FKTKYGASLIPQYMPVLQVGLKADSAVVKSLACKTVLCLLEDCDTNDVSSVQLVVNNGIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I+ D++VA AA   IK+LA F   + +IFP+ +++ THL +LAA+CSSL RVR
Sbjct  123   PLLLDYIINSDDEVANAASETIKSLARFPDAMSVIFPSETNDPTHLRNLAARCSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+LIVKLFSIS  VAS+V  + LL LLE E+    DTLV L+ LEL YEL+E +HS EF
Sbjct  183   VLSLIVKLFSISRLVASEVKKSGLLDLLEAEMKGTKDTLVILNVLELYYELMEVEHSSEF  242



>gb|AAM65463.1| unknown [Arabidopsis thaliana]
Length=519

 Score =   250 bits (639),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 168/229 (73%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAID     +   D D  E A++A GQ+G   KGA  +LS+SP   RHV+++AFD 
Sbjct  292  KALISAIDGSLESVEMNDTDAQEAAIDALGQMGSTTKGADLVLSTSPPAARHVVASAFDR  351

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HGK+LAALHAL NI GETR  ++ ++DG AEESLR LIYD +++S KLTPSGL LSVL
Sbjct  352  NAHGKQLAALHALANIAGETRPKSNRIVDGKAEESLRCLIYDAAAQSTKLTPSGLFLSVL  411

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR +T LVARPWCL+EI++++EI++IVT+  TET KI MEAR+ CC+A++
Sbjct  412  QQSSEIRLAGYRTLTALVARPWCLVEILAKEEIINIVTDATTETAKIAMEARYNCCKAIH  471

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F   +  + DP R     KL+EA+RSGPY+ +KH  A+P VMT + F
Sbjct  472  EAFLCGN-FVDDPRRLKTGDKLQEAVRSGPYMSKKHRGARPEVMTGEGF  519


 Score =   248 bits (634),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 172/240 (72%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  AA +FA+ P  Q++ S +EFLDRFPLP + NALQ   D PG E+ L  CL+++
Sbjct  3     DVNQLFDAAFEFAHYPGAQNETSVKEFLDRFPLPVIFNALQTDPDIPGFENTLVTCLERL  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN--TDETTAVYLILQNGVY  1270
             F+TKYGASLIP +MP + VGL A S  V+ LAC TV  LL++  T++ ++V L++ NG+Y
Sbjct  63    FKTKYGASLIPQYMPVLQVGLKADSAVVKSLACKTVLCLLEDCDTNDVSSVQLVVNNGIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I+ D++VA AA   IK+LA F   + +IFP+ +++ THL +LAA+CSSL RVR
Sbjct  123   PLLLDYIINSDDEVANAASETIKSLARFPDAMSVIFPSETNDPTHLRNLAARCSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+LIVKLFSIS  VAS+V  + +L LLE E+    DTLV L+ LEL YEL+E +HS EF
Sbjct  183   VLSLIVKLFSISRLVASEVKKSGILDLLEAEMKGTKDTLVILNVLELYYELMEVEHSSEF  242



>dbj|BAB02572.1| unnamed protein product [Arabidopsis thaliana]
Length=566

 Score =   251 bits (641),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAID     +   D D  E A++A GQ+G   KGA  +LS+SP   RHV+++AFD 
Sbjct  339  KALISAIDGSLESVEMNDTDAQEAAIDALGQMGSTTKGADLVLSTSPPAARHVVASAFDR  398

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HGK+LAALHAL NI GETR  ++ ++DG AEESLR LIYD +++S KLTPSGL LSVL
Sbjct  399  NAHGKQLAALHALANIAGETRPKSNRIVDGKAEESLRCLIYDAAAQSTKLTPSGLFLSVL  458

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR +T LVARPWCL+EI++++EI++IVT+  TET KI MEAR+ CC+A++
Sbjct  459  QQSSEIRLAGYRTLTALVARPWCLVEILAKEEIINIVTDATTETAKIAMEARYNCCKAIH  518

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+  + DP R     KL+EA+RSGPY+ +KH  A+P VMT + F
Sbjct  519  EAFLCSN-FVDDPRRLKTGDKLQEAVRSGPYMSKKHRGARPEVMTGEGF  566


 Score =   236 bits (602),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 165/231 (71%), Gaps = 2/231 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  AA +FA+ P  Q++ S +EFLDRFPLP + NALQ   D PG E+ L  CL+++
Sbjct  3     DVNQLFDAAFEFAHYPGAQNETSVKEFLDRFPLPVIFNALQTDPDIPGFENTLVTCLERL  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN--TDETTAVYLILQNGVY  1270
             F+TKYGASLIP +MP + VGL A S  V+ LAC TV  LL++  T++ ++V L++ NG+Y
Sbjct  63    FKTKYGASLIPQYMPVLQVGLKADSAVVKSLACKTVLCLLEDCDTNDVSSVQLVVNNGIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I+ D++VA AA   IK+LA F   + +IFP+ +++ THL +LAA+CSSL RVR
Sbjct  123   PLLLDYIINSDDEVANAASETIKSLARFPDAMSVIFPSETNDPTHLRNLAARCSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYEL  937
             VL+LIVKLFSIS  VAS+V  + LL LLE E+    DTLV L+ LEL YE+
Sbjct  183   VLSLIVKLFSISRLVASEVKKSGLLDLLEAEMKGTKDTLVILNVLELYYEM  233



>ref|XP_008386323.1| PREDICTED: uncharacterized protein LOC103448838 [Malus domestica]
Length=329

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = -3

Query  869  LGYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAA  690
            L  + V+SAIDR  +   +Q+ DE E ALEA GQIG   +GA  LLSSSP   RHVI AA
Sbjct  125  LNLKTVLSAIDRILSSSETQEIDECESALEALGQIGSSTQGAQRLLSSSPPVARHVIYAA  184

Query  689  FDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLL  510
            FD    GK+LAALHALGNI GETRS N ++L  DAEESLRRLIY+T+SKS KLTPSGL L
Sbjct  185  FDRHGRGKQLAALHALGNISGETRSANSMILTSDAEESLRRLIYETASKSSKLTPSGLFL  244

Query  509  SVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCE  330
            SVL+QD EIRLAGYR+++GLVARPWCL+EI S+QEI++IVT+  TET K+ MEAR+ CC+
Sbjct  245  SVLKQDLEIRLAGYRMLSGLVARPWCLMEICSKQEIINIVTDPITETTKLAMEARYNCCK  304

Query  329  AVYESFTSSSKLMSDPARSGLA  264
            A++ +F  SSKL  D + SG+A
Sbjct  305  AIHTAFNMSSKLAGDQSLSGIA  326


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  1101  GRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQH  922
             GRVRVLALIVKLFSIST VAS V  +NLL L E E+ N NDTL TLS LELLYEL E +H
Sbjct  16    GRVRVLALIVKLFSISTNVASVVQKSNLLGLFEAEINNPNDTLSTLSILELLYELTEIEH  75

Query  921   SMEF  910
               EF
Sbjct  76    GREF  79



>ref|XP_010465467.1| PREDICTED: uncharacterized protein LOC104745812 [Camelina sativa]
Length=519

 Score =   248 bits (633),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 171/236 (72%), Gaps = 1/236 (0%)
 Frame = -3

Query  881  LVQ*LGYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHV  702
            +V+    + +ISAI      +   D D  E A++A GQIG   KGA  +LS+SP   RHV
Sbjct  285  VVEETSVKALISAIVGSLESVEINDTDAQEVAIDALGQIGSTTKGANLVLSTSPPAARHV  344

Query  701  ISAAFDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPS  522
            ++ AFD   HGK+LAALHAL NI GETR  ++ ++DG AEESLR LIYD +++S KLTPS
Sbjct  345  VATAFDRNAHGKQLAALHALANIAGETRPKSNRIVDGKAEESLRWLIYDVAAESTKLTPS  404

Query  521  GLLLSVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARH  342
            GL LSVLQQ SEIRLAGYR +T LVARPWCL+EI+S++EI++IVT+  TE+EKI MEAR+
Sbjct  405  GLFLSVLQQSSEIRLAGYRALTALVARPWCLVEILSKEEIINIVTDATTESEKIAMEARY  464

Query  341  KCCEAVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             CC++++E+F  S+  + DP R     KL+EA+RSGPY+ +K+ +A+P V T Q F
Sbjct  465  NCCKSIHEAFLCSN-FVDDPRRLKTGEKLQEAVRSGPYMSKKYRDARPEVKTGQGF  519


 Score =   247 bits (630),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 170/240 (71%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  AA +FA  P  Q++ S +EFLDRFPLP +  ALQ   D PG E+ L  CL+++
Sbjct  3     DVNQLFDAAFEFANYPGVQNEASVKEFLDRFPLPVIFKALQTDPDIPGFENTLVTCLERL  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN--TDETTAVYLILQNGVY  1270
             F+TKYGASLIP +MP + VGL A S  V+ LAC TV  LL+N  T++ + V L++ NG++
Sbjct  63    FKTKYGASLIPQYMPVLQVGLKADSAVVKSLACKTVLCLLENCDTNDVSPVQLVVSNGIH  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I+ D++VA AA   IK+LA F   + +IFP+ +++ THL +LAA+CSSL RVR
Sbjct  123   PLLLDYIINSDDEVAHAASETIKSLARFPDAMSVIFPSDTNDATHLRNLAARCSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+L+VKLFSIS  VAS++ N+ LL LLE E+    DTLV L+ LEL YELVE +HS EF
Sbjct  183   VLSLVVKLFSISRVVASEIKNSGLLDLLEAEMKGTKDTLVILNVLELYYELVEVEHSSEF  242



>ref|XP_010487337.1| PREDICTED: uncharacterized protein LOC104765340 [Camelina sativa]
Length=519

 Score =   248 bits (632),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 171/240 (71%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  AA +FA+ P  Q++ S +EFLDRFPLP +  ALQ   D PG E+ L  CL+++
Sbjct  3     DVNQLFDAAFEFAHYPGVQNEASVKEFLDRFPLPVIFKALQTDPDIPGFENTLVTCLERL  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN--TDETTAVYLILQNGVY  1270
             F+TKYGASLIP +MP + VGL A S  V+ LAC TV  LL+N  T++ + V L++ NG+Y
Sbjct  63    FKTKYGASLIPQYMPVLQVGLKANSAVVKSLACKTVLCLLENCDTNDVSPVQLVVSNGIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I+ D++VA AA   IK+LA F   + +IFP+ +++ T+L +LAA+CSSL RVR
Sbjct  123   PLLLDYIINSDDEVAHAASETIKSLARFPDAMSVIFPSDTNDATNLRNLAARCSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+L+VKLFSIS  VAS++ N+ LL LLE E+    DTLV L+ LEL YELVE +HS EF
Sbjct  183   VLSLVVKLFSISRVVASEIKNSGLLDLLEAEMKGTKDTLVILNVLELYYELVEVEHSSEF  242


 Score =   245 bits (626),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAI      +   D D  E A++A GQIG   KGA  LLS+SP   RHV+++AFD 
Sbjct  292  KTLISAIVGSLESVEINDTDAQEVAIDALGQIGSTTKGATLLLSTSPPAARHVVASAFDR  351

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HGK+LAALHAL NI GETR  ++ ++DG AEESLR LIYD +++S KLTPSGL LSVL
Sbjct  352  NAHGKQLAALHALANIAGETRPKSNRIVDGKAEESLRCLIYDVAAESTKLTPSGLFLSVL  411

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR +T LV+RPWCL+EI+S++EI++IVT+  TE+EKI MEAR+ CC++++
Sbjct  412  QQSSEIRLAGYRTLTALVSRPWCLVEILSKEEILNIVTDATTESEKIAMEARYNCCKSIH  471

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+  + DP R     KL+EA+RSGPY+ +K+ +A+P V T + F
Sbjct  472  EAFLCST-FVDDPRRLKTGEKLQEAVRSGPYMSKKYRDARPEVKTGEGF  519



>ref|XP_010917987.1| PREDICTED: uncharacterized protein LOC105042456 isoform X1 [Elaeis 
guineensis]
Length=529

 Score =   247 bits (631),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 181/252 (72%), Gaps = 3/252 (1%)
 Frame = -2

Query  1656  LKTAMEEEYSV--DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYP  1483
             +  AME+E +   + A LL+AA+DFA  P  Q+D SA++FLDR+PL  +   LQ K+D P
Sbjct  1     MAAAMEDEGAPLPELASLLEAASDFASYPGFQNDASAKQFLDRYPLTVLFGVLQTKADVP  60

Query  1482  GLEDALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNT-DET  1306
             GLED +  CL+++F+TKYGASL+ ++ PF+  GL A SQ VR LAC  VS +L NT D  
Sbjct  61    GLEDTIVACLERIFKTKYGASLLTNYAPFIQAGLQANSQTVRCLACKAVSYILQNTEDSV  120

Query  1305  TAVYLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGD  1126
              AV +I+   +YPLL++CL++G+EQ + A++ AI N+A   +G+ IIFPA S E   L +
Sbjct  121   AAVQIIVGYSIYPLLINCLLEGNEQTSNASLDAITNIAQVPEGISIIFPAHSVESVQLKN  180

Query  1125  LAAKCSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELL  946
             +AA+ SSL R+R+LALI KLFS+S++VA+ VYN+NLL+L E E+ N +D L TLSA+ELL
Sbjct  181   VAAQSSSLARIRILALIAKLFSLSSSVATAVYNSNLLNLFEIEINNKHDMLTTLSAMELL  240

Query  945   YELVEAQHSMEF  910
             YELV + +S  F
Sbjct  241   YELVSSPYSSSF  252


 Score =   234 bits (597),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 162/224 (72%), Gaps = 1/224 (0%)
 Frame = -3

Query  845  AIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHHGK  666
            AID     LG Q+ DE E ALEA G IG   +GAA LL++     RHV  +AF+ Q  GK
Sbjct  307  AIDGELKLLGGQNTDECESALEALGLIGATNQGAALLLTNPSVVARHVFESAFNRQSRGK  366

Query  665  RLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSE  486
            +LAALHALG+I G  R  + +LLD  AEE LRR IY T++ SPKLTPSGLLLS+LQQ+ +
Sbjct  367  QLAALHALGSICGVDRPEDSMLLDDKAEECLRRFIYATAASSPKLTPSGLLLSLLQQEPD  426

Query  485  IRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTS  306
            +RLAGYR+I+GLVAR WCL+E+ S+QEI+ IVT+   E  K GMEAR++CC A+ ++  S
Sbjct  427  LRLAGYRLISGLVARSWCLMEVCSKQEIITIVTDATIEDTKNGMEARYQCCTAISKAL-S  485

