BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22807_g2_i3 len=878 path=[1:0-101 103:102-109 111:110-142
144:143-877]

Length=878
                                                                      Score     E

ref|XP_009603276.1|  PREDICTED: zinc-finger homeodomain protein 6...    175   1e-48   
ref|XP_006340630.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    172   2e-47   
ref|XP_011099626.1|  PREDICTED: zinc-finger homeodomain protein 6       172   3e-47   
ref|XP_004232414.1|  PREDICTED: zinc-finger homeodomain protein 5       170   5e-47   
ref|XP_002310240.2|  zinc finger family protein                         170   8e-47   Populus trichocarpa [western balsam poplar]
ref|XP_009804697.1|  PREDICTED: zinc-finger homeodomain protein 6       169   3e-46   
ref|XP_007046919.1|  Homeobox protein 24, putative                      169   8e-46   
ref|XP_004512050.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    166   1e-45   
gb|KDP38514.1|  hypothetical protein JCGZ_04439                         166   5e-45   
ref|XP_008392268.1|  PREDICTED: zinc-finger homeodomain protein 6...    166   5e-45   
ref|XP_006599376.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    166   9e-45   
gb|KHN11103.1|  ZF-HD homeobox protein                                  165   1e-44   
ref|XP_010254805.1|  PREDICTED: zinc-finger homeodomain protein 5...    165   3e-44   
ref|XP_009371603.1|  PREDICTED: zinc-finger homeodomain protein 6...    163   4e-44   
ref|XP_011025804.1|  PREDICTED: zinc-finger homeodomain protein 6       164   5e-44   
ref|XP_006380765.1|  hypothetical protein POPTR_0007s12970g             163   6e-44   
ref|XP_007156052.1|  hypothetical protein PHAVU_003G254200g             163   6e-44   
gb|AES94983.2|  homeobox domain, ZF-HD class protein                    162   7e-44   
ref|XP_003612025.1|  Zinc finger-homeodomain protein                    162   7e-44   
ref|XP_002886165.1|  ATHB24                                             161   7e-44   
ref|XP_002510399.1|  transcription factor, putative                     160   5e-43   Ricinus communis
gb|KHN00536.1|  ZF-HD homeobox protein                                  160   1e-42   
ref|XP_003520309.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    160   1e-42   
ref|XP_010102085.1|  hypothetical protein L484_009028                   160   1e-42   
ref|XP_007017558.1|  Homeobox protein 33 isoform 1                      158   3e-42   
ref|XP_004152776.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    157   3e-42   
ref|XP_010539898.1|  PREDICTED: zinc-finger homeodomain protein 5...    156   6e-42   
gb|EPS61290.1|  hypothetical protein M569_13509                         154   9e-42   
ref|XP_008444722.1|  PREDICTED: zinc-finger homeodomain protein 2       157   9e-42   
ref|XP_004165400.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    157   1e-41   
ref|XP_006383190.1|  hypothetical protein POPTR_0005s12420g             157   2e-41   
emb|CDX90679.1|  BnaA03g41020D                                          154   2e-41   
ref|XP_006291743.1|  hypothetical protein CARUB_v10017911mg             154   2e-41   
ref|XP_008440716.1|  PREDICTED: zinc-finger homeodomain protein 2       157   2e-41   
emb|CDY70550.1|  BnaAnng34110D                                          154   5e-41   
ref|XP_004143516.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    155   5e-41   
emb|CDY37252.1|  BnaCnng08060D                                          153   1e-40   
gb|KHG07143.1|  hypothetical protein F383_33189                         153   1e-40   
ref|XP_010095248.1|  hypothetical protein L484_014588                   154   1e-40   
gb|EPS63497.1|  hypothetical protein M569_11287                         151   1e-40   
emb|CBI17508.3|  unnamed protein product                                156   2e-40   
gb|KDP34399.1|  hypothetical protein JCGZ_12803                         154   2e-40   
emb|CDY70108.1|  BnaCnng66730D                                          152   2e-40   
ref|XP_009365549.1|  PREDICTED: zinc-finger homeodomain protein 2...    154   3e-40   
ref|XP_003517228.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    153   4e-40   
ref|XP_008241887.1|  PREDICTED: zinc-finger homeodomain protein 5...    151   6e-40   
gb|KFK40227.1|  hypothetical protein AALP_AA3G347100                    150   6e-40   
ref|XP_002281371.1|  PREDICTED: zinc-finger homeodomain protein 6       152   9e-40   Vitis vinifera
ref|XP_008388052.1|  PREDICTED: zinc-finger homeodomain protein 2       152   1e-39   
gb|KHN36110.1|  ZF-HD homeobox protein                                  151   2e-39   
ref|XP_008344270.1|  PREDICTED: zinc-finger homeodomain protein 6...    151   2e-39   
ref|XP_006299733.1|  hypothetical protein CARUB_v10015926mg             150   2e-39   
ref|XP_002521573.1|  transcription factor, putative                     151   2e-39   Ricinus communis
ref|XP_010414224.1|  PREDICTED: zinc-finger homeodomain protein 6...    149   2e-39   
ref|XP_009347543.1|  PREDICTED: zinc-finger homeodomain protein 6...    151   2e-39   
emb|CDY28987.1|  BnaC07g31930D                                          149   3e-39   
ref|XP_006409164.1|  hypothetical protein EUTSA_v10022806mg             149   3e-39   
ref|XP_009336904.1|  PREDICTED: zinc-finger homeodomain protein 2...    151   4e-39   
ref|XP_010550403.1|  PREDICTED: zinc-finger homeodomain protein 7...    149   5e-39   
ref|XP_007204025.1|  hypothetical protein PRUPE_ppa020272mg             150   5e-39   
ref|XP_010029792.1|  PREDICTED: zinc-finger homeodomain protein 6       150   5e-39   
ref|XP_010467646.1|  PREDICTED: zinc-finger homeodomain protein 6       148   6e-39   
ref|XP_011028851.1|  PREDICTED: zinc-finger homeodomain protein 5...    149   6e-39   
gb|KDP40895.1|  hypothetical protein JCGZ_24894                         148   6e-39   
ref|XP_008357201.1|  PREDICTED: zinc-finger homeodomain protein 5...    150   6e-39   
ref|XP_010547467.1|  PREDICTED: zinc-finger homeodomain protein 7...    148   7e-39   
ref|XP_003537589.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    150   7e-39   
gb|ACU20045.1|  unknown                                                 150   8e-39   Glycine max [soybeans]
ref|XP_002302028.1|  zinc finger family protein                         149   8e-39   Populus trichocarpa [western balsam poplar]
ref|XP_009364948.1|  PREDICTED: zinc-finger homeodomain protein 2...    150   9e-39   
ref|XP_009112487.1|  PREDICTED: zinc-finger homeodomain protein 6...    147   1e-38   
ref|XP_010489538.1|  PREDICTED: zinc-finger homeodomain protein 6...    147   1e-38   
ref|XP_002876052.1|  ATHB28                                             147   1e-38   
ref|XP_009136568.1|  PREDICTED: zinc-finger homeodomain protein 7...    146   2e-38   
emb|CAN72985.1|  hypothetical protein VITISV_009036                     146   2e-38   Vitis vinifera
ref|XP_004168867.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    146   2e-38   
ref|XP_010424889.1|  PREDICTED: zinc-finger homeodomain protein 7...    147   2e-38   
gb|KGN53304.1|  hypothetical protein Csa_4G046670                       146   3e-38   
ref|XP_010060955.1|  PREDICTED: zinc-finger homeodomain protein 5       147   3e-38   
ref|XP_009136567.1|  PREDICTED: zinc-finger homeodomain protein 7...    147   4e-38   
ref|NP_565436.1|  homeobox protein 24                                   145   7e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266577.2|  PREDICTED: zinc-finger homeodomain protein 6       147   8e-38   Vitis vinifera
ref|XP_004146554.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    145   8e-38   
ref|XP_002325543.2|  hypothetical protein POPTR_0019s11070g             145   8e-38   Populus trichocarpa [western balsam poplar]
ref|XP_009619186.1|  PREDICTED: zinc-finger homeodomain protein 2...    144   9e-38   
ref|XP_009772007.1|  PREDICTED: zinc-finger homeodomain protein 2...    144   1e-37   
ref|NP_190658.1|  homeobox protein 28                                   144   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002994344.1|  hypothetical protein SELMODRAFT_236945             142   1e-37   
ref|XP_009340741.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...    146   2e-37   
emb|CDY34299.1|  BnaA01g14020D                                          143   3e-37   
ref|XP_010503763.1|  PREDICTED: zinc-finger homeodomain protein 7...    144   3e-37   
ref|XP_009138327.1|  PREDICTED: zinc-finger homeodomain protein 2       143   3e-37   
gb|AAM63229.1|  unknown                                                 143   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788352.1|  PREDICTED: zinc-finger homeodomain protein 4...    143   4e-37   
ref|XP_004509268.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    140   5e-37   
ref|XP_006853040.1|  hypothetical protein AMTR_s00038p00027320          142   5e-37   
gb|KHG22175.1|  hypothetical protein F383_07505                         142   8e-37   
ref|XP_010266504.1|  PREDICTED: zinc-finger homeodomain protein 1...    142   9e-37   
ref|XP_009769511.1|  PREDICTED: zinc-finger homeodomain protein 2...    142   9e-37   
gb|KHN05023.1|  ZF-HD homeobox protein                                  140   1e-36   
ref|XP_003555538.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    140   1e-36   
ref|XP_009769508.1|  PREDICTED: zinc-finger homeodomain protein 2...    142   1e-36   
ref|XP_008808961.1|  PREDICTED: zinc-finger homeodomain protein 4...    142   1e-36   
emb|CDX88950.1|  BnaA04g02360D                                          140   1e-36   
gb|KHN03576.1|  ZF-HD homeobox protein                                  142   2e-36   
emb|CDX81284.1|  BnaC09g06950D                                          142   2e-36   
ref|XP_006859182.1|  hypothetical protein AMTR_s00070p00154800          140   2e-36   
emb|CDY08945.1|  BnaC08g11750D                                          140   2e-36   
ref|XP_010263641.1|  PREDICTED: zinc-finger homeodomain protein 5       144   3e-36   
ref|XP_002966118.1|  hypothetical protein SELMODRAFT_85536              138   3e-36   
ref|XP_006403985.1|  hypothetical protein EUTSA_v10010588mg             141   5e-36   
ref|XP_008810728.1|  PREDICTED: zinc-finger homeodomain protein 6...    142   5e-36   
ref|XP_002965557.1|  hypothetical protein SELMODRAFT_68508              138   6e-36   
emb|CDY24844.1|  BnaA08g14660D                                          139   6e-36   
ref|XP_010930367.1|  PREDICTED: zinc-finger homeodomain protein 4...    140   8e-36   
ref|XP_001752347.1|  predicted protein                                  140   1e-35   
ref|NP_194197.1|  ZF-HD homeobox protein                                138   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ADE77597.1|  unknown                                                 139   1e-35   
emb|CDX73775.1|  BnaC08g22280D                                          138   2e-35   
ref|XP_010272957.1|  PREDICTED: zinc-finger homeodomain protein 1...    138   2e-35   
ref|XP_002867654.1|  ATHB22/MEE68                                       138   2e-35   
gb|ABY61024.1|  zinc finger-homeodomain protein 2                       139   2e-35   Saruma henryi
ref|XP_001777987.1|  predicted protein                                  136   2e-35   
ref|XP_009115766.1|  PREDICTED: zinc-finger homeodomain protein 7       138   2e-35   
ref|XP_010515469.1|  PREDICTED: zinc-finger homeodomain protein 7...    139   2e-35   
emb|CDY54719.1|  BnaA09g52500D                                          138   2e-35   
emb|CDY03431.1|  BnaC01g16510D                                          138   2e-35   
ref|XP_002982727.1|  hypothetical protein SELMODRAFT_17376              135   3e-35   
ref|XP_006426297.1|  hypothetical protein CICLE_v10027024mg             138   3e-35   
ref|XP_003550152.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...    139   3e-35   
ref|XP_009112180.1|  PREDICTED: zinc-finger homeodomain protein 1...    138   3e-35   
ref|XP_009421143.1|  PREDICTED: zinc-finger homeodomain protein 4...    139   4e-35   
ref|XP_009596949.1|  PREDICTED: zinc-finger homeodomain protein 2...    137   5e-35   
emb|CDY71124.1|  BnaCnng71430D                                          137   6e-35   
ref|XP_011003997.1|  PREDICTED: zinc-finger homeodomain protein 2...    138   6e-35   
ref|XP_010912718.1|  PREDICTED: zinc-finger homeodomain protein 4...    138   6e-35   
ref|XP_008452084.1|  PREDICTED: zinc-finger homeodomain protein 6...    137   7e-35   
ref|XP_009802158.1|  PREDICTED: zinc-finger homeodomain protein 2...    136   9e-35   
ref|XP_001772697.1|  predicted protein                                  135   1e-34   
ref|XP_009407034.1|  PREDICTED: zinc-finger homeodomain protein 2...    137   2e-34   
ref|XP_009403385.1|  PREDICTED: zinc-finger homeodomain protein 4...    136   2e-34   
ref|XP_009109241.1|  PREDICTED: zinc-finger homeodomain protein 2...    135   2e-34   
ref|XP_009592418.1|  PREDICTED: zinc-finger homeodomain protein 5...    133   3e-34   
ref|XP_009802157.1|  PREDICTED: zinc-finger homeodomain protein 2...    135   4e-34   
ref|XP_003635057.1|  PREDICTED: zinc-finger homeodomain protein 2...    135   4e-34   
ref|XP_006286279.1|  hypothetical protein CARUB_v10007856mg             134   5e-34   
ref|XP_009596948.1|  PREDICTED: zinc-finger homeodomain protein 2...    134   6e-34   
ref|XP_006413402.1|  hypothetical protein EUTSA_v10026163mg             134   7e-34   
ref|XP_010433740.1|  PREDICTED: zinc-finger homeodomain protein 2...    134   7e-34   
ref|XP_010438998.1|  PREDICTED: zinc-finger homeodomain protein 2...    134   9e-34   
ref|XP_010438997.1|  PREDICTED: zinc-finger homeodomain protein 2...    134   1e-33   
ref|XP_001778248.1|  predicted protein                                  134   1e-33   
ref|XP_003519839.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...    135   1e-33   
ref|XP_010448536.1|  PREDICTED: zinc-finger homeodomain protein 2       133   2e-33   
ref|XP_003622365.1|  Zinc finger-homeodomain protein                    132   2e-33   
ref|XP_010438996.1|  PREDICTED: zinc-finger homeodomain protein 2...    134   2e-33   
ref|XP_009607017.1|  PREDICTED: zinc-finger homeodomain protein 4...    133   3e-33   
ref|NP_172896.1|  homeobox protein 31                                   134   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305389.1|  hypothetical protein CARUB_v10009782mg             134   4e-33   
ref|XP_009416998.1|  PREDICTED: zinc-finger homeodomain protein 4...    133   4e-33   
gb|AAZ07989.1|  zinc finger homeodomain protein 1                       134   5e-33   Physcomitrella patens
ref|XP_009392577.1|  PREDICTED: zinc-finger homeodomain protein 4...    132   5e-33   
ref|XP_006280898.1|  hypothetical protein CARUB_v10026891mg             133   5e-33   
ref|XP_001785616.1|  predicted protein                                  134   5e-33   
ref|XP_007154109.1|  hypothetical protein PHAVU_003G091100g             132   5e-33   
ref|XP_009613099.1|  PREDICTED: zinc-finger homeodomain protein 4       133   6e-33   
ref|XP_006841247.1|  hypothetical protein AMTR_s00135p00085840          131   6e-33   
ref|XP_009117900.1|  PREDICTED: zinc-finger homeodomain protein 4...    133   7e-33   
ref|XP_006426395.1|  hypothetical protein CICLE_v10027184mg             131   7e-33   
emb|CDX81638.1|  BnaC08g39630D                                          133   8e-33   
gb|EPS61017.1|  hypothetical protein M569_13783                         131   9e-33   
gb|ABY61029.1|  zinc finger-homeodomain protein 1                       132   9e-33   Asparagus officinalis
ref|XP_009150629.1|  PREDICTED: zinc-finger homeodomain protein 1...    132   9e-33   
ref|XP_006385095.1|  hypothetical protein POPTR_0004s23860g             133   1e-32   
gb|EYU31214.1|  hypothetical protein MIMGU_mgv1a022645mg                131   1e-32   
ref|XP_003551238.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    131   1e-32   
ref|XP_002892806.1|  ATHB31                                             132   1e-32   
ref|XP_006878601.1|  hypothetical protein AMTR_s00011p00255340          131   1e-32   
ref|XP_007023152.1|  Homeobox protein 31                                132   2e-32   
ref|XP_007156949.1|  hypothetical protein PHAVU_002G031000g             133   2e-32   
ref|XP_006466561.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    130   2e-32   
emb|CBI19232.3|  unnamed protein product                                130   2e-32   
ref|XP_010444532.1|  PREDICTED: zinc-finger homeodomain protein 1       131   2e-32   
ref|XP_006346746.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    130   2e-32   
ref|XP_009762783.1|  PREDICTED: zinc-finger homeodomain protein 4...    132   2e-32   
ref|XP_008460585.1|  PREDICTED: zinc-finger homeodomain protein 4       132   2e-32   
ref|XP_009404830.1|  PREDICTED: zinc-finger homeodomain protein 4...    130   3e-32   
ref|NP_201344.1|  homeobox protein 25                                   131   3e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AFW79306.1|  ZF-HD homeobox protein                                  130   3e-32   
ref|XP_004236700.1|  PREDICTED: zinc-finger homeodomain protein 2...    130   4e-32   
gb|ABK22835.1|  unknown                                                 130   4e-32   Picea sitchensis
ref|XP_007143929.1|  hypothetical protein PHAVU_007G114300g             128   4e-32   
gb|EPS61775.1|  hypothetical protein M569_13018                         130   4e-32   
ref|XP_007047820.1|  ZF-HD homeobox protein, putative                   130   4e-32   
ref|XP_007048627.1|  Homeobox protein 21, putative                      130   4e-32   
ref|XP_006417011.1|  hypothetical protein EUTSA_v10008236mg             131   4e-32   
ref|XP_003633412.1|  PREDICTED: zinc-finger homeodomain protein 4       130   5e-32   
ref|XP_004495441.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    128   5e-32   
gb|ABY61025.1|  zinc finger-homeodomain protein 3                       128   6e-32   Saruma henryi
ref|XP_010463122.1|  PREDICTED: zinc-finger homeodomain protein 1...    130   6e-32   
ref|XP_002864955.1|  hypothetical protein ARALYDRAFT_919872             130   6e-32   
ref|XP_009406459.1|  PREDICTED: zinc-finger homeodomain protein 4...    130   6e-32   
ref|XP_010496079.1|  PREDICTED: zinc-finger homeodomain protein 4...    131   7e-32   
ref|XP_009130511.1|  PREDICTED: zinc-finger homeodomain protein 1...    130   7e-32   
ref|XP_010502266.1|  PREDICTED: zinc-finger homeodomain protein 3...    130   7e-32   
ref|XP_010243316.1|  PREDICTED: zinc-finger homeodomain protein 1...    129   7e-32   
ref|XP_002285709.1|  PREDICTED: zinc-finger homeodomain protein 1       129   7e-32   Vitis vinifera
ref|XP_010908151.1|  PREDICTED: zinc-finger homeodomain protein 4...    129   8e-32   
ref|XP_010476498.1|  PREDICTED: zinc-finger homeodomain protein 4       130   8e-32   
gb|KFK28242.1|  hypothetical protein AALP_AA8G490700                    130   8e-32   
ref|XP_010458941.1|  PREDICTED: zinc-finger homeodomain protein 4...    130   9e-32   
ref|XP_006394037.1|  hypothetical protein EUTSA_v10005568mg             130   9e-32   
ref|XP_002875135.1|  hypothetical protein ARALYDRAFT_484166             130   1e-31   
ref|XP_011001095.1|  PREDICTED: zinc-finger homeodomain protein 2...    129   1e-31   
ref|XP_009762039.1|  PREDICTED: zinc-finger homeodomain protein 4...    128   1e-31   
ref|XP_006376247.1|  hypothetical protein POPTR_0013s11330g             128   1e-31   
ref|XP_006376248.1|  hypothetical protein POPTR_0013s11330g             129   2e-31   
ref|XP_011028421.1|  PREDICTED: zinc-finger homeodomain protein 4       129   2e-31   
ref|NP_001152263.1|  ZF-HD homeobox protein                             128   2e-31   Zea mays [maize]
ref|XP_009129138.1|  PREDICTED: zinc-finger homeodomain protein 3       129   2e-31   
emb|CAN75153.1|  hypothetical protein VITISV_035994                     129   2e-31   Vitis vinifera
emb|CDX69541.1|  BnaA10g18900D                                          128   2e-31   
ref|XP_009148819.1|  PREDICTED: zinc-finger homeodomain protein 4...    129   3e-31   
ref|XP_006290001.1|  hypothetical protein CARUB_v10003631mg             128   3e-31   
emb|CBI22215.3|  unnamed protein product                                127   3e-31   
gb|EPS73952.1|  hypothetical protein M569_00810                         126   3e-31   
ref|XP_010484369.1|  PREDICTED: zinc-finger homeodomain protein 1...    128   3e-31   
ref|XP_007156483.1|  hypothetical protein PHAVU_003G289700g             126   4e-31   
emb|CDY14559.1|  BnaC03g49000D                                          128   4e-31   
ref|XP_011012906.1|  PREDICTED: zinc-finger homeodomain protein 4...    128   5e-31   
ref|XP_002443023.1|  hypothetical protein SORBIDRAFT_08g006490          128   6e-31   Sorghum bicolor [broomcorn]
ref|XP_002264291.1|  PREDICTED: zinc-finger homeodomain protein 2...    127   8e-31   Vitis vinifera
ref|XP_010027493.1|  PREDICTED: zinc-finger homeodomain protein 2...    125   8e-31   
ref|XP_008782488.1|  PREDICTED: zinc-finger homeodomain protein 6...    126   8e-31   
emb|CDY41692.1|  BnaC02g34620D                                          127   1e-30   
emb|CDY09363.1|  BnaA02g26470D                                          127   1e-30   
ref|XP_010527865.1|  PREDICTED: zinc-finger homeodomain protein 4       127   1e-30   
ref|XP_008440565.1|  PREDICTED: zinc-finger homeodomain protein 1...    125   1e-30   
ref|XP_004143449.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    125   1e-30   
ref|XP_002264250.1|  PREDICTED: zinc-finger homeodomain protein 4...    125   2e-30   Vitis vinifera
ref|XP_006400038.1|  hypothetical protein EUTSA_v10016088mg             126   2e-30   
ref|XP_008339904.1|  PREDICTED: zinc-finger homeodomain protein 1...    126   3e-30   
ref|XP_003621193.1|  ZF-HD homeobox protein                             126   4e-30   
emb|CDY33960.1|  BnaC02g43770D                                          125   4e-30   
ref|XP_010514025.1|  PREDICTED: zinc-finger homeodomain protein 3       126   4e-30   
ref|XP_008353097.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...    125   6e-30   
