BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22809_g1_i1 len=397 path=[855:0-53 909:54-396]

Length=397
                                                                      Score     E

ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g           89.0    1e-18   
gb|KHN05057.1|  Auxin-responsive protein IAA14                        88.6    1e-18   
gb|ABR25977.1|  osiaa30-auxin-responsive aux/iaa gene family member   85.1    1e-18   Oryza sativa Indica Group [Indian rice]
gb|ABR25699.1|  osiaa30-auxin-responsive aux/iaa gene family memb...  85.1    1e-18   Oryza sativa Indica Group [Indian rice]
gb|ADN34157.1|  auxin-responsive protein                              84.3    2e-18   
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...  87.8    2e-18   
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580        88.2    3e-18   Sorghum bicolor [broomcorn]
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like   88.2    3e-18   
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28           88.2    3e-18   
gb|ACF88333.1|  unknown                                               87.8    3e-18   Zea mays [maize]
gb|EEE53551.1|  hypothetical protein OsJ_36765                        86.7    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like   87.4    4e-18   
gb|ACF87179.1|  unknown                                               87.4    4e-18   Zea mays [maize]
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like   87.4    4e-18   
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like   87.0    5e-18   
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member   87.4    5e-18   Zea mays [maize]
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like      87.0    5e-18   
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like   87.0    5e-18   
dbj|BAJ84870.1|  predicted protein                                    87.0    5e-18   
ref|XP_004150437.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  87.0    5e-18   
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...  86.7    5e-18   
dbj|BAK01326.1|  predicted protein                                    87.0    5e-18   
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like   87.0    5e-18   
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like   87.0    5e-18   
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like   87.0    5e-18   
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...  86.7    6e-18   
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like      87.0    6e-18   
dbj|BAJ97201.1|  predicted protein                                    86.7    6e-18   
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative          85.9    6e-18   Ricinus communis
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like   86.7    6e-18   
ref|NP_001067209.1|  Os12g0601300                                     87.0    7e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001240213.1|  auxin-induced protein ali50                      86.3    8e-18   
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                  86.3    1e-17   
gb|KDP40274.1|  hypothetical protein JCGZ_02272                       86.3    1e-17   
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like      85.9    1e-17   
gb|ABA29614.1|  SP-5                                                  83.6    1e-17   Glycine max [soybeans]
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14        85.9    1e-17   
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...  85.5    1e-17   
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like   85.5    1e-17   
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                 85.9    1e-17   
ref|XP_007201399.1|  hypothetical protein PRUPE_ppa010342mg           85.9    1e-17   
gb|AFK36086.1|  unknown                                               85.9    1e-17   
emb|CDO99148.1|  unnamed protein product                              85.5    1e-17   
ref|XP_010679165.1|  PREDICTED: auxin-responsive protein IAA14-like   85.9    1e-17   
gb|AAV50046.1|  auxin-induced protein                                 84.7    1e-17   Saccharum hybrid cultivar Pindar
ref|NP_001267662.1|  auxin-induced protein AUX28-like                 85.5    2e-17   
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like   85.5    2e-17   
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like      85.5    2e-17   
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg           85.5    2e-17   
gb|ADJ68049.1|  auxin responsive protein                              85.5    2e-17   
emb|CBI35213.3|  unnamed protein product                              84.3    2e-17   
gb|AFK42876.1|  unknown                                               85.5    2e-17   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like      85.5    2e-17   
ref|NP_001280973.1|  auxin-responsive protein IAA16                   85.5    2e-17   
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14        85.5    2e-17   
gb|ADL70552.1|  indole-3-acetic acid inducible 7                      82.4    2e-17   
gb|ADL70558.1|  indole-3-acetic acid inducible 7                      82.4    2e-17   
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg           85.1    2e-17   
gb|ADL70548.1|  indole-3-acetic acid inducible 7                      82.4    2e-17   
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein           85.1    2e-17   
gb|AAN16886.1|  Aux/IAA1                                              82.4    2e-17   Mirabilis jalapa
ref|NP_001268036.1|  uncharacterized protein LOC100250231             85.1    2e-17   
ref|NP_001266039.1|  IAA7 protein                                     84.7    2e-17   
gb|ABK24636.1|  unknown                                               86.3    2e-17   Picea sitchensis
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...  85.1    2e-17   
ref|NP_001266070.1|  IAA14                                            85.1    2e-17   
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14        85.1    2e-17   
gb|AFK37379.1|  unknown                                               85.1    2e-17   
gb|ADL70554.1|  indole-3-acetic acid inducible 7                      82.0    2e-17   
gb|ADL70550.1|  indole-3-acetic acid inducible 7                      82.0    2e-17   
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like   85.1    2e-17   
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg           84.7    3e-17   
gb|AFK44393.1|  unknown                                               85.1    3e-17   
ref|XP_009398379.1|  PREDICTED: auxin-responsive protein IAA30-like   85.1    3e-17   
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14        84.7    3e-17   
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like   84.7    3e-17   
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like   84.7    3e-17   
ref|XP_006383686.1|  auxin-induced protein aux28                      84.7    3e-17   
gb|ABM53874.1|  IAA6                                                  83.6    3e-17   Cestrum elegans
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like   84.7    3e-17   
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                   84.7    3e-17   Nicotiana tabacum [American tobacco]
ref|NP_001239753.1|  uncharacterized protein LOC100781847             84.7    3e-17   
emb|CAH59413.1|  auxin resistance protein                             84.7    3e-17   Plantago major [cart-track plant]
gb|KHN22078.1|  Auxin-responsive protein IAA16                        84.7    3e-17   
ref|XP_002302075.1|  auxin-induced protein aux28                      84.7    3e-17   Populus trichocarpa [western balsam poplar]
gb|AFK44192.1|  unknown                                               84.7    3e-17   
dbj|BAD94452.1|  auxin-induced protein                                81.3    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14        84.7    3e-17   
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1      85.1    3e-17   
ref|XP_002315736.1|  aux/IAA family protein                           84.7    3e-17   Populus trichocarpa [western balsam poplar]
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg              84.7    3e-17   
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like      84.7    3e-17   
emb|CDP06818.1|  unnamed protein product                              84.7    3e-17   
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                     84.7    4e-17   
ref|XP_002311658.1|  aux/IAA family protein                           84.7    4e-17   Populus trichocarpa [western balsam poplar]
gb|ADL70680.1|  indole-3-acetic acid inducible 16                     83.2    4e-17   
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like   84.3    4e-17   
gb|AFS44507.1|  auxin repressor                                       84.3    4e-17   
gb|ADL70670.1|  indole-3-acetic acid inducible 16                     83.2    4e-17   
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...  84.3    4e-17   
gb|AEE25654.1|  auxin-responsive protein                              84.3    4e-17   
ref|NP_001266049.1|  IAA9 protein                                     84.3    4e-17   
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like   84.3    4e-17   
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like      84.3    4e-17   
ref|NP_001275031.1|  auxin-responsive protein IAA14-like              84.0    4e-17   
gb|AFZ78617.1|  hypothetical protein                                  84.3    4e-17   
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                    84.3    4e-17   Nicotiana tabacum [American tobacco]
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein               84.3    4e-17   
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like      84.3    4e-17   
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg           84.7    4e-17   
gb|AAM96891.1|  auxin-responsive protein IAA1                         83.6    5e-17   Mirabilis jalapa
gb|ACU21378.1|  unknown                                               84.3    5e-17   Glycine max [soybeans]
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16        84.3    5e-17   
gb|KHN02537.1|  Auxin-induced protein AUX28                           84.3    5e-17   
gb|ACL81167.1|  auxin-responsive protein IAA1                         84.3    5e-17   Mirabilis jalapa
ref|NP_001236693.1|  auxin-induced protein AUX28                      84.3    5e-17   
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g           84.3    5e-17   
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14        84.0    5e-17   
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16        84.0    5e-17   
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like    84.0    5e-17   