Query  305  SSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +S L+ D   + LA KL+EA+R GPYL +KH EAQPVV+T +RF
Sbjct  486  TSNLVHDTPIAELAGKLQEAVRRGPYLAKKHVEAQPVVITAERF  529



>gb|KFK38863.1| hypothetical protein AALP_AA3G170300 [Arabis alpina]
Length=519

 Score =   244 bits (623),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 168/240 (70%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  +A +FA+ P  QS+ S +EFLDRFPLP +  ALQ   D PG E+ +  CL++V
Sbjct  3     DVNQLFDSAFEFAHYPGVQSEASVKEFLDRFPLPVIFYALQTDPDIPGFENTIVTCLERV  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTD--ETTAVYLILQNGVY  1270
             F+TKYGAS IPH+MP + VGL A S  V+ LAC TV+ LL+N D  + + V LI+ NG+Y
Sbjct  63    FKTKYGASQIPHYMPVLQVGLKADSTVVKSLACKTVTCLLENCDVNDVSPVQLIVSNGIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PLLL  +I+ D+ VA AA   IK+LA F   + +IFPA +++  HL +LAA+ SSL RVR
Sbjct  123   PLLLDYIINSDDDVANAASETIKSLARFPDAMSVIFPAETNDAAHLRNLAARSSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+LIVKLF+IS  VAS V N+ LL +LE E+ +  DTLV L+ LEL YEL+E +HS EF
Sbjct  183   VLSLIVKLFAISPHVASSVKNSGLLGVLETEMKSTKDTLVILNVLELYYELMEVEHSSEF  242


 Score =   229 bits (584),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 160/229 (70%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAID         D D  E AL+A GQIG   KGA  +LSSSP   RHV++ AFD 
Sbjct  292  KALISAIDGSLESPEMNDTDAQEAALDALGQIGSTTKGANLVLSSSPPAARHVVAYAFDR  351

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
               GK+LAALHAL  I GETR  +  ++DG AEESLR LIYD +++S KLTPSGL LSVL
Sbjct  352  NAQGKQLAALHALAYIAGETRPKSSRIVDGKAEESLRCLIYDVAAQSTKLTPSGLFLSVL  411

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SE+RLA YR +  LVARPW L+EI+S++EI++IVT+   ET KI MEAR+ CC++++
Sbjct  412  QQSSEMRLACYRTLDALVARPWGLLEILSKEEIINIVTDATVETAKIAMEARYNCCKSIH  471

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F SS+  + DP R     KL+EA+RSGPY+ +K+  A+P VM  + F
Sbjct  472  EAFLSSN-FVDDPRRLKTGEKLQEAVRSGPYMSKKYKGARPEVMMAEGF  519



>ref|XP_010502588.1| PREDICTED: uncharacterized protein LOC104779866 [Camelina sativa]
Length=519

 Score =   243 bits (619),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 165/229 (72%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + +ISAI      +   D D  E A++A GQIG   KGA  +LS+SP    HV++ AFD 
Sbjct  292  KALISAIVGSLESVEINDTDAQEVAIDALGQIGSTTKGANLVLSTSPPAASHVVATAFDR  351

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              HGK+LAALHAL NI GETR  ++ ++DG AEESLR LIYD +++S KLTPSGL LSVL
Sbjct  352  NAHGKQLAALHALANIAGETRPKSNRIVDGKAEESLRCLIYDVAAESTKLTPSGLFLSVL  411

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQ SEIRLAGYR +T LVARPWCL+EI+S++EI++IVT+  TE EKI MEAR+ CC++++
Sbjct  412  QQSSEIRLAGYRTLTALVARPWCLVEILSKEEIINIVTDATTEIEKIAMEARYNCCKSIH  471

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            E+F  S+    DP R     KL+EA+RSGPYL +K+ +A+P V T + F
Sbjct  472  EAFLCSN-FADDPRRLKTGEKLQEAVRSGPYLSKKYRDARPEVKTGEGF  519


 Score =   241 bits (615),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 167/240 (70%), Gaps = 2/240 (1%)
 Frame = -2

Query  1623  DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKV  1444
             D  QL  AA +FA  P   ++ S +EFLDRFPLP +  ALQ   D PG E+ L  CL+++
Sbjct  3     DVNQLFDAAFEFANYPGVLNEASVKEFLDRFPLPVIFKALQTDPDIPGFENTLVTCLERL  62

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN--TDETTAVYLILQNGVY  1270
             F+TKYGASLIP +MP +  GL A S  V+ LAC TV  LL+N  T++ + V L++ NG+Y
Sbjct  63    FKTKYGASLIPQYMPVLQAGLKANSAVVKSLACKTVLCLLENYDTNDVSPVQLVVSNGIY  122

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
             PL L  +I+ D++VA AA   IK+LA F   + +IFP+ +++ THL +LAA+CSSL RVR
Sbjct  123   PLQLDYIINSDDEVAHAASETIKSLARFPDAMSVIFPSDTNDATHLRNLAARCSSLARVR  182

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VL+L+VKLFSIS  VAS++ N+ LL LLE E+    DTLV L+ LEL YELVE +HS EF
Sbjct  183   VLSLVVKLFSISRVVASEIKNSGLLDLLEAEMKGTKDTLVILNVLELYYELVEVEHSSEF  242



>ref|XP_006593223.1| PREDICTED: uncharacterized protein LOC100782437 [Glycine max]
Length=415

 Score =   239 bits (611),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 132/259 (51%), Positives = 171/259 (66%), Gaps = 37/259 (14%)
 Frame = -3

Query  839  DRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQH---HG  669
            D R   L + D DE E ALE+ G +G   +GA  LLS S    RHVI AAF+ Q    HG
Sbjct  157  DLRLQSLDALDRDECETALESLGHMGSYIQGATLLLSGSSPAARHVIDAAFEGQGPTGHG  216

Query  668  KRL----------------------------------AALHALGNIVGETRSGNDVLLDG  591
            K+L                                  AALHALGNI G+TRS N ++L+ 
Sbjct  217  KQLFSELDSCSFLFKVFQGSLKEHIALKVKIAETAFMAALHALGNISGKTRSENSIILNA  276

Query  590  DAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSEIRLAGYRVITGLVARPWCLIEIISR  411
            +AE +LRRLIY+T+S+S KLTPSGL LSVLQQDSE+RLAGYR+++ LVARPWCL+EI S+
Sbjct  277  EAEVNLRRLIYETASRSTKLTPSGLFLSVLQQDSEMRLAGYRMLSELVARPWCLMEICSK  336

Query  410  QEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTSSSKLMSDPARSGLATKLEEAIRSGP  231
            QEI++ VT+  TET KIGME R+ CC+A+++S T SS++ ++PA +G+A KL+EA+  GP
Sbjct  337  QEIINKVTDPSTETTKIGMEGRYDCCKAIHKSLTVSSRVSANPAFAGIAAKLQEAVEMGP  396

Query  230  YLGRKHAEAQPVVMTEQRF  174
            YL ++H EAQP VMT  RF
Sbjct  397  YLIKRHVEAQPAVMTADRF  415


 Score =   146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 95/136 (70%), Gaps = 4/136 (3%)
 Frame = -2

Query  1626  VDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDK  1447
             VD++QLL+AA+DFA+     SD SA++FL+RFPLP + +ALQ + D PGLE+ L  CL++
Sbjct  2     VDSSQLLEAASDFAHYTGAHSDDSARDFLNRFPLPVIFSALQTQFDVPGLENTLVTCLER  61

Query  1446  VFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDE----TTAVYLILQN  1279
             +F TK GASLIP +MPFV VGL A SQ VR LAC TV+ L++N D       +V LI   
Sbjct  62    LFNTKLGASLIPQYMPFVQVGLQADSQAVRSLACKTVTCLIENLDNDHKVAASVRLIKDF  121

Query  1278  GVYPLLLSCLIDGDEQ  1231
              +YPLLL C I G+ Q
Sbjct  122   NMYPLLLDCFIKGNNQ  137



>gb|AIU50933.1| ARM repeat superfamily protein, partial [Cinnamomum camphora]
Length=281

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 161/234 (69%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             L QAA +FA  P  Q+D SA+EFLDRFPL  + +ALQ  +D  GLE+AL  CL+++F TK
Sbjct  1     LAQAAAEFASYPGIQTDASAKEFLDRFPLAVIFSALQCGADVAGLENALVSCLERIFGTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YG+S IPH+MPFV  GL A SQ VR LAC  VS LL N +            +YPLLL+C
Sbjct  61    YGSSFIPHYMPFVQAGLQAYSQMVRCLACKAVSYLLVNVELVI---------IYPLLLNC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+G+E VAAA+  AI N+A    G+DI+FP           +AA+CSSL R+RVLALIV
Sbjct  112   LIEGNELVAAASTDAIVNIARSPGGIDIVFP----------HIAARCSSLARIRVLALIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS+ VAS VY++ LL LLE EV N +D L TLSALELLYEL E+ H ++F
Sbjct  162   KLFSISSLVASAVYDSKLLGLLEAEVNNKSDMLTTLSALELLYELAESPHGIKF  215



>gb|AIU50899.1| ARM repeat superfamily protein, partial [Sarcandra glabra]
Length=463

 Score =   234 bits (596),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 164/234 (70%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             L  AA++FA  P   +D S +EFL RFPLP +++ALQ ++  P  E  L  CL+++FRTK
Sbjct  1     LSNAASEFASYPGMHTDASVEEFLGRFPLPTILSALQNEAHVPEFESTLVSCLERIFRTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YG SLIP +M FV VGL A SQ VR LAC  VS LL+N      V L++   +YPLL++C
Sbjct  61    YGTSLIPQYMTFVQVGLQANSQMVRYLACKAVSYLLEN------VQLVI---IYPLLVNC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L+DG+EQVAAA++ AI+NL+   KG++IIFP          +LAA CSS+ R+RVLALIV
Sbjct  112   LVDGNEQVAAASMDAIQNLSRSPKGINIIFP----------NLAAHCSSMARIRVLALIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFSIS ++AS V N+NLL L E EV N ND L+TLSALELLYEL E+ H  EF
Sbjct  162   KLFSISRSLASVVCNSNLLGLFEAEVNNTNDMLMTLSALELLYELAESPHGTEF  215


 Score =   208 bits (529),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 151/213 (71%), Gaps = 14/213 (7%)
 Frame = -3

Query  812  QDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHHGKRLAALHALGNI  633
             D DE E ALEA GQIG   +GA  LLS      RH++ AAFD Q  GK+LAALHAL NI
Sbjct  265  HDTDECESALEALGQIGASIQGAVLLLSPVA---RHIVDAAFDRQGRGKQLAALHALANI  321

Query  632  VGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSEIRLAGYRVITG  453
             G +RS     L+ DAEE LRRLIY T++ S KLTPSGLLLSVLQ++SEIRLA YR+I+G
Sbjct  322  SGASRSE----LNDDAEECLRRLIYTTAANSSKLTPSGLLLSVLQRESEIRLAAYRLISG  377

Query  452  LVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTSSSKLMSDPARS  273
            LVAR WCL+E+ S+Q+I+ IVT + T+    GMEA++ CC A+  + ++S KL  D   S
Sbjct  378  LVAREWCLLEVCSKQKIISIVTREATK----GMEAQYYCCMAIGAALSASHKL-GDATLS  432

Query  272  GLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            G+  +++EA+R GPYL ++  EAQP+V+T  RF
Sbjct  433  GIVAEVQEAVRRGPYLAKE--EAQPLVVTADRF  463



>ref|XP_010917995.1| PREDICTED: uncharacterized protein LOC105042456 isoform X2 [Elaeis 
guineensis]
Length=475

 Score =   233 bits (594),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 162/224 (72%), Gaps = 1/224 (0%)
 Frame = -3

Query  845  AIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHHGK  666
            AID     LG Q+ DE E ALEA G IG   +GAA LL++     RHV  +AF+ Q  GK
Sbjct  253  AIDGELKLLGGQNTDECESALEALGLIGATNQGAALLLTNPSVVARHVFESAFNRQSRGK  312

Query  665  RLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSE  486
            +LAALHALG+I G  R  + +LLD  AEE LRR IY T++ SPKLTPSGLLLS+LQQ+ +
Sbjct  313  QLAALHALGSICGVDRPEDSMLLDDKAEECLRRFIYATAASSPKLTPSGLLLSLLQQEPD  372

Query  485  IRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTS  306
            +RLAGYR+I+GLVAR WCL+E+ S+QEI+ IVT+   E  K GMEAR++CC A+ ++  S
Sbjct  373  LRLAGYRLISGLVARSWCLMEVCSKQEIITIVTDATIEDTKNGMEARYQCCTAISKAL-S  431

Query  305  SSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +S L+ D   + LA KL+EA+R GPYL +KH EAQPVV+T +RF
Sbjct  432  TSNLVHDTPIAELAGKLQEAVRRGPYLAKKHVEAQPVVITAERF  475


 Score =   171 bits (433),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 130/188 (69%), Gaps = 3/188 (2%)
 Frame = -2

Query  1656  LKTAMEEEYSV--DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYP  1483
             +  AME+E +   + A LL+AA+DFA  P  Q+D SA++FLDR+PL  +   LQ K+D P
Sbjct  1     MAAAMEDEGAPLPELASLLEAASDFASYPGFQNDASAKQFLDRYPLTVLFGVLQTKADVP  60

Query  1482  GLEDALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNT-DET  1306
             GLED +  CL+++F+TKYGASL+ ++ PF+  GL A SQ VR LAC  VS +L NT D  
Sbjct  61    GLEDTIVACLERIFKTKYGASLLTNYAPFIQAGLQANSQTVRCLACKAVSYILQNTEDSV  120

Query  1305  TAVYLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGD  1126
              AV +I+   +YPLL++CL++G+EQ + A++ AI N+A   +G+ IIFPA S E   L +
Sbjct  121   AAVQIIVGYSIYPLLINCLLEGNEQTSNASLDAITNIAQVPEGISIIFPAHSVESVQLKN  180

Query  1125  LAAKCSSL  1102
             +AA+ SSL
Sbjct  181   VAAQSSSL  188



>gb|KCW67107.1| hypothetical protein EUGRSUZ_F008902, partial [Eucalyptus grandis]
Length=244

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 155/249 (62%), Gaps = 56/249 (22%)
 Frame = -2

Query  1653  KTAMEEEYSV-DAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGL  1477
             +  MEEEY + D ++LL+AA+DFA  P  Q+D + +E LDRFPLP +I+ALQ ++D PGL
Sbjct  4     RAPMEEEYLMEDTSRLLEAASDFALYPGVQNDAAVKELLDRFPLPVIISALQTRADVPGL  63