ref|XP_011005585.1|  PREDICTED: zinc-finger homeodomain protein 3...    124   6e-30   
ref|XP_007224765.1|  hypothetical protein PRUPE_ppa024080mg             126   7e-30   
ref|XP_008389477.1|  PREDICTED: zinc-finger homeodomain protein 1...    125   7e-30   
ref|XP_004156724.1|  PREDICTED: LOW QUALITY PROTEIN: ZF-HD homeob...    125   7e-30   
ref|XP_006434579.1|  hypothetical protein CICLE_v10004050mg             122   8e-30   
ref|XP_011074552.1|  PREDICTED: zinc-finger homeodomain protein 5...    124   9e-30   
ref|XP_010940074.1|  PREDICTED: zinc-finger homeodomain protein 6...    125   9e-30   
ref|XP_006827241.1|  hypothetical protein AMTR_s00010p00261450          123   1e-29   
ref|XP_009360340.1|  PREDICTED: zinc-finger homeodomain protein 8       126   1e-29   
emb|CDY39311.1|  BnaC05g10680D                                          124   1e-29   
gb|KDO36261.1|  hypothetical protein CISIN_1g048824mg                   122   1e-29   
ref|NP_197025.1|  zinc finger homeodomain transcriptional factor ...    124   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142854.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    124   1e-29   
emb|CAN60985.1|  hypothetical protein VITISV_044468                     124   1e-29   Vitis vinifera
ref|XP_002306012.2|  hypothetical protein POPTR_0004s14270g             124   1e-29   Populus trichocarpa [western balsam poplar]
emb|CDP20040.1|  unnamed protein product                                121   1e-29   
ref|XP_009394611.1|  PREDICTED: zinc-finger homeodomain protein 2...    124   2e-29   
ref|XP_009380358.1|  PREDICTED: zinc-finger homeodomain protein 6...    124   2e-29   
ref|XP_006473167.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    121   2e-29   
ref|XP_006849460.1|  hypothetical protein AMTR_s00024p00085480          120   2e-29   
ref|XP_003543789.1|  PREDICTED: transcription factor HB29-like          124   3e-29   
gb|KHM99976.1|  ZF-HD homeobox protein                                  121   3e-29   
ref|XP_006291509.1|  hypothetical protein CARUB_v10017657mg             123   4e-29   
emb|CBI18514.3|  unnamed protein product                                122   5e-29   
emb|CDM83487.1|  unnamed protein product                                121   5e-29   
emb|CDM83476.1|  unnamed protein product                                121   5e-29   
gb|EPS71422.1|  hypothetical protein M569_03334                         121   5e-29   
gb|EEE69868.1|  hypothetical protein OsJ_29679                          121   6e-29   Oryza sativa Japonica Group [Japonica rice]
gb|ABO92969.1|  ZF-HD homeobox domain-containing protein                122   7e-29   Solanum tuberosum [potatoes]
ref|XP_008221618.1|  PREDICTED: zinc-finger homeodomain protein 1...    123   8e-29   
ref|XP_009788342.1|  PREDICTED: zinc-finger homeodomain protein 9...    121   1e-28   
ref|XP_009415270.1|  PREDICTED: zinc-finger homeodomain protein 6...    122   1e-28   
ref|XP_002873714.1|  ATHB30/ZFHD3                                       120   1e-28   
ref|XP_008467173.1|  PREDICTED: zinc-finger homeodomain protein 1...    118   2e-28   
ref|XP_008656066.1|  PREDICTED: zinc-finger homeodomain protein 6...    120   2e-28   
ref|XP_009620302.1|  PREDICTED: zinc-finger homeodomain protein 9...    120   3e-28   
ref|XP_006385182.1|  hypothetical protein POPTR_0003s00800g             119   4e-28   
ref|NP_001237557.1|  zinc finger homeodomain protein SZF-HD2            117   4e-28   
emb|CDY45257.1|  BnaA06g09270D                                          120   4e-28   
ref|XP_009390407.1|  PREDICTED: zinc-finger homeodomain protein 5...    120   4e-28   
ref|XP_003602944.1|  Zinc finger-homeodomain protein                    119   5e-28   
gb|AAD39591.1|AC007858_5  10A19I.6                                      121   5e-28   
gb|KFK25766.1|  hypothetical protein AALP_AA8G156900                    119   6e-28   
gb|ABY61026.1|  zinc finger-homeodomain protein 1                       116   6e-28   
ref|XP_011010943.1|  PREDICTED: zinc-finger homeodomain protein 9...    120   6e-28   
ref|NP_189534.1|  homeobox protein 34                                   119   7e-28   
ref|XP_011097503.1|  PREDICTED: zinc-finger homeodomain protein 2...    118   9e-28   
ref|NP_001056419.1|  Os05g0579300                                       118   9e-28   
ref|XP_004137520.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    116   1e-27   
ref|XP_009788413.1|  PREDICTED: zinc-finger homeodomain protein 9...    117   1e-27   
ref|XP_006360403.1|  PREDICTED: uncharacterized protein LOC102604466    124   1e-27   
ref|XP_004238801.1|  PREDICTED: zinc-finger homeodomain protein 1...    119   1e-27   
ref|XP_010420179.1|  PREDICTED: zinc-finger homeodomain protein 8...    118   1e-27   
ref|XP_006366102.1|  PREDICTED: transcription factor HB29-like          118   2e-27   
emb|CAN69661.1|  hypothetical protein VITISV_013011                     119   3e-27   
ref|XP_011070997.1|  PREDICTED: zinc-finger homeodomain protein 10      117   3e-27   
emb|CAC34413.1|  ZF-HD homeobox protein                                 117   3e-27   
ref|XP_010674293.1|  PREDICTED: zinc-finger homeodomain protein 1...    115   3e-27   
gb|AAT39967.1|  Putative ZF-HD homeobox protein, identical              117   4e-27   
dbj|BAD28899.1|  putative ZF-HD homeobox protein                        116   6e-27   
ref|XP_010243781.1|  PREDICTED: zinc-finger homeodomain protein 1...    114   6e-27   
emb|CAN60986.1|  hypothetical protein VITISV_044469                     114   7e-27   
ref|XP_011073164.1|  PREDICTED: zinc-finger homeodomain protein 1...    114   8e-27   
ref|XP_003525176.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    113   8e-27   
ref|XP_009121598.1|  PREDICTED: zinc-finger homeodomain protein 8       114   2e-26   
ref|XP_004513326.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    112   2e-26   
ref|XP_010321484.1|  PREDICTED: zinc-finger homeodomain protein 1...    112   3e-26   
ref|XP_010470956.1|  PREDICTED: zinc-finger homeodomain protein 11      114   3e-26   
ref|XP_007037025.1|  ZF-HD homeobox protein                             112   3e-26   
ref|XP_010551857.1|  PREDICTED: zinc-finger homeodomain protein 8...    114   3e-26   
ref|XP_007152632.1|  hypothetical protein PHAVU_004G146200g             111   5e-26   
gb|KHN33985.1|  ZF-HD homeobox protein                                  112   5e-26   
ref|XP_003556869.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    113   6e-26   
ref|XP_010271248.1|  PREDICTED: uncharacterized protein LOC104607317    115   9e-26   
ref|XP_010483696.1|  PREDICTED: zinc-finger homeodomain protein 1...    111   9e-26   
ref|NP_177118.1|  transcriptional factor ZFHD1                          112   9e-26   
ref|XP_002887246.1|  ATHB29/ZFHD1                                       112   9e-26   
ref|XP_006390994.1|  hypothetical protein EUTSA_v10019038mg             112   1e-25   
ref|XP_006471248.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    110   1e-25   
ref|XP_006431739.1|  hypothetical protein CICLE_v10003937mg             110   1e-25   
ref|XP_006302745.1|  hypothetical protein CARUB_v10020860mg             112   1e-25   
ref|XP_010527122.1|  PREDICTED: zinc-finger homeodomain protein 4...    111   1e-25   
ref|XP_010512006.1|  PREDICTED: zinc-finger homeodomain protein 1...    112   1e-25   
ref|XP_010232067.1|  PREDICTED: zinc-finger homeodomain protein 5...    112   1e-25   
ref|XP_010512007.1|  PREDICTED: zinc-finger homeodomain protein 1...    112   2e-25   
emb|CDO98637.1|  unnamed protein product                                110   2e-25   
ref|XP_003556881.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    112   2e-25   
gb|KDO43555.1|  hypothetical protein CISIN_1g044959mg                   109   2e-25   
gb|ABY61022.1|  zinc finger-homeodomain protein 3                       110   2e-25   
ref|XP_002318316.2|  hypothetical protein POPTR_0012s03770g             110   2e-25   
ref|XP_007215708.1|  hypothetical protein PRUPE_ppa008908mg             112   2e-25   
ref|NP_001237542.1|  zinc finger homeodomain protein SZF-HD1            110   2e-25   
ref|XP_003556880.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    111   2e-25   
emb|CDY20008.1|  BnaA09g02430D                                          112   3e-25   
ref|XP_010069461.1|  PREDICTED: zinc-finger homeodomain protein 1...    109   4e-25   
ref|XP_003518104.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    111   4e-25   
ref|XP_007158386.1|  hypothetical protein PHAVU_002G148900g             110   4e-25   
ref|XP_011000742.1|  PREDICTED: zinc-finger homeodomain protein 1...    109   5e-25   
ref|XP_009593275.1|  PREDICTED: zinc-finger homeodomain protein 1...    110   5e-25   
ref|XP_006363993.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    108   6e-25   
ref|XP_010415617.1|  PREDICTED: zinc-finger homeodomain protein 1...    110   6e-25   
ref|XP_007209606.1|  hypothetical protein PRUPE_ppa011508mg             109   7e-25   
ref|XP_004135457.1|  PREDICTED: transcription factor HB29-like          109   8e-25   
ref|XP_009589660.1|  PREDICTED: zinc-finger homeodomain protein 2...    108   8e-25   
gb|KEH26786.1|  zinc finger homeodomain protein                         108   8e-25   
ref|XP_008375099.1|  PREDICTED: zinc-finger homeodomain protein 1...    108   8e-25   
ref|XP_006282138.1|  hypothetical protein CARUB_v10028391mg             108   1e-24   
ref|XP_004235372.1|  PREDICTED: zinc-finger homeodomain protein 7...    108   1e-24   
ref|XP_010252306.1|  PREDICTED: zinc-finger homeodomain protein 4       110   1e-24   
ref|XP_008393463.1|  PREDICTED: zinc-finger homeodomain protein 1...    108   1e-24   
ref|XP_009355979.1|  PREDICTED: zinc-finger homeodomain protein 1...    108   2e-24   
ref|XP_010456467.1|  PREDICTED: zinc-finger homeodomain protein 1...    107   2e-24   
ref|XP_011035531.1|  PREDICTED: zinc-finger homeodomain protein 4...    107   2e-24   
emb|CDP02013.1|  unnamed protein product                                110   2e-24   
ref|XP_006395776.1|  hypothetical protein EUTSA_v10004643mg             110   2e-24   
ref|XP_006374228.1|  hypothetical protein POPTR_0015s05220g             107   2e-24   
ref|XP_011017078.1|  PREDICTED: zinc-finger homeodomain protein 1...    110   3e-24   
ref|XP_009360029.1|  PREDICTED: zinc-finger homeodomain protein 1...    107   3e-24   
ref|XP_011003723.1|  PREDICTED: zinc-finger homeodomain protein 6       109   5e-24   
ref|XP_009776697.1|  PREDICTED: zinc-finger homeodomain protein 5...    106   5e-24   
ref|XP_007160565.1|  hypothetical protein PHAVU_002G332400g             105   6e-24   
gb|EYU40171.1|  hypothetical protein MIMGU_mgv1a008153mg                109   6e-24   
ref|XP_002263466.1|  PREDICTED: zinc-finger homeodomain protein 9       105   7e-24   
ref|XP_003532548.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    104   1e-23   
ref|XP_006425664.1|  hypothetical protein CICLE_v10025926mg             108   1e-23   
ref|XP_008240396.1|  PREDICTED: zinc-finger homeodomain protein 1...    105   1e-23   
ref|XP_002267747.1|  PREDICTED: zinc-finger homeodomain protein 3       106   1e-23   
ref|NP_200856.1|  homeobox protein 26                                   105   2e-23   
sp|Q9FKJ9.1|ZHD12_ARATH  RecName: Full=Zinc-finger homeodomain pr...    105   2e-23   
ref|XP_010326743.1|  PREDICTED: uncharacterized protein LOC101258...    110   2e-23   
ref|XP_003518103.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    106   2e-23   
gb|KDO79571.1|  hypothetical protein CISIN_1g021302mg                   107   3e-23   
ref|XP_004247917.1|  PREDICTED: uncharacterized protein LOC101258...    110   3e-23   
ref|XP_003556882.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    105   3e-23   
ref|XP_010326742.1|  PREDICTED: uncharacterized protein LOC101258...    110   3e-23   
ref|XP_009131913.1|  PREDICTED: zinc-finger homeodomain protein 12      103   5e-23   
emb|CDY28566.1|  BnaC02g19350D                                          104   9e-23   
ref|XP_003560584.1|  PREDICTED: zinc-finger homeodomain protein 11      104   9e-23   
emb|CDY44079.1|  BnaA02g14430D                                          104   9e-23   
gb|KHG11042.1|  hypothetical protein F383_15979                         104   1e-22   
ref|XP_004293203.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    105   2e-22   
ref|XP_008444884.1|  PREDICTED: zinc-finger homeodomain protein 2       103   2e-22   
ref|XP_004287891.1|  PREDICTED: uncharacterized protein LOC101298828    105   2e-22   
emb|CDP07504.1|  unnamed protein product                                104   2e-22   
ref|XP_008220812.1|  PREDICTED: zinc-finger homeodomain protein 5...    104   2e-22   
ref|XP_007224511.1|  hypothetical protein PRUPE_ppa023369mg             104   2e-22   
ref|XP_008220815.1|  PREDICTED: zinc-finger homeodomain protein 5...    104   2e-22   
emb|CDX88760.1|  BnaA03g08890D                                          101   3e-22   
gb|ABY61019.1|  mini zinc finger 1                                      101   3e-22   
emb|CDX73152.1|  BnaC06g36000D                                          103   3e-22   
emb|CDY69628.1|  BnaAnng31040D                                          101   3e-22   
ref|XP_010425030.1|  PREDICTED: zinc-finger homeodomain protein 3...    103   3e-22   
gb|ABY61018.1|  zinc finger-homeodomain protein 1                       103   4e-22   
gb|KDP29745.1|  hypothetical protein JCGZ_18680                         102   4e-22   
ref|XP_004152612.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    102   5e-22   
gb|EPS70172.1|  hypothetical protein M569_04589                       99.4    6e-22   
ref|XP_006354529.1|  PREDICTED: uncharacterized protein LOC102604540    106   8e-22   
emb|CDY45419.1|  BnaA07g31990D                                          102   8e-22   
ref|XP_006302600.1|  hypothetical protein CARUB_v10020705mg             102   9e-22   
ref|XP_011083674.1|  PREDICTED: zinc-finger homeodomain protein 5       101   9e-22   
ref|XP_009763792.1|  PREDICTED: zinc-finger homeodomain protein 5...    102   9e-22   
ref|XP_010530124.1|  PREDICTED: zinc-finger homeodomain protein 2       100   1e-21   
ref|XP_009106180.1|  PREDICTED: zinc-finger homeodomain protein 5       102   1e-21   
ref|XP_008665304.1|  PREDICTED: zinc-finger homeodomain protein 11      101   1e-21   
gb|AEN81237.1|  AT1G75240-like protein                                  100   1e-21   
ref|XP_006341952.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    101   1e-21   
ref|XP_011004015.1|  PREDICTED: zinc-finger homeodomain protein 5...    101   1e-21   
ref|XP_002306871.1|  zinc finger family protein                         101   2e-21   
emb|CBI19706.3|  unnamed protein product                                102   2e-21   
ref|XP_009630982.1|  PREDICTED: zinc-finger homeodomain protein 5...    101   2e-21   
ref|XP_007041337.1|  Homeobox 31-like protein                           100   2e-21   
ref|XP_002466561.1|  hypothetical protein SORBIDRAFT_01g010020          100   2e-21   
ref|XP_004238289.1|  PREDICTED: zinc-finger homeodomain protein 5       100   3e-21   
ref|XP_004981969.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  99.8    3e-21   
gb|ABY61021.1|  zinc finger-homeodomain protein 2                       100   3e-21   
emb|CDX68137.1|  BnaA07g21770D                                          100   3e-21   
ref|XP_009104712.1|  PREDICTED: zinc-finger homeodomain protein 5...    100   3e-21   
ref|XP_006435006.1|  hypothetical protein CICLE_v10001952mg             100   3e-21   
ref|XP_009596464.1|  PREDICTED: mini zinc finger protein 2-like       95.9    4e-21   
ref|XP_010099792.1|  hypothetical protein L484_010980                   100   4e-21   
ref|XP_006473514.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    100   4e-21   
gb|KDO84585.1|  hypothetical protein CISIN_1g021941mg                   100   4e-21   
ref|XP_009776474.1|  PREDICTED: uncharacterized protein LOC104226...    103   4e-21   
ref|XP_009602563.1|  PREDICTED: zinc-finger homeodomain protein 2...  99.8    5e-21   
gb|AEN81229.1|  AT1G75240-like protein                                98.2    5e-21   
ref|XP_009776475.1|  PREDICTED: uncharacterized protein LOC104226...    103   5e-21   
gb|AEN81227.1|  AT1G75240-like protein                                98.2    5e-21   
gb|AFK36118.1|  unknown                                               98.6    5e-21   
ref|XP_009776472.1|  PREDICTED: uncharacterized protein LOC104226...    103   5e-21   
ref|XP_001773677.1|  predicted protein                                94.7    7e-21   
gb|KDO58763.1|  hypothetical protein CISIN_1g041672mg                 95.9    8e-21   
ref|XP_010925945.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  99.8    9e-21   
ref|XP_006338094.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  98.6    1e-20   
emb|CBI29630.3|  unnamed protein product                              96.7    1e-20   
ref|XP_004237971.1|  PREDICTED: zinc-finger homeodomain protein 2     98.2    1e-20   
ref|XP_007205692.1|  hypothetical protein PRUPE_ppa009712mg           99.0    1e-20   
ref|XP_002525870.1|  transcription factor, putative                   99.4    1e-20   
gb|AES96050.2|  homeobox domain, ZF-HD class protein                  98.6    2e-20   
ref|XP_010548327.1|  PREDICTED: zinc-finger homeodomain protein 6...  99.0    2e-20   
ref|XP_010471631.1|  PREDICTED: zinc-finger homeodomain protein 5...  99.0    2e-20   
ref|XP_010026173.1|  PREDICTED: zinc-finger homeodomain protein 6...  99.0    2e-20   
ref|XP_006390329.1|  hypothetical protein EUTSA_v10018892mg           99.0    2e-20   
gb|AEN81226.1|  AT1G75240-like protein                                96.7    2e-20   
ref|XP_010679737.1|  PREDICTED: zinc-finger homeodomain protein 6     98.6    2e-20   
ref|XP_010416393.1|  PREDICTED: zinc-finger homeodomain protein 5...  98.6    2e-20   
ref|XP_002887580.1|  hypothetical protein ARALYDRAFT_895391           98.6    2e-20   
gb|ABR16769.1|  unknown                                               96.3    2e-20   
ref|XP_010428533.1|  PREDICTED: zinc-finger homeodomain protein 5     98.6    2e-20   
ref|XP_002514009.1|  transcription factor, putative                   98.2    2e-20   
ref|XP_008782098.1|  PREDICTED: zinc-finger homeodomain protein 4...  95.9    2e-20   
emb|CDY62531.1|  BnaA02g35950D                                        97.8    2e-20   
ref|XP_003613092.1|  Zinc finger-homeodomain protein                  99.0    2e-20   
ref|NP_565106.1|  homeobox protein 33                                 98.6    2e-20   
emb|CDY01760.1|  BnaC06g28000D                                        97.8    2e-20   
ref|XP_010681042.1|  PREDICTED: zinc-finger homeodomain protein 1...  98.2    2e-20   
ref|XP_004489767.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  97.8    3e-20   
ref|XP_009128086.1|  PREDICTED: zinc-finger homeodomain protein 5...  98.2    3e-20   
ref|XP_010927875.1|  PREDICTED: zinc-finger homeodomain protein 4...  97.8    3e-20   
ref|XP_011100018.1|  PREDICTED: zinc-finger homeodomain protein 1...  96.7    3e-20   
ref|NP_001151696.1|  ZF-HD protein dimerisation region containing...  97.1    4e-20   
emb|CDX85886.1|  BnaC06g22480D                                        97.8    4e-20   
emb|CBI18716.3|  unnamed protein product                              95.9    4e-20   
ref|XP_011087615.1|  PREDICTED: zinc-finger homeodomain protein 4     97.4    4e-20   
ref|XP_009127747.1|  PREDICTED: zinc-finger homeodomain protein 1...  97.1    4e-20   
ref|XP_002981262.1|  hypothetical protein SELMODRAFT_38995            92.0    4e-20   
ref|XP_008800713.1|  PREDICTED: zinc-finger homeodomain protein 6...  97.8    5e-20   
ref|XP_008378554.1|  PREDICTED: zinc-finger homeodomain protein 2...  97.1    5e-20   
ref|XP_008338913.1|  PREDICTED: zinc-finger homeodomain protein 2...  97.1    5e-20   
ref|XP_010675490.1|  PREDICTED: zinc-finger homeodomain protein 1...  97.4    5e-20   
ref|XP_002306048.1|  zinc finger family protein                       93.6    6e-20   
ref|XP_004509783.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.9    6e-20   
emb|CDO97666.1|  unnamed protein product                              97.1    6e-20   
ref|XP_002460367.1|  hypothetical protein SORBIDRAFT_02g027040        97.1    6e-20   
emb|CDX95914.1|  BnaA07g28170D                                        95.9    7e-20   
ref|XP_006349273.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  96.7    7e-20   
ref|XP_008338912.1|  PREDICTED: zinc-finger homeodomain protein 2...  96.7    7e-20   
ref|XP_009758154.1|  PREDICTED: zinc-finger homeodomain protein 2...  96.3    7e-20   
ref|XP_002452677.1|  hypothetical protein SORBIDRAFT_04g030480        98.2    8e-20   
ref|XP_009624224.1|  PREDICTED: zinc-finger homeodomain protein 2...  95.5    9e-20   
ref|XP_011010389.1|  PREDICTED: zinc-finger homeodomain protein 2...  95.9    1e-19   
ref|XP_002306552.2|  hypothetical protein POPTR_0005s17620g           95.9    1e-19   
ref|XP_008799036.1|  PREDICTED: zinc-finger homeodomain protein 1...  94.4    1e-19   
ref|XP_010912536.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  95.9    1e-19   
gb|KDO42061.1|  hypothetical protein CISIN_1g048741mg                 96.3    1e-19   
ref|XP_006470838.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  96.3    1e-19   
ref|XP_006431432.1|  hypothetical protein CICLE_v10003702mg           96.3    1e-19   
ref|XP_002518018.1|  conserved hypothetical protein                   95.9    1e-19   
gb|KDP24222.1|  hypothetical protein JCGZ_25879                       95.5    1e-19   
gb|ABY61020.1|  zinc finger-homeodomain protein 1                     95.5    1e-19   
ref|XP_008378952.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  96.3    2e-19   
ref|XP_004230410.1|  PREDICTED: zinc-finger homeodomain protein 4     95.5    2e-19   
gb|ABY61023.1|  zinc finger homeodomain protein 1                     94.7    2e-19   
ref|XP_004288462.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.1    2e-19   
ref|XP_006836924.1|  hypothetical protein AMTR_s00099p00145100        95.1    2e-19   