gb|AGV54230.1|  auxin-induced protein AUX28                           84.0    5e-17   
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                  84.0    5e-17   
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg              84.0    5e-17   
ref|NP_188945.1|  auxin-responsive protein IAA7                       84.0    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7         84.0    6e-17   
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16             84.0    6e-17   
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like   84.0    6e-17   
gb|ACJ83896.1|  unknown                                               84.0    6e-17   Medicago truncatula
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg           84.0    6e-17   
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like    84.0    6e-17   
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)         84.0    6e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                  84.0    6e-17   
gb|AEE25653.1|  auxin-responsive protein                              84.0    6e-17   
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like   83.6    6e-17   
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg           83.6    7e-17   
gb|ABD98055.1|  auxin-regulated protein                               84.0    7e-17   Striga asiatica [witchweed]
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100             83.6    7e-17   
gb|ADL70671.1|  indole-3-acetic acid inducible 16                     82.8    7e-17   
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14        83.6    7e-17   
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like   83.6    7e-17   
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like   83.6    7e-17   
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like   83.6    7e-17   Vitis vinifera
gb|ADL70673.1|  indole-3-acetic acid inducible 16                     82.4    7e-17   
gb|KDP23667.1|  hypothetical protein JCGZ_23500                       83.6    7e-17   
gb|KHN31465.1|  Auxin-responsive protein IAA16                        83.6    7e-17   
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like   83.6    7e-17   
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                  83.6    7e-17   
emb|CAN63268.1|  hypothetical protein VITISV_013635                   83.6    8e-17   Vitis vinifera
emb|CBI36106.3|  unnamed protein product                              84.0    8e-17   
ref|NP_187124.1|  auxin-responsive protein IAA16                      83.6    8e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative         83.6    8e-17   Ricinus communis
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like   84.3    8e-17   Vitis vinifera
gb|ABI36490.1|  AUX/IAA7 C                                            82.0    8e-17   
gb|ABR17764.1|  unknown                                               84.0    8e-17   Picea sitchensis
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16        83.6    8e-17   
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like   83.6    8e-17   
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like   83.6    9e-17   
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...  83.6    9e-17   
gb|AFK35603.1|  unknown                                               81.3    9e-17   
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like   83.2    9e-17   
ref|XP_002884465.1|  indoleacetic acid-induced protein 16             83.2    9e-17   
gb|EPS64756.1|  hypothetical protein M569_10024                       83.2    9e-17   
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14        83.2    1e-16   Vitis vinifera
emb|CBI26357.3|  unnamed protein product                              83.2    1e-16   
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like      83.6    1e-16   
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like   83.2    1e-16   
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg           83.2    1e-16   
gb|ABI36487.1|  AUX/IAA7 A                                            82.0    1e-16   
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like      83.2    1e-16   
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg           83.2    1e-16   
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...  83.2    1e-16   
ref|XP_006432922.1|  hypothetical protein CICLE_v10002290mg           82.8    1e-16   
sp|Q75GK0.1|IAA11_ORYSJ  RecName: Full=Auxin-responsive protein I...  83.2    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...  83.2    1e-16   
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like    82.8    1e-16   
gb|KDO48904.1|  hypothetical protein CISIN_1g026005mg                 82.8    1e-16   
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like      83.2    1e-16   
ref|XP_010102292.1|  Auxin-responsive protein IAA16                   83.2    1e-16   
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17        82.8    1e-16   
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like   82.8    1e-16   
emb|CDY47148.1|  BnaA08g05350D                                        82.8    1e-16   
gb|EAZ27868.1|  hypothetical protein OsJ_11821                        82.8    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg           83.2    1e-16   
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like    82.8    1e-16   
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...  83.2    1e-16   
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like   83.2    1e-16   
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...  82.8    1e-16   
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...  82.8    1e-16   
gb|ABR16139.1|  unknown                                               85.1    1e-16   Picea sitchensis
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                 82.8    1e-16   
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like   82.8    2e-16   
gb|KHN16618.1|  Auxin-responsive protein IAA27                        83.2    2e-16   
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member          82.4    2e-16   Ipomoea nil [qian niu]
gb|ACJ84642.1|  unknown                                               82.8    2e-16   Medicago truncatula
ref|XP_008789309.1|  PREDICTED: auxin-responsive protein IAA27-like   83.2    2e-16   
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                  82.4    2e-16   
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg           82.4    2e-16   
dbj|BAJ34138.1|  unnamed protein product                              82.4    2e-16   
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16        82.8    2e-16   
gb|ADB93631.2|  indole-3-acetic acid inducible 16                     81.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY10694.1|  BnaA05g16680D                                        81.6    2e-16   
ref|XP_003630761.1|  Auxin-responsive protein (Aux/IAA)               82.8    2e-16   
ref|NP_001241599.1|  uncharacterized protein LOC100803065             82.4    2e-16   
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like   82.4    2e-16   
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                  82.4    2e-16   
emb|CDY30017.1|  BnaC01g39910D                                        82.4    2e-16   
gb|AFK49596.1|  unknown                                               82.8    2e-16   
ref|NP_001288823.1|  auxin-responsive protein IAA7                    82.4    2e-16   
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  82.0    2e-16   
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760        82.4    2e-16   
gb|ADL70678.1|  indole-3-acetic acid inducible 16                     81.3    2e-16   
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g           82.4    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like   82.4    2e-16   
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27        83.2    2e-16   
ref|XP_010917562.1|  PREDICTED: auxin-responsive protein IAA27-like   82.8    2e-16   
gb|KHN18836.1|  Auxin-induced protein AUX28                           82.0    3e-16   
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024           82.0    3e-16   
ref|XP_006584572.1|  PREDICTED: uncharacterized protein LOC100795...  83.2    3e-16   
gb|ABM53871.1|  IAA3                                                  80.9    3e-16   Cestrum elegans
gb|ABM53872.1|  IAA4                                                  80.5    3e-16   Cestrum elegans
gb|ADL70672.1|  indole-3-acetic acid inducible 16                     80.9    3e-16   
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like   82.8    3e-16   
emb|CAC84710.1|  aux/IAA protein                                      82.0    3e-16   Populus tremula x Populus tremuloides
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg              82.0    3e-16   
gb|KHG04941.1|  Auxin-induced AUX28                                   82.0    3e-16   
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg              81.6    3e-16   
ref|XP_009380572.1|  PREDICTED: auxin-responsive protein IAA21-li...  82.0    3e-16   
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16        82.0    3e-16   
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like   82.0    3e-16   
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g           82.0    3e-16   
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g           82.0    4e-16   
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like   81.6    4e-16   
gb|AAM21317.1|AF373100_1  auxin-regulated protein                     81.6    4e-16   Populus tremula x Populus tremuloides
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g           81.6    4e-16   
emb|CDY50750.1|  BnaAnng10570D                                        82.0    4e-16   
gb|ABB55368.1|  Aux/IAA protein-like                                  82.4    4e-16   Solanum tuberosum [potatoes]
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like   81.6    4e-16   
ref|NP_001275473.1|  Aux/IAA protein                                  82.4    4e-16   
emb|CAD10639.1|  IAA9 protein                                         82.4    4e-16   Nicotiana tabacum [American tobacco]
ref|NP_001288939.1|  auxin-responsive protein IAA16                   81.3    4e-16   
emb|CAI77628.1|  Aux/IAA protein                                      82.0    4e-16   Solanum lycopersicum
dbj|BAI94494.1|  Aux/IAA protein                                      81.6    4e-16   
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like   81.6    4e-16   
ref|XP_004503453.1|  PREDICTED: auxin-responsive protein IAA27-like   81.6    5e-16   
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like    82.4    5e-16   
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...  82.4    5e-16   