Query  1476  EDALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAV  1297
             E  L +CL++VF+TKYGASLIPHFMPFV VGL A SQ VR LAC T              
Sbjct  64    ESTLVNCLERVFKTKYGASLIPHFMPFVQVGLQAASQEVRCLACKT--------------  109

Query  1296  YLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAA  1117
                  N V+P                                    AS SE THL +LAA
Sbjct  110   -----NVVFP------------------------------------ASDSEVTHLRNLAA  128

Query  1116  KCSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYEL  937
             +CSSLGRV VLALIVKLF +S++VAS +Y++NLLSL E E+ ++ DTLVTLS LELLYE+
Sbjct  129   QCSSLGRVWVLALIVKLFPVSSSVASIIYSSNLLSLFEAEISDSQDTLVTLSVLELLYEM  188

Query  936   VEAQHSMEF  910
             VE +H+ E 
Sbjct  189   VEIRHATEI  197



>gb|AIU50909.1| ARM repeat superfamily protein, partial [Chloranthus japonicus]
Length=289

 Score =   225 bits (573),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 162/234 (69%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             L  AA++FA  P   SD S +EFL RFPLP +++ALQ+++  P  E AL  CL+++FRTK
Sbjct  1     LTNAASEFASYPGVHSDASVKEFLGRFPLPTILSALQSEAHVPEFETALVSCLERIFRTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YG SLIP +M FV VGL A SQ VR LAC  VS LL+N      V L++   +YPLL++C
Sbjct  61    YGTSLIPQYMSFVRVGLQANSQMVRCLACKAVSYLLEN------VLLVI---IYPLLVNC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L+DG+E VAAA++ AI+NL+   KG+ IIFP          +LA  CSS+ R+RVLALIV
Sbjct  112   LLDGNEPVAAASMDAIQNLSRSPKGISIIFP----------NLATHCSSVARIRVLALIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS+S ++A+ V  +NLL L E EV N ND L+TLSALELLYEL E+ H  EF
Sbjct  162   KLFSVSRSLATVVCKSNLLGLFEAEVNNTNDMLMTLSALELLYELAESPHGTEF  215



>ref|XP_006859052.1| hypothetical protein AMTR_s00068p00189110 [Amborella trichopoda]
 gb|ERN20519.1| hypothetical protein AMTR_s00068p00189110 [Amborella trichopoda]
Length=1082

 Score =   234 bits (597),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 131/240 (55%), Positives = 166/240 (69%), Gaps = 3/240 (1%)
 Frame = -2

Query  1626  VDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDK  1447
             VD   LL AA+DFA  P P +D S +EFLDRFPLP + + LQ + D  GLE  L  CL++
Sbjct  566   VDKELLLAAASDFASYPGPPADASTKEFLDRFPLPVIFSVLQ-EPDTTGLESTLVSCLER  624

Query  1446  VFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDE--TTAVYLILQNGV  1273
             VF+T YG SLIP +MP+V  GL A S+ V+ LAC  V+SLLD  D    TAV L++   +
Sbjct  625   VFKTSYGTSLIPQYMPYVKAGLQANSEAVKCLACKAVASLLDTDDRDVGTAVQLVVAYDI  684

Query  1272  YPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRV  1093
             YPLL++CLI G EQVA A+  AIKNLA   +GLDI+FP        L DLAA+ SSL R+
Sbjct  685   YPLLVNCLIHGYEQVAKASTEAIKNLARSPQGLDIMFPTKEGLALSLKDLAARSSSLARI  744

Query  1092  RVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSME  913
             R+LALI KLFSIS++VA  VY + LL++LE EV N +D L+TLSALE+LYEL  + +S E
Sbjct  745   RILALIAKLFSISSSVAVAVYESGLLNVLEAEVKNTSDVLMTLSALEVLYELAASPYSSE  804


 Score =   227 bits (579),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 163/231 (71%), Gaps = 5/231 (2%)
 Frame = -3

Query  860   RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
                + AID R   L S+D DE E AL+A GQIG   +GA  L SSSP   RH + AAF  
Sbjct  855   NTAVLAIDGRLECLKSEDTDECESALDALGQIGSSIRGAELLFSSSPPVARHAVEAAFCR  914

Query  680   QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
             Q  GK+LA LHAL NI G TRS +  +L+  +EE LR+LIY+T++K+ K+TPSGL+LS+L
Sbjct  915   QGPGKQLAGLHALANICGATRSEDGKMLNYHSEECLRQLIYETAAKTTKITPSGLVLSIL  974

Query  500   QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
             QQD+E+RLA YR+I GLVAR WCL+E+ SR+E V++VT+ + ET K GMEARH CC A+ 
Sbjct  975   QQDAEVRLAAYRLIGGLVARKWCLLEVCSREETVNLVTDAHAETTKSGMEARHSCCVAIG  1034

Query  320   ESFTSS--SKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
              +  +S   K+ S+ A   L TK++EAIR GPYL ++  EAQPVVMT +RF
Sbjct  1035  FALANSDNQKIQSNTA---LITKVQEAIRRGPYLTQQRVEAQPVVMTAERF  1082



>gb|AIU50908.1| ARM repeat superfamily protein, partial [Iris japonica]
Length=403

 Score =   201 bits (510),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 154/226 (68%), Gaps = 18/226 (8%)
 Frame = -3

Query  851  ISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHH  672
            + AID+R      Q+ +E E ALEA G IG    GA  LL+     V+HV+ +AFD Q  
Sbjct  196  VLAIDQRL-----QNNEEVENALEAVGLIGSSTDGAIFLLTPV---VKHVVESAFDQQDR  247

Query  671  GKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQD  492
            GK+LAALHALG+I G  RS     L+  AEE L+RLIY+ ++ S KLTPSGL LSVLQQ+
Sbjct  248  GKQLAALHALGSIAGADRSD----LNDSAEECLKRLIYEAATNSSKLTPSGLFLSVLQQE  303

Query  491  SEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESF  312
             E+RLA YR+I+ LVAR WCL+EI SR EI  IV +   E  K+GMEARH+CC A+Y++ 
Sbjct  304  PEMRLAAYRLISALVARSWCLMEICSRLEITSIVMD---EDAKMGMEARHQCCAAIYDAL  360

Query  311  TSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             S+S + +D   + LA KL+EA++ GP+L ++  E +P+V+T +RF
Sbjct  361  -SASNIAADAKLAELAGKLQEAVKRGPFLTKR--EPKPIVITAERF  403


 Score = 69.3 bits (168),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -2

Query  1113  CSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELV  934
             C S  R+R+LALI +LFS+S  +A  +Y +NLL L E E+   NDTL  L+ALE+LYEL 
Sbjct  89    CKS-ARIRILALISELFSLSEDIACAIYASNLLELYEVEINKRNDTLTVLTALEILYELA  147

Query  933   EAQHSMEF  910
             ++ H  +F
Sbjct  148   QSPHGTKF  155


 Score = 92.4 bits (228),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +LQAA++FA  P   +D +A+EF+DR PL  +  ALQ + D P LED L  CL+++FRT+
Sbjct  1     ILQAASEFASYPGAVNDAAAKEFVDRCPLTTLFGALQMEVDVPKLEDTLVACLERIFRTR  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTT  1339
             YG++L+  ++ F+  GL A S+ +R LAC +
Sbjct  61    YGSTLLLQYVDFIRAGLQANSEAIRCLACKS  91



>gb|KCW67108.1| hypothetical protein EUGRSUZ_F008901, partial [Eucalyptus grandis]
 gb|KCW67109.1| hypothetical protein EUGRSUZ_F008901, partial [Eucalyptus grandis]
Length=177

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 133/179 (74%), Gaps = 17/179 (9%)
 Frame = -3

Query  710  RHVISAAFDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKL  531
            RHV+ AAFD Q  GK+LAALHALGN+ G+ +S N V+L+G AEE+LR LIY+ +S+SPKL
Sbjct  16   RHVVYAAFDRQGRGKQLAALHALGNLAGDAQSDNSVILNGSAEETLRLLIYEAASRSPKL  75

Query  530  TPSGLLLSVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGME  351
             PSGL LSVLQQ++E RLAGYR IT LVARPWCL+EI S++EIVDIVT+   ET KIGME
Sbjct  76   IPSGLFLSVLQQEAETRLAGYRPITALVARPWCLMEICSKEEIVDIVTDPSIETTKIGME  135

Query  350  ARHKCCEAVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            AR+ CC+A+++                  + L++A+R GP+L R+  EAQPVVMT +RF
Sbjct  136  ARYGCCQAIHK-----------------LSHLQDAVRRGPFLARRRPEAQPVVMTAERF  177



>ref|NP_001056287.1| Os05g0557200 [Oryza sativa Japonica Group]
 gb|AAT58715.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18201.1| Os05g0557200 [Oryza sativa Japonica Group]
 dbj|BAG88214.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95390.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64650.1| hypothetical protein OsJ_19504 [Oryza sativa Japonica Group]
Length=526

 Score =   225 bits (574),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 155/229 (68%), Gaps = 2/229 (1%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AID+      SQ+ DE E ALEA G IG    GA  LL+ S    RHV+ A+F  Q
Sbjct  299  NLLLAIDKLLKMEESQNTDETESALEALGLIGTTSAGACLLLTDSSNAARHVVEASFGRQ  358

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              GK+LAALHA G+I G  R  + + LD  AEE L+R +Y T+  SPKLTPS LLLSVLQ
Sbjct  359  GRGKQLAALHAFGSISGVDRQEDQIKLDNQAEERLKRFVYTTARNSPKLTPSALLLSVLQ  418

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD +IR+ GYRVI+GLVAR WCL+EI S+ +I+++VT+   E  K+GMEARH CC A+ +
Sbjct  419  QDPDIRITGYRVISGLVAREWCLMEICSKLDIINLVTDPKMEMTKLGMEARHDCCLAISK  478

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLG-RKHAEAQPVVMTEQRF  174
            +  SSS L+ +P+ S L  KL EA++ GPYL  RK  E QPVV+  +RF
Sbjct  479  AL-SSSHLLHEPSLSELIGKLNEAVKRGPYLSERKRVEPQPVVVPAERF  526


 Score =   216 bits (550),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 161/235 (69%), Gaps = 1/235 (0%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +L+AA +FA  P    D + ++FL+++PLP ++ ALQ+++D PG+++ +  CLDKVF ++
Sbjct  14    MLRAAAEFASYPGAHGDDTVRQFLEQYPLPKLLGALQSEADVPGMDETIAACLDKVFSSR  73

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNT-DETTAVYLILQNGVYPLLLS  1255
             YGAS +P +  F+  GL A S+N R+LAC  V  LLD   D    V   +Q+ +YPLL++
Sbjct  74    YGASFLPSYGAFIQAGLLANSKNTRQLACKAVIHLLDKAGDSAVVVDTFVQHNLYPLLMN  133

Query  1254  CLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALI  1075
             CL +GDE+++A ++  IK LA   KG++IIFP +      L  +AA+ SS+ R+R+L+LI
Sbjct  134   CLTEGDEEISAISLDGIKRLAQIPKGIEIIFPPNGQGSVQLHKVAAQSSSMARIRILSLI  193

Query  1074  VKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
              KLF++ST  A+ +Y++NLLSL E E+ +  D L TLSALE+LYELVE  HS  F
Sbjct  194   AKLFAVSTYTATAIYDSNLLSLFEDEIKDRRDMLKTLSALEVLYELVEHPHSNIF  248



>gb|AIU50892.1| ARM repeat superfamily protein, partial [Lilium brownii]
Length=464

 Score =   222 bits (566),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 160/234 (68%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL+AA DFA  P  Q+D +A++FLDRFPL  +   LQ  +D PG E+ +  CLD++F+TK
Sbjct  1     LLEAAADFASYPGQQNDAAAKDFLDRFPLSVLFGVLQNVADVPGSEETIVSCLDRIFKTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGAS +P +MPFV  GL A S+ +R LAC  VS LL N +            +YPLL++C
Sbjct  61    YGASHLPQYMPFVQAGLQANSEIIRCLACKVVSYLLGNVEMIV---------IYPLLINC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L+DG+EQ AAA++ AIK+L  F +G+ II P           +A+ CSSL R+R+L LIV
Sbjct  112   LLDGNEQTAAASLDAIKSLGRFPEGISIILPT----------VASSCSSLARIRILGLIV  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             +LFSIS++VAS V+N++LL+L E EV N ND L TLSALELLYEL E+ +S EF
Sbjct  162   QLFSISSSVASTVHNSDLLNLFEVEVNNKNDMLTTLSALELLYELAESPYSSEF  215


 Score =   213 bits (542),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 157/224 (70%), Gaps = 18/224 (8%)
 Frame = -3

Query  845  AIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHHGK  666
            AID R      Q+ DE E ALEA GQIG   +GAA LL+      RHV+ +AF     G 
Sbjct  259  AIDGRL-----QNTDEIESALEALGQIGTSAQGAAMLLTVVA---RHVLDSAFTGHGRGV  310

Query  665  RLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSE  486
            +LAAL+ALG I G  R      L+ +AEESL+RLIY+T++ +PKLTPSGLLL VLQQ+ E
Sbjct  311  QLAALYALGCICGVDRRE----LNNNAEESLKRLIYETAANNPKLTPSGLLLKVLQQEPE  366

Query  485  IRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTS  306
            IRLA YR I+GLVARPWCL+E+ SRQEI+ +VT+   E+ K  MEARH CC A+ ++  S
Sbjct  367  IRLAAYRAISGLVARPWCLVEVCSRQEIITMVTD---ESTKNNMEARHNCCIAINKAL-S  422

Query  305  SSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +S +++D + +G+A KL+EA+R GPYL  K  +AQP+V+T +RF
Sbjct  423  ASAMLTDASVAGIAEKLQEAVRRGPYLATK--DAQPIVVTAERF  464



>emb|CAN62354.1| hypothetical protein VITISV_022417 [Vitis vinifera]
Length=298

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 153/233 (66%), Gaps = 15/233 (6%)
 Frame = -3

Query  866  GYRNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAF  687
            G + VIS ID R   L SQDADE E ALEA GQIG    GA  LL SSP   RHVI AAF
Sbjct  79   GVKTVISLIDGRLRSLESQDADECESALEALGQIGSSIHGAELLLLSSPPAARHVIDAAF  138

Query  686  DCQHHGKRL--AALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLL  513
            D Q  G++L    +  L   + + +          ++  LR   Y       +    GL 
Sbjct  139  DRQGRGRQLIGVCMWPLHTTISKPQG---------SKSRLRPKFYQYGGDFGQ----GLF  185