>ref|XP_009603276.1| PREDICTED: zinc-finger homeodomain protein 6-like [Nicotiana 
tomentosiformis]
Length=311

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 138/214 (64%), Gaps = 41/214 (19%)
 Frame = +3

Query  360  LLPQRFADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCH  539
            L  Q     S   + +RY+ECLKNHAAS GGHV+DGCGEFMP G+EGTPE LKCAAC+CH
Sbjct  88   LRQQSTTSASDKNSSVRYKECLKNHAASMGGHVLDGCGEFMPSGEEGTPEYLKCAACDCH  147

Query  540  RNFHRKGITFQTQN-----------------PPMLPP----QHY--------RGaapppp  632
            RNFHRK    ++Q                  PP LP     QHY        RG  PP  
Sbjct  148  RNFHRKETEDESQTAGVHRNNSNSHRIHAQIPPSLPAPPQQQHYHKYTHGYSRGPMPPVM  207

Query  633  -----pvrapaESSSEDLNA----GGGQGLMQ---VPSSkkrfrtkftqqqkqqMHEFAE  776
                     PAESSSEDLN      GGQG++Q     +SKKRFRTKFTQQQK++M EFAE
Sbjct  208  MNFGGNSGVPAESSSEDLNMFNSNAGGQGVIQPCTFSASKKRFRTKFTQQQKEKMQEFAE  267

Query  777  KIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            K+GWRIQKQD++EV +FC+EVGVKRQVFKV+MHN
Sbjct  268  KLGWRIQKQDEQEVQQFCNEVGVKRQVFKVFMHN  301



>ref|XP_006340630.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Solanum tuberosum]
Length=302

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 131/196 (67%), Gaps = 36/196 (18%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK-------  557
            T +RY+ECLKNHAA+ GG+V DGCGEFMP G+E TPE LKCAAC+CHRNFHRK       
Sbjct  97   TPVRYKECLKNHAANMGGYVRDGCGEFMPSGEEETPEYLKCAACDCHRNFHRKETEDESQ  156

Query  558  --GI-----TFQTQNPPMLPP-----QHY--------RGaapppp-----pvrapaESSS  662
              G+         Q PP LP      QH+        RG   P            AESSS
Sbjct  157  TPGVHRNNHRILNQTPPSLPAVPTQQQHHHKYSHSYPRGHMAPVMMSFGGNTGVAAESSS  216

Query  663  EDLNA-GGGQGLMQ---VPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFC  830
            EDLN   GGQG++Q     +SKKRFRTKF+QQQK +M EFAEK+GWRIQKQD++EVH+FC
Sbjct  217  EDLNMFHGGQGIIQPCNFSASKKRFRTKFSQQQKDRMLEFAEKLGWRIQKQDEQEVHQFC  276

Query  831  SEVGVKRQVFKVWMHN  878
            +EVGVKRQVFKVWMHN
Sbjct  277  NEVGVKRQVFKVWMHN  292



>ref|XP_011099626.1| PREDICTED: zinc-finger homeodomain protein 6 [Sesamum indicum]
Length=353

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 128/203 (63%), Gaps = 45/203 (22%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT-----F  569
            IRYRECLKNHAA+ GGHVVDGCGEFMP G+EGTPESL+CAAC+CHRNFHRK +      +
Sbjct  141  IRYRECLKNHAAAMGGHVVDGCGEFMPSGEEGTPESLRCAACDCHRNFHRKEVDGEQSHY  200

Query  570  QTQNP----------PML--------PPQHYRGaappp----------------ppvrap  647
             T NP          P+L        PP H    +                       A 
Sbjct  201  YTYNPNTGNKNSHRNPILHGQTPSSAPPHHKHSLSYSQGFTTGPTPPTMVNFGGNSGGAA  260

Query  648  aESSSEDLN---AGGG---QGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDD  809
            AESSSEDLN   +G G    G      SKKRFRTKF+Q+QK +MHEFA K+GWRIQKQD+
Sbjct  261  AESSSEDLNMFQSGSGVHATGQTSFSGSKKRFRTKFSQEQKDRMHEFATKLGWRIQKQDE  320

Query  810  EEVHKFCSEVGVKRQVFKVWMHN  878
            +EV +FCSEVGVKRQVFKVWMHN
Sbjct  321  KEVQEFCSEVGVKRQVFKVWMHN  343



>ref|XP_004232414.1| PREDICTED: zinc-finger homeodomain protein 5 [Solanum lycopersicum]
Length=293

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 132/288 (46%), Positives = 161/288 (56%), Gaps = 53/288 (18%)
 Frame = +3

Query  159  MESRSKEKFEGIP--------PSRINLQAQESSSQQTLDSQREKELEHHHMHEGpsnpdp  314
            ME R +EK  G+P        PS++N Q   SS+     +   +    H      +    
Sbjct  1    MEHRGQEKDMGLPNPNPMSYNPSQLNQQESSSSAANKFLTAPNRTTNEH-----ENTIFS  55

Query  315  dppsllnnKATTQQVLLPQRFADTSHTT----TLIRYRECLKNHAASTGGHVVDGCGEFM  482
               +L  +  T      P R   TS  +    T +RY+ECLKNHAA+ GG+V+DGCGEFM
Sbjct  56   PNQTLDQHNITQNSDPDPVRQLSTSSASERNITPVRYKECLKNHAANLGGYVLDGCGEFM  115

Query  483  PGGKEGTPESLKCAACNCHRNFHRK---------GI-----TFQTQNPPMLP--------  596
            P G+E T E LKCAAC+CHRNFHRK         G+         Q PP LP        
Sbjct  116  PSGEEETLEYLKCAACDCHRNFHRKETEDESQTPGVHRNNHRIPNQTPPSLPAVPTQQQH  175

Query  597  ----PQHY-RGaapppp-----pvrapaESSSEDLNA-GGGQGLMQ---VPSSkkrfrtk  734
                P  Y RG   P            AESSSEDLN   GGQG++Q     +SKKRFRTK
Sbjct  176  HHKYPHSYPRGHMAPVMMSFGGNTGVAAESSSEDLNMFHGGQGVIQPCNFSASKKRFRTK  235

Query  735  ftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            F+QQQK +M EFAEK+GWRIQKQD++EVH+FC+EVGVKRQVFKVWMHN
Sbjct  236  FSQQQKDRMLEFAEKLGWRIQKQDEQEVHQFCNEVGVKRQVFKVWMHN  283



>ref|XP_002310240.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE90690.2| zinc finger family protein [Populus trichocarpa]
Length=296

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 121/182 (66%), Gaps = 20/182 (11%)
 Frame = +3

Query  384  TSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI  563
            T  ++   RYRECLKNHAAS GGHV+DGCGEFMPGG+EGT ES KCAAC CHRNFHR+ I
Sbjct  108  TPASSASTRYRECLKNHAASMGGHVLDGCGEFMPGGEEGTLESFKCAACECHRNFHRREI  167

Query  564  -------------TFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAG----GGQG  692
                         T      P+ P      +        A AESSSEDLN       GQ 
Sbjct  168  DGEPQCHHRYHQGTLSAYTTPIAP---MIMSFGRGDGGGAAAESSSEDLNMYQSNLQGQA  224

Query  693  LMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWM  872
             +Q   S+KRFRTKF+Q QK +M EFAEK+GWRIQKQD++EV +FCS+VGVKR+VFKVWM
Sbjct  225  SVQPSMSRKRFRTKFSQDQKDKMTEFAEKLGWRIQKQDEQEVQQFCSQVGVKRKVFKVWM  284

Query  873  HN  878
            HN
Sbjct  285  HN  286



>ref|XP_009804697.1| PREDICTED: zinc-finger homeodomain protein 6 [Nicotiana sylvestris]
Length=311

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 136/214 (64%), Gaps = 41/214 (19%)
 Frame = +3

Query  360  LLPQRFADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCH  539
            L  Q     S   + IRY+ECLKNHAAS GGHV+DGCGEFMP G+EGTPE LKCAAC+CH
Sbjct  88   LRQQSTTSASDRNSSIRYKECLKNHAASMGGHVLDGCGEFMPSGEEGTPEYLKCAACDCH  147

Query  540  RNFHRK---------GIT--------FQTQNPPMLP--PQ----------HYRGaapppp  632
            RNFHRK         G+            Q PP LP  PQ          + RG  PP  
Sbjct  148  RNFHRKETEDELQTAGVYRNNSNSHRVHIQTPPSLPVPPQQQHHHKYSHNYSRGPMPPVM  207

Query  633  -----pvrapaESSSEDLNA----GGGQGLMQ---VPSSkkrfrtkftqqqkqqMHEFAE  776
                     PAESSSEDLN      GGQG++Q      SKKRFRTKFTQQQK++M EFAE
Sbjct  208  MNFGGNTGVPAESSSEDLNMFHSNAGGQGVIQPCAFSVSKKRFRTKFTQQQKEKMQEFAE  267

Query  777  KIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            K+ WRIQKQD++EV +FC+EVGVKRQVFKV+MHN
Sbjct  268  KLEWRIQKQDEQEVQQFCNEVGVKRQVFKVFMHN  301



>ref|XP_007046919.1| Homeobox protein 24, putative [Theobroma cacao]
 gb|EOX91076.1| Homeobox protein 24, putative [Theobroma cacao]
Length=385

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 129/211 (61%), Gaps = 46/211 (22%)
 Frame = +3

Query  384  TSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI  563
            T  +T LIRYREC+KNHAAS G HV+DGCGEFMP G+EGTPE+LKCAAC CHRNFHRK I
Sbjct  151  TISSTPLIRYRECMKNHAASMGSHVMDGCGEFMPSGEEGTPEALKCAACECHRNFHRKEI  210

Query  564  T---------FQTQNP-----------------PMLP-PQHYRGaapppppvrap-----  647
                      + + NP                 P  P P H +  +              
Sbjct  211  NGETQYAPSCYYSYNPNKNNNRRDTTHPPSQLHPQQPIPLHQQRFSLGLSTSPTAMPIAP  270

Query  648  ----------aESSSEDLNA----GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIG  785
                      AESSSEDLN      GGQ   Q  SSKKRFRTKF+Q+QK +M EFAEK+G
Sbjct  271  VMMNFRGGGPAESSSEDLNMFHSNAGGQISAQPQSSKKRFRTKFSQEQKDKMMEFAEKLG  330

Query  786  WRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            WRIQKQD++EV +FC++VGVKRQVFKVWMHN
Sbjct  331  WRIQKQDEQEVQQFCAQVGVKRQVFKVWMHN  361



>ref|XP_004512050.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
Length=284

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 119/182 (65%), Gaps = 24/182 (13%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ-TQN  581
            I YRECLKNHAAS G HVVDGCGEFMP G+EGTPES KCAAC+CHRNFHRK +  Q   N
Sbjct  93   ICYRECLKNHAASMGSHVVDGCGEFMPSGEEGTPESFKCAACDCHRNFHRKHVQQQHVPN  152

Query  582  P-----------------PMLPPQHYRGaapppppvr-apaESSSEDL-----NAGGGQG  692
            P                  +  P +  G   P        AESSSEDL     NAG    
Sbjct  153  PNYHLNFPTPSSSNRFSHVLTTPTNSSGQVQPLMMTFGGAAESSSEDLNMFQCNAGAQFS  212

Query  693  LMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWM  872
            L   P SKKR RTKF+Q+QK +M EFAEK+GW+IQK D++EV +FCS+VG+KRQVFKVWM
Sbjct  213  LQAQPVSKKRMRTKFSQEQKDKMMEFAEKVGWKIQKTDEQEVQQFCSQVGIKRQVFKVWM  272

Query  873  HN  878
            HN
Sbjct  273  HN  274



>gb|KDP38514.1| hypothetical protein JCGZ_04439 [Jatropha curcas]
Length=302

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 125/201 (62%), Gaps = 40/201 (20%)
 Frame = +3

Query  396  TTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT  575
            T+ +RYRECL+NHAAS GG+V DGCGEFMPGG+EGT E+LKCAAC+CHRNFHRK +  ++
Sbjct  78   TSNVRYRECLRNHAASVGGNVFDGCGEFMPGGEEGTLEALKCAACDCHRNFHRKEVDGES  137

Query  576  QNPP---------------------MLPPQHY--------------RGaapppppvrapa  650
            Q  P                     +L  Q Y              +             
Sbjct  138  QFSPSSRRSTMVHSLQLPPPLPSPTVLHHQRYSMGLHNSPTAANMVQPMTVAFGGGGGGT  197

Query  651  ESSSEDLNA--GGGQGLMQVPS---SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEE  815
            ESSSEDLNA     +G+   P    S+KRFRTKFTQ+QK +M EFAEK+GWRI KQD+EE
Sbjct  198  ESSSEDLNAFQSNAEGVPPPPPYVLSRKRFRTKFTQEQKDRMMEFAEKVGWRINKQDEEE  257

Query  816  VHKFCSEVGVKRQVFKVWMHN  878
            V KFC+EVGVKRQVFKVWMHN
Sbjct  258  VEKFCAEVGVKRQVFKVWMHN  278



>ref|XP_008392268.1| PREDICTED: zinc-finger homeodomain protein 6-like [Malus domestica]
Length=311

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 121/203 (60%), Gaps = 39/203 (19%)
 Frame = +3

Query  387  SHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT  566
            S   + +RYRECLKNHAAS+GGHV+DGCGEFMPGG E TP SLKCAAC CHRNFHRK I 
Sbjct  99   STAASRVRYRECLKNHAASSGGHVLDGCGEFMPGGDEDTPGSLKCAACECHRNFHRKEID  158

Query  567  ---------------------------FQTQNPPMLPPQH--YRGaapppppv-----ra  644
                                            PP LP  H   RG +P            
Sbjct  159  GDHVSNNYYVINQQHNSRRDSAITRLPVLISTPPSLPVHHSAARGPSPAMMMTFGSSGGV  218

Query  645  paESSSEDLNA-----GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDD  809
             AESSSEDLN      GG         SKKRFRTKF+Q+QK++M E AEK+GWRIQK D+
Sbjct  219  AAESSSEDLNMNNNLFGGANYAADAQGSKKRFRTKFSQEQKEKMTEVAEKLGWRIQKHDE  278

Query  810  EEVHKFCSEVGVKRQVFKVWMHN  878
            +EV K CSEVG+KRQVFKVWMHN
Sbjct  279  QEVEKLCSEVGIKRQVFKVWMHN  301



>ref|XP_006599376.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform X2 [Glycine 
max]
 ref|XP_003548885.2| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform X1 [Glycine 
max]
Length=329

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 130/203 (64%), Gaps = 41/203 (20%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK----G  560
            TTTL RYRECLKNHAAS GGHV DGCGEFMP G+EGTPES KCAAC CHRNFHRK    G
Sbjct  105  TTTLFRYRECLKNHAASMGGHVTDGCGEFMPNGEEGTPESFKCAACECHRNFHRKEPHQG  164

Query  561  ITFQTQNPPMLPPQHYRGaapppppvrap----------------------aESSSEDLN  674
            +  ++Q    +  ++ R       P                          AESSSEDLN
Sbjct  165  VVLESQLLQHVLNKNSRNINILHSPHSHHVLHGVVGGPVQPVMLGFGGSGPAESSSEDLN  224

Query  675  A-------GGGQGL---MQVP-----SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDD  809
                    GGG  L   +Q P     SSKKRFRTKFTQQQK +M EFAEK+GW+IQKQD+
Sbjct  225  MFQTLDHRGGGNLLSSSVQQPPLSSSSSKKRFRTKFTQQQKDRMMEFAEKLGWKIQKQDE  284