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like    82.0    5e-16   
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like   81.3    5e-16   
gb|KEH27147.1|  auxin response factor                                 81.3    5e-16   
gb|ABH01143.1|  auxin-regulated protein                               81.6    5e-16   Populus tomentosa [Chinese white poplar]
gb|KDP37265.1|  hypothetical protein JCGZ_06321                       82.0    5e-16   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)               82.0    5e-16   
ref|XP_010924571.1|  PREDICTED: auxin-responsive protein IAA27-like   81.6    5e-16   
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14        81.3    5e-16   
ref|NP_001266055.1|  IAA10 protein                                    80.9    5e-16   
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like      81.3    6e-16   
gb|ACU19136.1|  unknown                                               81.3    6e-16   Glycine max [soybeans]
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like   81.6    6e-16   
ref|XP_002516003.1|  Auxin-responsive protein IAA27, putative         82.4    6e-16   Ricinus communis
ref|XP_004150556.1|  PREDICTED: auxin-responsive protein IAA27-like   81.3    6e-16   
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g           81.3    6e-16   
gb|KHG27397.1|  Auxin-responsive IAA27 -like protein                  80.9    6e-16   
ref|XP_007024229.1|  Phytochrome-associated protein 2 isoform 2       81.6    7e-16   
gb|ADW66131.1|  auxin-responsive protein IAA                          77.0    7e-16   
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...  80.9    7e-16   
gb|KDO56957.1|  hypothetical protein CISIN_1g019236mg                 81.6    7e-16   
ref|XP_008462746.1|  PREDICTED: auxin-responsive protein IAA27        81.3    7e-16   
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                  81.6    7e-16   
gb|AEI70506.1|  auxin-responsive protein                              81.6    7e-16   
ref|XP_006465643.1|  PREDICTED: auxin-responsive protein IAA8-lik...  81.6    8e-16   
ref|XP_011009359.1|  PREDICTED: auxin-responsive protein IAA27-like   81.6    8e-16   
ref|XP_002464208.1|  hypothetical protein SORBIDRAFT_01g014130        80.9    8e-16   Sorghum bicolor [broomcorn]
emb|CDY41894.1|  BnaC05g47100D                                        80.5    8e-16   
ref|XP_003534212.1|  PREDICTED: auxin-responsive protein IAA27        81.3    9e-16   
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative            80.5    9e-16   Ricinus communis
ref|XP_008353316.1|  PREDICTED: auxin-responsive protein IAA14-like   77.8    9e-16   
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like   81.3    9e-16   
gb|AAC49055.1|  IAA14                                                 79.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ACU18407.1|  unknown                                               80.5    1e-15   Glycine max [soybeans]
emb|CAC84706.1|  aux/IAA protein                                      81.6    1e-15   
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like    81.6    1e-15   
ref|XP_002302351.1|  auxin-responsive family protein                  81.6    1e-15   
gb|AFZ78618.1|  hypothetical protein                                  81.6    1e-15   
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1       80.9    1e-15   
emb|CBI28036.3|  unnamed protein product                              79.3    1e-15   
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like   80.1    1e-15   
ref|XP_007013107.1|  Phytochrome-associated protein 2 isoform 2       80.9    1e-15   
gb|KHN41649.1|  Auxin-responsive protein IAA27                        80.5    1e-15   
ref|NP_001239808.1|  uncharacterized protein LOC100778529             80.5    1e-15   
ref|XP_006833393.1|  hypothetical protein AMTR_s00109p00120700        81.3    1e-15   
ref|XP_007160318.1|  hypothetical protein PHAVU_002G311500g           80.5    1e-15   
ref|NP_193191.2|  auxin-responsive protein IAA14                      80.1    1e-15   
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like      80.1    1e-15   
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like   80.5    1e-15   
ref|XP_002303297.1|  auxin-responsive protein IAA27                   80.9    1e-15   
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like   80.5    1e-15   
ref|XP_006381732.1|  hypothetical protein POPTR_0006s16640g           80.5    1e-15   
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27        80.5    1e-15   
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like    80.9    1e-15   
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540        81.6    2e-15   
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...  80.5    2e-15   
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                 79.7    2e-15   
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...  80.5    2e-15   
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg           79.7    2e-15   
ref|XP_006650321.1|  PREDICTED: auxin-responsive protein IAA11-like   79.7    2e-15   
ref|XP_006426926.1|  hypothetical protein CICLE_v10025988mg           80.5    2e-15   
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg           79.7    2e-15   
gb|KHN04889.1|  Auxin-responsive protein IAA8                         79.7    2e-15   
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg           79.7    2e-15   
gb|ACU18415.1|  unknown                                               76.3    2e-15   
ref|XP_011072390.1|  PREDICTED: auxin-responsive protein IAA27        80.1    2e-15   
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                  79.7    2e-15   
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16-like   79.3    2e-15   
ref|XP_002298231.1|  hypothetical protein POPTR_0001s18680g           80.1    3e-15   
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like   79.0    3e-15   
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like   79.3    3e-15   
gb|ACL54532.1|  unknown                                               79.3    3e-15   
ref|NP_001150629.1|  LOC100284262                                     79.3    3e-15   
ref|NP_001280875.1|  auxin-responsive protein IAA14-like              79.3    3e-15   
gb|ABI36493.1|  AUX/IAA16 A                                           78.2    3e-15   
ref|NP_001149952.1|  IAA13 - auxin-responsive Aux/IAA family member   79.0    3e-15   
gb|AAB70005.1|  GH1 protein                                           80.1    3e-15   
dbj|BAD94907.1|  putative auxin-induced protein, IAA17/AXR3-1         75.9    3e-15   
gb|AAN16888.1|  Aux/IAA3                                              75.5    3e-15   
dbj|BAB21575.1|  unnamed protein product                              75.5    3e-15   
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like    79.3    3e-15   
emb|CDY10349.1|  BnaC05g29300D                                        79.3    3e-15   
gb|ADN34477.1|  auxin influx carrier                                  76.6    3e-15   
gb|ADL36587.1|  ARF domain class transcription factor                 78.2    3e-15   
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...  80.1    3e-15   
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like   79.0    3e-15   
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9         79.7    3e-15   
ref|XP_004981820.1|  PREDICTED: auxin-responsive protein IAA13-li...  79.0    4e-15   
gb|AEQ94167.1|  auxin induced family protein                          77.0    4e-15   
gb|AFK45766.1|  unknown                                               79.0    4e-15   
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like   79.3    4e-15   
ref|NP_001051230.1|  Os03g0742900                                     79.0    4e-15   
ref|XP_002463898.1|  hypothetical protein SORBIDRAFT_01g008480        78.6    4e-15   
emb|CAC80823.1|  putative IAA1 protein                                78.6    4e-15   
gb|AEV89263.1|  IAA9                                                  79.3    4e-15   
ref|XP_006650567.1|  PREDICTED: auxin-responsive protein IAA13-like   78.6    4e-15   
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451           78.6    4e-15   
gb|AEE25650.1|  auxin-responsive protein                              78.6    4e-15   
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9         79.7    5e-15   
ref|XP_007135656.1|  hypothetical protein PHAVU_010G147200g           79.0    5e-15   
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)               79.3    5e-15   
emb|CDY10068.1|  BnaC08g43830D                                        78.6    5e-15   
emb|CDY32537.1|  BnaA09g50590D                                        78.6    5e-15   
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like    79.3    5e-15   
ref|NP_001267710.1|  auxin-responsive protein IAA9-like               79.3    5e-15   
gb|ABY48132.1|  GH1 protein                                           79.3    5e-15   
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg           78.2    5e-15   
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg           78.2    6e-15   
gb|ABI36497.1|  AUX/IAA27 B                                           76.3    6e-15   
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like   78.2    6e-15   
ref|XP_009381047.1|  PREDICTED: auxin-responsive protein IAA17-like   78.6    6e-15   
ref|XP_010062501.1|  PREDICTED: auxin-responsive protein IAA27        79.3    6e-15   
emb|CDP03299.1|  unnamed protein product                              79.0    6e-15   
emb|CDY15493.1|  BnaA08g27770D                                        78.2    6e-15   
gb|KCW69643.1|  hypothetical protein EUGRSUZ_F03050                   79.0    6e-15   
ref|XP_008793077.1|  PREDICTED: auxin-responsive protein IAA27-li...  79.0    6e-15   
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17        78.2    6e-15   
ref|XP_006475665.1|  PREDICTED: auxin-responsive protein IAA27-li...  78.6    7e-15   
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g           79.0    7e-15   
emb|CDO98008.1|  unnamed protein product                              79.0    7e-15   
ref|XP_006451212.1|  hypothetical protein CICLE_v10009070mg           78.6    7e-15   
ref|XP_009416499.1|  PREDICTED: auxin-responsive protein IAA21-like   78.2    7e-15   
emb|CDY18214.1|  BnaC05g02370D                                        77.8    7e-15   
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg           77.8    7e-15   
emb|CDY63910.1|  BnaC01g43640D                                        78.2    7e-15   
gb|AAC39440.1|  IAA17/AXR3-1 protein                                  77.8    7e-15   
ref|NP_171921.1|  auxin-responsive protein IAA17                      77.8    7e-15   