Query  512  LSVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCC  333
            LSVLQQD+E+RLAGYRVITGLVARPWCL+EI S+QEIV+I+T  ++ET KIGMEA++ CC
Sbjct  186  LSVLQQDAEVRLAGYRVITGLVARPWCLMEICSKQEIVNIITGAHSETTKIGMEAKYNCC  245

Query  332  EAVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +A++  F SSSKL SDPA +G+A KL+EA+R GPYL RK  EAQPVVMT  RF
Sbjct  246  KAIHWVFMSSSKLTSDPALTGIAEKLQEAVRRGPYLARKLQEAQPVVMTADRF  298



>gb|EEC79675.1| hypothetical protein OsI_20936 [Oryza sativa Indica Group]
Length=526

 Score =   222 bits (566),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 154/229 (67%), Gaps = 2/229 (1%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AID+      S + DE E ALEA G IG    GA  LL+ S    RHV+ A+F  Q
Sbjct  299  NLLLAIDKLLKMEESLNTDETESALEALGLIGTTSAGACLLLTDSSNAARHVVEASFGRQ  358

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              GK+LAALHA G+I G  R  + + LD  AEE L+R +Y T+  SPKLTPS LLLSVLQ
Sbjct  359  GRGKQLAALHAFGSISGVDRQEDQIKLDNQAEERLKRFVYTTARNSPKLTPSALLLSVLQ  418

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD +IR+ GYRVI+GLVAR WCL+EI S+ +I+++VT+   E  K+GMEARH CC A+ +
Sbjct  419  QDPDIRITGYRVISGLVAREWCLMEICSKLDIINLVTDPKMEMTKLGMEARHDCCLAISK  478

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLG-RKHAEAQPVVMTEQRF  174
            +  SSS L+ +P+ S L  KL EA++ GPYL  RK  E QPVV+  +RF
Sbjct  479  AL-SSSHLLHEPSLSELIGKLNEAVKRGPYLSERKRVEPQPVVVPAERF  526


 Score =   216 bits (550),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 161/235 (69%), Gaps = 1/235 (0%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +L+AA +FA  P    D + ++FL+++PLP ++ ALQ+++D PG+++ +  CLDKVF ++
Sbjct  14    MLRAAAEFASYPGAHGDDTVRQFLEQYPLPKLLGALQSEADVPGMDETIAACLDKVFSSR  73

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNT-DETTAVYLILQNGVYPLLLS  1255
             YGAS +P +  F+  GL A S+N R+LAC  V  LLD   D    V   +Q+ +YPLL++
Sbjct  74    YGASFLPSYGAFIQAGLLANSKNTRQLACKAVIHLLDKAGDSAVVVDTFVQHNLYPLLMN  133

Query  1254  CLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALI  1075
             CL +GDE+++A ++  IK LA   KG++IIFP +      L  +AA+ SS+ R+R+L+LI
Sbjct  134   CLTEGDEEISAISLDGIKRLAQIPKGIEIIFPPNGQGSVQLHKVAAQSSSMARIRILSLI  193

Query  1074  VKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
              KLF++ST  A+ +Y++NLLSL E E+ +  D L TLSALE+LYELVE  HS  F
Sbjct  194   AKLFAVSTYTATAIYDSNLLSLFEDEIKDRRDMLKTLSALEVLYELVEHPHSNIF  248



>gb|AIU50925.1| ARM repeat superfamily protein, partial [Dioscorea oppositifolia]
Length=464

 Score =   220 bits (561),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 162/227 (71%), Gaps = 18/227 (8%)
 Frame = -3

Query  854  VISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQH  675
            ++SAID R      ++ +E E ALEA GQIG   +GA+ LL+       HVI +AFD  +
Sbjct  256  LLSAIDERL-----ENTEECEIALEALGQIGASTQGASLLLTLVAM---HVIESAFDRHY  307

Query  674  HGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQ  495
             G++LAALHALG I G  RS     L+ +AE+SLRRLIY T+S++PKLTPSGLLLSVLQQ
Sbjct  308  RGRQLAALHALGCICGVDRSD----LNDNAEDSLRRLIYATASETPKLTPSGLLLSVLQQ  363

Query  494  DSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYES  315
            + EIRLA YR+I  LVAR WCL+E+ S QEI+ IV +   ET+K GMEARH CC A+ ++
Sbjct  364  EPEIRLAAYRLIAALVARKWCLMEVCSNQEIITIVID---ETQKNGMEARHLCCTAISKA  420

Query  314  FTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
              S+S +++D   +G+A KL+EA+R GPYL ++  EAQPVVMT +RF
Sbjct  421  L-SASNMLNDATAAGIAAKLQEAVRRGPYLVKR--EAQPVVMTAERF  464


 Score =   218 bits (554),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 120/231 (52%), Positives = 160/231 (69%), Gaps = 19/231 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL AA +FA  P  Q+D SA+E LDRFPLPA++ +LQ  +D PGLED +  CL+++FRTK
Sbjct  1     LLDAAAEFASHPGAQNDASAKELLDRFPLPALLGSLQTNADVPGLEDTVASCLERLFRTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASLIP +  F+  GL A S+ VR LAC  VSS L+N      + +I    +YPLLL+C
Sbjct  61    YGASLIPQYASFIQAGLQANSETVRCLACKAVSSFLEN------LQII---DIYPLLLNC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L+ G+EQ +AA++ AIK++A    G+ +IFP           +A+  SSL R+R+LALI 
Sbjct  112   LLFGNEQTSAASLDAIKDIAQLPDGIKMIFP----------HIASTSSSLARIRILALIA  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHS  919
             KL+S+S +VAS V ++NLLSL E E+ N +D L TLSALELLYELVE+ HS
Sbjct  162   KLYSLSISVASLVNDSNLLSLFEAEINNTSDMLTTLSALELLYELVESPHS  212



>ref|XP_002440229.1| hypothetical protein SORBIDRAFT_09g028070 [Sorghum bicolor]
 gb|EES18659.1| hypothetical protein SORBIDRAFT_09g028070 [Sorghum bicolor]
Length=523

 Score =   219 bits (558),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 162/234 (69%), Gaps = 0/234 (0%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +L+AA DFA  P   SD + ++FL+R PLP ++ ALQ+++D PG+ + + +CLDK+F ++
Sbjct  13    MLRAAADFASYPGLHSDDTVRQFLERCPLPKLLGALQSEADVPGMVETVTECLDKIFSSR  72

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASL+P +  F+  GL   S+ +R+LAC  V  LLD  ++  AV  ++Q+ ++PL+++C
Sbjct  73    YGASLLPSYGAFIQAGLLTDSKQIRKLACKAVLHLLDKAEDGAAVETVVQHNLFPLMINC  132

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+GDE+++A  +  +K LA   KG ++IFP        LG +AA+ SSL R+R+L+LI 
Sbjct  133   LIEGDEEISAIILDTVKRLAQIPKGAEVIFPPDGQGSVQLGKVAAQSSSLPRIRILSLIA  192

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLF++S+  AS + + NLLS+ E+E+ +  D L TLSALE+LYELVE  HS  F
Sbjct  193   KLFTVSSYTASAIRDTNLLSIFEEEIKDTRDMLKTLSALEVLYELVEHPHSNIF  246


 Score =   212 bits (539),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 156/229 (68%), Gaps = 3/229 (1%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AID+      SQ+ DE E ALE  G IG   +GA  LL+SS    RHV+ ++FD Q
Sbjct  297  NLLVAIDKILKMEESQNTDEIESALETLGLIGTTSQGAHFLLTSSNV-ARHVVKSSFDRQ  355

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              G++LAALHA G+I G  R  + + LD +AE +L+RL+Y T++ SPKLTPS  LLS+LQ
Sbjct  356  GRGRQLAALHAFGSICGMDRQEDQMKLDDEAEGNLKRLVYTTAANSPKLTPSAALLSILQ  415

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD +IR+AGYRVI+GLV R WCL E+    EI+  VT+   ET K+GMEAR+ CC A+ +
Sbjct  416  QDPDIRIAGYRVISGLVIREWCLREVCLNSEIIRFVTDPTMETTKLGMEARYNCCVAINK  475

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLG-RKHAEAQPVVMTEQRF  174
            +  SSS L+ + + SGL  KL +A++ GPYL  RK  EA+PVV T +RF
Sbjct  476  AL-SSSHLLHEASLSGLIGKLNDAVKRGPYLSERKRVEARPVVDTAERF  523



>gb|AIU50913.1| ARM repeat superfamily protein, partial [Pandanus utilis]
Length=408

 Score =   216 bits (550),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 120/228 (53%), Positives = 160/228 (70%), Gaps = 18/228 (8%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            +V+ AIDRR      ++ DE E ALEA GQIG   +GA+ LL+      RHV+ +AFD Q
Sbjct  199  SVLLAIDRRL-----ENTDECEIALEALGQIGDSIQGASLLLTLVA---RHVVESAFDRQ  250

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              GK+LAALHALG+I G  RS     L+ +AE+ LRRL Y T+S++PKLTPSGLLLS LQ
Sbjct  251  SRGKQLAALHALGSICGVNRSD----LNDNAEDCLRRLFYATASETPKLTPSGLLLSALQ  306

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            Q+ E+RLA YR+I  LV R WCL+E+  +QEI+ IVT+   ET+K GMEARH CC A+ +
Sbjct  307  QEPELRLAAYRLIAALVTRKWCLMEVCLKQEIITIVTD---ETQKNGMEARHLCCTAICK  363

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            + ++SS ++ D   +G+  KL+EA++ GPYL R+  EAQP VMT +RF
Sbjct  364  ALSASS-MLDDSTIAGIVAKLQEAVKRGPYLARR--EAQPHVMTAERF  408


 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 118/175 (67%), Gaps = 19/175 (11%)
 Frame = -2

Query  1443  FRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPL  1264
             FRT+YGASLIP + PF+  GL A S  VR LAC  VSS L+     +         +YPL
Sbjct  1     FRTRYGASLIPQYAPFLQAGLQANSGTVRCLACKAVSSFLEKLQIIS---------MYPL  51

Query  1263  LLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVL  1084
             LL+CL+DGDEQ +AA++ AIKNLA   +G+ II P           +A+ CSSL R+R+L
Sbjct  52    LLNCLLDGDEQTSAASLDAIKNLAQLPEGIKIILP----------HIASNCSSLARIRIL  101

Query  1083  ALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHS  919
             ALI KLFS+S++VA  V ++NLLSL E E+ + ND L TLSALEL+YE+VE+ HS
Sbjct  102   ALIAKLFSLSSSVALAVCDSNLLSLFEVEISDRNDVLTTLSALELIYEVVESPHS  156



>gb|EMT14922.1| 26S proteasome non-ATPase regulatory subunit 5 [Aegilops tauschii]
Length=501

 Score =   218 bits (555),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 122/231 (53%), Positives = 156/231 (68%), Gaps = 4/231 (2%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AID+      SQ+ DE E ALE  G IG   +GA  LLS  P   RHV+  +FD Q
Sbjct  272  NLLLAIDKILRTEESQNTDEIESALETLGLIGTTTQGACLLLSDPPNIARHVVEMSFDRQ  331

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDG-DAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              GK LAALHALG+I G  R  + + LD   AEE L+RL+Y  +S SPKLTPS LLLS+L
Sbjct  332  GRGKHLAALHALGSICGVDRQEDQMKLDDPQAEEFLKRLVYSAASNSPKLTPSALLLSIL  391

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQD ++R+AGYRV++GLV R WCL E+ S+ EI+ IVT+   ET K+GMEAR+ CC A+ 
Sbjct  392  QQDPDVRIAGYRVLSGLVVREWCLREVCSKPEIIGIVTDPKMETTKLGMEARYACCVAIN  451

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLG--RKHAEAQPVVMTEQRF  174
            ++  SSS L+ +P+ S L  KL EA+R GPYL   R+  EAQPVV T +RF
Sbjct  452  KAL-SSSHLLHEPSLSELIGKLNEAVRRGPYLSEKRQRVEAQPVVGTMERF  501


 Score =   129 bits (324),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 130/238 (55%), Gaps = 29/238 (12%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL+AA DFA  P    + + ++FL++FPLP ++  L                       K
Sbjct  9     LLRAAADFASYPGTHGEDTVRQFLEQFPLPKLLGNL----------------------FK  46

Query  1431  YGAS---LIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNT-DETTAVYLILQNGVYPL  1264
              G S   ++ +  P     L +P  + + L    V  LLD   D   AV   +Q+ +YPL
Sbjct  47    LGCSQTQIVSNNWPAKRQCLQSPDPHFQVL--YQVVHLLDKAGDIAVAVDTFVQHNLYPL  104

Query  1263  LLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVL  1084
             L++CL++GDE+++A  + AIK LA    G DIIFP    +   L  +AA+ SS+ R+R+L
Sbjct  105   LINCLVEGDEEISAIVLDAIKRLAEIPTGTDIIFPPDG-QGLQLNKVAAQSSSMARIRIL  163

Query  1083  ALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             +LI KLF  S+  A+ + ++NLLSL E E+ +  D L TLSALE+LYEL E  HS  F
Sbjct  164   SLIAKLFGASSCTATAIRDSNLLSLFEDEIKDRKDMLKTLSALEVLYELAEHPHSNMF  221



>ref|NP_001145467.1| uncharacterized protein LOC100278856 [Zea mays]
 gb|ACG47786.1| hypothetical protein [Zea mays]
Length=524

 Score =   218 bits (554),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 162/235 (69%), Gaps = 1/235 (0%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +L+AA DFA  P   SD + ++FL+R PLP ++ ALQ+++D PG+ + + +CLDK+F ++
Sbjct  13    MLRAAADFASYPGLHSDDTVRQFLERCPLPKLLGALQSEADVPGMVETVTECLDKIFSSR  72

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNT-DETTAVYLILQNGVYPLLLS  1255
             YGASL+P++  F+  GL   S+ +R+LAC  V  LLD   D   AV  ++Q+ +YPLL+ 
Sbjct  73    YGASLLPNYGAFIQAGLLTDSKQIRKLACKAVLHLLDKAEDGAAAVETVVQHNLYPLLIK  132

Query  1254  CLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALI  1075
             CLI+GDE+++A  +  +K LA   KG ++IFP        LG +AA+ SSL R+R+L+LI
Sbjct  133   CLIEGDEEISAIVLDTVKRLAQIPKGAEVIFPPDGQGSVQLGKVAAQSSSLARIRILSLI  192

Query  1074  VKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
              KLF++S+  A+ + ++NLLS+ E+E+ +  D L TLSALE+LYELVE  HS  F
Sbjct  193   AKLFTVSSYTATVIRDSNLLSIFEEEIKDRRDMLKTLSALEVLYELVEHPHSNIF  247