Query  810  EEVHKFCSEVGVKRQVFKVWMHN  878
            +E+H+FCS+VGV+RQVFKVWMHN
Sbjct  285  QELHQFCSQVGVRRQVFKVWMHN  307



>gb|KHN11103.1| ZF-HD homeobox protein [Glycine soja]
Length=317

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 130/203 (64%), Gaps = 41/203 (20%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK----G  560
            TTTL RYRECLKNHAAS GGHV DGCGEFMP G+EGTPES KCAAC CHRNFHRK    G
Sbjct  105  TTTLFRYRECLKNHAASMGGHVTDGCGEFMPNGEEGTPESFKCAACECHRNFHRKEPHQG  164

Query  561  ITFQTQNPPMLPPQHYRGaapppppvrap----------------------aESSSEDLN  674
            +  ++Q    +  ++ R       P                          AESSSEDLN
Sbjct  165  VVLESQLLQHVLNKNSRNINILHSPHSHHVLHGVVGGPVQPVMLGFGGSGPAESSSEDLN  224

Query  675  A-------GGGQGL---MQVP-----SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDD  809
                    GGG  L   +Q P     SSKKRFRTKFTQQQK +M EFAEK+GW+IQKQD+
Sbjct  225  MFQTLDHRGGGNLLSSSVQQPPLSSSSSKKRFRTKFTQQQKDRMMEFAEKLGWKIQKQDE  284

Query  810  EEVHKFCSEVGVKRQVFKVWMHN  878
            +E+H+FCS+VGV+RQVFKVWMHN
Sbjct  285  QELHQFCSQVGVRRQVFKVWMHN  307



>ref|XP_010254805.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254806.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254807.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
Length=363

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 121/211 (57%), Gaps = 53/211 (25%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQ--  578
            +RYRECLKNHAAS GGHVVDGCGEFMP G+EGTPE+LKCAAC+CHRNFHRK +  ++Q  
Sbjct  143  VRYRECLKNHAASIGGHVVDGCGEFMPSGEEGTPEALKCAACDCHRNFHRKEMEGESQSG  202

Query  579  --------------------------------------------NPPMLPPQHYRGaapp  626
                                                        +P  +PP         
Sbjct  203  ANCYYYHNKNYDGSRSRIPPPQPQLPPPPLQQHQKFQLGLPTSPSPGSIPPMMMMAFGGG  262

Query  627  pppvrapaESSSEDLNA-------GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIG  785
                    ESSSEDLNA       G  Q    +  SKKRFRTKFTQ+QK +M EFAEKIG
Sbjct  263  GGIGGGATESSSEDLNAYQSSAPGGATQPPQPLSLSKKRFRTKFTQEQKDRMLEFAEKIG  322

Query  786  WRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            W+IQKQD+ EV +FC+EVGVKRQV KVWMHN
Sbjct  323  WKIQKQDEPEVQQFCAEVGVKRQVLKVWMHN  353



>ref|XP_009371603.1| PREDICTED: zinc-finger homeodomain protein 6-like [Pyrus x bretschneideri]
Length=311

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 119/197 (60%), Gaps = 39/197 (20%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ----  572
            +RYRECLKNHAAS+GGHV+DGCGEFMPGG E TP SLKCAAC CHRNFHRK I  +    
Sbjct  105  VRYRECLKNHAASSGGHVLDGCGEFMPGGDEDTPGSLKCAACECHRNFHRKEIDGEHVSN  164

Query  573  -----------------------TQNPPMLPPQH--YRGaapppppv-----rapaESSS  662
                                      PP LP  H   RG +P             AESSS
Sbjct  165  NYYVINQQHNSRRDSAITRLPVLISTPPSLPVHHSAARGPSPAMMMTFGSSGGVAAESSS  224

Query  663  EDLNAG-----GGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKF  827
            EDLN       G         SKKRFRTKF+Q+QK++M E AEK+GWRI KQD++EV K 
Sbjct  225  EDLNMNNNLFRGANYAADAQGSKKRFRTKFSQEQKEKMTEVAEKLGWRIHKQDEQEVEKL  284

Query  828  CSEVGVKRQVFKVWMHN  878
            CSEVG+KRQVFKVWMHN
Sbjct  285  CSEVGIKRQVFKVWMHN  301



>ref|XP_011025804.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
 ref|XP_011025805.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
Length=330

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 122/206 (59%), Gaps = 49/206 (24%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQ---  578
            RYRECLKNHAAS GGHV+DGCGEFMPGG+EGT ES KCAAC CHRNFHR+ I  + Q   
Sbjct  115  RYRECLKNHAASLGGHVLDGCGEFMPGGEEGTLESFKCAACECHRNFHRREIDGEPQCVA  174

Query  579  ----------NPPMLPPQH------------------YRGaappppp-------------  635
                         +LPPQH                  + G                    
Sbjct  175  NSTLYKISNGQRNILPPQHLVTSCAPRQLFLHQHHRYHYGTLSAYTTPIAPMTMSFGRGD  234

Query  636  -vrapaESSSEDLNAG----GGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQK  800
               A AESSSEDLN       GQ  MQ   S+KRFRTKF+Q QK +M EFAEK+GWRIQK
Sbjct  235  GGGAAAESSSEDLNMYQSDLQGQASMQPSMSRKRFRTKFSQDQKDKMTEFAEKLGWRIQK  294

Query  801  QDDEEVHKFCSEVGVKRQVFKVWMHN  878
            QD+ EV +FCS+VGVKR+VFKVWMHN
Sbjct  295  QDEREVQQFCSQVGVKRKVFKVWMHN  320



>ref|XP_006380765.1| hypothetical protein POPTR_0007s12970g [Populus trichocarpa]
 gb|ERP58562.1| hypothetical protein POPTR_0007s12970g [Populus trichocarpa]
Length=331

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 127/214 (59%), Gaps = 49/214 (23%)
 Frame = +3

Query  384  TSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI  563
            T  ++   RYRECLKNHAAS GGHV+DGCGEFMPGG+EGT ES KCAAC CHRNFHR+ I
Sbjct  108  TPASSASTRYRECLKNHAASMGGHVLDGCGEFMPGGEEGTLESFKCAACECHRNFHRREI  167

Query  564  TFQTQ-------------NPPMLPPQH------------------YRGaapppppvra--  644
              + Q                +LPPQH                  ++G         A  
Sbjct  168  DGEPQCVANSTLYKISNGQRNILPPQHLVTSCAPRQPFPHQHHRYHQGTLSAYTTPIAPM  227

Query  645  ------------paESSSEDLNAG----GGQGLMQVPSSkkrfrtkftqqqkqqMHEFAE  776
                         AESSSEDLN       GQ  +Q   S+KRFRTKF+Q QK +M EFAE
Sbjct  228  IMSFGRGDGGGAAAESSSEDLNMYQSNLQGQASVQPSMSRKRFRTKFSQDQKDKMTEFAE  287

Query  777  KIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            K+GWRIQKQD++EV +FCS+VGVKR+VFKVWMHN
Sbjct  288  KLGWRIQKQDEQEVQQFCSQVGVKRKVFKVWMHN  321



>ref|XP_007156052.1| hypothetical protein PHAVU_003G254200g [Phaseolus vulgaris]
 gb|ESW28046.1| hypothetical protein PHAVU_003G254200g [Phaseolus vulgaris]
Length=321

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 121/202 (60%), Gaps = 41/202 (20%)
 Frame = +3

Query  396  TTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKG-----  560
            T  +RYRECLKNHAA  GGHV DGCGEFMP G+EGTPES KCAAC CHRNFHRK      
Sbjct  110  TATVRYRECLKNHAAIMGGHVTDGCGEFMPSGEEGTPESFKCAACECHRNFHRKEPEGES  169

Query  561  -------------------ITFQTQNPPMLPPQHYRGaapppppvrap----------aE  653
                               +    Q+   LP  H  G    P                 E
Sbjct  170  SQHVLNYHLTYPNKTNRNIVIHSPQSHLQLPTHHLHGVVATPSGGSVQPAVLGFGGTPTE  229

Query  654  SSSEDLNA----GGGQGLMQVP---SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDE  812
            SSSEDLN       GQ L   P   SSKKRFRTKF+QQQK QM EFA+K+GW+IQKQD++
Sbjct  230  SSSEDLNMFQTDEAGQLLSVQPPLSSSKKRFRTKFSQQQKDQMMEFADKLGWKIQKQDEQ  289

Query  813  EVHKFCSEVGVKRQVFKVWMHN  878
            E+H+FCS+VGVKRQ+FKVWMHN
Sbjct  290  ELHQFCSQVGVKRQIFKVWMHN  311



>gb|AES94983.2| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=297

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 121/195 (62%), Gaps = 33/195 (17%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ  572
            T T I YRECL+NHAAS G HVVDGCGEFMP G+EGTP+  KCAAC+CHRNFHRK +  Q
Sbjct  93   TATKICYRECLRNHAASMGSHVVDGCGEFMPSGEEGTPQYFKCAACDCHRNFHRKHVQQQ  152

Query  573  TQNPPM----LPPQHYRGa--------------------------apppppvrapaESSS  662
               P      +P  H+                             +        PAESSS
Sbjct  153  HSIPQQHVQHVPNYHHSNNNGHLNLPTPSSSSQRVSQPSSGQVPPSMMMTFGSVPAESSS  212

Query  663  EDLNAGGGQGLMQVPS---SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCS  833
            EDLN  G Q  +Q P    SKKR RTKF+QQQK +M EFAEKIGW+IQK D++EV +FCS
Sbjct  213  EDLNMFGAQFSIQTPQQPLSKKRVRTKFSQQQKDKMMEFAEKIGWKIQKHDEQEVQQFCS  272

Query  834  EVGVKRQVFKVWMHN  878
            +VG+KRQVFKV+MHN
Sbjct  273  QVGIKRQVFKVFMHN  287



>ref|XP_003612025.1| Zinc finger-homeodomain protein [Medicago truncatula]
Length=293

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 121/195 (62%), Gaps = 33/195 (17%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ  572
            T T I YRECL+NHAAS G HVVDGCGEFMP G+EGTP+  KCAAC+CHRNFHRK +  Q
Sbjct  89   TATKICYRECLRNHAASMGSHVVDGCGEFMPSGEEGTPQYFKCAACDCHRNFHRKHVQQQ  148

Query  573  TQNPPM----LPPQHYRGa--------------------------apppppvrapaESSS  662
               P      +P  H+                             +        PAESSS
Sbjct  149  HSIPQQHVQHVPNYHHSNNNGHLNLPTPSSSSQRVSQPSSGQVPPSMMMTFGSVPAESSS  208

Query  663  EDLNAGGGQGLMQVPS---SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCS  833
            EDLN  G Q  +Q P    SKKR RTKF+QQQK +M EFAEKIGW+IQK D++EV +FCS
Sbjct  209  EDLNMFGAQFSIQTPQQPLSKKRVRTKFSQQQKDKMMEFAEKIGWKIQKHDEQEVQQFCS  268

Query  834  EVGVKRQVFKVWMHN  878
            +VG+KRQVFKV+MHN
Sbjct  269  QVGIKRQVFKVFMHN  283



>ref|XP_002886165.1| ATHB24 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62424.1| ATHB24 [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 117/172 (68%), Gaps = 16/172 (9%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI--------  563
            RYREC KNHAAS+GGHVVDGCGEFMP G+EGT ESL+CAAC+CHR+FHRK I        
Sbjct  81   RYRECQKNHAASSGGHVVDGCGEFMPSGEEGTAESLRCAACDCHRSFHRKEIDGLFVVNF  140

Query  564  -TFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLN------AGGGQGLMQVPSSkkr  722
             +F     P++  +H              AESS+EDLN      +G G         KKR
Sbjct  141  NSFGHSQRPLV-SRHVSPIMMSFGGGGGAAESSTEDLNKFHQSFSGNGVDQFHQYQPKKR  199

Query  723  frtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            FRTKF ++QK++M EFAEKIGWR+ KQ+D+EV++FC E+ VKRQVFKVWMHN
Sbjct  200  FRTKFNEEQKEKMMEFAEKIGWRMTKQEDDEVNRFCREINVKRQVFKVWMHN  251



>ref|XP_002510399.1| transcription factor, putative [Ricinus communis]
 gb|EEF52586.1| transcription factor, putative [Ricinus communis]
Length=289

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 123/215 (57%), Gaps = 44/215 (20%)
 Frame = +3

Query  366  PQRFADTSH----TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACN  533
            P RF   S      TT +RYRECL+NHAAS GG+V DGCGEFMPGG+EG+ E+LKCAAC 
Sbjct  55   PDRFPIISKGSNSKTTHVRYRECLRNHAASVGGNVFDGCGEFMPGGEEGSLEALKCAACE  114

Query  534  CHRNFHRKGITFQTQ------NPPML-----------------------------PPQHY  608
            CHRNFHRK +  +TQ        PM+                             P    
Sbjct  115  CHRNFHRKEVDGETQFSPSSRRSPMVHSLQLPPPLPSPTVLHHQQRYSVGLHSTSPTTPN  174

Query  609  RGaapppppvrapaESSSEDLNA--GGGQGLMQVPS---SkkrfrtkftqqqkqqMHEFA  773
                          ESSSEDLNA      G+   P    SKKRFRTKFT  QK +M EFA
Sbjct  175  MVQPMTVAFGGGGTESSSEDLNAFHSNADGVPPPPPYVLSKKRFRTKFTHDQKDKMMEFA  234

Query  774  EKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            EK+GWRI KQD+EEV KFC+E+GV+RQVFKVWMHN
Sbjct  235  EKVGWRINKQDEEEVDKFCAEIGVRRQVFKVWMHN  269



>gb|KHN00536.1| ZF-HD homeobox protein [Glycine soja]
Length=333

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 130/212 (61%), Gaps = 53/212 (25%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK----GITF  569
            L RYRECLKNHAAS GGHV DGCGEFMP G+EGTPESLKCAAC CHRNFHRK    G+  
Sbjct  112  LFRYRECLKNHAASMGGHVTDGCGEFMPNGEEGTPESLKCAACECHRNFHRKEPHQGVLV  171

Query  570  QTQNPPML-------------------------PPQHYRGaapppppvra------paES  656
            ++Q   +L                         P  H  G  P   PV        PAES
Sbjct  172  ESQLQHVLLNKNNRNINTIIHSPDSHHHLQFPTPHSHLHGGPPVVQPVMLGFGGSGPAES  231

Query  657  SSEDLN-------AGGGQGLM-----------QVPSSkkrfrtkftqqqkqqMHEFAEKI  782
            SSEDLN        GGG  L+              SSKKRFRTKFTQQQK +M EFAEK+
Sbjct  232  SSEDLNMFQTNDHGGGGNNLLLSSVQQQPPLLSSSSSKKRFRTKFTQQQKDRMMEFAEKL  291

Query  783  GWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            GW+IQKQD++E+H+FCS+VGV+RQVFKVWMHN
Sbjct  292  GWKIQKQDEQELHQFCSQVGVRRQVFKVWMHN  323



>ref|XP_003520309.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=334

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 130/212 (61%), Gaps = 53/212 (25%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK----GITF  569
            L RYRECLKNHAAS GGHV DGCGEFMP G+EGTPESLKCAAC CHRNFHRK    G+  
Sbjct  113  LFRYRECLKNHAASMGGHVTDGCGEFMPNGEEGTPESLKCAACECHRNFHRKEPHQGVLV  172

Query  570  QTQNPPML-------------------------PPQHYRGaapppppvra------paES  656
            ++Q   +L                         P  H  G  P   PV        PAES
Sbjct  173  ESQLQHVLLNKNNRNINTIIHSPDSHHHLQFPTPHSHLHGGPPVVQPVMLGFGGSGPAES  232

Query  657  SSEDLN-------AGGGQGLM-----------QVPSSkkrfrtkftqqqkqqMHEFAEKI  782
            SSEDLN        GGG  L+              SSKKRFRTKFTQQQK +M EFAEK+
Sbjct  233  SSEDLNMFQTNDHGGGGNNLLLSSVQQQPPLLSSSSSKKRFRTKFTQQQKDRMMEFAEKL  292

Query  783  GWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            GW+IQKQD++E+H+FCS+VGV+RQVFKVWMHN
Sbjct  293  GWKIQKQDEQELHQFCSQVGVRRQVFKVWMHN  324



>ref|XP_010102085.1| hypothetical protein L484_009028 [Morus notabilis]
 gb|EXB91935.1| hypothetical protein L484_009028 [Morus notabilis]
Length=361

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 124/215 (58%), Gaps = 50/215 (23%)
 Frame = +3

Query  384  TSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI  563
            T  T++ ++YRECLKNHAAS GG+V DGCGEFMP G+EG+ E+LKCAAC CHRNFHRK I
Sbjct  98   TKTTSSAVKYRECLKNHAASVGGNVFDGCGEFMPNGQEGSLEALKCAACQCHRNFHRKEI  157

Query  564  TFQTQ------------------------NPPMLPPQHYRGaapppp-------------  632
              +TQ                         PP+  P  +       P             
Sbjct  158  DGETQLYSPGSRRSSTTTTTALMLNPLQLTPPLPSPSLHHHHPNHHPHHHHHLHKYPIVQ  217

Query  633  --------pvrapaESSSEDLNAGGGQGLMQVPS-----SkkrfrtkftqqqkqqMHEFA  773
                       A  ESSSEDLN  G      VP      SKKRFRTKFTQ+QK++M EFA
Sbjct  218  PMNVAFGGVAAAGTESSSEDLNVYGQSTAEGVPPPPFALSKKRFRTKFTQEQKERMLEFA  277

Query  774  EKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            EK+GWRIQKQD+ EV +FC+EVGVKRQV KVWMHN
Sbjct  278  EKVGWRIQKQDEVEVERFCAEVGVKRQVLKVWMHN  312



>ref|XP_007017558.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
 ref|XP_007017559.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
 gb|EOY14783.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
 gb|EOY14784.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
Length=296

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 125/217 (58%), Gaps = 47/217 (22%)
 Frame = +3

Query  357  VLLPQRFADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNC  536
             + P   +  +  +++IRYRECLKNHAAS GG+V DGCGEFMP G+EGT E+LKCAAC+C
Sbjct  74   AVAPISVSSNTKPSSVIRYRECLKNHAASIGGNVYDGCGEFMPSGEEGTLEALKCAACDC  133

Query  537  HRNFHRKGITFQTQNPP---------------------------------------MLPP  599
            HRNFHRK +  +TQ  P                                       M+ P
Sbjct  134  HRNFHRKEVDGETQFGPNSSRRSLMLNPLQLPPPLPSPTMLHHHQRYSVHTSPSSAMVAP  193

Query  600  QHYRGaapppppvrapaESSSEDL----NAGGGQGLMQVPSSkkrfrtkftqqqkqqMHE  767
             +               ESSSEDL    NA G         SKKRFRTKFTQ+QK +M E
Sbjct  194  MNV----AFGSGGGCGTESSSEDLMFQSNAEGMPPPPPYVLSKKRFRTKFTQEQKDKMLE  249

Query  768  FAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            FAEK+GWRI KQD+EEV KFC+EVGVKRQVFKVWMHN
Sbjct  250  FAEKLGWRINKQDEEEVEKFCAEVGVKRQVFKVWMHN  286



>ref|XP_004152776.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
Length=276

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 114/202 (56%), Gaps = 46/202 (23%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
            +RYRECLKNHAAS GG++ DGCGEFMP G++GT E+LKCAAC CHRNFHRK I  +TQ  
Sbjct  48   VRYRECLKNHAASVGGNIYDGCGEFMPSGEDGTLEALKCAACECHRNFHRKEIDGETQ--  105

Query  585  PMLPPQHYRGa----------------------------------------apppppvra  644
              + P + RG                                                  
Sbjct  106  LNISPNYRRGLMLNHLQLPPPLPSPSALHGHHKFSMALNLHSSPTAPIIAPMNVAFAGGG  165

Query  645  paESSSEDLNAGGGQGLMQVPSSkkrfr----tkftqqqkqqMHEFAEKIGWRIQKQDDE  812
              ESSSEDLN       +  PSS    +    TKFTQ+QK +M EFAEK+GWRIQKQD+E
Sbjct  166  GNESSSEDLNVFHSNAEVMPPSSFSLSKKRFRTKFTQEQKDRMLEFAEKVGWRIQKQDEE  225

Query  813  EVHKFCSEVGVKRQVFKVWMHN  878
            EV +FC+EVGVKRQV KVWMHN
Sbjct  226  EVERFCTEVGVKRQVLKVWMHN  247



>ref|XP_010539898.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539899.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010539900.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X1 [Tarenaya 
hassleriana]
Length=271

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 124/198 (63%), Gaps = 40/198 (20%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---------  557
            +RYRECLKNHAAS GG V DGCGEFMPGG+EGT E+LKCAAC+CHRNFHRK         
Sbjct  63   VRYRECLKNHAASVGGSVQDGCGEFMPGGEEGTIEALKCAACDCHRNFHRKEVDGGGGNR  122