ref|XP_010526458.1|  PREDICTED: auxin-responsive protein IAA27        78.2    7e-15   
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1          77.8    7e-15   
ref|XP_009614298.1|  PREDICTED: auxin-responsive protein IAA27-like   78.2    7e-15   
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like   78.2    8e-15   
ref|NP_001266034.1|  IAA6 protein                                     78.2    8e-15   
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like   77.8    8e-15   
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401           77.8    8e-15   
gb|ACJ84551.1|  unknown                                               79.0    8e-15   
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17        77.8    8e-15   
gb|AAP44408.1|  auxin-induced protein 5                               78.2    8e-15   
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like   77.8    8e-15   
ref|NP_001240013.1|  uncharacterized protein LOC100804423             78.6    8e-15   
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...  79.3    9e-15   
gb|AGV54485.1|  auxin-responsive protein                              79.0    9e-15   
ref|XP_003543635.1|  PREDICTED: auxin-responsive protein IAA27-like   78.2    9e-15   
gb|KHN32629.1|  Auxin-responsive protein IAA27                        78.2    9e-15   
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like   77.8    1e-14   
ref|NP_001170298.1|  IAA13-auxin-responsive Aux/IAA family member     77.4    1e-14   
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein           78.6    1e-14   
gb|ABW24025.1|  aux/IAA protein                                       76.6    1e-14   
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...  79.3    1e-14   
ref|XP_004141756.1|  PREDICTED: auxin-responsive protein IAA8-like    78.6    1e-14   
ref|NP_001237212.1|  uncharacterized protein LOC100499872             77.4    1e-14   
ref|XP_008462174.1|  PREDICTED: auxin-responsive protein IAA27-like   78.6    1e-14   
ref|XP_010521483.1|  PREDICTED: auxin-responsive protein IAA27-li...  77.4    1e-14   
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...  79.3    1e-14   
gb|EMT06709.1|  Auxin-responsive protein IAA13                        77.0    1e-14   
emb|CDX89832.1|  BnaA10g02500D                                        77.4    1e-14   
ref|XP_002514266.1|  Auxin-responsive protein IAA27, putative         77.8    1e-14   
ref|XP_010521482.1|  PREDICTED: auxin-responsive protein IAA8-lik...  78.6    1e-14   
gb|ABI36491.1|  AUX/IAA8A                                             76.3    1e-14   
ref|XP_003530133.1|  PREDICTED: auxin-responsive protein IAA27-like   77.8    1e-14   
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like   77.8    1e-14   
ref|XP_011010527.1|  PREDICTED: auxin-responsive protein IAA27-li...  78.2    1e-14   
ref|XP_010521481.1|  PREDICTED: auxin-responsive protein IAA8-lik...  78.2    1e-14   
gb|KHN09036.1|  Auxin-responsive protein IAA8                         78.6    1e-14   
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like    78.6    1e-14   
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like   77.4    1e-14   
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like   77.8    1e-14   
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg           78.6    1e-14   
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9         78.6    2e-14   
emb|CDY62130.1|  BnaC08g47390D                                        77.0    2e-14   
ref|XP_009409066.1|  PREDICTED: auxin-responsive protein IAA17-like   77.8    2e-14   
ref|NP_001280937.1|  auxin-responsive protein IAA27                   77.8    2e-14   
ref|XP_009336858.1|  PREDICTED: auxin-responsive protein IAA27-like   77.8    2e-14   
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like   77.4    2e-14   
emb|CAE00638.1|  IAA1 protein                                         77.0    2e-14   
gb|KDP21369.1|  hypothetical protein JCGZ_21840                       77.0    2e-14   
gb|AAP44406.1|  auxin-induced protein 3                               77.0    2e-14   
dbj|BAK05607.1|  predicted protein                                    76.6    2e-14   
ref|XP_009624916.1|  PREDICTED: auxin-responsive protein IAA27-like   77.0    2e-14   
gb|ACV31210.1|  auxin/indole-3-acetic acid 4                          76.3    2e-14   
gb|ABM53870.1|  IAA2                                                  75.5    2e-14   
gb|ABR25452.1|  osiaa17-auxin-responsive aux/iaa gene family member   73.6    2e-14   
gb|KDP41528.1|  hypothetical protein JCGZ_15935                       77.8    2e-14   
gb|ABR25735.1|  auxin-responsive aux/iaa gene family member           73.6    2e-14   
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...  76.6    2e-14   
gb|ABI36495.1|  AUX/IAA27 A                                           74.7    2e-14   
gb|AFA36482.1|  auxin-responsive protein                              74.3    2e-14   
ref|XP_009354869.1|  PREDICTED: auxin-induced protein 22D-like        75.9    2e-14   
emb|CDP02673.1|  unnamed protein product                              77.8    3e-14   
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g           77.4    3e-14   
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9         77.8    3e-14   
ref|NP_001050713.2|  Os03g0633500                                     76.3    3e-14   
gb|ADL36578.1|  ARF domain class transcription factor                 77.8    3e-14   
gb|EEC75792.1|  hypothetical protein OsI_12721                        75.5    3e-14   
ref|NP_001241389.1|  uncharacterized protein LOC100783314             77.4    3e-14   
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                   77.4    3e-14   
ref|XP_007050424.1|  AUX/IAA transcriptional regulator family pro...  78.2    3e-14   
ref|XP_010666360.1|  PREDICTED: auxin-responsive protein IAA8-like    77.4    3e-14   
gb|AEI70507.1|  auxin-responsive protein                              77.4    3e-14   
ref|NP_001280944.1|  auxin-induced protein 22D-like                   75.5    3e-14   
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg              76.6    3e-14   
gb|ADC29384.1|  indole-3-acetic acid inducible 7                      73.6    3e-14   
gb|ADL70559.1|  indole-3-acetic acid inducible 7                      73.6    3e-14   
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...  77.8    3e-14   
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg           77.8    3e-14   
gb|AFK41855.1|  unknown                                               74.3    3e-14   
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like    77.8    3e-14   
gb|ADC29388.2|  indole-3-acetic acid inducible 7                      73.6    3e-14   
gb|ABI36496.1|  AUX/IAA26                                             74.3    4e-14   
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...  75.9    4e-14   
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...  76.6    4e-14   
gb|ADC29387.2|  indole-3-acetic acid inducible 7                      73.6    4e-14   
gb|ADC29385.2|  indole-3-acetic acid inducible 7                      73.6    4e-14   
ref|XP_008372302.1|  PREDICTED: auxin-induced protein 22D-like        75.5    4e-14   
ref|XP_008228477.1|  PREDICTED: auxin-responsive protein IAA27-like   77.0    4e-14   
ref|XP_006353472.1|  PREDICTED: auxin-responsive protein IAA27        76.3    4e-14   
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like    77.0    4e-14   
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-like    77.0    4e-14   
gb|ADL70676.1|  indole-3-acetic acid inducible 16                     74.7    4e-14   
emb|CDY63072.1|  BnaCnng41350D                                        77.4    4e-14   
gb|ADL70549.1|  indole-3-acetic acid inducible 7                      73.2    4e-14   
gb|AFK46390.1|  unknown                                               73.6    4e-14   
ref|NP_001130483.1|  IAA17-auxin-responsive Aux/IAA family member     75.9    4e-14   
ref|XP_007150643.1|  hypothetical protein PHAVU_005G169600g           76.6    5e-14   
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...  77.0    5e-14   
ref|XP_009771095.1|  PREDICTED: auxin-responsive protein IAA8-like    75.9    5e-14   
gb|ADE62383.1|  IAA1 protein                                          74.7    5e-14   
gb|ABD98054.1|  auxin-regulated protein                               76.3    5e-14   
ref|XP_006466369.1|  PREDICTED: auxin-responsive protein IAA9-like    77.0    5e-14   
ref|XP_006426197.1|  hypothetical protein CICLE_v10025873mg           77.0    6e-14   
ref|XP_009389389.1|  PREDICTED: auxin-responsive protein IAA17-like   75.9    6e-14   
emb|CAN72026.1|  hypothetical protein VITISV_014421                   75.9    6e-14   
emb|CBI19314.3|  unnamed protein product                              76.3    6e-14   
ref|XP_004287443.1|  PREDICTED: auxin-responsive protein IAA27-like   75.9    6e-14   
ref|XP_008348504.1|  PREDICTED: auxin-responsive protein IAA21-li...  76.3    6e-14   
ref|XP_008348505.1|  PREDICTED: auxin-responsive protein IAA21-li...  76.3    6e-14   
ref|NP_001266052.1|  IAA8                                             75.9    6e-14   
gb|AAN16889.1|  Aux/IAA4                                              72.0    7e-14   
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...  76.6    7e-14   
ref|XP_004960656.1|  PREDICTED: auxin-responsive protein IAA17-like   75.1    7e-14   
gb|AFK49626.1|  unknown                                               76.3    7e-14   
ref|XP_006654167.1|  PREDICTED: auxin-responsive protein IAA17-like   75.1    7e-14   
ref|XP_003568720.1|  PREDICTED: auxin-responsive protein IAA17-like   75.1    7e-14   
gb|AAP44405.1|  auxin-induced protein 2                               75.5    7e-14   
sp|Q75GB1.1|IAA17_ORYSJ  RecName: Full=Auxin-responsive protein I...  75.1    8e-14   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA  75.5    8e-14   
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like    76.3    8e-14   
ref|XP_007203891.1|  hypothetical protein PRUPE_ppa009134mg           75.5    8e-14   
ref|NP_001268170.1|  Aux/IAA protein                                  76.3    8e-14   
ref|XP_009774736.1|  PREDICTED: auxin-responsive protein IAA27-like   75.5    9e-14   
ref|XP_008342663.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  75.9    9e-14   
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1            76.3    9e-14   
ref|NP_001280795.1|  auxin-responsive protein IAA8-like               76.3    9e-14   
gb|AAM12952.1|  auxin-regulated protein                               76.3    9e-14   
ref|XP_009377833.1|  PREDICTED: auxin-responsive protein IAA21-like   75.9    9e-14   
gb|AAL92850.1|  Aux/IAA protein                                       76.3    1e-13   