 Score =   213 bits (541),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 156/229 (68%), Gaps = 3/229 (1%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AIDR      S++ DE E ALE  G IG   +GA  LL+SS    RHV+ ++FD Q
Sbjct  298  NLLVAIDRILKMEESKNTDEIESALETLGLIGTTSQGAHFLLTSSNV-ARHVVESSFDRQ  356

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              G++LAALHA G+I G  R  + + LD +AEE+L+RL+Y T++ SPKLTPS LLLSVLQ
Sbjct  357  GRGRQLAALHAFGSICGVGRQEDQMKLDSEAEENLKRLVYTTAANSPKLTPSALLLSVLQ  416

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD ++R+AGYRVITGLV R WCL E+    EI+  VT+   ET K+GME R+ CC A+ +
Sbjct  417  QDPDVRIAGYRVITGLVIREWCLREVCLNSEIIRFVTDPTMETTKLGMETRYGCCVAINK  476

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLG-RKHAEAQPVVMTEQRF  174
            +  SSS L+ + + S L  KL +A++ GPYL  RK  EA+PVV T +RF
Sbjct  477  AL-SSSHLLHEASLSELVGKLNDAVKRGPYLSDRKRVEARPVVDTAERF  524



>gb|AFW79105.1| hypothetical protein ZEAMMB73_239741 [Zea mays]
Length=524

 Score =   217 bits (553),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 161/235 (69%), Gaps = 1/235 (0%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +L+AA DFA  P   SD + ++FL+R PLP ++ ALQ++ D PG+ + + +CLDK+F ++
Sbjct  13    MLRAAADFASYPGLHSDDTVRQFLERCPLPKLLGALQSEEDVPGMVETVTECLDKIFSSR  72

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNT-DETTAVYLILQNGVYPLLLS  1255
             YGASL+P++  F+  GL   S+ +R+LAC  V  LLD   D   AV  ++Q+ +YPLL+ 
Sbjct  73    YGASLLPNYGAFIQAGLLTDSKQIRKLACKAVLHLLDKAEDGGAAVETVVQHNLYPLLIK  132

Query  1254  CLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALI  1075
             CLI+GDE+++A  +  +K LA   KG ++IFP        LG +AA+ SSL R+R+L+LI
Sbjct  133   CLIEGDEEISAIILDTVKRLAQIPKGAEVIFPPDGQGSVQLGKVAAQSSSLARIRILSLI  192

Query  1074  VKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
              KLF++S+  A+ + ++NLLS+ E+E+ +  D L TLSALE+LYELVE  HS  F
Sbjct  193   AKLFTVSSYTATAIRDSNLLSIFEEEIKDRRDMLKTLSALEVLYELVEHPHSNIF  247


 Score =   211 bits (538),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 155/229 (68%), Gaps = 3/229 (1%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AI R      S++ DE E ALE  G IG   +GA  LL+SS    RHV+ ++FD Q
Sbjct  298  NLLIAIGRILKMEESKNTDEIESALETLGLIGTTSQGAHFLLTSSNV-ARHVVESSFDRQ  356

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              G++LAALHA GNI G  R  + + LD +AEE+L+RL+Y T++ SPKLTPS LLLSVLQ
Sbjct  357  GRGRQLAALHAFGNICGVGRQEDQMKLDSEAEENLKRLVYTTAANSPKLTPSALLLSVLQ  416

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD ++R+AGYRVITGLV R WCL E+    EI+  VT+   ET K+GME R+ CC A+ +
Sbjct  417  QDPDVRIAGYRVITGLVIREWCLREVCLNSEIIRFVTDPTMETTKLGMETRYGCCVAINK  476

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLG-RKHAEAQPVVMTEQRF  174
            +  SSS L+ + + S L  KL +A++ GPYL  RK  EA+PVV T +RF
Sbjct  477  AL-SSSHLLHEASLSELVGKLNDAVKRGPYLSDRKRVEARPVVDTAERF  524



>ref|XP_003567925.1| PREDICTED: uncharacterized protein LOC100830727 [Brachypodium 
distachyon]
Length=523

 Score =   216 bits (550),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 154/229 (67%), Gaps = 2/229 (1%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AID+      SQ+ DE E ALEA G IG   +GA  L + S    +HV+  +F+ Q
Sbjct  296  NLLLAIDKILGIEESQNTDEIESALEALGLIGATTQGACFLFTDSSNVAKHVVQLSFNRQ  355

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              GK+LAALHA G+I G  R  + + L   AEE L+RL+Y  +S SPKLTPS LLLSVLQ
Sbjct  356  GRGKQLAALHAFGSICGVDRQEDQMKLGDQAEERLKRLVYTVASDSPKLTPSALLLSVLQ  415

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD +IR+AGYRVI+ LV R WCL E+ S+ EI+ +VT+   ET K+GMEAR+ CC A+ +
Sbjct  416  QDPDIRIAGYRVISRLVVREWCLREVCSKSEIIRVVTDPKMETTKLGMEARYNCCVAINK  475

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLG-RKHAEAQPVVMTEQRF  174
            +  SSS L+++ + S L  KL +A+R GPYL  RK  EAQPVV T +RF
Sbjct  476  AL-SSSHLLNESSLSELIGKLNDAVRRGPYLSDRKRMEAQPVVDTAERF  523


 Score =   209 bits (533),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 160/235 (68%), Gaps = 1/235 (0%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL+AA DFA  P    D + ++FL++FPLP ++  LQ+++D PG+++ L  CLDKVF ++
Sbjct  11    LLRAAADFASYPGVHCDDTVRQFLEQFPLPKLLGVLQSQADVPGVDETLAACLDKVFSSR  70

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNT-DETTAVYLILQNGVYPLLLS  1255
             YGASL+P++  F+  GL   S+ +R+LAC  V +LLD   D   A+   +Q+ +YPLL++
Sbjct  71    YGASLLPNYGEFIQAGLLTNSKIIRQLACKAVLNLLDKAGDSAVALDTFVQHNLYPLLIN  130

Query  1254  CLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALI  1075
             CLI+GDE+V+A  +  +K LA   KG DIIFP        L  +AA+ SS+ R+R+L+LI
Sbjct  131   CLIEGDEEVSAIVLDVLKRLAEIPKGTDIIFPPDGQGSLQLNKVAAQSSSMARIRILSLI  190

Query  1074  VKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
              KLF++S++ A+ + ++NLLSL E E+ +  D L TLSALE+LYEL E  +S  F
Sbjct  191   AKLFAVSSSTATAIRDSNLLSLFEDEIKDRKDMLKTLSALEVLYELAEHPNSNIF  245



>gb|AIU50895.1| ARM repeat superfamily protein, partial [Pinellia ternata]
Length=463

 Score =   214 bits (545),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 158/224 (71%), Gaps = 18/224 (8%)
 Frame = -3

Query  845  AIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHHGK  666
            AID+R      QD DE E ALEA G+IG   +GAA LLS      RHV+++AF+    GK
Sbjct  258  AIDKRL-----QDTDECESALEALGEIGSTIQGAAMLLSPVA---RHVVASAFNHHGRGK  309

Query  665  RLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSE  486
            +LAALHAL +I G  R      L+ +AE+ LRRLIYD +S S K TPSGLLLSVLQQ+ E
Sbjct  310  QLAALHALASISGVNRPD----LNNEAEDCLRRLIYDVASNSLKFTPSGLLLSVLQQEPE  365

Query  485  IRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTS  306
            IRLA YR+I  LVARPWCL E+ S+Q+I+++VT+   ET K GMEAR+ CC  + +S ++
Sbjct  366  IRLAAYRLIAALVARPWCLSEVCSKQDIINMVTD---ETTKNGMEARYLCCTGISKSMSA  422

Query  305  SSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            S+KL SDPA +G+  KL+EA+R GPYL  K  EA+P+V+T +RF
Sbjct  423  SNKL-SDPALAGIVEKLQEAVRRGPYLVAK--EAKPIVVTAERF  463


 Score =   198 bits (503),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 165/234 (71%), Gaps = 20/234 (9%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL AA+DFA  P  Q+D S + FLDR+PLP + +AL+  +  P LE+ +  CL++VF+T+
Sbjct  1     LLDAASDFAAYPGVQTDDSVKAFLDRYPLPVLFSALE-NTGVPRLEETIVACLERVFKTR  59

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             +GA LIPH+MPF+  GL A SQ V  L+C  VS+LL+       V LI+   VYPLL+ C
Sbjct  60    FGALLIPHYMPFMRAGLQADSQTVNCLSCKAVSNLLEK------VQLIV---VYPLLIDC  110

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+G+E  AAA+I AIKNLA   KG++IIFP          ++AA+CSSL R+R+L+L+ 
Sbjct  111   LINGNELAAAASIDAIKNLAQSPKGINIIFP----------NVAARCSSLARIRILSLVA  160

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLFS+S +VA+ VYN+NLL+L E E+ N +D L++LSALELLYEL E+ HS  F
Sbjct  161   KLFSLSRSVAAAVYNSNLLNLFEAEISNTSDMLLSLSALELLYELAESPHSTGF  214



>ref|XP_008647702.1| PREDICTED: uncharacterized protein LOC100278856 isoform X1 [Zea 
mays]
Length=597

 Score =   217 bits (553),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 161/235 (69%), Gaps = 1/235 (0%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +L+AA DFA  P   SD + ++FL+R PLP ++ ALQ++ D PG+ + + +CLDK+F ++
Sbjct  86    MLRAAADFASYPGLHSDDTVRQFLERCPLPKLLGALQSEEDVPGMVETVTECLDKIFSSR  145

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNT-DETTAVYLILQNGVYPLLLS  1255
             YGASL+P++  F+  GL   S+ +R+LAC  V  LLD   D   AV  ++Q+ +YPLL+ 
Sbjct  146   YGASLLPNYGAFIQAGLLTDSKQIRKLACKAVLHLLDKAEDGGAAVETVVQHNLYPLLIK  205

Query  1254  CLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALI  1075
             CLI+GDE+++A  +  +K LA   KG ++IFP        LG +AA+ SSL R+R+L+LI
Sbjct  206   CLIEGDEEISAIILDTVKRLAQIPKGAEVIFPPDGQGSVQLGKVAAQSSSLARIRILSLI  265

Query  1074  VKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
              KLF++S+  A+ + ++NLLS+ E+E+ +  D L TLSALE+LYELVE  HS  F
Sbjct  266   AKLFTVSSYTATAIRDSNLLSIFEEEIKDRRDMLKTLSALEVLYELVEHPHSNIF  320


 Score =   211 bits (537),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 155/229 (68%), Gaps = 3/229 (1%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AI R      S++ DE E ALE  G IG   +GA  LL+SS    RHV+ ++FD Q
Sbjct  371  NLLIAIGRILKMEESKNTDEIESALETLGLIGTTSQGAHFLLTSSNV-ARHVVESSFDRQ  429

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              G++LAALHA GNI G  R  + + LD +AEE+L+RL+Y T++ SPKLTPS LLLSVLQ
Sbjct  430  GRGRQLAALHAFGNICGVGRQEDQMKLDSEAEENLKRLVYTTAANSPKLTPSALLLSVLQ  489

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD ++R+AGYRVITGLV R WCL E+    EI+  VT+   ET K+GME R+ CC A+ +
Sbjct  490  QDPDVRIAGYRVITGLVIREWCLREVCLNSEIIRFVTDPTMETTKLGMETRYGCCVAINK  549

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLG-RKHAEAQPVVMTEQRF  174
            +  SSS L+ + + S L  KL +A++ GPYL  RK  EA+PVV T +RF
Sbjct  550  AL-SSSHLLHEASLSELVGKLNDAVKRGPYLSDRKRVEARPVVDTAERF  597



>dbj|BAJ87373.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score =   214 bits (545),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 155/231 (67%), Gaps = 4/231 (2%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AID+      SQ+ DE E ALE  G IG   +GA  L S  P   +HV+  +FD Q
Sbjct  299  NLLLAIDKILRTEESQNTDEIESALETLGLIGTTSQGACLLFSDPPNVAKHVVEMSFDRQ  358

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDG-DAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              GK+LAALHA G+I G  R  + + LD   AEE L+RL+Y  +S SPKLTPS LLLS+L
Sbjct  359  GRGKQLAALHAFGSICGVDREEDQMKLDDYQAEECLKRLVYSAASNSPKLTPSALLLSIL  418

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQD ++R+AGYRV++GLV R WCL E+ S+ EI+ +VT+   ET K+GMEAR+ CC A+ 
Sbjct  419  QQDPDVRIAGYRVLSGLVVREWCLREVCSKPEIIGVVTDPKMETTKLGMEARYACCVAIN  478

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRK--HAEAQPVVMTEQRF  174
            ++  +SS L+ +P+ S L  KL EA+R GPYL +K    EAQPVV T +RF
Sbjct  479  KAL-ASSHLLHEPSLSELIGKLNEAVRRGPYLSQKKPRVEAQPVVGTMERF  528


 Score =   192 bits (487),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/249 (43%), Positives = 159/249 (64%), Gaps = 5/249 (2%)
 Frame = -2

Query  1644  MEEEYSVDAAQL---LQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLE  1474
             M+    +DA +L    +AA DFA  P    + + ++FL++FPL  ++ ALQ++   P   
Sbjct  1     MDAAAEMDAGELEAVFRAAADFASYPGVHGEDAVRQFLEQFPLHDLLGALQSQGAEPETV  60

Query  1473  DALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDET-TAV  1297
             + +  CLDKVF ++YGASL+P +  F+  GL     N+R+LAC  V  LLD  +++  AV
Sbjct  61    ETVAACLDKVFSSRYGASLLPSYAAFIEAGLLTNLNNIRQLACKAVVHLLDKAEDSDVAV  120

Query  1296  YLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAA  1117
                +Q+ +YPLL++CLI+GDE+++A  + AIK LA   KG DIIFP    +   L  +AA
Sbjct  121   DTFVQHNLYPLLINCLIEGDEEISAIVLDAIKRLAEIPKGTDIIFP-PDGQGLQLNKVAA  179

Query  1116  KCSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYEL  937
             + SS+ R+R+L+LI KLF+ S+  A+ + ++NLLSL E E+ +  D L TLSALE+LYEL
Sbjct  180   QSSSMARIRILSLIAKLFAASSCTATAIRDSNLLSLFEDEIKDRKDMLKTLSALEVLYEL  239

Query  936   VEAQHSMEF  910
              E  HS  F
Sbjct  240   AEHPHSNMF  248



>ref|XP_006654765.1| PREDICTED: uncharacterized protein LOC102715305 [Oryza brachyantha]
Length=496