Query  558  --GITFQTQNPPML------------PPQ--HYRGaapppppvrap----aESSSEDLNA  677
              G +   + PP +            PP   H+R      P   A     AESSSEDLN 
Sbjct  123  PYGSSAALRPPPAVGMSMMMSPLMVSPPASFHHRKYGMVTPMSVAYGGGGAESSSEDLNL  182

Query  678  --------GGGQGLMQVPS---SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
                    G   G    P    +KKRFRTKFT +QK++M EFAEK+GWR+ KQD+EE+ +
Sbjct  183  YGQSSGEYGAAVGTQTQPPFSMTKKRFRTKFTSEQKERMMEFAEKLGWRMNKQDEEELER  242

Query  825  FCSEVGVKRQVFKVWMHN  878
            FC+E+GVKRQVFKVWMHN
Sbjct  243  FCAEIGVKRQVFKVWMHN  260



>gb|EPS61290.1| hypothetical protein M569_13509, partial [Genlisea aurea]
Length=208

 Score =   154 bits (389),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 116/175 (66%), Gaps = 14/175 (8%)
 Frame = +3

Query  396  TTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT  575
            T  I Y+ECLKNHAA  GG+V DGCGEFMP G++GT E+LKCAAC+CHRNFHRK    + 
Sbjct  5    TGRIVYKECLKNHAAKIGGNVTDGCGEFMPSGEDGTIEALKCAACSCHRNFHRKEHHGEA  64

Query  576  QNPPMLPPQHYRGa-----------apppppvrapaESSSEDLNAG---GGQGLMQVPSS  713
                M+ P  +R                     A  +SSSE+LN      G G+ +  S+
Sbjct  65   AGTAMVHPLQHRVVGGHWTSAMVQPVKMAFGGNAGTDSSSEELNFNPYHSGGGIPRPSST  124

Query  714  kkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            KKRFRTKFT  QK++M EFAEK+GWRI ++DD E+ +FC+EVGVKRQVFKVWMHN
Sbjct  125  KKRFRTKFTADQKERMLEFAEKLGWRIPREDDSEIQRFCAEVGVKRQVFKVWMHN  179



>ref|XP_008444722.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
Length=314

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 114/202 (56%), Gaps = 46/202 (23%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
            +RYRECLKNHAAS GG++ DGCGEFMP G++GT E+LKCAAC CHRNFHRK I  +TQ  
Sbjct  85   VRYRECLKNHAASVGGNIYDGCGEFMPSGEDGTLEALKCAACECHRNFHRKEIDGETQ--  142

Query  585  PMLPPQHYRGa----------------------------------------apppppvra  644
              + P + RG                                                  
Sbjct  143  LNISPNYRRGLMLNHLQLPPPLPSPSALHGHHKFSMALNLHSSPTAPIIAPMNVAFAGGG  202

Query  645  paESSSEDLNAGGGQGLMQVPSSkkrfr----tkftqqqkqqMHEFAEKIGWRIQKQDDE  812
              ESSSEDLN       +  PSS    +    TKFTQ+QK +M EFAEK+GWRIQKQD+E
Sbjct  203  GNESSSEDLNVFHSNAEVMPPSSFSLSKKRFRTKFTQEQKDRMLEFAEKVGWRIQKQDEE  262

Query  813  EVHKFCSEVGVKRQVFKVWMHN  878
            EV +FC+EVGVKRQV KVWMHN
Sbjct  263  EVERFCTEVGVKRQVLKVWMHN  284



>ref|XP_004165400.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN62606.1| hypothetical protein Csa_2G361700 [Cucumis sativus]
Length=320

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 114/202 (56%), Gaps = 46/202 (23%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
            +RYRECLKNHAAS GG++ DGCGEFMP G++GT E+LKCAAC CHRNFHRK I  +TQ  
Sbjct  92   VRYRECLKNHAASVGGNIYDGCGEFMPSGEDGTLEALKCAACECHRNFHRKEIDGETQ--  149

Query  585  PMLPPQHYRGa----------------------------------------apppppvra  644
              + P + RG                                                  
Sbjct  150  LNISPNYRRGLMLNHLQLPPPLPSPSALHGHHKFSMALNLHSSPTAPIIAPMNVAFAGGG  209

Query  645  paESSSEDLNAGGGQGLMQVPSSkkrfr----tkftqqqkqqMHEFAEKIGWRIQKQDDE  812
              ESSSEDLN       +  PSS    +    TKFTQ+QK +M EFAEK+GWRIQKQD+E
Sbjct  210  GNESSSEDLNVFHSNAEVMPPSSFSLSKKRFRTKFTQEQKDRMLEFAEKVGWRIQKQDEE  269

Query  813  EVHKFCSEVGVKRQVFKVWMHN  878
            EV +FC+EVGVKRQV KVWMHN
Sbjct  270  EVERFCTEVGVKRQVLKVWMHN  291



>ref|XP_006383190.1| hypothetical protein POPTR_0005s12420g [Populus trichocarpa]
 gb|ERP60987.1| hypothetical protein POPTR_0005s12420g [Populus trichocarpa]
Length=339

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 122/206 (59%), Gaps = 48/206 (23%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFH-----------  551
            IRYRECLKNHAAS GGHV+DGCGEFMPGG+EGTPE+ KCAAC CHR+FH           
Sbjct  124  IRYRECLKNHAASMGGHVLDGCGEFMPGGEEGTPETFKCAACECHRSFHRREIDGAPQCV  183

Query  552  ------------RKGITFQTQ-----NPP----MLPPQHYRGaapppppvr---------  641
                        R  + F  Q      PP    + P Q Y                    
Sbjct  184  ANSTCYKNSNGKRNILPFPQQLVTSHAPPQSASLHPHQRYHHGTLSTYTTPIAPMMMSFG  243

Query  642  ---apaESSSEDLNAGG----GQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQK  800
               A AESSSEDLN       GQ   Q   SKKRFRT+F+++QK +M EFAEK+GWRIQK
Sbjct  244  GGGAAAESSSEDLNMYQSDLQGQSSAQPLISKKRFRTRFSEEQKDKMMEFAEKLGWRIQK  303

Query  801  QDDEEVHKFCSEVGVKRQVFKVWMHN  878
            QD++EV +FCS+VGVKR+VFKVWMHN
Sbjct  304  QDEQEVQQFCSQVGVKRKVFKVWMHN  329



>emb|CDX90679.1| BnaA03g41020D [Brassica napus]
Length=243

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 109/174 (63%), Gaps = 17/174 (10%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT--FQTQN  581
            +Y EC KNHAA TGGHVVDGC EFMPGG+EGT  +LKCAACNCHR+FHRK +     +  
Sbjct  54   KYEECQKNHAALTGGHVVDGCCEFMPGGEEGTSGALKCAACNCHRSFHRKEVYGHRNSTQ  113

Query  582  PPMLPPQHYRGaapppppv----------rapaESSSEDLNA-----GGGQGLMQVPSSk  716
              ++ P  YR +                      SSSED+         G+GLM +   K
Sbjct  114  EELISPTFYRSSNSYKAIQPRGVYPTGEIGRRTSSSSEDMKKILNQNSDGKGLMMITRKK  173

Query  717  krfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            KR RTK  + QK++M EFAE++GW IQK+D+EE+ KFC  V ++RQVFKVWMHN
Sbjct  174  KRVRTKINEGQKKKMKEFAERLGWSIQKKDEEEIDKFCRTVNLRRQVFKVWMHN  227



>ref|XP_006291743.1| hypothetical protein CARUB_v10017911mg [Capsella rubella]
 gb|EOA24641.1| hypothetical protein CARUB_v10017911mg [Capsella rubella]
Length=248

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 111/177 (63%), Gaps = 20/177 (11%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            +YREC KNHAA TGGHVVDGC EF+ GG+EGT  +LKCAACNCHR+FHRK +    Q+  
Sbjct  59   KYRECQKNHAALTGGHVVDGCCEFLAGGEEGTLGALKCAACNCHRSFHRKEVYGHKQDQM  118

Query  588  MLPPQHYRGaapppppvr-----------apaESSSEDL---------NAGGGQGLMQVP  707
            M+ P  Y         ++               SSSED+         N   G G+M   
Sbjct  119  MITPAFYSSNNSSYKAMQPRGVYPAGEIGRRTSSSSEDMKKILSHRNHNNVDGNGMMMTR  178

Query  708  SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              KKR RTK  ++QK++M EFAE++GWR+QK+D+EE+ KFC  V ++RQVFKVWMHN
Sbjct  179  KKKKRVRTKINEEQKEKMKEFAERLGWRMQKKDEEEIDKFCKVVNLRRQVFKVWMHN  235



>ref|XP_008440716.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
 ref|XP_008440717.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
 ref|XP_008440718.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
 ref|XP_008440719.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
 ref|XP_008440720.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
Length=336

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 124/206 (60%), Gaps = 39/206 (19%)
 Frame = +3

Query  378  ADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK  557
             D +  +++IRYRECLKNHAASTGGHV+DGCGEFMP G++GT E++KCAAC CHRNFHRK
Sbjct  121  TDNTIRSSVIRYRECLKNHAASTGGHVLDGCGEFMPNGEDGTTEAMKCAACECHRNFHRK  180

Query  558  GIT-----------------------FQTQNPPMLPPQHYRGaapppppvrapa------  650
             +                         +T   P++P   +      P      A      
Sbjct  181  EMKDDPPLQQALPTGFFVSNSIRNNGHRTDRTPVVPVSRHHQLPAVPISSMMMAFGGSNG  240

Query  651  ---ESSSEDLNA-----GGGQGLM--QVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQK  800
               ESSSEDLN       G + L   Q    KKRFRTKFTQ QK +M EFAEK+GW+IQK
Sbjct  241  APDESSSEDLNMYHPSNNGARDLFGQQTQLIKKRFRTKFTQGQKDKMEEFAEKLGWKIQK  300

Query  801  QDDEEVHKFCSEVGVKRQVFKVWMHN  878
             D+ EV +FC+EVGV+RQVFKVWMHN
Sbjct  301  HDELEVQQFCAEVGVRRQVFKVWMHN  326



>emb|CDY70550.1| BnaAnng34110D [Brassica napus]
Length=257

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 124/182 (68%), Gaps = 12/182 (7%)
 Frame = +3

Query  366  PQRFA--DTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCH  539
            P+ +A   T+  T  + YREC +NHAAS+GGHVVDGCGEFM  G+EGT ESL CAAC+CH
Sbjct  67   PRSYARPQTTSPTRRVSYRECQRNHAASSGGHVVDGCGEFMSSGEEGTAESLLCAACDCH  126

Query  540  RNFHRKGI-TFQTQNPPMLPPQHYRGaapp---pppvrapaESSSEDLN----AGGGQGL  695
            R+FHRK   +F     P++  +H              R PAESS+EDLN    A  G G+
Sbjct  127  RSFHRKEFNSFGHSQRPLI-NRHVSPIMMSFGGGGGGRDPAESSTEDLNRFHQALSGNGV  185

Query  696  MQVPS-SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWM  872
             Q     KKRFRTKF Q+QK++M EFAEKIGWR+ K +DEEV++FC E+ VKRQVFKVWM
Sbjct  186  DQFQYHPKKRFRTKFNQEQKERMFEFAEKIGWRMNKTEDEEVNRFCREINVKRQVFKVWM  245

Query  873  HN  878
            HN
Sbjct  246  HN  247



>ref|XP_004143516.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform 1 [Cucumis 
sativus]
 ref|XP_004143517.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform 2 [Cucumis 
sativus]
 ref|XP_004162318.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162319.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform 2 [Cucumis 
sativus]
 gb|KGN48833.1| hypothetical protein Csa_6G502710 [Cucumis sativus]
Length=337

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 125/206 (61%), Gaps = 39/206 (19%)
 Frame = +3

Query  378  ADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK  557
             D +  +++IRYRECLKNHAASTGGHV+DGCGEFMP G+ GT E++KCAAC CHRNFHRK
Sbjct  122  TDNNIPSSVIRYRECLKNHAASTGGHVLDGCGEFMPNGENGTFEAMKCAACECHRNFHRK  181

Query  558  GIT----FQ-------------------TQNPPMLPPQHYRGaapppppvrapa------  650
             +     FQ                   T+  P++P   +      P      A      
Sbjct  182  EMKDDPPFQQALPSGFFISNSIRNNGHRTERTPVVPVSRHHQLPAVPISSMMMAFGGSNG  241

Query  651  ---ESSSEDLNA-----GGGQGLM--QVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQK  800
               ESSSEDLN       G + L   Q    KKRFRTKFTQ QK +M EFAEK+GW+IQK
Sbjct  242  APDESSSEDLNMYHPSNNGARDLFGQQTQLIKKRFRTKFTQGQKDKMEEFAEKLGWKIQK  301

Query  801  QDDEEVHKFCSEVGVKRQVFKVWMHN  878
             D+ EV +FC+EVGV+RQVFKVWMHN
Sbjct  302  HDELEVQQFCAEVGVRRQVFKVWMHN  327



>emb|CDY37252.1| BnaCnng08060D [Brassica napus]
Length=261

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 120/211 (57%), Gaps = 51/211 (24%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---GITF  569
            T +RYRECLKNHAA+ GG V DGCGEFMP G+EGT E+L+CAAC+CHRNFHRK   G+  
Sbjct  35   TTVRYRECLKNHAANVGGSVQDGCGEFMPSGEEGTLEALRCAACDCHRNFHRKEVDGVGS  94

Query  570  QTQNP----------------------------------------PMLPPQHYRGaappp  629
               +P                                         + PP          
Sbjct  95   SAHHPRHHHQYGGGGGRRPPPPNMMLNPLMLPPPPNYAQMHHHKYGVSPPSGMVTPMSVA  154

Query  630  ppvrapaESSSEDLNA--------GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIG  785
                  AESSSEDLN         GGG    Q+  SKKRFRTKFT +QK++M EFAEK+G
Sbjct  155  YGGGGGAESSSEDLNMYGQSSGEHGGGATAGQMGFSKKRFRTKFTTEQKERMMEFAEKLG  214

Query  786  WRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            WR+ KQD+EE+ +FC+E+GVKRQVFKVWMHN
Sbjct  215  WRMNKQDEEELKRFCNEIGVKRQVFKVWMHN  245



>gb|KHG07143.1| hypothetical protein F383_33189 [Gossypium arboreum]
Length=281

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 122/211 (58%), Gaps = 51/211 (24%)
 Frame = +3

Query  378  ADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK  557
            ++T     ++RYRECLKNHAAS GG+V DGCGEFMP G+EGT E+LKCAAC+CHRNFHRK
Sbjct  67   SNTKPLAGVVRYRECLKNHAASIGGNVYDGCGEFMPSGEEGTLEALKCAACDCHRNFHRK  126

Query  558  GITFQTQ------------------------------------NPP--MLPPQHYRGaap  623
             +  +TQ                                    +PP  M+ P +      
Sbjct  127  EVDGETQQFGGRRSLMLNPLQLPPPLPSPTMLHHHHHHHQKYTSPPSAMVTPMNV-----  181

Query  624  ppppvrapaESSSEDLNA------GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIG  785
                V    ESSSEDLN       G          SKKRFRTKFTQ+QK +M E AEK+G
Sbjct  182  --AFVGGGTESSSEDLNMYQSNPEGMAAAAPPYVLSKKRFRTKFTQEQKDKMLELAEKLG  239

Query  786  WRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            WRI KQD++EV KFC+E GVKRQVFKVWMHN
Sbjct  240  WRINKQDEDEVEKFCAEYGVKRQVFKVWMHN  270



>ref|XP_010095248.1| hypothetical protein L484_014588 [Morus notabilis]
 gb|EXB59094.1| hypothetical protein L484_014588 [Morus notabilis]
Length=311

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 122/221 (55%), Gaps = 60/221 (27%)
 Frame = +3

Query  396  TTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT  575
               +RYRECL+NHAAS GGHV+DGCGEFMP G +GT E+LKCAAC CHRNFHRK I  ++
Sbjct  81   VNAVRYRECLRNHAASKGGHVLDGCGEFMPSGDDGTEEALKCAACECHRNFHRKEIDGES  140

Query  576  QNPP-------------MLPPQHY------------------------------------  608
            Q  P             ++ PQHY                                    
Sbjct  141  QYNPNHKLSRNSNNNNSVVLPQHYLPPPPPTVLPNHNPHHHYNHRNHHNSDHPQYPVHHH  200

Query  609  -RGaapppppvrapaESSSEDLN----------AGGGQGLMQVPSSkkrfrtkftqqqkq  755
             R  A P       AESSSEDL+          +     +     SKKRFRTKF Q+QK+
Sbjct  201  RRPIAAPVMMAFGGAESSSEDLHMFDHDHNINQSKAAAAVQHAGESKKRFRTKFNQEQKE  260

Query  756  qMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            +M E AEK+GWRIQK DD+EV +FCSEVGVKRQVFKVWMHN
Sbjct  261  KMMELAEKLGWRIQKHDDQEVQRFCSEVGVKRQVFKVWMHN  301



>gb|EPS63497.1| hypothetical protein M569_11287, partial [Genlisea aurea]
Length=210

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 117/179 (65%), Gaps = 18/179 (10%)
 Frame = +3

Query  381  DTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKG  560
            + +  + + RYRECLKNHAAS G HVVDGC EFMP G EGT   LKCAAC+CHRNFHRK 
Sbjct  31   NAAAGSPVARYRECLKNHAASMGAHVVDGCCEFMPSGGEGTAGELKCAACDCHRNFHRKE  90

Query  561  ITFQTQNPPMLPPQHYR-------------GaapppppvrapaESSSEDLNAGGGQGLMQ  701
            +  + +NP   P   YR                P  P     AESSSEDL+     G   
Sbjct  91   V--EGENP--RPSASYRPPFLGHHHHHQRHQHRPARPHNSGAAESSSEDLHM-FESGHAD  145

Query  702  VPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             PSSKKRFRTKF+Q+QK QM EFAEK+GWR+QKQD+ +V +FC   GVK+QVFKVWMHN
Sbjct  146  NPSSKKRFRTKFSQEQKDQMQEFAEKLGWRMQKQDEHQVQQFCERSGVKKQVFKVWMHN  204



>emb|CBI17508.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 126/186 (68%), Gaps = 28/186 (15%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------  563
            IRYRECLKNHAAS GGHV DGCGEFMP G+EGT E+LKCAAC+CHRNFHRK I       
Sbjct  89   IRYRECLKNHAASMGGHVFDGCGEFMPSGEEGTLEALKCAACDCHRNFHRKEIDGESQPT  148

Query  564  --TFQTQNP-----------PMLPPQH--YRGaapppppvrapaESSSEDLN---AGGGQ  689
               + T NP           P LPP H              APAESSSEDLN   +  G 
Sbjct  149  ANCYYTCNPNTNSSRRNTIAPQLPPSHAPLPHLHQHHKYSHAPAESSSEDLNMFQSNVGM  208

Query  690  GLMQVPS---SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVF  860
             L   P+   SKKRFRTKF+Q+QK +M EFAEK+GW+IQKQ+++EV +FCS+VGVKRQVF
Sbjct  209  HLQPQPAFALSKKRFRTKFSQEQKDKMQEFAEKLGWKIQKQEEQEVQQFCSDVGVKRQVF  268

Query  861  KVWMHN  878
            KVWMHN
Sbjct  269  KVWMHN  274



>gb|KDP34399.1| hypothetical protein JCGZ_12803 [Jatropha curcas]
Length=340

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 128/208 (62%), Gaps = 49/208 (24%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT-----  566
            L+RYRECLKNHAAS GG VVDGCGEFMP G+EGT E+L+CAAC CHRNFHRK I      
Sbjct  123  LVRYRECLKNHAASKGGFVVDGCGEFMPTGEEGTAEALRCAACQCHRNFHRKEIDGEHQS  182

Query  567  --------------------FQTQNPPMLPPQ---HYR-------Gaapppppvr-----  641
                                  T +PP+  P    H+R       GA    P        
Sbjct  183  AATNSYYKDNNQRNTIPQQQLATSHPPISQPSVHYHHRYPHGLTLGAPTTTPAPTIVMTF  242

Query  642  ----apaESSSEDLNA----GGGQGLMQVPS-SkkrfrtkftqqqkqqMHEFAEKIGWRI  794
                A AESSSEDLN       G G +Q  S SKKRFRTKF+Q+QK++M EFAEKI W+I
Sbjct  243  GGGGAAAESSSEDLNMFQSNVQGYGSIQPSSLSKKRFRTKFSQEQKEKMLEFAEKIEWKI  302

Query  795  QKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            QKQD++EV +FCS+VGVKR+VFKVWMHN
Sbjct  303  QKQDEQEVQQFCSKVGVKRKVFKVWMHN  330