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CKSRS
Sbjct  195  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSRS  244



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CKSRS
Sbjct  196  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSRS  245



>gb|ABR25977.1| osiaa30-auxin-responsive aux/iaa gene family member [Oryza sativa 
Indica Group]
Length=87

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  38   TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  87



>gb|ABR25699.1| osiaa30-auxin-responsive aux/iaa gene family member, expressed 
[Oryza sativa Indica Group]
Length=85

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  36   TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  85



>gb|ADN34157.1| auxin-responsive protein [Cucumis melo subsp. melo]
Length=67

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSRS
Sbjct  18   TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  67



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  191  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  240



>ref|XP_002443496.1| hypothetical protein SORBIDRAFT_08g020580 [Sorghum bicolor]
 gb|EES17334.1| hypothetical protein SORBIDRAFT_08g020580 [Sorghum bicolor]
Length=281

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  232  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  281



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CKSRS
Sbjct  282  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSRS  331



>ref|XP_010674855.1| PREDICTED: auxin-induced protein AUX28 [Beta vulgaris subsp. 
vulgaris]
Length=297

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRA++ CKSRS
Sbjct  248  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKSRS  297



>gb|ACF88333.1| unknown [Zea mays]
 tpg|DAA55066.1| TPA: IAA30-auxin-responsive Aux/IAA family member [Zea mays]
Length=271

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  222  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  271



>gb|EEE53551.1| hypothetical protein OsJ_36765 [Oryza sativa Japonica Group]
Length=183

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  134  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  183



>ref|XP_004963100.1| PREDICTED: auxin-responsive protein IAA30-like [Setaria italica]
Length=264

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  215  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  264



>gb|ACF87179.1| unknown [Zea mays]
 gb|ADX60115.1| AUX/IAA transcription factor [Zea mays]
Length=276

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  227  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  276



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSRS
Sbjct  194  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  243



>ref|XP_003579189.1| PREDICTED: auxin-responsive protein IAA30-like [Brachypodium 
distachyon]
Length=249

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  200  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  249



>ref|NP_001150626.1| IAA30 - auxin-responsive Aux/IAA family member [Zea mays]
 gb|ACG39802.1| IAA30 - auxin-responsive Aux/IAA family member [Zea mays]
Length=275

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  226  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  275



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G+E    APRAM+ CKSRS
Sbjct  195  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAKGLAPRAMEKCKSRS  244



>ref|XP_006664171.1| PREDICTED: auxin-responsive protein IAA30-like [Oryza brachyantha]
Length=248

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  199  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  248



>dbj|BAJ84870.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92398.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  203  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  252



>ref|XP_004150437.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
Length=264

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSRS
Sbjct  215  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  264



>ref|XP_004134097.1| PREDICTED: auxin-responsive protein IAA14-like isoform 2 [Cucumis 
sativus]
Length=220

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSRS
Sbjct  171  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  220



>dbj|BAK01326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  203  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  252



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSRS
Sbjct  199  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  248



>ref|XP_004172452.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSRS
Sbjct  207  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  256



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSRS
Sbjct  207  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  256



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162257.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSRS
Sbjct  188  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  237



>ref|XP_010038039.1| PREDICTED: auxin-induced protein AUX28-like [Eucalyptus grandis]
 gb|KCW49838.1| hypothetical protein EUGRSUZ_K03313 [Eucalyptus grandis]
Length=280

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G+E    APRAM+ CKSRS
Sbjct  231  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAVGLAPRAMEKCKSRS  280



>dbj|BAJ97201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=241

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV SC RLRIM+GSE    APRAM+ CKSRS
Sbjct  192  TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKSRS  241



>ref|XP_002517023.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
 gb|EEF45186.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
Length=181

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSR+
Sbjct  132  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  181



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSRS
Sbjct  188  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  237



>ref|NP_001067209.1| Os12g0601300 [Oryza sativa Japonica Group]
 sp|P0C132.1|IAA30_ORYSJ RecName: Full=Auxin-responsive protein IAA30; AltName: Full=Indoleacetic 
acid-induced protein 30 [Oryza sativa Japonica Group]
 gb|ABA99793.1| Auxin-induced protein AUX28, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF30228.1| Os12g0601300 [Oryza sativa Japonica Group]
 gb|EAY83785.1| hypothetical protein OsI_39001 [Oryza sativa Indica Group]
 dbj|BAG90803.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  228  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  277



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV SC RLRIM+GSE    APRAM+ CKSRS
Sbjct  190  TYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKSRS  239



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CKSR
Sbjct  199  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSR+
Sbjct  192  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  241



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFVESC RLRIM+G+E    APRAM+ CKSRS
Sbjct  186  TYEDKDGDWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKSRS  235



>gb|ABA29614.1| SP-5 [Glycine max]
Length=113

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 42/52 (81%), Gaps = 6/52 (12%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE------APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E      APRAM  CK+RS
Sbjct  62   TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS  113



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRAM+ CKSRS
Sbjct  194  TYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  243



>ref|XP_006605305.1| PREDICTED: uncharacterized protein LOC100499872 isoform X1 [Glycine 
max]
 gb|KHN04928.1| Auxin-induced protein AUX28 [Glycine soja]
Length=227

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRA++ CK+RS
Sbjct  178  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  227



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFVESC RLR+M+G+E    APRAM+ CKSRS
Sbjct  166  TYEDKDGDWMLVGDVPWQMFVESCKRLRVMKGTEAKGLAPRAMEKCKSRS  215



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSR+
Sbjct  205  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRA  254



>ref|XP_007201399.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
 gb|EMJ02598.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
Length=247

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+RS
Sbjct  198  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS  247



>gb|AFK36086.1| unknown [Lotus japonicus]
Length=257

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+RS
Sbjct  208  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS  257



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSR
Sbjct  190  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  238



>ref|XP_010679165.1| PREDICTED: auxin-responsive protein IAA14-like [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+RS
Sbjct  229  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNRS  278



>gb|AAV50046.1| auxin-induced protein [Saccharum hybrid cultivar Pindar]
Length=188

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDK+GDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  139  TYEDKEGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  188



>ref|NP_001267662.1| auxin-induced protein AUX28-like [Cucumis sativus]
 dbj|BAA81687.1| unnamed protein product [Cucumis sativus]
 gb|KGN44763.1| hypothetical protein Csa_7G378520 [Cucumis sativus]
Length=230

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+RS
Sbjct  181  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS  230



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CK+RS
Sbjct  202  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  251



>ref|XP_004289900.1| PREDICTED: auxin-induced protein AUX28-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+RS
Sbjct  201  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS  250



>ref|XP_007201400.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
 gb|EMJ02599.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
Length=253

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+RS
Sbjct  204  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS  253



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSR
Sbjct  193  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  241



>emb|CBI35213.3| unnamed protein product [Vitis vinifera]
Length=170

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRA++ CK+RS
Sbjct  121  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  170



>gb|AFK42876.1| unknown [Medicago truncatula]
 gb|KEH23853.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=250

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+RS
Sbjct  201  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  250



>ref|XP_008235328.1| PREDICTED: auxin-induced protein AUX28-like [Prunus mume]
Length=253

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+RS
Sbjct  204  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS  253



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV SC RLRIMRGSE    APRA++ CK+RS
Sbjct  202  TYEDKDGDWMLVGDVPWEMFVNSCKRLRIMRGSEAIGLAPRAVEKCKNRS  251



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CK+RS
Sbjct  199  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  248



>gb|ADL70552.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
 gb|ADL70553.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
Length=95

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  45   SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  95



>gb|ADL70558.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
Length=95

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  45   SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS  95



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CK+RS
Sbjct  190  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  239



>gb|ADL70548.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
 gb|ADL70557.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
Length=95

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  45   SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  95



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV SC RLRIM+GSE    APRAM+ CK+RS
Sbjct  187  TYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS  236



>gb|AAN16886.1| Aux/IAA1 [Mirabilis jalapa]
Length=97

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+R
Sbjct  48   TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  96



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRA++ CK+RS
Sbjct  189  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  238



>ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum]
 gb|AEX00351.1| IAA7 [Solanum lycopersicum]
Length=218

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRAM+ CK+RS
Sbjct  169  TYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  218



>gb|ABK24636.1| unknown [Picea sitchensis]
Length=390

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GS+    APRAM+ CKSRS
Sbjct  341  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSDAIGLAPRAMEKCKSRS  390



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSR+
Sbjct  199  SYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  248



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSR
Sbjct  187  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  235



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSR
Sbjct  202  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  250



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV SC RLRIM+GSE    APRAM+ CK+RS
Sbjct  187  TYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS  236



>gb|ADL70554.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
 gb|ADL70555.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
 gb|ADL70560.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
Length=94

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  44   SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  94



>gb|ADL70550.1| indole-3-acetic acid inducible 7 [Arabidopsis thaliana]
Length=85

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  35   SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS  85



>ref|XP_009420668.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=241

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CK+RS
Sbjct  192  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  241



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRAM+ CKSR+
Sbjct  183  TYEDKDGDWMLVGDVPWEMFVDSCKRMRIMKGSEAIGLAPRAMEKCKSRT  232



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV SC RLRIM+GSE    APRAM+ CK+RS
Sbjct  193  TYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS  242



>ref|XP_009398379.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=253

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLR+M+GSE    APR M+ CK+RS
Sbjct  204  TYEDKDGDWMLVGDVPWEMFVESCKRLRLMKGSEAVGLAPRGMEKCKNRS  253



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPW+MFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  185  SYEDKDGDWMLVGDVPWQMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  234



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSR
Sbjct  189  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  237



>ref|XP_009413916.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    AP+AM+ CK+RS
Sbjct  195  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS  244



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFVESC RLRIM+G+E    APRAM+ CK+RS
Sbjct  186  TYEDKDGDWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNRS  235



>gb|ABM53874.1| IAA6 [Cestrum elegans]
Length=153

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            +YEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSR
Sbjct  104  SYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  152



>ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CK+RS
Sbjct  194  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  243



>gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum]
Length=220

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  171  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  220