 Score =   213 bits (543),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 162/235 (69%), Gaps = 1/235 (0%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +L AA +FA  P    D + ++FL++FPLP ++ ALQ++ D PG+++ +  CLDKVF ++
Sbjct  4     MLLAAAEFASYPGAHGDDAVRQFLEQFPLPKLLGALQSEGDVPGMDETVAACLDKVFSSR  63

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNT-DETTAVYLILQNGVYPLLLS  1255
             YGASL+P +  F+  GL A S+N+R+LAC  V  LL+   D   AV   +Q+ +YPLL++
Sbjct  64    YGASLLPSYGAFIQAGLLANSKNLRQLACKAVIHLLEKAGDSAVAVDTFVQHNLYPLLIN  123

Query  1254  CLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALI  1075
             CL +GDE+++A ++  IK LA   KG +IIFP +      L  +AA+ SS+ R+R+L+LI
Sbjct  124   CLTEGDEEISAISLDGIKRLAEIPKGFEIIFPPNGQGSVQLDKVAAQSSSMARIRILSLI  183

Query  1074  VKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
              KLF++ST +A+ ++++NLLSL E E+ +  D L TLS+LE+LYELVE  HS  F
Sbjct  184   AKLFAVSTNIATAIFDSNLLSLFEDEIKDRRDMLKTLSSLEVLYELVEHPHSNIF  238


 Score =   112 bits (280),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            +++ AID+      SQ+ DE E ALEA G IG    GA  LL+      RHV+ A+FD Q
Sbjct  289  SLLLAIDKILQMEDSQNTDETESALEALGLIGTTSVGACLLLTDPSNAARHVVDASFDRQ  348

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              GK+LAALHA G+I G  R  + + LD  AEE L+ L+Y T+  SPKLTPS  LL++LQ
Sbjct  349  GRGKQLAALHAFGSICGADRQEDQIKLDNQAEECLKHLVYATARNSPKLTPSAHLLAMLQ  408

Query  497  QDSEIRLA  474
            QD +IR+A
Sbjct  409  QDPDIRIA  416



>ref|XP_008360047.1| PREDICTED: uncharacterized protein LOC103423744 [Malus domestica]
Length=190

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 135/182 (74%), Gaps = 3/182 (2%)
 Frame = -2

Query  1638  EEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALC  1462
             EEYSVD   QLL+AA+DFA  P  Q+D SA+EFLDRFPLP ++NALQ K+D P LE  L 
Sbjct  2     EEYSVDDPTQLLEAASDFASYPGFQNDASAKEFLDRFPLPVILNALQTKADVPRLESTLV  61

Query  1461  DCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDE--TTAVYLI  1288
               L++VF+TKYGASLIP FMPFV VGL A SQ V+ LAC TVS LL+N +E   +A  LI
Sbjct  62    AVLERVFKTKYGASLIPQFMPFVQVGLTAESQEVKSLACKTVSCLLZNLNEGSVSATRLI  121

Query  1287  LQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCS  1108
             L + +YPLLL CLI G+E VA  A+ AI  +AG  +G+DI+FPA++ E THLG LA +CS
Sbjct  122   LDHNIYPLLLDCLIHGNETVATLAMDAIAKIAGSPEGIDIVFPANNKEATHLGALADQCS  181

Query  1107  SL  1102
             S+
Sbjct  182   SV  183



>gb|EMS59085.1| 26S proteasome non-ATPase regulatory subunit 5 [Triticum urartu]
Length=715

 Score =   218 bits (554),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 156/231 (68%), Gaps = 4/231 (2%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N++ AID+      SQ+ DE E ALE  G IG   +GA  LLS  P   RHV+  +FD Q
Sbjct  486  NLLLAIDKILRTEESQNTDEIESALETLGLIGTTTQGACLLLSDPPKIARHVVEMSFDRQ  545

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDG-DAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
              GK+LAALHA G+I G  R  + + LD   AEE L+RL+Y  +S SPKLTPS LLLS+L
Sbjct  546  GRGKQLAALHAFGSICGVDRQEDQMKLDDHQAEECLKRLVYSAASNSPKLTPSALLLSIL  605

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQD ++R+AGYRV++GLV R WCL E+ S+ EI+ IVT+   ET K+GMEAR+ CC A+ 
Sbjct  606  QQDPDVRIAGYRVLSGLVVREWCLREVCSKPEIIGIVTDPKMETTKLGMEARYACCVAIN  665

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLG--RKHAEAQPVVMTEQRF  174
            ++  SSS L+ +P+ S L  KL EA+R GPYL   R+  EAQPVV T +RF
Sbjct  666  KAL-SSSHLLHEPSLSELIGKLNEAVRRGPYLSEKRQRVEAQPVVGTMERF  715


 Score =   187 bits (476),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 153/246 (62%), Gaps = 13/246 (5%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL+AA DFA  P    + + ++FL++FPLP ++  LQ+++D P   + +  CLDKVF ++
Sbjct  191   LLRAAADFASYPGTHGEDTVRQFLEQFPLPKLLGVLQSQADVPETVETVAACLDKVFSSR  250

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTT-----------VSSLLDNT-DETTAVYLI  1288
             YGASL+P +  F+  GL   S ++R+LAC             V  LLD   D   AV   
Sbjct  251   YGASLLPSYGEFIQAGLLTNSNSIRQLACKASPDPHFQVLYQVVHLLDKAGDIAVAVDTF  310

Query  1287  LQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCS  1108
             +Q+ +YPLL++CLI+GDE+++A  + AIK LA    G DIIFP    +   L  +AA+ S
Sbjct  311   VQHNLYPLLINCLIEGDEEISAIVLDAIKRLAEIPTGTDIIFPP-DGQGLQLNKVAAQSS  369

Query  1107  SLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEA  928
             S+ R+R+L+LI KLF  S+  A+ + ++NLLSL E E+ +  D L TLSALE+LYEL E 
Sbjct  370   SMARIRILSLIAKLFGASSCTATAIRDSNLLSLFEDEIKDRKDMLKTLSALEVLYELAEH  429

Query  927   QHSMEF  910
              HS  F
Sbjct  430   PHSNMF  435



>gb|AIU50898.1| ARM repeat superfamily protein, partial [Acorus calamus]
Length=460

 Score =   211 bits (538),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 160/234 (68%), Gaps = 23/234 (10%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             L++AA++F+  P  Q+D S ++FLDRFPLP V  AL+ + +    E  L DCLD++F+T+
Sbjct  1     LMEAASEFSSYPGLQNDESVKKFLDRFPLPVVFGALEREEN----EWTLVDCLDRIFKTR  56

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             +GASLIPH+M FV VGL   SQ +R LAC  +  LL+N      + LI+   +YPLLL  
Sbjct  57    HGASLIPHYMQFVQVGLQVNSQLIRCLACNVIYYLLEN------IQLII---LYPLLLRN  107

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LIDG+E VAAAA  AIKNLA F KG+ +IFP          + AA CSSL R+R+LAL+ 
Sbjct  108   LIDGNEVVAAAATEAIKNLAQFPKGISLIFP----------NAAAHCSSLARIRILALVA  157

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             KLF+IS+ VAS VYN+NLLSL E E+ N+ D L T+SALELLYEL E+ H   F
Sbjct  158   KLFAISSPVASSVYNSNLLSLFEAEISNSTDMLSTMSALELLYELAESPHGTNF  211


 Score =   203 bits (516),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 150/213 (70%), Gaps = 13/213 (6%)
 Frame = -3

Query  812  QDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHHGKRLAALHALGNI  633
            QD DE E ALEAFGQIG   +GA  LL+      +HV+  AF     GK++AAL ALG+I
Sbjct  261  QDIDECENALEAFGQIGSSIQGAQLLLAPVA---KHVVELAFYPHGRGKQMAALLALGSI  317

Query  632  VGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSEIRLAGYRVITG  453
             G  RS     +  DAEE LRRLIY T++ S KLTPSGL LSVLQQD E+RLA YR+I  
Sbjct  318  CGADRS----YVKDDAEECLRRLIYATAANSSKLTPSGLYLSVLQQDPEVRLAAYRLIAV  373

Query  452  LVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTSSSKLMSDPARS  273
            LV RPW L+E+ S+QEI+++VT+   ET K GMEARH+CC A+  + ++S++L +D A +
Sbjct  374  LVVRPWSLMEVCSKQEIINMVTD---ETTKKGMEARHECCAAISNALSTSNRL-NDAALA  429

Query  272  GLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            G+A KL+EA++ GPYL ++  E+QPVV+T  RF
Sbjct  430  GIAAKLQEAVKRGPYLAKR--ESQPVVVTADRF  460



>ref|XP_004961264.1| PREDICTED: uncharacterized protein LOC101757405 [Setaria italica]
Length=526

 Score =   213 bits (542),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 110/237 (46%), Positives = 164/237 (69%), Gaps = 3/237 (1%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             +LQAA DFA  P   SD + ++FL+R PLP ++ ALQ+++D PG+ + + +CLDKVF ++
Sbjct  13    MLQAAGDFASYPGLHSDDTVRQFLERCPLPKLLGALQSEADAPGMVETVTECLDKVFSSR  72

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNT-DETTAVYLILQNGVYPLLLS  1255
             YGASL+P +  F+  GL   S+++R+LAC  V  LLD   D   AV  ++Q+ +YP+L++
Sbjct  73    YGASLLPSYGAFIRTGLLTDSKDIRKLACKAVLHLLDKAEDGAAAVETVVQHNLYPVLIN  132

Query  1254  CLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQ--THLGDLAAKCSSLGRVRVLA  1081
             CLI+GDE+++A  + A+K LA   KG +IIFP     Q    LG +A++ SSL R+R+L+
Sbjct  133   CLIEGDEEISAIILDAVKRLAEIPKGAEIIFPLPPDGQGSVQLGKVASQSSSLARIRILS  192

Query  1080  LIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             LI KLF++S+  A+ + ++NLLS+ E E+ +  D L TLSALE+LYELVE  HS  F
Sbjct  193   LIAKLFTVSSYTATAIRDSNLLSIFEDEIKDRRDMLKTLSALEVLYELVEHPHSNIF  249


 Score =   212 bits (540),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 157/229 (69%), Gaps = 3/229 (1%)
 Frame = -3

Query  857  NVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQ  678
            N+++AID+      +Q+ DE E ALE  G IG   +GA  LL+SS    RHV+ ++FD Q
Sbjct  300  NLLAAIDKILKMEENQNTDEIESALETLGLIGTTTQGAHFLLTSSNV-ARHVVESSFDRQ  358

Query  677  HHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQ  498
              G++LAALHA G+I G  R  + + LDG AEE L+RL+Y T++ S KLTPS LLLS+LQ
Sbjct  359  GRGRQLAALHAFGSICGVDRQEDQMKLDGQAEEYLKRLVYTTAANSSKLTPSALLLSILQ  418

Query  497  QDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYE  318
            QD +IR+AGYRVI+GLV R WCL EI    +I+ +VT+   ET K+GMEAR+ CC A+ +
Sbjct  419  QDPDIRIAGYRVISGLVVREWCLREICLNSDIIRLVTDPTMETTKLGMEARYNCCVAINK  478

Query  317  SFTSSSKLMSDPARSGLATKLEEAIRSGPYLG-RKHAEAQPVVMTEQRF  174
            S  SSS L+ + + S L  KL +A+R GPYL  RK  EA+PVV+  +RF
Sbjct  479  SL-SSSHLLHEKSLSELIGKLNDAVRRGPYLSERKREEARPVVVPAERF  526



>gb|KDO49244.1| hypothetical protein CISIN_1g0124482mg, partial [Citrus sinensis]
Length=360

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            + VISAID R  FL SQD+DE E ALEA GQIG   +GA  LL   P   RHVI AAFD 
Sbjct  195  KTVISAIDGRLGFLQSQDSDECESALEALGQIGSSIQGATLLLLCLPPAARHVIDAAFDR  254

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
            Q HGK+LAALH L NI G+TRS + ++L+ DAEESLR LIY+ +S+S KLTPSGL LSVL
Sbjct  255  QGHGKQLAALHGLANIAGKTRSEDKIILNADAEESLRHLIYEVASRSSKLTPSGLFLSVL  314

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEK  363
            QQ +EIRLAGYR+ITGLVARPWCL+E+ S+QEI++ VT+  TE +K
Sbjct  315  QQAAEIRLAGYRMITGLVARPWCLMELCSKQEIINTVTDASTEQQK  360


 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
 Frame = -2

Query  1338  VSSLLDNTD--ETTAVYLILQNGVYPLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDII  1165
             V+ LL+++D   + A+ L++   +YPLLL CLI+G+E+VA A++ AIK LAGF  G+DII
Sbjct  1     VTCLLEDSDLEASCALQLLIDYEIYPLLLDCLINGNEEVATASMDAIKKLAGFPNGIDII  60

Query  1164  FPASSSEQTHLGDLAAKCSSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNA  985
             FPA +   T LG+L A+CSSLGRVRVL+LIVKLFS+S +VAS ++ ANLL+LLE+ V   
Sbjct  61    FPADNKAATDLGNLVAQCSSLGRVRVLSLIVKLFSVSRSVASVIFKANLLTLLEEGVSKK  120

Query  984   NDTLVTLSALELLYELVEAQHSMEF  910
             NDTL TLS LELLYEL E QHS EF
Sbjct  121   NDTLETLSILELLYELAEIQHSAEF  145



>gb|AIU50926.1| ARM repeat superfamily protein, partial [Yucca filamentosa]
Length=464

 Score =   210 bits (534),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 154/234 (66%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL+AA+DFA  P  Q+D +A EFLDRFPLP + + LQ   +   LE  +  CLD++FRTK
Sbjct  1     LLEAASDFATYPGLQTDAAATEFLDRFPLPLIFSVLQTGVEESELEATIVACLDRIFRTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGAS +  +  F+  GL A S  VR LAC  VS +L+N              +Y LL+ C
Sbjct  61    YGASRLLQYASFLQAGLRANSHIVRCLACKAVSYILENVKNII---------IYSLLIDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             L+DG+E+ +AA + +IKN+A  ++G+ +IFP          ++A++CSSLGRVR+LALI 
Sbjct  112   LLDGNEETSAAVLESIKNIAQSSEGIGVIFP----------NVASRCSSLGRVRILALIK  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             +LFS+ST+VAS VY ANLL L E E+   +D L TLSALELLYELVE+ HS  F
Sbjct  162   ELFSLSTSVASAVYEANLLKLFEAEINRRDDMLTTLSALELLYELVESPHSSRF  215