>emb|CDY70108.1| BnaCnng66730D [Brassica napus]
Length=265

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 118/179 (66%), Gaps = 14/179 (8%)
 Frame = +3

Query  384  TSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI  563
            T+  T  + YREC +NHAAS+GGHVVDGCGEFM  G+EGT ESL CAAC+CHR+FHRK I
Sbjct  77   TTSPTRRVSYRECQRNHAASSGGHVVDGCGEFMSSGEEGTAESLLCAACDCHRSFHRKEI  136

Query  564  ---------TFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLN----AGGGQGLMQV  704
                     +F     P++                 PAESS+EDLN    A  G G+ Q 
Sbjct  137  DGMFVVKFNSFGHSQRPLVNRHVSPIMMSFGGGGGDPAESSTEDLNRFHQALSGNGVDQF  196

Query  705  PS-SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
                KKRFRTKF Q+QK++M EFAEKIGWR+ K +DEEV++FC E+ VKRQVFKVWMHN
Sbjct  197  QYHPKKRFRTKFNQEQKERMFEFAEKIGWRMNKTEDEEVNRFCREINVKRQVFKVWMHN  255



>ref|XP_009365549.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=344

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 120/198 (61%), Gaps = 44/198 (22%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            ++RYRECLKNHAA+ GG+V DGCGEFMP G+EGT E+LKCAAC+CHRNFHRK +  +T  
Sbjct  112  VVRYRECLKNHAANIGGNVFDGCGEFMPSGEEGTMEALKCAACDCHRNFHRKEVDGETAA  171

Query  582  ---------------------------------------PPMLPPQHYRGaapppppvra  644
                                                   PP++ P +             
Sbjct  172  FSPGSRRSSIMLSPLQLPPPLPSPSSALHHHHHHQKYAMPPIVQPVNV-----AFGSSGG  226

Query  645  paESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
              ESSSEDLNA  G  +    SSKKRFRTKFT +QK++M EF EK+GWRIQKQD+EEV +
Sbjct  227  GTESSSEDLNAFEGGTVPPFASSKKRFRTKFTVEQKERMMEFGEKVGWRIQKQDEEEVER  286

Query  825  FCSEVGVKRQVFKVWMHN  878
            FC+EVGVKRQV +VWMHN
Sbjct  287  FCAEVGVKRQVLRVWMHN  304



>ref|XP_003517228.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=317

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 119/206 (58%), Gaps = 45/206 (22%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ  572
            +T  IRYRECL+NHAAS G HVVDGCGEFM  G+EGTPESL+CAAC CHRNFHRK +  +
Sbjct  101  STPSIRYRECLRNHAASMGSHVVDGCGEFMASGEEGTPESLRCAACECHRNFHRKEVEGE  160

Query  573  TQNPPMLPPQHYRGaapppppvra------------------------------------  644
             Q P  LP QH                                                 
Sbjct  161  LQ-PQSLPQQHVPNYHSYYTNKHNGHFHYPTPSSSSLHHRLVATTTATPSLVPPVMMAFG  219

Query  645  -paESSSEDLNAGGGQGL---MQVP----SSkkrfrtkftqqqkqqMHEFAEKIGWRIQK  800
             PAESSSEDL    G  L    Q P    S+KKRFRTKF+Q QK +M EFA+KI W+IQK
Sbjct  220  GPAESSSEDLINNTGAQLSVQQQAPLTHSSNKKRFRTKFSQHQKDRMMEFADKIDWKIQK  279

Query  801  QDDEEVHKFCSEVGVKRQVFKVWMHN  878
             +++EV  FC++VGVKRQVFKVWMHN
Sbjct  280  HNEQEVQHFCTQVGVKRQVFKVWMHN  305



>ref|XP_008241887.1| PREDICTED: zinc-finger homeodomain protein 5-like [Prunus mume]
Length=261

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 96/158 (61%), Gaps = 24/158 (15%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
            +RYRECLKNHAAS+GGHV+DGCGEFMP G+E  PE+LKCAAC CHRNFHRK I       
Sbjct  118  VRYRECLKNHAASSGGHVLDGCGEFMPSGEEDIPEALKCAACECHRNFHRKEIEGD----  173

Query  585  PMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMH  764
              LP  +Y          R  +E+    L                         QK++M 
Sbjct  174  -HLPNNYYVVNHQKHTISRRDSETRVLQLPPPPPP-------------------QKEKMM  213

Query  765  EFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            E AEK+GW+IQ+ D++EV K CSEVG+KRQVFKVWMHN
Sbjct  214  EVAEKLGWKIQRHDEQEVQKLCSEVGIKRQVFKVWMHN  251



>gb|KFK40227.1| hypothetical protein AALP_AA3G347100 [Arabis alpina]
Length=246

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 115/175 (66%), Gaps = 18/175 (10%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------  563
            +RYREC KNHAAS+GGHVVDGCGEFM  G+EGT ES  CAAC+CHR+FHRK +       
Sbjct  63   VRYRECQKNHAASSGGHVVDGCGEFMSSGEEGTAESFLCAACDCHRSFHRKEVDGMFVVK  122

Query  564  --TFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNA------GGGQGLMQVPS--S  713
              +F     P++  +H              AESS+EDLN        G  G+ Q      
Sbjct  123  FNSFGHSQRPLV-SRHVSPMMMSFGGGGGAAESSTEDLNKLHHQSFSGKNGVDQFHQYHP  181

Query  714  kkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            KKRFRTKF Q+QK++M +FAEKIGWR+ KQ+DE+V+ FC E+ VKRQVFKVWMHN
Sbjct  182  KKRFRTKFNQEQKEKMMDFAEKIGWRMTKQEDEQVNLFCREINVKRQVFKVWMHN  236



>ref|XP_002281371.1| PREDICTED: zinc-finger homeodomain protein 6 [Vitis vinifera]
Length=316

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 124/201 (62%), Gaps = 37/201 (18%)
 Frame = +3

Query  387  SHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT  566
            S++   +RYRECLKNHAA+ GG+VVDGCGEFMP G+EGT E+L CAACNCHRNFHRK + 
Sbjct  98   SNSKASVRYRECLKNHAANIGGNVVDGCGEFMPDGEEGTLEALMCAACNCHRNFHRKEVD  157

Query  567  FQTQN---------PPML--PPQHYR-----------------GaapppppvrapaESSS  662
             +T           PP L  PP  +R                   +          ESSS
Sbjct  158  GETIGRSAPHFHPLPPTLASPPYLHRQKFPKAFHAPPSTIIIPPMSMAFGTSIGATESSS  217

Query  663  EDL-----NAGGGQGLMQVPS----SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEE  815
            EDL     NAG        P     SKKRFRTKFTQ+QK++M E+AEK+GWR+QKQ +E+
Sbjct  218  EDLRAFDSNAGAAPPPPPPPPPSSLSKKRFRTKFTQEQKEKMLEYAEKVGWRMQKQYEEQ  277

Query  816  VHKFCSEVGVKRQVFKVWMHN  878
            V + C+EVGVKRQVFKVWMHN
Sbjct  278  VQQLCAEVGVKRQVFKVWMHN  298



>ref|XP_008388052.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
 ref|XP_008388053.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
 ref|XP_008388054.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
Length=350

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 120/199 (60%), Gaps = 45/199 (23%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            ++RYRECLKNHAA+ GG+V DGCGEFMP G+EGT E+LKCAAC+CHRNFHRK +  +T  
Sbjct  117  VVRYRECLKNHAANIGGNVFDGCGEFMPSGEEGTLEALKCAACDCHRNFHRKEVDGETAA  176

Query  582  ----------------------------------------PPMLPPQHYRGaapppppvr  641
                                                    PP++ P +            
Sbjct  177  FSPGSRRSSIMLTPLQLPPPLPSPSSALHHHHHHHQKYSMPPIVQPVNM-----AFGSGG  231

Query  642  apaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVH  821
               ESSSEDLNA  G  +     SKKRFRTKFT +QK++M EFAE++GWRIQKQD+EEV 
Sbjct  232  GGTESSSEDLNAFEGGAVPPFALSKKRFRTKFTVEQKERMMEFAERVGWRIQKQDEEEVE  291

Query  822  KFCSEVGVKRQVFKVWMHN  878
            +FC+EVGVKRQV +VWMHN
Sbjct  292  RFCAEVGVKRQVLRVWMHN  310



>gb|KHN36110.1| ZF-HD homeobox protein [Glycine soja]
Length=319

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 119/206 (58%), Gaps = 45/206 (22%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ  572
            +T  IRYRECL+NHAAS G HVVDGCGEFM  G+EGTPESL+CAAC CHR+FHRK +  +
Sbjct  103  STPSIRYRECLRNHAASMGSHVVDGCGEFMASGEEGTPESLRCAACECHRSFHRKEVEGE  162

Query  573  TQNPPMLPPQHYRGaapppppvra------------------------------------  644
             Q P  LP QH                                                 
Sbjct  163  LQ-PQSLPQQHVPNYHSYYTNKHNGHFHYPTPSSSSLHHRLVATTTATPSLVPPVMMAFG  221

Query  645  -paESSSEDLNAGGGQGL---MQVP----SSkkrfrtkftqqqkqqMHEFAEKIGWRIQK  800
             PAESSSEDL    G  L    Q P    S+KKRFRTKF+Q QK +M EFA+KI W+IQK
Sbjct  222  GPAESSSEDLINNTGAQLSVQQQAPLTHSSNKKRFRTKFSQHQKDRMMEFADKIDWKIQK  281

Query  801  QDDEEVHKFCSEVGVKRQVFKVWMHN  878
             +++EV  FCS+VGVKRQVFKVWMHN
Sbjct  282  HNEQEVQHFCSQVGVKRQVFKVWMHN  307



>ref|XP_008344270.1| PREDICTED: zinc-finger homeodomain protein 6-like [Malus domestica]
Length=320

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 116/198 (59%), Gaps = 40/198 (20%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT--FQTQ  578
            IRYRECLKN+AA++GGHV+DGCGEFMP G E TP +LKCAAC CHRNFHRK I   + + 
Sbjct  113  IRYRECLKNYAANSGGHVLDGCGEFMPSGDEDTPGALKCAACECHRNFHRKEIDGEYVSN  172

Query  579  N--------------------------PPMLPPQHYRG-------aapppppvrapaESS  659
            N                          P  LP  H                     AESS
Sbjct  173  NYYVINHQQHNSRRDSALTRLPVLASSPRGLPVYHSMAGGPSPPMMMTFGGGGGVVAESS  232

Query  660  SEDLNAG-----GGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
            SEDLN       G     +   SKKRFRTKF+Q+QK++M E AEK+GWRIQK D++EV K
Sbjct  233  SEDLNMNNKLFRGANYAEEAQGSKKRFRTKFSQEQKEKMTEVAEKLGWRIQKHDEQEVQK  292

Query  825  FCSEVGVKRQVFKVWMHN  878
             CSEVG+KRQVFKVWMHN
Sbjct  293  LCSEVGIKRQVFKVWMHN  310



>ref|XP_006299733.1| hypothetical protein CARUB_v10015926mg [Capsella rubella]
 gb|EOA32631.1| hypothetical protein CARUB_v10015926mg [Capsella rubella]
Length=265

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 126/200 (63%), Gaps = 24/200 (12%)
 Frame = +3

Query  348  TQQVLL---PQRFADTSHTTT--LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPES  512
            T  +L+   P+ +A    TT+    RYREC KNHAAS+GGHVVDGCGEFM  G+EGT ES
Sbjct  57   TNPILIAPAPRSYARPQQTTSPGKARYRECQKNHAASSGGHVVDGCGEFMSSGEEGTAES  116

Query  513  LKCAACNCHRNFHRKGI---------TFQTQNPPMLPPQHYRGaapppppvrap---aES  656
            L CAAC+CHR+FHRK I         +F     P++  +H                 AES
Sbjct  117  LLCAACDCHRSFHRKEIDGLFVVNFNSFGHSQRPLV-NRHVSPIMMSFGGGGGNGGPAES  175

Query  657  SSEDLN------AGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEV  818
            S+EDLN      +G G         KKRFRTKF ++QK++M EFAEKIGWR+ KQ+++EV
Sbjct  176  STEDLNRFHQSFSGNGVDQFHQFQPKKRFRTKFNEEQKEKMMEFAEKIGWRMIKQEEDEV  235

Query  819  HKFCSEVGVKRQVFKVWMHN  878
            ++FC E+ VKRQVFKVWMHN
Sbjct  236  NRFCREINVKRQVFKVWMHN  255



>ref|XP_002521573.1| transcription factor, putative [Ricinus communis]
 gb|EEF40844.1| transcription factor, putative [Ricinus communis]
Length=333

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 124/210 (59%), Gaps = 47/210 (22%)
 Frame = +3

Query  384  TSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI  563
            T+ +   +RYRECLKNHAASTGG +VDGCGEFMP G+EGT E++KCAAC CHRNFHRK I
Sbjct  116  TTASAPSVRYRECLKNHAASTGGLIVDGCGEFMPSGQEGTLEAMKCAACECHRNFHRKEI  175

Query  564  TFQTQ-------------NPPMLPPQHYRGaapppppvr---------------------  641
              ++Q             N  + PP H+   +                            
Sbjct  176  HGESQCAANCYCKNNSQRNNTVPPPYHHLSHSLASAQPPIHQRRTFPHGFSSAVLTAPVL  235

Query  642  -------apaESSSEDLNA----GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGW  788
                   A AESSSEDL+       G G MQ    KKR+RTKF+Q+QK +M EFAE++ W
Sbjct  236  MTFGSGGAAAESSSEDLDMFQPNSQGHGCMQ--QLKKRYRTKFSQEQKDKMMEFAERLEW  293

Query  789  RIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            +IQKQDD+EV +FC+ VGVKR+VF VWMHN
Sbjct  294  KIQKQDDQEVQQFCTRVGVKRRVFMVWMHN  323



>ref|XP_010414224.1| PREDICTED: zinc-finger homeodomain protein 6-like [Camelina sativa]
Length=264

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 114/175 (65%), Gaps = 19/175 (11%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI--------  563
            RYREC KNHAA++GGHVVDGCGEFM  G+EGT ESL CAAC+CHR+FHRK I        
Sbjct  81   RYRECQKNHAATSGGHVVDGCGEFMSSGEEGTAESLLCAACDCHRSFHRKEIDGLFVVNF  140

Query  564  -TFQTQNPPMLPPQHYRGaapp---pppvrapaESSSEDLN------AGGGQGLMQVPSS  713
              F     P++  +H                PAESS+EDLN      +G G         
Sbjct  141  NNFGHSQRPLV-GRHVSPIMMSFGGGGGGGGPAESSTEDLNKFHQSFSGNGVDQFHQFQP  199

Query  714  kkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            KKRFRTKF ++QK +M EFAEKIGWR+ KQDD+EV++FC E+ VKRQVFKVWMHN
Sbjct  200  KKRFRTKFNEEQKDKMMEFAEKIGWRMTKQDDDEVNRFCREINVKRQVFKVWMHN  254



>ref|XP_009347543.1| PREDICTED: zinc-finger homeodomain protein 6-like [Pyrus x bretschneideri]
Length=319

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 115/198 (58%), Gaps = 40/198 (20%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------  563
            IRYRECLKNHAA++GGHV+DGCGEFMP G E T  +LKCAAC CHRNFHRK I       
Sbjct  112  IRYRECLKNHAANSGGHVLDGCGEFMPSGDEDTAGALKCAACECHRNFHRKEIDGEYVSN  171

Query  564  -----TFQTQN----------------PPMLPPQHYRG-------aapppppvrapaESS  659
                   Q QN                P  LP  H                     AESS
Sbjct  172  NYYVLNHQQQNSRRDSALTRLPVLASPPRALPVYHSTAGGPSQPMMMTFGGGGGVVAESS  231

Query  660  SEDLNA-----GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
            SEDLN       G     +   SKKRFRTKF+Q+QK++M + AEK+GWRIQK D++EV K
Sbjct  232  SEDLNMYNKLFRGANYAEEAQGSKKRFRTKFSQEQKEKMTDVAEKLGWRIQKHDEQEVQK  291

Query  825  FCSEVGVKRQVFKVWMHN  878
             CSEVG+KRQVFKVWMHN
Sbjct  292  LCSEVGIKRQVFKVWMHN  309



>emb|CDY28987.1| BnaC07g31930D [Brassica napus]
Length=245

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 109/174 (63%), Gaps = 17/174 (10%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT--FQTQN  581
            +Y EC KNHAA TGG VVDGC EFMPGG+EGTP +LKCAACNCHR+FHRK +     +  
Sbjct  54   KYEECQKNHAALTGGQVVDGCCEFMPGGEEGTPGALKCAACNCHRSFHRKEVYGHRNSTQ  113

Query  582  PPMLPPQHYRGaapppp----------pvrapaESSSEDLNA-----GGGQGLMQVPSSk  716
              ++ P  YR +                +     SSSED+         G+GL  +   K
Sbjct  114  EELISPTFYRSSNSYKAIHPRGVYPTGEIGRRTSSSSEDMKKILNQNSDGKGLTMIMRKK  173

Query  717  krfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            KR RTK  + QK++M EFA+++GW IQK+D+EE+ KFC  V ++RQVF+VWMHN
Sbjct  174  KRVRTKINEGQKKKMKEFAQRLGWSIQKKDEEEIDKFCRTVNLRRQVFRVWMHN  227



>ref|XP_006409164.1| hypothetical protein EUTSA_v10022806mg [Eutrema salsugineum]
 gb|ESQ50617.1| hypothetical protein EUTSA_v10022806mg [Eutrema salsugineum]
Length=267

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 119/176 (68%), Gaps = 20/176 (11%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT------  566
            +RYREC +NHAAS+GGHVVDGCGEFM  G+EGT ESL CAAC+CHR+FHRK I       
Sbjct  84   VRYRECQRNHAASSGGHVVDGCGEFMSSGEEGTAESLLCAACDCHRSFHRKEIDGMFVVK  143

Query  567  FQ----TQNPPMLPPQHYRGaapp---pppvrapaESSSEDLN----AGGGQGLMQVPS-  710
            F     +Q P  +  +H              R PAESS+EDLN    +  G G+ Q    
Sbjct  144  FNSLGHSQRP--IVSRHVSPIMMSFGGGGGGRDPAESSTEDLNKLHQSFSGNGVDQFQYH  201

Query  711  SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             KKRFRTKF Q+QK++M EFAEKIGWR+ K +DEEV++FC E+ VKRQVFKVWMHN
Sbjct  202  PKKRFRTKFNQEQKEKMMEFAEKIGWRLSKPEDEEVNRFCREINVKRQVFKVWMHN  257



>ref|XP_009336904.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=351

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 119/198 (60%), Gaps = 44/198 (22%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            ++RYRECLKNHAA+ GG+V DGCGEFMP G+EGT E+LKCAAC+CHRNFHRK +  +T  
Sbjct  119  VVRYRECLKNHAANIGGNVFDGCGEFMPSGEEGTAEALKCAACDCHRNFHRKEVDGETAA  178

Query  582  ---------------------------------------PPMLPPQHYRGaapppppvra  644
                                                   PP++ P +             
Sbjct  179  FSPASRRSSIMLTPLQLPPPLPSSSALHHHHHHHQKYSMPPIVQPVNV-----AFGSGGG  233

Query  645  paESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
              ESSSEDLNA  G  +     SKKRFRTKFT +QK++M EFAE++ WRIQKQD+EEV +
Sbjct  234  GTESSSEDLNAFEGGAVPPFALSKKRFRTKFTVEQKERMMEFAERVEWRIQKQDEEEVER  293

Query  825  FCSEVGVKRQVFKVWMHN  878
            FC+EVGVKRQV +VWMHN
Sbjct  294  FCAEVGVKRQVLRVWMHN  311



>ref|XP_010550403.1| PREDICTED: zinc-finger homeodomain protein 7-like [Tarenaya hassleriana]
 ref|XP_010550404.1| PREDICTED: zinc-finger homeodomain protein 7-like [Tarenaya hassleriana]
Length=272

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 115/184 (63%), Gaps = 29/184 (16%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQ  578
            T +RYR C KNHAA+TGGHVVDGC EFMP G+E TPE+LKCAAC CHR+FHR+ I  Q  
Sbjct  83   TTVRYRGCQKNHAAATGGHVVDGCCEFMPSGEEETPEALKCAACGCHRSFHRRDIDGQDS  142

Query  579  NPP-----------MLPPQHYRGaapp-------pppvrapaESSSEDLN------AGGG  686
              P           M P  +  G+                    S+ED+N      +G  
Sbjct  143  PAPYMYAHTTSKHVMTPTLYCSGSYRLLQPHAVHRTAEIPRRSYSTEDMNNVYQRRSGEE  202