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TY+DKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRA++ CK+RS
Sbjct  182  TYQDKDGDWMLVGDVPWEMFVESCQRLRIMKGSEAIGLAPRAVEKCKNRS  231



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV SC RLRIM+G+E    APRAM+ CKSRS
Sbjct  178  TYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRAMEKCKSRS  227



>gb|KHN22078.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=231

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TY+DKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRA++ CK+RS
Sbjct  182  TYQDKDGDWMLVGDVPWEMFVESCQRLRIMKGSEAIGLAPRAVEKCKNRS  231



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFVESC RLRIM+G+E    APRAM+ CK+RS
Sbjct  186  TYEDKDGDWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNRS  235



>gb|AFK44192.1| unknown [Medicago truncatula]
Length=253

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  204  TYEDKDGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAVEKCKNRS  253



>dbj|BAD94452.1| auxin-induced protein [Arabidopsis thaliana]
Length=71

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  22   TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  71



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  180  TYEDKDGDWMLVGDVPWLMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  229



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFVESC RLRIM+G+E    APRAM+ CK+RS
Sbjct  256  TYEDKDGDWMLVGDVPWDMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  305



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CKSR+
Sbjct  228  SYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  277



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 42/49 (86%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV SC RLRIM+GSE    APRAM+ CKSR
Sbjct  205  TYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSR  253



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFVESC RLRIM+G+E    APRAM+ CK+RS
Sbjct  186  TYEDKDGDWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNRS  235



>emb|CDP06818.1| unnamed protein product [Coffea canephora]
Length=245

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  196  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAVGLAPRAVEKCKNRS  245



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  200  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPWEMFV SC RLRIM+GSE    APRAM+ CKSR+
Sbjct  199  SYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSRT  248



>gb|ADL70680.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=152

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  103  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  152



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRAM+ CKSR+
Sbjct  195  TYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRN  244



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    AP+AM+ CK+RS
Sbjct  182  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS  231



>gb|ADL70670.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=156

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  107  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  156



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 6/52 (12%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE------APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE      APRAM+ CKSR+
Sbjct  199  SYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLVSAPRAMEKCKSRT  250



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  197  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  246



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  202  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  251



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    AP+AM+ CK+RS
Sbjct  189  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS  238



>ref|XP_008451270.1| PREDICTED: auxin-induced protein AUX28-like [Cucumis melo]
Length=230

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC R+RIM+G E    APRAM+ CK+RS
Sbjct  181  TYEDKDGDWMLVGDVPWEMFVESCKRVRIMKGKEAIGLAPRAMEKCKNRS  230



>ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum]
 gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum]
Length=213

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRAM+ CK+RS
Sbjct  164  TYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  213



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPWEMFV SC RLRIM+GSE    APRAM+ CKSR+
Sbjct  199  SYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSRT  248



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  191  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  240



>gb|KEH43017.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=253

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  204  TYEDKDGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAVEKCKNRS  253



>ref|XP_004493739.1| PREDICTED: auxin-induced protein AUX28-like [Cicer arietinum]
Length=246

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWM+VGDVPWEMFVESC RLRIM+G E    APRAM+ CK+RS
Sbjct  196  TYEDKDGDWMVVGDVPWEMFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  245



>ref|XP_006298251.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
 gb|EOA31149.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
Length=285

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  235  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  285



>gb|AAM96891.1| auxin-responsive protein IAA1 [Mirabilis jalapa]
Length=194

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+R
Sbjct  145  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  193



>gb|ACU21378.1| unknown [Glycine max]
Length=252

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 42/52 (81%), Gaps = 6/52 (12%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE------APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E      APRAM  CK+RS
Sbjct  201  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS  252



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  191  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  240



>gb|KHN02537.1| Auxin-induced protein AUX28 [Glycine soja]
Length=252

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 42/52 (81%), Gaps = 6/52 (12%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE------APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E      APRAM  CK+RS
Sbjct  201  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS  252



>gb|ACL81167.1| auxin-responsive protein IAA1, partial [Mirabilis jalapa]
Length=263

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+R
Sbjct  214  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  262



>ref|NP_001236693.1| auxin-induced protein AUX28 [Glycine max]
 sp|P13089.1|AUX28_SOYBN RecName: Full=Auxin-induced protein AUX28 [Glycine max]
 gb|AAA33945.1| auxin-regulated protein (Aux28) [Glycine max]
Length=243

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 42/52 (81%), Gaps = 6/52 (12%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE------APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E      APRAM  CK+RS
Sbjct  192  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS  243



>ref|XP_007144686.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
 gb|ESW16680.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
Length=245

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYED+DGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+RS
Sbjct  196  TYEDRDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS  245



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRAM+ CKSR
Sbjct  192  TYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  240



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  191  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  240



>ref|XP_010466604.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  192  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>gb|AGV54230.1| auxin-induced protein AUX28 [Phaseolus vulgaris]
Length=245

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYED+DGDWMLVGDVPWEMFVESC RLRIM+G E    APRAM+ CK+RS
Sbjct  196  TYEDRDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS  245



>gb|KFK39592.1| hypothetical protein AALP_AA3G264300 [Arabis alpina]
Length=235

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  185  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  235



>gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata]
Length=247

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRAM+ CKSR
Sbjct  198  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRAMEKCKSR  246



>ref|NP_188945.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 sp|Q38825.1|IAA7_ARATH RecName: Full=Auxin-responsive protein IAA7; AltName: Full=Auxin 
resistant 2; AltName: Full=Indoleacetic acid-induced protein 
7 [Arabidopsis thaliana]
 gb|AAG48759.1|AF332395_1 indoleacetic acid-inducible protein IAA7 [Arabidopsis thaliana]
 gb|AAC49048.1| IAA7 [Arabidopsis thaliana]
 dbj|BAB02096.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAK96842.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAL66876.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76710.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=243

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  193  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS  243



>ref|XP_010512022.1| PREDICTED: auxin-responsive protein IAA7 [Camelina sativa]
Length=242

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  192  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  200  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>ref|XP_008788131.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLR+M+GSE    APRAM+ CK+RS
Sbjct  192  TYEDKDGDWMLVGDVPWEMFVDSCKRLRMMKGSEAIGLAPRAMEKCKNRS  241



>gb|ACJ83896.1| unknown [Medicago truncatula]
 gb|AFK48514.1| unknown [Medicago truncatula]
 gb|KEH42620.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=245

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF++SC RLRIM+G E    APRAM+ CK+RS
Sbjct  196  TYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGKEAIGLAPRAMEKCKNRS  245



>ref|XP_006406100.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
 dbj|BAJ33997.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47553.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
Length=239

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  189  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  239



>ref|XP_010488346.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  192  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>gb|AAM65301.1| indoleacetic acid (IAA)-inducible gene (IAA7) [Arabidopsis thaliana]
Length=238

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+RS
Sbjct  188  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  238



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRAM+ CKSR+
Sbjct  200  SYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRA  249



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRAM+ CKSR+
Sbjct  200  SYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRA  249



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPW MFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  176  SYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSESIGLAPRAMEKCKNRS  225



>ref|XP_006284476.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
 gb|EOA17374.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
Length=228

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPW MFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  179  SYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  228



>gb|ABD98055.1| auxin-regulated protein [Striga asiatica]
Length=248

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFVESC RLRIM+G+E    APRAM+ CKSRS
Sbjct  199  TYEDKDGDWMLVGDVPWGMFVESCKRLRIMKGTEAKGLAPRAMEKCKSRS  248



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPW MFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  181  SYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  230



>gb|ADL70671.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=167

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  118  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  167



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPW MFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  179  SYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAVGLAPRAMEKCKNRS  228



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPW MFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  176  SYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  225



>ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  183  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+G E    APRAM+ CK+RS
Sbjct  195  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS  244



>gb|ADL70673.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
 gb|ADL70674.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=165

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  116  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  165



>gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF++SC RLRIM+GSE    APRA++ CK+RS
Sbjct  199  TYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  248



>gb|KHN31465.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=243

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKD DWMLVGDVPWEMFVESC RLRIM+GSE    APRA++ CK+RS
Sbjct  194  TYEDKDADWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  243



>ref|XP_003521753.1| PREDICTED: auxin-responsive protein IAA16-like [Glycine max]
Length=243

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKD DWMLVGDVPWEMFVESC RLRIM+GSE    APRA++ CK+RS
Sbjct  194  TYEDKDADWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  243



>gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina]
Length=232

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  183  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+G E    APRAM+ CK+RS
Sbjct  186  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS  235



>emb|CBI36106.3| unnamed protein product [Vitis vinifera]
Length=292

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF ESC RLRIM+GSE    APRAM+ CK+R+
Sbjct  243  TYEDKDGDWMLVGDVPWEMFTESCKRLRIMKGSEAIGLAPRAMEKCKNRN  292



>ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
 sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic 
acid-induced protein 16 [Arabidopsis thaliana]
 gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana]
 gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana]
 gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana]
 gb|AAB84353.1| IAA16 [Arabidopsis thaliana]
 gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana]
 dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
Length=236