 Score =   200 bits (508),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 150/224 (67%), Gaps = 18/224 (8%)
 Frame = -3

Query  845  AIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHHGK  666
            A+D R      QD DE E ALEA GQIG   +GA  LL+      RHV  +AF CQ  GK
Sbjct  259  AVDERL-----QDTDECESALEALGQIGTSIQGAVLLLTPVA---RHVFESAFGCQGRGK  310

Query  665  RLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSE  486
            +LAALHA+G+I G  RS     L+  AE+ LRRL Y  ++ S KLTPSGLLLSVLQQ+ E
Sbjct  311  QLAALHAIGDICGANRSE----LNDTAEKCLRRLFYAAAANSTKLTPSGLLLSVLQQEPE  366

Query  485  IRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTS  306
            IRLA YR+I+ +V RPW ++E+ S++EI+ I+T++ T   KIGMEAR  CC ++  +  S
Sbjct  367  IRLAAYRLISAVVVRPWGIMEVCSKKEIITILTDEAT---KIGMEARFNCCASINNAL-S  422

Query  305  SSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +S ++ D + + +A KL+EA+R GPYL +K  E QPVV+T  RF
Sbjct  423  ASNMVHDASVAEIAAKLQEAVRRGPYLSKK--EPQPVVVTADRF  464



>gb|AIU50938.1| ARM repeat superfamily protein, partial [Alisma plantago-aquatica]
Length=290

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 155/226 (69%), Gaps = 18/226 (8%)
 Frame = -3

Query  851  ISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHH  672
            + AI+RR       D DE E A EA GQIG   +GA  LL  S   V+HVI++AF     
Sbjct  83   VFAINRRL-----HDTDECESAFEALGQIGTSLQGALLLLRPS---VKHVITSAFCRSGR  134

Query  671  GKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQD  492
            G  LAALHA GNIVG  R+     LD DAE SL+RL+Y+ ++ S KLTPSGL L+VL+++
Sbjct  135  GVALAALHAFGNIVGVERTE----LDSDAEASLQRLVYEVATNSSKLTPSGLFLTVLRKE  190

Query  491  SEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESF  312
             + RLA YR+I+ LV+R WCLIE+ S+QEI+DIVT+   ET K GM+ARH CC A+ ++ 
Sbjct  191  PDFRLAAYRLISALVSRQWCLIEVCSKQEIIDIVTD---ETIKNGMDARHACCLAISKAL  247

Query  311  TSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             SS+ + +D A +G+  KL+EA+R GPYL ++  EAQP+V+T +RF
Sbjct  248  FSSN-MANDTALAGVTGKLQEAVRRGPYLPKR--EAQPIVVTAERF  290


 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  1032  YNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             YN+ LLSL E EVG  ND L TLSALEL+YEL E+ +S +F
Sbjct  1     YNSGLLSLFEAEVGKTNDMLTTLSALELMYELAESPYSSQF  41



>gb|ADE76369.1| unknown [Picea sitchensis]
Length=526

 Score =   205 bits (522),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 149/229 (65%), Gaps = 1/229 (0%)
 Frame = -3

Query  860  RNVISAIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDC  681
            +N + AID     L + D++E E AL+A  QIG   +GA  LL ++P   RH + A F  
Sbjct  299  KNAVQAIDMDLERLKATDSNEREIALDALSQIGTVMRGAELLLCNTPPTARHAVDATFSH  358

Query  680  QHHGKRLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVL  501
                 +LA+ HAL +I G+ RS +  LL+  AE  LR LIY  +  S K +PSGLL S+L
Sbjct  359  GWRNIQLASTHALASISGQERSQSTQLLNDQAETCLRNLIYTAAENSSKRSPSGLLWSLL  418

Query  500  QQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVY  321
            QQD EIRLA YR+I GLV RPWCL E+ ++QEI+++VTN ++ET KIGME RH CC A+ 
Sbjct  419  QQDPEIRLAAYRLIAGLVTRPWCLWEVCAKQEIINLVTNPHSETTKIGMEFRHSCCVAIR  478

Query  320  ESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             +  +SS   +DPA S ++ KL+ A+R GPYL ++    +P+V TE+R+
Sbjct  479  NALLASS-YKNDPAFSDVSEKLQAAVRRGPYLAKEFVAPKPLVATEERY  526


 Score =   182 bits (462),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 140/225 (62%), Gaps = 2/225 (1%)
 Frame = -2

Query  1578  PSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTKYGASLIPHFMP  1399
             P   +D + +EFLDRFPLP +  AL+   D PGLE +L  CL+++ +T YG SL+P  +P
Sbjct  25    PGHLTDAAVKEFLDRFPLPLIFIALKNGFDVPGLEGSLVSCLERILKTSYGVSLLPQCVP  84

Query  1398  FVVVGLGAPSQNVRRLACTTVSSLLDNTD--ETTAVYLILQNGVYPLLLSCLIDGDEQVa  1225
             +   GL A     R+L+C  ++ LL+N+D  E   V  I+  GV+P ++ CL D DE VA
Sbjct  85    YAQAGLKANFPLTRQLSCKAIAQLLENSDKDEGVGVRAIVDYGVWPSIVVCLADSDESVA  144

Query  1224  aaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIVKLFSISTTV  1045
              AA  A+KNLA  T+GL++IFPA + E T L +     SS+ R+R+LA+I  LF IS   
Sbjct  145   TAAAEAVKNLAKSTRGLELIFPAKAEEDTLLKEFTMNSSSMVRIRILAIIAALFGISDEA  204

Query  1044  ASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             A+ V+ + LL + E+E+    D L TL+ LE+LYE+V    + +F
Sbjct  205   ATAVHQSGLLGMFEQELNGTTDMLATLNVLEVLYEIVATPIAAKF  249



>gb|AIU50914.1| ARM repeat superfamily protein, partial [Asparagus officinalis]
Length=464

 Score =   201 bits (511),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 150/224 (67%), Gaps = 18/224 (8%)
 Frame = -3

Query  845  AIDRRFAFLGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHHGK  666
            AID R      QD+DE+E A+EA GQIG   +GA  LL+      RHV  A F  Q  GK
Sbjct  259  AIDGRL-----QDSDEYESAIEALGQIGASSQGAILLLTPV---ARHVFQAVFGHQSRGK  310

Query  665  RLAALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSE  486
            +LAALHALG+I G +R G    L+  AE+ LR+L Y  ++ SPK+TPSGLLL VLQQ+ E
Sbjct  311  QLAALHALGDICGASRPG----LNNAAEKCLRQLFYAAAANSPKMTPSGLLLWVLQQEPE  366

Query  485  IRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTS  306
             R AGYR+I+ LVARPW L+E+ S+QEI+ IVT+   E  K GMEAR  CC A+  +  S
Sbjct  367  KRQAGYRLISALVARPWGLMEVCSKQEIITIVTD---EDTKFGMEARFNCCAAINNAL-S  422

Query  305  SSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
            +S ++ D + + +A KL++A+R GPYL +K  EAQPVV+T  RF
Sbjct  423  ASNMLHDASIAEVAAKLQDAVRRGPYLAKK--EAQPVVVTADRF  464


 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 157/234 (67%), Gaps = 19/234 (8%)
 Frame = -2

Query  1611  LLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTK  1432
             LL+AA+DFA  P   +D +A+EFLDRFPL  + + LQ+  D PG E  +  CLD++FRTK
Sbjct  1     LLEAASDFASYPGLLTDDAAKEFLDRFPLTFLFSVLQSWVDRPGAEATVVACLDRLFRTK  60

Query  1431  YGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSC  1252
             YGASL+  +  F+  GL A S  +R LAC +VS +L+N              +Y LL+ C
Sbjct  61    YGASLLLQYTSFLQAGLRANSHTLRCLACKSVSYILENVKTIV---------IYSLLVDC  111

Query  1251  LIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIV  1072
             LI+G+E+ +AAA+ AIKN+    +G+D+IFP           +A++CSSLGR+RVLALI 
Sbjct  112   LIEGNEETSAAALGAIKNIVQSPEGIDVIFP----------HVASRCSSLGRIRVLALIK  161

Query  1071  KLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             +LFS+S++VAS V+ ANLL L E E+ N +D L TLSALELLYELVE+ HS  F
Sbjct  162   ELFSLSSSVASAVHKANLLKLFEAEINNRDDMLTTLSALELLYELVESPHSSRF  215



>gb|EPS65697.1| hypothetical protein M569_09080, partial [Genlisea aurea]
Length=162

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 121/162 (75%), Gaps = 1/162 (1%)
 Frame = -3

Query  659  AALHALGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSEIR  480
            AALH+L N+ GE R+ N  +L+  AEE+ RRLIYD +S + KLTPSGLLLSVLQQDSEIR
Sbjct  1    AALHSLANVAGEKRADNARVLNRQAEENFRRLIYDKASTTAKLTPSGLLLSVLQQDSEIR  60

Query  479  LAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTSSS  300
            +AGYRVI G VARPW L+EI+++ +I+DIV + Y E++K GMEARH+CC+A++E+  SSS
Sbjct  61   IAGYRVIAGGVARPWWLMEILAKSQIIDIVIDTYGESKKTGMEARHRCCKAIHEALASSS  120

Query  299  KLMSDPARSGLATKLEEAIRSGPYLGRKHAEA-QPVVMTEQR  177
                    S +A+K+EE +R G Y  R+ +EA Q +V+T  R
Sbjct  121  SRELGAEFSAVASKVEEGVRRGAYGARRQSEAHQAMVITADR  162



>gb|AIU50940.1| ARM repeat superfamily protein, partial [Cabomba caroliniana]
Length=315

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 139/213 (65%), Gaps = 13/213 (6%)
 Frame = -3

Query  812  QDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHHGKRLAALHALGNI  633
            +D+DE   A++A GQIG   KGA  L +     V HVI  AF  +    RLA+LHALG+I
Sbjct  116  EDSDECINAIDAIGQIGASLKGAELLFALM---VEHVIRTAFLRKGRATRLASLHALGSI  172

Query  632  VGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSEIRLAGYRVITG  453
            VGE RS     L   +EE LR+LIY+T++ S KLTPSG+L SVLQQD+EIRLA YRVI G
Sbjct  173  VGEDRST----LSNPSEERLRKLIYETAAASSKLTPSGILHSVLQQDAEIRLAAYRVIAG  228

Query  452  LVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTSSSKLMSDPARS  273
            LV RPW L+E+  + E +DI+T+   ET K GMEARHKCC  + ++  +      D    
Sbjct  229  LVVRPWFLLEVCLKGEFIDIITD---ETTKYGMEARHKCCVGLRDAIAAQPN-PDDALLL  284

Query  272  GLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
             + +K++EAI  GPYLG K  EAQPVV+  QRF
Sbjct  285  AVGSKVQEAISRGPYLGNK--EAQPVVIPAQRF  315


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -2

Query  1110  SSLGRVRVLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVE  931
             S L R+R+ +   KLFSIST  AS V  + LL +L  EV +++D L+TLS LE+LYEL  
Sbjct  1     SPLARIRIFSFTAKLFSISTVAASAVRRSGLLDVLVSEVNSSSDVLMTLSILEVLYELAS  60

Query  930   AQHSMEF  910
               H  E+
Sbjct  61    TPHGSEY  67



>gb|AIU50919.1| ARM repeat superfamily protein, partial [Erythranthe guttata]
Length=213

 Score =   175 bits (444),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 120/166 (72%), Gaps = 19/166 (11%)
 Frame = -2

Query  1407  FMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSCLIDGDEQV  1228
             F  FV+VGL A SQ VRRLAC  +SSLL+N      V L+L   VYPLLLSC IDGDEQV
Sbjct  1     FQAFVLVGLVADSQKVRRLACIAISSLLEN------VQLVL---VYPLLLSCCIDGDEQV  51

Query  1227  aaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIVKLFSISTT  1048
             AAA+  AI+NLAG+ +GL I+ P          ++A KCSSLGRVRVLALIV+LFS S +
Sbjct  52    AAASSEAIRNLAGYEEGLGIVLP----------NIAEKCSSLGRVRVLALIVRLFSASRS  101

Query  1047  VASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             VAS+V  + +LSLLE EV N NDTLVTLS LEL+YEL E +HS EF
Sbjct  102   VASEVSRSGILSLLEAEVRNTNDTLVTLSVLELIYELAEVEHSAEF  147


 Score = 46.6 bits (109),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 5/34 (15%)
 Frame = -3

Query  863  YRNVISAIDRRFAFLGSQDADEFECALEAFGQIG  762
            +R+V+SAIDRRF     Q ADE ECALEA GQIG
Sbjct  185  FRSVLSAIDRRF-----QAADECECALEALGQIG  213



>ref|XP_010064455.1| PREDICTED: uncharacterized protein LOC104451515 [Eucalyptus grandis]
Length=508

 Score =   159 bits (402),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -3

Query  761  LCKKGaaallssspaPVRHVISAAFDCQHHGKRLAALHALGNIVGETRSGNDVLLDGDAE  582
            L  +GA  LLSS+    RHV+ AAFD Q  GK+LAALHALGN+ G+ RS N V+L+G AE
Sbjct  324  LATQGAELLLSSTYPVARHVVYAAFDRQGRGKQLAALHALGNLAGDARSDNSVILNGSAE  383

Query  581  ESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEI  402
            E+ R LIY+ +S+SPKL PSGL LSVLQQ++E RLAGYR IT LVARPWCL+EI S++EI
Sbjct  384  ETPRLLIYEAASRSPKLIPSGLFLSVLQQEAETRLAGYRPITALVARPWCLMEICSKEEI  443

Query  401  VDIVTN  384
            VDIVT+
Sbjct  444  VDIVTD  449



>ref|XP_006478066.1| PREDICTED: uncharacterized protein LOC102620361 [Citrus sinensis]
Length=149

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = -2

Query  1650  TAMEEEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLE  1474
             TAM++E S+D + QLL +A+DFAY P  Q+D +A+ FLDRFPL  ++N LQ K D PGLE
Sbjct  32    TAMDDELSMDDSNQLLDSASDFAYHPGVQNDAAAKNFLDRFPLSVILNTLQTKPDVPGLE  91

Query  1473  DALCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSS  1330
             D L  CL+++F+TKYGASLIPH+MPFV VGL A S +V+RLAC TVS+
Sbjct  92    DTLVVCLERIFKTKYGASLIPHYMPFVQVGLTADSHSVKRLACKTVSA  139



>gb|KDO49245.1| hypothetical protein CISIN_1g0124481mg, partial [Citrus sinensis]
Length=103