Query  687  QGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKV  866
            +G     S KKRFRTK  ++QK++M EFAE++GWR+QK+D+EEV KFCS+V ++RQVFKV
Sbjct  203  KG-----SRKKRFRTKINEEQKEKMKEFAERLGWRMQKKDEEEVDKFCSQVNLRRQVFKV  257

Query  867  WMHN  878
            WMHN
Sbjct  258  WMHN  261



>ref|XP_007204025.1| hypothetical protein PRUPE_ppa020272mg [Prunus persica]
 gb|EMJ05224.1| hypothetical protein PRUPE_ppa020272mg [Prunus persica]
Length=331

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 118/203 (58%), Gaps = 48/203 (24%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------  563
            +RYRECL+NHAAS+GGHV+DGCGEFMP G+E  PE+LKCAAC CHRNFHRK I       
Sbjct  122  VRYRECLRNHAASSGGHVLDGCGEFMPSGEEDIPEALKCAACECHRNFHRKEIEGDHLPN  181

Query  564  --------------------TFQTQNPPMLP----------PQHYRGaapppppvrapaE  653
                                 FQ   PP+ P          PQ                E
Sbjct  182  NYYVVNHQKHTISRRDSETRVFQLPPPPLPPVHHSAAGGPVPQTMMAFGGRGGGGGGADE  241

Query  654  SSSEDLNA--------GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDD  809
            SSSEDLN           GQ   Q   SKKRFRTKF+Q+QK++M E AEK+GW+IQ+ D+
Sbjct  242  SSSEDLNMNNLFRATYAAGQ---QAAGSKKRFRTKFSQEQKEKMMEVAEKLGWKIQRHDE  298

Query  810  EEVHKFCSEVGVKRQVFKVWMHN  878
            +EV K CSEVG+KRQVFKVWMHN
Sbjct  299  QEVQKLCSEVGIKRQVFKVWMHN  321



>ref|XP_010029792.1| PREDICTED: zinc-finger homeodomain protein 6 [Eucalyptus grandis]
 gb|KCW56751.1| hypothetical protein EUGRSUZ_I02434 [Eucalyptus grandis]
Length=343

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 119/211 (56%), Gaps = 49/211 (23%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ  572
            +T+ IRYRECL+NHAAS GGH++DGCGEFMP G+EGTP   +CAAC CHRNFHRK +  +
Sbjct  123  STSSIRYRECLRNHAASMGGHIIDGCGEFMPSGEEGTPGYFRCAACECHRNFHRKEVDGE  182

Query  573  TQNPPML---------------PPQHY------------------------------RGa  617
             Q  P L               PPQH+                                 
Sbjct  183  PQYTPSLYYSSNKTNGQRAALPPPQHHAIPQPNPINLHHRFSYCISSAATTTTTMALNQP  242

Query  618  apppppvrapaESSSEDLN----AGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIG  785
                     P ESSSEDL     +       Q+ SSKKRFRTKFTQQQK +M E AEK+G
Sbjct  243  VMMAFGGGVPEESSSEDLTMIQHSDAVLRSTQLASSKKRFRTKFTQQQKDKMMECAEKLG  302

Query  786  WRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            WRIQKQD++EV +FC+E GV R+ FKVWMHN
Sbjct  303  WRIQKQDEQEVTQFCAEAGVTRKAFKVWMHN  333



>ref|XP_010467646.1| PREDICTED: zinc-finger homeodomain protein 6 [Camelina sativa]
Length=252

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 114/175 (65%), Gaps = 19/175 (11%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI--------  563
            RYREC KNHAAS+GGHVVDGCGEFM  G++GT ESL CAAC+CHR+FHRK I        
Sbjct  69   RYRECQKNHAASSGGHVVDGCGEFMSSGEDGTAESLLCAACDCHRSFHRKEIDGLFVVNF  128

Query  564  -TFQTQNPPMLPPQHYRGaapppppvrap---aESSSEDLN------AGGGQGLMQVPSS  713
             +F     P++  +H                 AESS+EDLN      +G G         
Sbjct  129  NSFGHSQRPLV-GRHVSPIMMSFGGGGGGGGPAESSTEDLNKFHQSFSGNGVDQFHQFQP  187

Query  714  kkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            KKRFRTKF ++QK +M EFAEKIGWR+ KQ+D+EV++FC E+ VKRQVFKVWMHN
Sbjct  188  KKRFRTKFNEEQKDKMMEFAEKIGWRMTKQEDDEVNRFCREINVKRQVFKVWMHN  242



>ref|XP_011028851.1| PREDICTED: zinc-finger homeodomain protein 5-like [Populus euphratica]
Length=293

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 126/218 (58%), Gaps = 48/218 (22%)
 Frame = +3

Query  366  PQRFADTSH----TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACN  533
            P R A  S      T+  RY ECL+NHAAS GG+V DGCGEFMPGG+EG+ E+LKCAAC+
Sbjct  57   PDRLAIISSGSNSKTSNTRYLECLRNHAASAGGNVFDGCGEFMPGGEEGSLEALKCAACD  116

Query  534  CHRNFHRKGITFQTQ----------------NPPMLPP---------QHY----------  608
            CHRNFHR+ +  + Q                 PP+  P         Q Y          
Sbjct  117  CHRNFHRRELDGEIQFSPGSRSTTMVHNLQLAPPLPSPTVLHHHHHHQRYSMGLHSSPNT  176

Query  609  ----RGaapppppvrapaESSSEDLNA--GGGQGLMQVPS---SkkrfrtkftqqqkqqM  761
                +  +          ESSSE+LN      +G+   P    SKKR+RTKFTQ+QK +M
Sbjct  177  ANMVQPMSVAFGGTSGGTESSSEELNPFQSNAEGVPPPPPYVMSKKRYRTKFTQEQKDKM  236

Query  762  HEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMH  875
             EFAEK+GWRI +QD+EEV +FC+EVGV+RQVFKVWMH
Sbjct  237  MEFAEKVGWRINRQDEEEVERFCAEVGVRRQVFKVWMH  274



>gb|KDP40895.1| hypothetical protein JCGZ_24894 [Jatropha curcas]
Length=262

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 111/165 (67%), Gaps = 10/165 (6%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            ++RYRECLKNHAA+ GG+  DGCGEFMP G+EG+ E+L C+ACNCHRNFHRK +  ++ +
Sbjct  75   MVRYRECLKNHAAAMGGNATDGCGEFMPSGEEGSIEALTCSACNCHRNFHRKEVEGESSS  134

Query  582  PPMLP-----PQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrf-rtkftq  743
               +P     P H                S S++   GGG  + + P   K+  RTKFTQ
Sbjct  135  CTFVPSRAAGPPH----QMIMSYNMGSIPSESDEQEDGGGVIMGRAPQIVKKRFRTKFTQ  190

Query  744  qqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            +QK++MH FAEK+GW+IQKQ++  V +FC E+GVKR+V KVWMHN
Sbjct  191  EQKEKMHNFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHN  235



>ref|XP_008357201.1| PREDICTED: zinc-finger homeodomain protein 5-like [Malus domestica]
 ref|XP_008357202.1| PREDICTED: zinc-finger homeodomain protein 5-like [Malus domestica]
Length=345

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 119/201 (59%), Gaps = 47/201 (23%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            ++RYRECLKNHAA+ GG+V DGCGEFMP G+EGT E+LKCAAC+CHRNFHRK +  +T  
Sbjct  112  VVRYRECLKNHAANIGGNVFDGCGEFMPSGQEGTMEALKCAACDCHRNFHRKEVDGETAA  171

Query  582  ------------------------------------------PPMLPPQHYRGaappppp  635
                                                      PP++ P +          
Sbjct  172  FSPGSRRSSIMLSPLQLPPPLPSPSSALHHHHHHHHHQKYAMPPIVQPVNV-----AFGS  226

Query  636  vrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEE  815
                 ESSSEDLNA  G  +     SKKRFRTKFT +QK++M EF EK+GWRIQKQD+EE
Sbjct  227  SGGGTESSSEDLNAFEGGTVPPFALSKKRFRTKFTVEQKERMMEFGEKVGWRIQKQDEEE  286

Query  816  VHKFCSEVGVKRQVFKVWMHN  878
            V +FC+EVGVKRQV +VWMHN
Sbjct  287  VERFCAEVGVKRQVLRVWMHN  307



>ref|XP_010547467.1| PREDICTED: zinc-finger homeodomain protein 7-like [Tarenaya hassleriana]
Length=251

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 104/171 (61%), Gaps = 21/171 (12%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT-------  566
            RYREC +NHAA TGG V+DGCGEFMPGG+E TP++LKCAAC CHR+FHRK +        
Sbjct  75   RYRECQRNHAAVTGGLVIDGCGEFMPGGEEDTPDALKCAACGCHRSFHRKEVDGQDSQTA  134

Query  567  ----FQTQNPPMLPPQHYRGaappp---ppvrapaESSSEDLNAGGGQGLMQVPSSkkrf  725
                 Q   P +     YR             A   SSSE++N     G  ++ +     
Sbjct  135  AYMYAQRTAPALYCSGSYRAMQTHAMHRTAGIARRSSSSEEMNDEKRSGKKRLRT-----  189

Query  726  rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              K  Q+QK +M EFAE++GW +QK+D+EEV KFCS V ++R+VFKVWMHN
Sbjct  190  --KINQEQKDKMKEFAERLGWSLQKKDEEEVDKFCSMVNLRREVFKVWMHN  238



>ref|XP_003537589.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
 gb|KHN41972.1| ZF-HD homeobox protein [Glycine soja]
Length=336

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 119/203 (59%), Gaps = 45/203 (22%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------  563
            IRYRECL+NHAAS G HVVDGCGEFM  G+EGTPESL+CAAC CHRNFHRK +       
Sbjct  122  IRYRECLRNHAASMGSHVVDGCGEFMASGEEGTPESLRCAACECHRNFHRKEVEGELRPQ  181

Query  564  -------------TFQTQN--------PPMLPPQHYRGaapppppvrap------aESSS  662
                         ++ T           P     H+R   P              AESSS
Sbjct  182  PQPQPQTHVPNYHSYYTNKHNGHLHYPTPSSSSLHHRLVTPTSLVSPVMMAFGGPAESSS  241

Query  663  EDLNA----GGGQGLMQV-------PSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDD  809
            EDLN      GG  L+ V        SSKKRFRTKF+Q QK +M EFA+KI W+I K ++
Sbjct  242  EDLNMFQSNTGGAQLISVQQHAPLLSSSKKRFRTKFSQHQKDRMMEFADKIDWKIHKHNE  301

Query  810  EEVHKFCSEVGVKRQVFKVWMHN  878
            +EV +FCS+VGVKRQVFKVWMHN
Sbjct  302  QEVQQFCSQVGVKRQVFKVWMHN  324



>gb|ACU20045.1| unknown [Glycine max]
Length=336

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 119/203 (59%), Gaps = 45/203 (22%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------  563
            IRYRECL+NHAAS G HVVDGCGEFM  G+EGTPESL+CAAC CHRNFHRK +       
Sbjct  122  IRYRECLRNHAASMGSHVVDGCGEFMASGEEGTPESLRCAACECHRNFHRKEVEGELRPQ  181

Query  564  -------------TFQTQN--------PPMLPPQHYRGaapppppvrap------aESSS  662
                         ++ T           P     H+R   P              AESSS
Sbjct  182  PQPQPQIHVPNYHSYYTNKHNGHLHYPTPSSSSLHHRLVTPTSLVSPVMMAFGGPAESSS  241

Query  663  EDLNA----GGGQGLMQV-------PSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDD  809
            EDLN      GG  L+ V        SSKKRFRTKF+Q QK +M EFA+KI W+I K ++
Sbjct  242  EDLNMFQSNTGGAQLISVQQHAPLLSSSKKRFRTKFSQHQKDRMMEFADKIDWKIHKHNE  301

Query  810  EEVHKFCSEVGVKRQVFKVWMHN  878
            +EV +FCS+VGVKRQVFKVWMHN
Sbjct  302  QEVQQFCSQVGVKRQVFKVWMHN  324



>ref|XP_002302028.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE81301.1| zinc finger family protein [Populus trichocarpa]
Length=293

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 124/218 (57%), Gaps = 48/218 (22%)
 Frame = +3

Query  366  PQRFADTSH----TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACN  533
            P R A  S      T+  RY ECL+NHAAS GG+V DGCGEFMPGG+EG+ E+LKCAAC+
Sbjct  57   PDRLAIISSGSNSKTSNTRYLECLRNHAASVGGNVFDGCGEFMPGGEEGSLEALKCAACD  116

Query  534  CHRNFHRKGITFQTQNPP-------------MLPP-------------QHY---------  608
            CHRNFHR+ +  + Q  P             + PP             Q Y         
Sbjct  117  CHRNFHRRELDGEIQFSPGSRRSTTMVHSLQLAPPLPSPTVLHHHHHHQRYSMGLHTSPN  176

Query  609  -----RGaapppppvrapaESSSEDLNA--GGGQGLMQVPS--SkkrfrtkftqqqkqqM  761
                 +  +          ESSSE+LN      +G    P   SKKR RTKFTQ+QK +M
Sbjct  177  TANMVQPMSVAFGGTSGGTESSSEELNPFQSNAEGAPPPPYVMSKKRHRTKFTQEQKDKM  236

Query  762  HEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMH  875
             EFAEK+GWRI KQD+EEV +FC+EVGV+RQVFKVWMH
Sbjct  237  MEFAEKVGWRINKQDEEEVERFCAEVGVRRQVFKVWMH  274



>ref|XP_009364948.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=349

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 119/198 (60%), Gaps = 44/198 (22%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            ++RYRECLKNHAA+ GG+V DGCGEFMP G+EGT E+LKCAAC+CHRNFHRK +  +T  
Sbjct  117  IVRYRECLKNHAANIGGNVFDGCGEFMPSGEEGTLEALKCAACDCHRNFHRKEVDGETAA  176

Query  582  ---------------------------------------PPMLPPQHYRGaapppppvra  644
                                                   PP++ P +             
Sbjct  177  FSPGSRRSSIMLTPLQLPPPLPSSSALHHHHHHHQKYSMPPIVQPVNV-----AFGSGGG  231

Query  645  paESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
              ESSSEDLNA  G  +     SKKRFRTKFT +QK++M EFAE++ WRIQKQD+EEV +
Sbjct  232  GTESSSEDLNAFEGGAVPPFALSKKRFRTKFTVEQKERMMEFAERVEWRIQKQDEEEVER  291

Query  825  FCSEVGVKRQVFKVWMHN  878
            FC+EVGVKRQV +VWMHN
Sbjct  292  FCAEVGVKRQVLRVWMHN  309



>ref|XP_009112487.1| PREDICTED: zinc-finger homeodomain protein 6-like [Brassica rapa]
Length=265

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 124/190 (65%), Gaps = 20/190 (11%)
 Frame = +3

Query  366  PQRFA--DTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCH  539
            P+ +A   T+  T  + YREC +NHAAS+GGHVVDG GEFM  G+EGT ESL CAAC+CH
Sbjct  67   PRSYARPQTTSPTRRVSYRECQRNHAASSGGHVVDGWGEFMSSGEEGTAESLLCAACDCH  126

Query  540  RNFHRKGI---------TFQTQNPPMLPPQHYRGaapp---pppvrapaESSSEDLN---  674
            R+FHRK +         +F     P++  +H              R PAESS+EDLN   
Sbjct  127  RSFHRKEVDGMFVVKFNSFGHSQRPLV-NRHVSPIMMSFGGGGGGRDPAESSTEDLNRFH  185

Query  675  -AGGGQGLMQVPS-SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVK  848
             A  G G+ Q     KKRFRTKF Q+QK++M EFAEKIGWR+ K +DEEV++FC E+ VK
Sbjct  186  QALSGNGVDQFQYHPKKRFRTKFNQEQKERMFEFAEKIGWRMNKSEDEEVNRFCREINVK  245

Query  849  RQVFKVWMHN  878
            RQVFKVWMHN
Sbjct  246  RQVFKVWMHN  255



>ref|XP_010489538.1| PREDICTED: zinc-finger homeodomain protein 6 isoform X1 [Camelina 
sativa]
 ref|XP_010489539.1| PREDICTED: zinc-finger homeodomain protein 6 isoform X2 [Camelina 
sativa]
Length=262

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 114/175 (65%), Gaps = 19/175 (11%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI--------  563
            RYREC KNHAAS+GGHVVDGCGEFM  G+EGT  SL CAAC+CHR+FHRK I        
Sbjct  79   RYRECQKNHAASSGGHVVDGCGEFMSSGEEGTAASLLCAACDCHRSFHRKEIDGLFVVNF  138

Query  564  -TFQTQNPPMLPPQHYRGaapp---pppvrapaESSSEDLN------AGGGQGLMQVPSS  713
             +F     P++  +H                PAESS+EDLN      +G G         
Sbjct  139  NSFGHSQRPLV-GRHVSPIMMSFGGGGGGGGPAESSTEDLNKFHQSFSGNGVDQFHQFQP  197

Query  714  kkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            KKRFRTKF ++QK +M EFAEKIGWR+ KQ+D+EV++FC E+ VKRQVFKVWMHN
Sbjct  198  KKRFRTKFNEEQKDKMMEFAEKIGWRMTKQEDDEVNRFCREINVKRQVFKVWMHN  252



>ref|XP_002876052.1| ATHB28 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52311.1| ATHB28 [Arabidopsis lyrata subsp. lyrata]
Length=249

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 113/179 (63%), Gaps = 22/179 (12%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---GITFQTQ  578
            +YREC KNHAASTGGHVVDGC EFM GG+EGT E++KCAACNCHR+FHRK   G     Q
Sbjct  58   KYRECQKNHAASTGGHVVDGCCEFMAGGEEGTLEAVKCAACNCHRSFHRKEVYGHMSSKQ  117

Query  579  NPPMLPPQHYRGaapppppvr----------apaESSSEDL---------NAGGGQGLMQ  701
            +  ++ P  Y   +                     SSSED+         N  G   +M 
Sbjct  118  DQLIITPAFYSSNSSYKAMQTRGMHPTGEIGRRTSSSSEDMKKILSHRNQNIDGKGLMMM  177

Query  702  VPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            +   KKR RTK +++QK++M EFAE++GWR+QK+D+EE+ KFC  V ++RQVFKVWMHN
Sbjct  178  MMRKKKRVRTKISEEQKEKMKEFAERLGWRMQKKDEEEIDKFCRMVNLRRQVFKVWMHN  236



>ref|XP_009136568.1| PREDICTED: zinc-finger homeodomain protein 7-like isoform X2 
[Brassica rapa]
 ref|XP_009136569.1| PREDICTED: zinc-finger homeodomain protein 7-like isoform X2 
[Brassica rapa]
Length=243

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 106/174 (61%), Gaps = 17/174 (10%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT--FQTQN  581
            +Y EC KNHAA TGGHVVDGC EFMPGG+E T  +LKCAACNC R+FHRK +     +  
Sbjct  54   KYEECQKNHAALTGGHVVDGCCEFMPGGEEVTSGALKCAACNCPRSFHRKEVYGHRNSTQ  113

Query  582  PPMLPPQHYRGaapppppv----------rapaESSSEDLNA-----GGGQGLMQVPSSk  716
              ++ P  YR                        SSSED+         G+GLM +   K
Sbjct  114  EELISPTFYRSGNSYKAIQPRGVYPTGEIGRRTSSSSEDMKKILNQNSDGKGLMMITRKK  173

Query  717  krfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            KR RTK  + QK++M EFAE++GW IQK+D+EE+ KFC  V ++RQVFKVWMHN
Sbjct  174  KRVRTKINEGQKKKMKEFAERLGWSIQKKDEEEIDKFCRTVNLRRQVFKVWMHN  227



>emb|CAN72985.1| hypothetical protein VITISV_009036 [Vitis vinifera]
Length=250

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 125/209 (60%), Gaps = 51/209 (24%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------  563
            IRYRECLKNHAAS GGHV DGCGEFMP G+EGT E+LKCAAC+CHRNFHRK I       
Sbjct  32   IRYRECLKNHAASMGGHVFDGCGEFMPSGEEGTLEALKCAACDCHRNFHRKEIDGESQPT  91

Query  564  --TFQTQNP-----------PMLPPQHY-------------------------RGaappp  629
               + T NP           P LPP H                                 
Sbjct  92   ANCYYTCNPNTNSSRRNTIAPQLPPSHAPLPHLHQXHKYSHGLSGSPLMSPIPPMMMAFG  151

Query  630  ppvrapaESSSEDLN---AGGGQGLMQVPS---SkkrfrtkftqqqkqqMHEFAEKIGWR  791
                APAESSSEDLN   +  G  L   P+   SKKRFRTKF+Q+QK +M EFAEK+GW+
Sbjct  152  GGGGAPAESSSEDLNMFQSNVGMHLQPQPAFALSKKRFRTKFSQEQKDKMQEFAEKLGWK  211