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  187  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  236



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV SC RLRIM+GSE    APRA++ CK+RS
Sbjct  208  TYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKNRS  257



>ref|XP_002284282.1| PREDICTED: auxin-responsive protein IAA27-like [Vitis vinifera]
Length=343

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF ESC RLRIM+GSE    APRAM+ CK+R+
Sbjct  294  TYEDKDGDWMLVGDVPWEMFTESCKRLRIMKGSEAIGLAPRAMEKCKNRN  343



>gb|ABI36490.1| AUX/IAA7 C [Malus domestica]
Length=148

 Score = 82.0 bits (201),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+  E    APRAM+ CK+RS
Sbjct  99   TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  148



>gb|ABR17764.1| unknown [Picea sitchensis]
Length=324

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF++SC RLRIM+GSE    APRAM+ CK+R+
Sbjct  275  TYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPRAMEKCKNRN  324



>ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [Camelina sativa]
Length=232

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  183  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  203  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  252



>ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum]
Length=252

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV SC RLRIM+GSE    APRA++ CK+RS
Sbjct  203  TYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAVEKCKNRS  252



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPWEMFV SC RLR+M+GSE    APRAM+ CKSR+
Sbjct  199  SYEDKDGDWMLVGDVPWEMFVNSCKRLRLMKGSEAIGLAPRAMEKCKSRT  248



>gb|AFK35603.1| unknown [Lotus japonicus]
Length=114

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF +SC RLRIM+ SE    APRAM+ CKSR+
Sbjct  65   TYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAIGLAPRAMEKCKSRT  114



>ref|XP_010463960.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  183  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  187  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  236



>gb|EPS64756.1| hypothetical protein M569_10024, partial [Genlisea aurea]
Length=214

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV SC RLRIM+GSE    APRAM+ CKSR+
Sbjct  165  TYEDKDGDWMLVGDVPWEMFVCSCKRLRIMKGSEAIGLAPRAMEKCKSRN  214



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CK+R
Sbjct  194  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  242



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CK+R
Sbjct  188  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  236



>ref|XP_008382962.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+  E    APRAM+ CK+RS
Sbjct  208  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  257



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  186  TYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  235



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  192  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  241



>gb|ABI36487.1| AUX/IAA7 A [Malus domestica]
 gb|ABI36488.1| AUX/IAA7 B [Malus domestica]
Length=154

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+  E    APRAM+ CK+RS
Sbjct  105  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  154



>ref|XP_008372303.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+  E    APRAM+ CK+RS
Sbjct  208  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  257



>ref|XP_006414696.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
 gb|ESQ56149.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
Length=257

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPW MFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  208  SYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  257



>ref|XP_004982376.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Setaria 
italica]
Length=267

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 4/48 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKS  133
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+
Sbjct  218  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKCKN  265



>ref|XP_006432922.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471685.1| PREDICTED: auxin-responsive protein IAA16-like isoform X2 [Citrus 
sinensis]
 gb|ESR46162.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=221

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  172  TYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  221



>sp|Q75GK0.1|IAA11_ORYSJ RecName: Full=Auxin-responsive protein IAA11; AltName: Full=Indoleacetic 
acid-induced protein 11 [Oryza sativa Japonica Group]
 gb|AAS07281.1| putative auxin-responsive protein [Oryza sativa Japonica Group]
 gb|AAU89153.1| Auxin-responsive protein, putative [Oryza sativa Japonica Group]
 gb|ABF97770.1| Auxin-responsive protein IAA17, putative, expressed [Oryza sativa 
Japonica Group]
Length=233

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 4/48 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKS  133
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRA++ CKS
Sbjct  186  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKS  233



>ref|XP_004982377.1| PREDICTED: auxin-responsive protein IAA30-like isoform X2 [Setaria 
italica]
Length=266

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 4/48 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKS  133
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+
Sbjct  217  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKCKN  264



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM+ CK R
Sbjct  176  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKRR  224



>gb|KDO48904.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=221

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  172  TYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  221



>ref|XP_009367750.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=259

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+  E    APRAM+ CK+RS
Sbjct  210  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  259



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+R+
Sbjct  208  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRT  257



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFVESC RLRIM+GSE    APRAM+ CK+R+
Sbjct  189  TYEDKDGDWMLVGDVPWLMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRA  238



>ref|XP_010522504.1| PREDICTED: auxin-responsive protein IAA17-like [Tarenaya hassleriana]
Length=235

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFVESC RLRIM+GSE    APRAM+ CK+R+
Sbjct  186  TYEDKDGDWMLVGDVPWLMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRA  235



>emb|CDY47148.1| BnaA08g05350D [Brassica napus]
Length=233

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPW MF+ESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  184  SYEDKDGDWMLVGDVPWPMFIESCKRLRIMKGSEAIGLAPRAMQKCKNRS  233



>gb|EAZ27868.1| hypothetical protein OsJ_11821 [Oryza sativa Japonica Group]
Length=240

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 4/48 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKS  133
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRA++ CKS
Sbjct  193  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKS  240



>ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus 
sinensis]
 gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=245

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  196  TYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  245



>ref|XP_009135842.1| PREDICTED: auxin-responsive protein IAA7-like [Brassica rapa]
 emb|CDX92973.1| BnaA03g36950D [Brassica napus]
Length=237

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM K CK+RS
Sbjct  187  SYEDKDGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAMEKYCKNRS  237



>ref|XP_010923478.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Elaeis 
guineensis]
Length=250

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGD MLVGDVPWEMFVESC RLRIM+GSE    APRAM+ CK+RS
Sbjct  201  TYEDKDGDLMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  250



>ref|XP_010025014.1| PREDICTED: auxin-responsive protein IAA16-like [Eucalyptus grandis]
 gb|KCW61599.1| hypothetical protein EUGRSUZ_H04335 [Eucalyptus grandis]
Length=270

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  221  TYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  270



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF++SC RLRIM+GSE    AP+AM+ CK++S
Sbjct  189  TYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPKAMEKCKNKS  238



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 6/52 (12%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE------APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPWEMFV SC RLR+M+GSE      APRAM+ CKSR+
Sbjct  199  SYEDKDGDWMLVGDVPWEMFVNSCKRLRLMKGSEAIGLVSAPRAMEKCKSRT  250



>gb|ABR16139.1| unknown [Picea sitchensis]
Length=461

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF++SC RLRIM+GSE    APRAM+ CK+R+
Sbjct  412  TYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPRAMEKCKNRN  461



>gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=245

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  196  TYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  245



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK RS
Sbjct  202  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKKRS  251



>gb|KHN16618.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=283

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 41/49 (84%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMF ESC RLRIM+ SE    APRAM+ CKSR
Sbjct  234  TYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIGLAPRAMEKCKSR  282



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  176  TYEDKDGDWMLVGDVPWNMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  225



>gb|ACJ84642.1| unknown [Medicago truncatula]
Length=250

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFVESC RLRIM+G E    APRAM+ CK+RS
Sbjct  201  TYEDKDGDWMLVGDVPWGMFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  250



>ref|XP_008789309.1| PREDICTED: auxin-responsive protein IAA27-like [Phoenix dactylifera]
Length=318

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MF +SC RLRIMRGSE    APRAM+ CKSR+
Sbjct  269  TYEDKDGDWMLVGDVPWNMFTDSCRRLRIMRGSEAVGIAPRAMEKCKSRN  318



>gb|KFK31703.1| hypothetical protein AALP_AA6G148100 [Arabis alpina]
Length=208

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            +YEDKDGDWMLVGDVPWEMFVESC R+RIM+GSE    APRAM+ C+SR
Sbjct  159  SYEDKDGDWMLVGDVPWEMFVESCKRIRIMKGSEAIGLAPRAMEKCESR  207



>ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=234

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  185  TYEDKDGDWMLVGDVPWKMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  234



>dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila]
Length=234

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  185  TYEDKDGDWMLVGDVPWKMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  234



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPWEMFV SC RLRIM+GSE    APRA++ CK+RS
Sbjct  202  SYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKNRS  251



>gb|ADB93631.2| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=152

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+R
Sbjct  104  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  152



>emb|CDY10694.1| BnaA05g16680D [Brassica napus]
Length=174

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM K CK+RS
Sbjct  124  SYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKYCKNRS  174



>ref|XP_003630761.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula]
 gb|AET05237.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=293

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF ESC RLRIM+ SE    APRAM+ CKSR+
Sbjct  244  TYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIGLAPRAMEKCKSRN  293



>ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycine max]
 gb|ACU20028.1| unknown [Glycine max]
 gb|KHN03840.1| Auxin-induced protein AUX28 [Glycine soja]
Length=248

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYED+DGDWMLVGDVPWEMFVESC RLRIM+G E    APRA++ CK+RS
Sbjct  199  TYEDRDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS  248



>ref|XP_009124981.1| PREDICTED: auxin-responsive protein IAA16-like [Brassica rapa]
 emb|CDY21111.1| BnaA01g33420D [Brassica napus]
Length=236

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+R
Sbjct  187  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  235