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = -2

Query  1644  MEEEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDA  1468
             M+EE S+D + QLL +A+DFAY P  Q+D +A++FLDRFPL  ++N LQ K D PGLED 
Sbjct  1     MDEELSMDDSNQLLDSASDFAYHPGVQNDAAAKKFLDRFPLSVILNTLQTKPDVPGLEDT  60

Query  1467  LCDCLDKVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTT  1339
             L  CL+++F+TKYGASLIPH+MPFV VGL A S +V+RLAC T
Sbjct  61    LVVCLERIFKTKYGASLIPHYMPFVQVGLTADSHSVKRLACKT  103



>ref|XP_001766663.1| predicted protein [Physcomitrella patens]
 gb|EDQ68516.1| predicted protein [Physcomitrella patens]
Length=527

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 136/233 (58%), Gaps = 2/233 (1%)
 Frame = -2

Query  1602  AATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTKYGA  1423
             AA++F+  P   SD SA+ FL +FPLP +++AL+   D PGLE ++   L+++F+T YG 
Sbjct  8     AASEFSNYPGDISDASAESFLSKFPLPVLLSALETGRDVPGLESSVALSLERIFQTAYGK  67

Query  1422  SLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDN--TDETTAVYLILQNGVYPLLLSCL  1249
              L+P  + +  VGL A S  VR+L C+ +  LL+   TD   AV  I +  +   LL  +
Sbjct  68    KLLPQTLSYAGVGLKAESSLVRKLTCSAIGDLLEGGETDGGAAVRAIAEAHLAAPLLLAI  127

Query  1248  IDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVRVLALIVK  1069
              DGD  VA AA  A+  LA    GL++IF A  +    L D+A++ S+  R+R L++   
Sbjct  128   GDGDAHVAKAAADALGKLARNPGGLELIFTAKGAGAGLLKDMASQSSATVRIRALSMAAS  187

Query  1068  LFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVEAQHSMEF  910
             +F IS   A+ V ++ + ++L  E+ N++D L  L+ALELL +L    H  +F
Sbjct  188   IFGISEEAAAAVQDSGIFTVLAAELDNSDDMLAQLNALELLCDLAATSHGAKF  240


 Score =   124 bits (311),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/216 (35%), Positives = 119/216 (55%), Gaps = 4/216 (2%)
 Frame = -3

Query  815  SQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHHGKRLAALHALGN  636
            + +  E+E AL A   I    KGA  L   +   +RH++ AAF  +    +LA L  L  
Sbjct  314  TTETTEYENALNALSFIAKTVKGAELLFDHTMV-IRHMVKAAFLDRTLCIKLAGLQVLAT  372

Query  635  IVGETRSGNDVLLDGDAEESLRRLIYDTSS-KSPKLTPSGLLLSVLQQDSEIRLAGYRVI  459
            + G  R  ++VLL   +E  L+ +IY  +  +SP  TP+G+ L   QQ +E+RLA YR  
Sbjct  373  VAGSERDPSNVLLSESSEAQLKDMIYSAAEERSPTRTPAGMFLIFFQQSTEVRLAMYRFT  432

Query  458  TGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTSSSKLMSDPA  279
            + ++AR WCL E+ + +E+VD + +   E  K  ME RH CC A+  + +++ +    P 
Sbjct  433  SPMLARLWCLRELCASREVVDYLLDARLEISKDSMEWRHVCCVAMTTALSAAIERGQIPP  492

Query  278  RSGLATKLEEAIRSGPYLGR-KHAEAQPVVMTEQRF  174
               L ++LEE +R GP+LG+ +  EA P+  T +R 
Sbjct  493  TDTL-SRLEEFVRKGPFLGKEQQKEAIPIYATLERM  527



>ref|XP_002975709.1| hypothetical protein SELMODRAFT_442892 [Selaginella moellendorffii]
 gb|EFJ23338.1| hypothetical protein SELMODRAFT_442892 [Selaginella moellendorffii]
Length=512

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 120/213 (56%), Gaps = 12/213 (6%)
 Frame = -3

Query  809  DADEFECALEAFGQIGLCKKGaaallss-spaPVRHVISAAFDCQHHGKRLAALHALGNI  633
            D DE + AL+A GQIG    GA  LL   +  P  +V+ +AF  +     LA +HAL  I
Sbjct  311  DKDEKDAALDALGQIGSFSHGAQVLLLRGARPPALYVVHSAFKPE-----LAGIHALALI  365

Query  632  VGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSEIRLAGYRVITG  453
             G  R   DVLL+  AE  LR LI+D    S + T S  LL +L+Q +E+R A YR++  
Sbjct  366  AGSER--EDVLLNEQAENVLRDLIFDAIHVSSQKTLSNSLLHLLKQTAELRQAVYRLLVP  423

Query  452  LVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYESFTSSSKLMSDPARS  273
            L +R WCL+E+ S   +VD + +   E+ K GME RH CC A+      +  ++S   R 
Sbjct  424  LASRTWCLLEVSSNDGLVDFIVDSRIESSKQGMEWRHACCAALATGLRQA--ILS--VRG  479

Query  272  GLATKLEEAIRSGPYLGRKHAEAQPVVMTEQRF  174
                KL EA R GPYL + HA+A PVV T++RF
Sbjct  480  DTLEKLNEAARRGPYLSKDHAQAIPVVATQERF  512


 Score =   132 bits (331),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/233 (36%), Positives = 137/233 (59%), Gaps = 5/233 (2%)
 Frame = -2

Query  1629  SVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLD  1450
             SVD   LL  A+D A  P    + S  +FL ++P P + + L + ++ P L  A+ + ++
Sbjct  9     SVDTNLLLVEASDLAAHPGALPESSVSDFLAKYPFPVLFSVL-STAETPELVSAIVNAVE  67

Query  1449  KVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVY  1270
             K+ ++ +G S++   +P+   GL A S  +RRLAC +++  L++ D +++V      G+ 
Sbjct  68    KILQSPFGHSMLIGVLPYANAGLNAASPQIRRLACFSITKYLEDGD-SSSVQTAADAGIM  126

Query  1269  PLLLSCLIDGDEQVaaaaiaaIKNLAGFTKGLDIIFPASSSEQTHLGDLAAKCSSLGRVR  1090
               LLS + D D  VA  A  AI+NLA  + GL++IF AS   Q  L +LA   SSL ++R
Sbjct  127   DPLLSTICDEDSSVAKEASDAIENLAKSSAGLEVIFGAS---QNSLKELAIHGSSLVQIR  183

Query  1089  VLALIVKLFSISTTVASKVYNANLLSLLEKEVGNANDTLVTLSALELLYELVE  931
              L+L  ++F +S   A+ V  + +LS+LE ++ N++DTL  L+A E+L EL E
Sbjct  184   ALSLAARIFGLSDVAAAAVQTSGILSVLEGQLKNSSDTLAQLNAFEILSELAE  236



>gb|KHN05308.1| hypothetical protein glysoja_047203 [Glycine soja]
Length=182

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -3

Query  521  GLLLSVLQQDSEIRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARH  342
            GL LSVLQQDSE+RLAGYR+++ LVARPWCL+EI S+QEI++ VT+  TET KIGME R+
Sbjct  77   GLFLSVLQQDSEMRLAGYRMLSELVARPWCLMEICSKQEIINKVTDPSTETTKIGMEGRY  136

Query  341  KCCEAVYESFTSSSKLMSDPARSGLATKL  255
             CC+A+++S T SS++ ++PA +G+A K+
Sbjct  137  DCCKAIHKSLTVSSRVSANPAFAGIAAKV  165


 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  1626  VDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDK  1447
             VD++QLL+AA+DFA+     SD SA++FL+RFPLP + +ALQ + D PGLE+ L  CL++
Sbjct  2     VDSSQLLEAASDFAHYTGAHSDDSARDFLNRFPLPVIFSALQTQFDVPGLENTLVTCLER  61

Query  1446  VFRTKYGASLIPHFM  1402
             +F TK GASLIP +M
Sbjct  62    LFNTKLGASLIPQYM  76



>ref|XP_002973654.1| hypothetical protein SELMODRAFT_413906 [Selaginella moellendorffii]
 gb|EFJ25314.1| hypothetical protein SELMODRAFT_413906 [Selaginella moellendorffii]
Length=451

 Score = 88.2 bits (217),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 91/181 (50%), Gaps = 29/181 (16%)
 Frame = -3

Query  809  DADEFECALEAFGQIGLCKKGaaallss-spaPVRHVISAAFDCQHHGKRLAALHALGNI  633
            D DE + AL+A GQIG    GA  LL   +  P  +V+ +AF  +     LA +HAL  I
Sbjct  257  DKDEKDAALDALGQIGSFSHGAQVLLLRGARPPALYVVHSAFKPE-----LAGIHALALI  311

Query  632  VGETRSGNDVLLDGDAEESLRRLIYDTSSKSPKLTPSGLLLSVLQQDSEIRLAGYRVITG  453
             G  R   DVLL+  AE  LR LI+D    S + T S  LL +L+Q +E+R A YR++  
Sbjct  312  AGSER--EDVLLNEQAENVLRDLIFDAIHVSSQKTLSNSLLHLLKQTAELREAVYRLLVP  369

Query  452  LVARPWCLIEIISRQEIVDIVTN---------------------KYTETEKIGMEARHKC  336
            L +R WCL+E+ S   +VD + +                     K+    + GMEAR  C
Sbjct  370  LASRTWCLLEVSSNDGLVDFIVDARIESSKQGSYFSLHGSWQELKFNAHHRHGMEARLLC  429

Query  335  C  333
            C
Sbjct  430  C  430


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 54/95 (57%), Gaps = 1/95 (1%)
 Frame = -2

Query  1629  SVDAAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLD  1450
             SVD   LL  A++ A  P    + S  +FL ++P P + + L + ++ P L  A+ + ++
Sbjct  9     SVDTNLLLVEASNLAAHPGALPESSVSDFLAKYPFPVLFSVL-STAETPELVSAIVNAVE  67

Query  1449  KVFRTKYGASLIPHFMPFVVVGLGAPSQNVRRLAC  1345
             K+ ++ +G S++   +P+   GL A S  +RRLAC
Sbjct  68    KILQSPFGHSMLIGVLPYANAGLNAGSPQIRRLAC  102



>ref|XP_005846909.1| hypothetical protein CHLNCDRAFT_134792, partial [Chlorella variabilis]
 gb|EFN54807.1| hypothetical protein CHLNCDRAFT_134792, partial [Chlorella variabilis]
Length=210

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 62/137 (45%), Gaps = 7/137 (5%)
 Frame = -2

Query  1569  QSDVSAQEFLDRFPLPAVINALQAKSDYPGLEDALCDCLDKVFRTKYGASLIPHFMPFVV  1390
             QSD  AQ+F+  FPL      L        L +     L KVF T YGASL+P  +P   
Sbjct  19    QSDAEAQDFIAAFPLETCFRELSGPDVSASLMEDAAAALAKVFGTSYGASLLPSILPLAA  78

Query  1389  VGLGAPSQNVRRLACTTVSSLLDNTDETTAVYLILQNGVYPLLLSCLIDGDEQVaaaaia  1210
               L +PS  +RRLA   +  L+   +E     L        LL++ L D +  V +AA A
Sbjct  79    AALQSPSVPLRRLAVQQLGRLVAAQEEPPPACLD-------LLMAALQDPEVGVTSAAEA  131

Query  1209  aIKNLAGFTKGLDIIFP  1159
             A++ L     G   + P
Sbjct  132   ALRQLGRPQAGAQALLP  148



>emb|CAN71644.1| hypothetical protein VITISV_041775 [Vitis vinifera]
Length=392

 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -2

Query  1644  MEEEYSVD-AAQLLQAATDFAYDPSPQSDVSAQEFLDRFPLPAVINALQAK  1495
             MEEEY++D    LLQAA+DF + P   SD SA+ FL RFPLP +IN  + +
Sbjct  1     MEEEYTLDDPTLLLQAASDFGHHPGVHSDASAKAFLHRFPLPVIINGCKNR  51



>ref|XP_005651761.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27217.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
Length=441

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 57/220 (26%), Positives = 102/220 (46%), Gaps = 19/220 (9%)
 Frame = -3

Query  821  LGSQDADEFECALEAFGQIGLCKKGaaallssspaPVRHVISAAFDCQHHGK-RLAALHA  645
            L    AD  E AL+A  ++G    GA    + +     HV + A       + R AALHA
Sbjct  221  LAEPSADLVEAALDAVSRLGASPSGAELFFADAHGLPAHVATLALGRAGGTQIRTAALHA  280

Query  644  LGNIVGETRSGNDVLLDGDAEESLRRLIYDTSSKSPK--LTPSGLLLSVLQQD-SEIRLA  474
            LG + G  R+  D  +   AE++ R++ + T++  P     P+ LLL  L+Q  +++R  
Sbjct  281  LGIVAGAHRA--DHAMSAPAEDTFRQVTF-TAAAGPSGFQAPAELLLGFLRQPFADLRTG  337

Query  473  GYRVITGLVARPWCLIEIISRQEIVDIVTNKYTETEKIGMEARHKCCEAVYES-------  315
             YR++  L  R W   E+    ++++ + +  +ET     E R    +A+ ++       
Sbjct  338  AYRLLRALAQRTWGAAEVCRNAQLMERLGDPRSET--TAQEWRFAIVQALAKTVREATGA  395

Query  314  -FTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEAQP  198
               + +    D  R+  A +++ A++ G Y GR  A  +P
Sbjct  396  ELANGASQQRDALRAA-APQVDRAVQQGLY-GRGAATHRP  433



>ref|XP_002609424.1| hypothetical protein BRAFLDRAFT_114978 [Branchiostoma floridae]
 gb|EEN65434.1| hypothetical protein BRAFLDRAFT_114978 [Branchiostoma floridae]
Length=503

 Score = 52.8 bits (125),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 60/117 (51%), Gaps = 8/117 (7%)
 Frame = -3

Query  551  SSKSPKLTPSGLLLSVLQQDSE-IRLAGYRVITGLVARPWCLIEIISRQEIVDIVTNKYT  375
            ++ SPK  P   L+S++QQ  + +  AG  V+  L  +PW    + +    V+ + ++ T
Sbjct  388  NTFSPK--PMDTLMSIVQQPFQNLHCAGLAVLQALGNQPWAQRAMANFPGFVEYLVDRST  445

Query  374  ETEKIGMEARHKCCEAVYESFTSSSKLMSDPARSGLATKLEEAIRSGPYLGRKHAEA  204
            E +K+G EAR++  +A+ ES T+          S    KL+E  R GP+  R  AE 
Sbjct  446  EKDKMGKEARYEVIKALVESSTALETF-----GSPFYLKLKEYYRQGPFYVRVQAEV  497



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4826968840940