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYED+DGDWMLVGDVPWEMFV++C RLRIM+GSE    APRA++ CK+RS
Sbjct  197  TYEDRDGDWMLVGDVPWEMFVDTCKRLRIMKGSEAIGLAPRAVEKCKNRS  246



>emb|CDY30017.1| BnaC01g39910D [Brassica napus]
Length=237

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+R
Sbjct  188  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  236



>gb|AFK49596.1| unknown [Medicago truncatula]
Length=293

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF ESC RLRIM+ SE    APRAM+ CKSR+
Sbjct  244  TYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIGLAPRAMEKCKSRN  293



>ref|NP_001288823.1| auxin-responsive protein IAA7 [Brassica rapa]
 dbj|BAF81520.1| auxin-responsive protein IAA [Brassica rapa]
Length=242

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 5/51 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSRS  139
            +YEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRAM K CK+RS
Sbjct  192  SYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>ref|XP_010550916.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16 
[Tarenaya hassleriana]
Length=212

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA+  CK+R
Sbjct  163  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRALVKCKNR  211



>ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYED+DGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  189  TYEDRDGDWMLVGDVPWEMFVDSCRRLRIMKGSEAIGLAPRAVEKCKNRS  238



>gb|ADL70678.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=161

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+R
Sbjct  113  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  161



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+R
Sbjct  197  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    APRA++ CK+R
Sbjct  197  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>ref|XP_010249636.1| PREDICTED: auxin-responsive protein IAA27 [Nelumbo nucifera]
Length=343

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MF +SC RLRIM+GSE    APRAM+ CKSR+
Sbjct  294  TYEDKDGDWMLVGDVPWQMFTDSCRRLRIMKGSEAIGLAPRAMEKCKSRN  343



>ref|XP_010917562.1| PREDICTED: auxin-responsive protein IAA27-like [Elaeis guineensis]
Length=318

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MF +SC RLRIMRGSE    APRAM+ CKSR+
Sbjct  269  TYEDKDGDWMLVGDVPWNMFTDSCRRLRIMRGSEAVGIAPRAMEKCKSRN  318



>gb|KHN18836.1| Auxin-induced protein AUX28 [Glycine soja]
Length=246

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYED+DGDWMLVGDVPWEMFVESC RLRIM+G E    APRA++ CK+RS
Sbjct  197  TYEDRDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS  246



>ref|XP_002883395.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59654.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 5/50 (10%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAM-KICKSR  136
            +YEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRAM K CK+R
Sbjct  192  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>ref|XP_006584572.1| PREDICTED: uncharacterized protein LOC100795749 isoform X1 [Glycine 
max]
Length=357

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 41/49 (84%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMF ESC RLRIM+ SE    APRAM+ CKSR
Sbjct  308  TYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIGLAPRAMEKCKSR  356



>gb|ABM53871.1| IAA3 [Cestrum elegans]
Length=153

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF+++C RLRIM+GS+    APRAM+ C+SR+
Sbjct  104  TYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  153



>gb|ABM53872.1| IAA4 [Cestrum elegans]
Length=149

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  100  TYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  149



>gb|ADL70672.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
 gb|ADL70675.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=166

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+R
Sbjct  118  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  166



>ref|XP_010254042.1| PREDICTED: auxin-responsive protein IAA27-like [Nelumbo nucifera]
Length=340

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF +SC RLRIM+GSE    APRAM+ CK+R+
Sbjct  291  TYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGLAPRAMEKCKNRN  340



>emb|CAC84710.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=277

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            +YEDKDGDWMLVGDVPWEMFV+SC R RIM+GSE    APRAM+ CKSR+
Sbjct  228  SYEDKDGDWMLVGDVPWEMFVDSCKRPRIMKGSEAVGLAPRAMEKCKSRT  277



>gb|EYU30526.1| hypothetical protein MIMGU_mgv1a012831mg [Erythranthe guttata]
Length=239

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSR  136
            TYEDKDGDWMLVGDVPWEMFV+SC R+RIM+GSE    APRA++ CK+R
Sbjct  190  TYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRAVEKCKNR  238



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGD MLVGDVPWEMF+ESC RLRIM+G+E    APRAM+ CK+RS
Sbjct  186  TYEDKDGDLMLVGDVPWEMFIESCKRLRIMKGTEAIGLAPRAMEKCKNRS  235



>gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Erythranthe guttata]
Length=231

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV SC RLRIM+G+E    AP+AM  CK+RS
Sbjct  182  TYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAKGLAPKAMDKCKTRS  231



>ref|XP_009380572.1| PREDICTED: auxin-responsive protein IAA21-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=292

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF +SC RLRIM+GS+    APRAM+ CKSR+
Sbjct  243  TYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDAIGLAPRAMEKCKSRN  292



>ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume]
Length=256

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  207  TYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  256



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  200  TYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  201  TYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  250



>ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
 gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
Length=272

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+GSE    APRA++  K+RS
Sbjct  223  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKRKNRS  272



>ref|XP_004142529.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 ref|XP_004170021.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 gb|KGN66786.1| hypothetical protein Csa_1G690240 [Cucumis sativus]
Length=236

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MFV+SC RLRIM+GSE    APRA++ CK+R+
Sbjct  187  TYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRALEKCKNRN  236



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  200  TYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>ref|XP_007162490.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
 gb|ESW34484.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
Length=246

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 41/52 (79%), Gaps = 6/52 (12%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE------APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFVESC RLRIM+G E      APRAM   K+RS
Sbjct  195  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKSKNRS  246



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  242  TYEDKDGDWMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  291



>gb|ABB55368.1| Aux/IAA protein-like [Solanum tuberosum]
Length=349

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF+++C RLRIM+GS+    APRAM+ C+SR+
Sbjct  300  TYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  349



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMFV+SC RLRIM+GSE    AP+ M+ CK++S
Sbjct  192  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKVMEKCKNQS  241



>ref|NP_001275473.1| Aux/IAA protein [Solanum tuberosum]
 gb|AAM29182.1| Aux/IAA protein [Solanum tuberosum]
Length=349

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF+++C RLRIM+GS+    APRAM+ C+SR+
Sbjct  300  TYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  349



>emb|CAD10639.1| IAA9 protein [Nicotiana tabacum]
Length=346

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF+E+C RLRIM+GS+    APR M+ C+SR+
Sbjct  297  TYEDKDGDWMLVGDVPWEMFIETCKRLRIMKGSDAIGLAPRGMEKCRSRN  346



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFV+SC R+RIM+GSE    APRA++ CK+RS
Sbjct  182  TYEDKDGDWMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  231



>emb|CAI77628.1| Aux/IAA protein [Solanum lycopersicum]
Length=308

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF+++C RLRIM+GS+    APRAM+ C+SR+
Sbjct  259  TYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  308



>dbj|BAI94494.1| Aux/IAA protein [Dianthus caryophyllus]
Length=238

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFVESC R+RIM+G E    APRAM+ CK+RS
Sbjct  189  TYEDKDGDWMLVGDVPWGMFVESCKRIRIMKGKEAAGLAPRAMEKCKNRS  238



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFV+SC RLRIM+GSE    AP+AM+ CK RS
Sbjct  195  TYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPKAMEKCKGRS  244



>ref|XP_004503453.1| PREDICTED: auxin-responsive protein IAA27-like [Cicer arietinum]
Length=302

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF ESC +LRIM+ SE    APRAM+ CKSR+
Sbjct  253  TYEDKDGDWMLVGDVPWEMFTESCKKLRIMKSSEAIGLAPRAMEKCKSRN  302



>ref|XP_009608764.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana tomentosiformis]
Length=346

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF+++C RLRIM+GS+    APRAM+ C+SR+
Sbjct  297  TYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  346



>ref|XP_010320058.1| PREDICTED: auxin-responsive protein (Aux/IAA) isoform X1 [Solanum 
lycopersicum]
Length=349

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF+++C RLRIM+GS+    APRAM+ C+SR+
Sbjct  300  TYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  349



>ref|XP_009789143.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana sylvestris]
Length=346

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPWEMF+++C RLRIM+GS+    APRAM+ C+SR+
Sbjct  297  TYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN  346



>ref|XP_006366663.1| PREDICTED: auxin-responsive protein IAA16-like [Solanum tuberosum]
Length=214

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFV+SC RLRIM+G+E    APRAM+ CK+R+
Sbjct  164  TYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGTEAIGLAPRAMEKCKNRN  213



>gb|KEH27147.1| auxin response factor [Medicago truncatula]
Length=254

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW+MF++SC RLRIM+ SE    APRAM+ CKSR+
Sbjct  205  TYEDKDGDWMLVGDVPWKMFIDSCKRLRIMKSSEAIGLAPRAMEKCKSRN  254



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    TYEDKDGDWMLVGDVPWEMFVESCNRLRIMRGSE----APRAMKICKSRS  139
            TYEDKDGDWMLVGDVPW MFV+SC RLRIM+GSE    APRA++ CK+RS
Sbjct  202  TYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  251



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512400555856