Query  792  IQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            IQ Q+++EV +FCS+VGVKRQVFKVWMHN
Sbjct  212  IQXQEEQEVQQFCSDVGVKRQVFKVWMHN  240



>ref|XP_004168867.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
Length=242

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 111/190 (58%), Gaps = 26/190 (14%)
 Frame = +3

Query  378  ADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK  557
            A  S T+T +RY +CLKNHA  TGGHV+DGCGEFMP G++GTP+S KCAAC CHR+FHR+
Sbjct  43   APASPTSTPLRYSQCLKNHAVKTGGHVLDGCGEFMPSGEDGTPDSFKCAACECHRSFHRR  102

Query  558  GIT-----------FQTQNPPMLPPQHYRGaapppppvra------------paESSSED  668
             +              T  PP    Q   G                        E+ +E 
Sbjct  103  VLEEEDITNNTRLHILTSAPPQYNTQFSNGNNNNKQYPGRTRVAPMMMTFGGSTEAPAES  162

Query  669  LNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVK  848
             + GG +   +    KKR RTKF+ +QK +M E A KIGW+IQK D+EEV KFC+E+GVK
Sbjct  163  SSDGGAEASGK---QKKRCRTKFSGEQKGKMMELANKIGWKIQKADEEEVLKFCNEIGVK  219

Query  849  RQVFKVWMHN  878
            RQ FKVWMHN
Sbjct  220  RQNFKVWMHN  229



>ref|XP_010424889.1| PREDICTED: zinc-finger homeodomain protein 7-like [Camelina sativa]
Length=259

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 108/180 (60%), Gaps = 23/180 (13%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            +YREC KNHAASTGGHVVDGC EF+ GG+EGT  +LKCAACNCHRNFHRK +    Q+  
Sbjct  65   KYRECQKNHAASTGGHVVDGCCEFLAGGEEGTLGALKCAACNCHRNFHRKEVYGHKQDQM  124

Query  588  MLPPQHYRGaapppppv----------rapaESSSEDL---------NAGG----GQGLM  698
            M+ P  Y   +                     SSSED+         N  G         
Sbjct  125  MITPAFYSSNSSYKAMQPRVMHPTGEIGRRTSSSSEDMKKILSHHNQNVDGRCLMMMMTT  184

Query  699  QVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
                 KKR RTK  ++QK++M EFAE++GWR+QK+D+EE+ KFC  V ++RQVFKVWMHN
Sbjct  185  TTRKKKKRVRTKINEEQKEKMKEFAERLGWRMQKKDEEEIDKFCKVVNLRRQVFKVWMHN  244



>gb|KGN53304.1| hypothetical protein Csa_4G046670 [Cucumis sativus]
Length=242

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 111/190 (58%), Gaps = 26/190 (14%)
 Frame = +3

Query  378  ADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK  557
            A  S T+T +RY +CLKNHA  TGGHV+DGCGEFMP G++GTP+S KCAAC CHR+FHR+
Sbjct  43   APASPTSTPLRYSQCLKNHAVKTGGHVLDGCGEFMPSGEDGTPDSFKCAACECHRSFHRR  102

Query  558  GIT-----------FQTQNPPMLPPQHYRGaapppppvra------------paESSSED  668
             +              T  PP    Q   G                        E+ +E 
Sbjct  103  VLEEEDITNNTRLHILTSAPPQYNTQFSNGNNNNKQYPGRTRVAPMMMTFGGSTEAPAES  162

Query  669  LNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVK  848
             + GG +   +    KKR RTKF+ +QK +M E A KIGW+IQK D+EEV KFC+E+GVK
Sbjct  163  SSDGGAEASGK---QKKRCRTKFSGEQKGKMMELANKIGWKIQKADEEEVLKFCNEIGVK  219

Query  849  RQVFKVWMHN  878
            RQ FKVWMHN
Sbjct  220  RQNFKVWMHN  229



>ref|XP_010060955.1| PREDICTED: zinc-finger homeodomain protein 5 [Eucalyptus grandis]
 gb|KCW67854.1| hypothetical protein EUGRSUZ_F01575 [Eucalyptus grandis]
Length=308

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 114/195 (58%), Gaps = 43/195 (22%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN-  581
            +RYRECL+NHAAS GG V DGCGEFMP G++GT  +L+CAAC CHRNFHRK +  +T + 
Sbjct  103  VRYRECLRNHAASVGGSVYDGCGEFMPAGEDGTAGALRCAACECHRNFHRKEVDGETLHL  162

Query  582  --------------------------------PPMLPPQHYRGaapppppvrapaESSSE  665
                                             PM+ P      +          ESSSE
Sbjct  163  STSFRRGLVPPLQLPPPPLASPYQRYSVGVVHSPMVTPM-----SVAFGGGGGGNESSSE  217

Query  666  DLNAGGGQGL-----MQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFC  830
            DLN  G   L        P SKKRFRTKFTQ+QK +M EFAE++GWRIQKQ++EEV +FC
Sbjct  218  DLNLFGSDHLHRHAATAPPFSKKRFRTKFTQEQKDRMMEFAERVGWRIQKQNEEEVERFC  277

Query  831  SEVGVKRQVFKVWMH  875
             E+GV+RQV KVWMH
Sbjct  278  GEIGVRRQVLKVWMH  292



>ref|XP_009136567.1| PREDICTED: zinc-finger homeodomain protein 7-like isoform X1 
[Brassica rapa]
Length=283

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 106/174 (61%), Gaps = 17/174 (10%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT--FQTQN  581
            +Y EC KNHAA TGGHVVDGC EFMPGG+E T  +LKCAACNC R+FHRK +     +  
Sbjct  94   KYEECQKNHAALTGGHVVDGCCEFMPGGEEVTSGALKCAACNCPRSFHRKEVYGHRNSTQ  153

Query  582  PPMLPPQHYRGaapppppv----------rapaESSSEDLNA-----GGGQGLMQVPSSk  716
              ++ P  YR                        SSSED+         G+GLM +   K
Sbjct  154  EELISPTFYRSGNSYKAIQPRGVYPTGEIGRRTSSSSEDMKKILNQNSDGKGLMMITRKK  213

Query  717  krfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            KR RTK  + QK++M EFAE++GW IQK+D+EE+ KFC  V ++RQVFKVWMHN
Sbjct  214  KRVRTKINEGQKKKMKEFAERLGWSIQKKDEEEIDKFCRTVNLRRQVFKVWMHN  267



>ref|NP_565436.1| homeobox protein 24 [Arabidopsis thaliana]
 sp|Q9ZPW7.1|ZHD6_ARATH RecName: Full=Zinc-finger homeodomain protein 6; Short=AtZHD6; 
AltName: Full=Homeobox protein 24; Short=AtHB-24 [Arabidopsis 
thaliana]
 gb|AAD15502.1| expressed protein [Arabidopsis thaliana]
 gb|AAM65795.1| unknown [Arabidopsis thaliana]
 gb|AEC06760.1| homeobox protein 24 [Arabidopsis thaliana]
Length=262

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 113/172 (66%), Gaps = 15/172 (9%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI--------  563
            RYREC KNHAAS+GGHVVDGCGEFM  G+EGT ESL CAAC+CHR+FHRK I        
Sbjct  81   RYRECQKNHAASSGGHVVDGCGEFMSSGEEGTVESLLCAACDCHRSFHRKEIDGLFVVNF  140

Query  564  -TFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLN----AGGGQGLMQV--PSSkkr  722
             +F     P+                   AESS+EDLN    +  G G+ Q      KKR
Sbjct  141  NSFGHSQRPLGSRHVSPIMMSFGGGGGCAAESSTEDLNKFHQSFSGYGVDQFHHYQPKKR  200

Query  723  frtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            FRTKF ++QK++M EFAEKIGWR+ K +D+EV++FC E+ VKRQVFKVWMHN
Sbjct  201  FRTKFNEEQKEKMMEFAEKIGWRMTKLEDDEVNRFCREIKVKRQVFKVWMHN  252



>ref|XP_002266577.2| PREDICTED: zinc-finger homeodomain protein 6 [Vitis vinifera]
Length=345

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 126/209 (60%), Gaps = 51/209 (24%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT------  566
            IRYRECLKNHAAS GGHV DGCGEFMP G+EGT E+LKCAAC+CHRNFHRK I       
Sbjct  127  IRYRECLKNHAASMGGHVFDGCGEFMPSGEEGTLEALKCAACDCHRNFHRKEIDGESQPT  186

Query  567  ---FQTQNP-----------PMLPPQHY-------------------------RGaappp  629
               + T NP           P LPP H                                 
Sbjct  187  ANCYYTCNPNTNSSRRNTIAPQLPPSHAPLPHLHQHHKYSHGLSGSPLMSPIPPMMMAFG  246

Query  630  ppvrapaESSSEDLN---AGGGQGLMQVPS---SkkrfrtkftqqqkqqMHEFAEKIGWR  791
                APAESSSEDLN   +  G  L   P+   SKKRFRTKF+Q+QK +M EFAEK+GW+
Sbjct  247  GGGGAPAESSSEDLNMFQSNVGMHLQPQPAFALSKKRFRTKFSQEQKDKMQEFAEKLGWK  306

Query  792  IQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            IQKQ+++EV +FCS+VGVKRQVFKVWMHN
Sbjct  307  IQKQEEQEVQQFCSDVGVKRQVFKVWMHN  335



>ref|XP_004146554.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
Length=239

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 110/187 (59%), Gaps = 26/187 (14%)
 Frame = +3

Query  387  SHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT  566
            S T+T +RY +CLKNHA  TGGHV+DGCGEFMP G++GTP+S KCAAC CHR+FHR+ + 
Sbjct  43   SPTSTPLRYSQCLKNHAVKTGGHVLDGCGEFMPSGEDGTPDSFKCAACECHRSFHRRVLE  102

Query  567  -----------FQTQNPPMLPPQHYRGaapppppvra------------paESSSEDLNA  677
                         T  PP    Q   G                        E+ +E  + 
Sbjct  103  EEDITNNTRLHILTSAPPQYNTQFSNGNNNNKQYPGRTRVAPMMMTFGGSTEAPAESSSD  162

Query  678  GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQV  857
            GG +   +    KKR RTKF+ +QK +M E A KIGW+IQK D+EEV KFC+E+GVKRQ 
Sbjct  163  GGAEASGK---QKKRCRTKFSGEQKGKMMELANKIGWKIQKADEEEVLKFCNEIGVKRQN  219

Query  858  FKVWMHN  878
            FKVWMHN
Sbjct  220  FKVWMHN  226



>ref|XP_002325543.2| hypothetical protein POPTR_0019s11070g [Populus trichocarpa]
 gb|EEE99924.2| hypothetical protein POPTR_0019s11070g [Populus trichocarpa]
Length=244

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 108/167 (65%), Gaps = 5/167 (3%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ  572
            +  +++Y+EC++NHAAS GGH  DGCGEFMP G EGT + L CAAC CHRNFHR+  + +
Sbjct  51   SINIVKYKECMRNHAASIGGHANDGCGEFMPRGDEGTRDWLTCAACGCHRNFHRRQGSTK  110

Query  573  TQNPPML---PPQHYRGaapppppvrapaESSSEDLNAGGGQGLM--QVPSSkkrfrtkf  737
             Q+   L   PP   +       P          D  +  G+G M     S+ KR RTKF
Sbjct  111  RQHQQQLLLSPPPQTQQFLLYGAPTDINMNRPVHDFVSREGKGFMVKNAGSNNKRLRTKF  170

Query  738  tqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            TQ+QK++M EFAEKIGWRIQK DD  +++FC+EVGVKR V KVWMHN
Sbjct  171  TQEQKERMLEFAEKIGWRIQKHDDMALNQFCNEVGVKRNVLKVWMHN  217



>ref|XP_009619186.1| PREDICTED: zinc-finger homeodomain protein 2-like [Nicotiana 
tomentosiformis]
Length=241

 Score =   144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 112/182 (62%), Gaps = 31/182 (17%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK----GITFQT  575
            +Y+ECLKNHA S GGH VDGCGEFMP G++G+ +SLKCAACNCHRNFHRK     +    
Sbjct  57   KYKECLKNHAVSIGGHAVDGCGEFMPAGEDGSLDSLKCAACNCHRNFHRKITQPPLITAA  116

Query  576  QNPPML-----------PPQHYRGaapppppvrapaESSS----------EDLNAGGGQG  692
            + PP +           PP  Y      P        S+S           +LN  GG G
Sbjct  117  EPPPFVNYHSPYYRSLPPPCGYLQYHVAPQQRPLALPSTSGGYREDQEDMSNLNNSGGSG  176

Query  693  LMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWM  872
                  S KRFRTKF+Q+QK++M E A+K+GWRIQ++D+E V + C+E GV+RQVFKVWM
Sbjct  177  ------SNKRFRTKFSQEQKEKMQELADKLGWRIQREDEELVQQLCNETGVRRQVFKVWM  230

Query  873  HN  878
            HN
Sbjct  231  HN  232



>ref|XP_009772007.1| PREDICTED: zinc-finger homeodomain protein 2-like [Nicotiana 
sylvestris]
Length=228

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 106/167 (63%), Gaps = 10/167 (6%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN--  581
            RYRECLKNHA   GG  VDGCGEF+P G+EGT ++LKCAACNCHRNFHRK +  +  N  
Sbjct  53   RYRECLKNHAVGIGGQAVDGCGEFLPAGEEGTLDALKCAACNCHRNFHRKEVEGEILNFH  112

Query  582  ----PPML--PPQH--YRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkf  737
                PP+L  P  H  YR    P       +    ED  +           S+KRFRTKF
Sbjct  113  HTTPPPILHHPAHHYPYRYLQRPLALPSVSSREDIEDYVSNPTSSGGGGSGSRKRFRTKF  172

Query  738  tqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            TQ QK++M  FAE +GWRIQK++D  V +FC+E  ++RQVFKVWMHN
Sbjct  173  TQDQKEKMFAFAEGLGWRIQKENDAAVQQFCAETNIRRQVFKVWMHN  219



>ref|NP_190658.1| homeobox protein 28 [Arabidopsis thaliana]
 sp|Q9SVL0.1|ZHD7_ARATH RecName: Full=Zinc-finger homeodomain protein 7; Short=AtZHD7; 
AltName: Full=Homeobox protein 28; Short=AtHB-28 [Arabidopsis 
thaliana]
 emb|CAB42918.1| putative protein [Arabidopsis thaliana]
 dbj|BAD43412.1| unknown protein [Arabidopsis thaliana]
 gb|AEE78722.1| homeobox protein 28 [Arabidopsis thaliana]
Length=249

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 113/177 (64%), Gaps = 20/177 (11%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI----TFQT  575
            +YREC KNHAASTGGHVVDGC EFM GG+EGT  +LKCAACNCHR+FHRK +      + 
Sbjct  59   KYRECQKNHAASTGGHVVDGCCEFMAGGEEGTLGALKCAACNCHRSFHRKEVYGHRNSKQ  118

Query  576  QNPPMLPPQHYRGaapppppvr-------apaESSSEDL---------NAGGGQGLMQVP  707
             +  M+ P  Y   +   P V            SSSED+         N  G   +M + 
Sbjct  119  DHQLMITPAFYSSNSSYKPRVMHPTGEIGRRTSSSSEDMKKILSHRNQNVDGKSLMMMMM  178

Query  708  SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              KKR RTK  ++QK++M EFAE++GWR+QK+D+EE+ KFC  V ++RQVFKVWMHN
Sbjct  179  RKKKRVRTKINEEQKEKMKEFAERLGWRMQKKDEEEIDKFCRMVNLRRQVFKVWMHN  235



>ref|XP_002994344.1| hypothetical protein SELMODRAFT_236945 [Selaginella moellendorffii]
 gb|EFJ04587.1| hypothetical protein SELMODRAFT_236945 [Selaginella moellendorffii]
Length=161

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 106/161 (66%), Gaps = 14/161 (9%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
            +RY +CLKNHAA  GGH +DGCGEFMP G+EGT ++LKCAAC+CHRNFHR+    + +  
Sbjct  3    VRYTQCLKNHAAGIGGHALDGCGEFMPCGEEGTLDALKCAACDCHRNFHRR----EVEGE  58

Query  585  PMLPPQHYRGaapppppvrapaESSSEDL---NAGGGQGLMQVPSSkkrfrtkftqqqkq  755
            P     H+R             E   + +   NAGG       P+ KKRFRTKFT  QK+
Sbjct  59   PSCLECHHRKDKKRLMLPSRSGELDDQGVYMPNAGG-------PNLKKRFRTKFTGDQKE  111

Query  756  qMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            +M  FA+K+GW+IQK D+ EV +FC+EVGVKR V KVWMHN
Sbjct  112  RMLAFADKVGWKIQKHDEAEVQQFCNEVGVKRHVLKVWMHN  152



>ref|XP_009340741.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
6 [Pyrus x bretschneideri]
Length=323

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 113/204 (55%), Gaps = 48/204 (24%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------  563
            IRYRECLKNHAA++GGHV+DGCGEFMP G E T  +LKCAAC CHRNFHRK I       
Sbjct  112  IRYRECLKNHAANSGGHVLDGCGEFMPSGDEDTAGALKCAACECHRNFHRKEIDGEYVSN  171

Query  564  -----TFQTQN----------------PPMLPPQHYRG-------aapppppvrapaESS  659
                   Q QN                P  LP  H                     AESS
Sbjct  172  NYYVLNHQQQNSRRDSALTRLPVLASPPRALPVYHSTAGGPSQPMMMTFGGGGGVVAESS  231

Query  660  SEDLN-----------AGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQD  806
            SEDLN           A   QG  +    + +F  KF+Q+QK++M + AEK+GWRIQK D
Sbjct  232  SEDLNMYNKLFRGANYAEEAQGSKK--RFRTKFSQKFSQEQKEKMTDVAEKLGWRIQKHD  289

Query  807  DEEVHKFCSEVGVKRQVFKVWMHN  878
            ++EV K CSEVG+KRQVFKVWMHN
Sbjct  290  EQEVQKLCSEVGIKRQVFKVWMHN  313



>emb|CDY34299.1| BnaA01g14020D [Brassica napus]
Length=225

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 106/176 (60%), Gaps = 26/176 (15%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT---  575
            +RYRECLKNHA + GGH VDGC EFMP G++G+ ++LKCAAC CHRNFHRK     +   
Sbjct  49   VRYRECLKNHAVNIGGHAVDGCCEFMPSGEDGSLDALKCAACGCHRNFHRKETEVMSGRA  108

Query  576  -------QNPPMLPPQHY--------RGaapppppvrapaESSSEDLNAGGGQGLMQVPS  710
                     PP LPP  Y         G    PP      E +S   ++GG        +
Sbjct  109  HRVPTYYNRPPQLPPPGYLHLTSPAAAGQPYKPPAASGDEEDTSNPSSSGG--------T  160

Query  711  SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              KRFRTKFT +QK +M  FAE++GWRIQK DD  V +FC+E GV+RQV K+WMHN
Sbjct  161  RAKRFRTKFTAEQKDKMLAFAERLGWRIQKHDDAAVEQFCAETGVRRQVLKIWMHN  216



>ref|XP_010503763.1| PREDICTED: zinc-finger homeodomain protein 7-like [Camelina sativa]
Length=258

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 109/179 (61%), Gaps = 22/179 (12%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            +YREC KNHAASTGGHV+DGC EF+ GG+EGT  +LKCAACNCHR+FHRK +    Q+  
Sbjct  65   KYRECQKNHAASTGGHVIDGCCEFLAGGEEGTLGALKCAACNCHRSFHRKEVYGHKQDQM  124

Query  588  MLPPQHYRGaapppppv----------rapaESSSEDL---------NAGG---GQGLMQ  701
            M+ P  Y   +                     SSSED+         N  G      +  
Sbjct  125  MITPAFYSSNSSYKAMQPRVMHPTGEIGRRTSSSSEDMKKILSHRNQNVDGRCLMMMMTT  184

Query  702  VPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
                KKR RTK  ++QK++M EFAE++GWR+QK+D++E+ KFC  V ++RQVFKVWMHN
Sbjct  185  TRKKKKRVRTKINEEQKEKMKEFAERLGWRMQKKDEDEIDKFCKVVNLRRQVFKVWMHN  243



>ref|XP_009138327.1| PREDICTED: zinc-finger homeodomain protein 2 [Brassica rapa]
Length=225

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 107/176 (61%), Gaps = 26/176 (15%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT---  575
            +RYRECLKNHA + GGH VDGC EFMP G++G+ ++LKCAAC CHRNFHRK     +   
Sbjct  49   VRYRECLKNHAVNIGGHAVDGCCEFMPSGEDGSLDALKCAACGCHRNFHRKETEVMSGRA  108

Query  576  -------QNPPMLPPQHY--------RGaapppppvrapaESSSEDLNAGGGQGLMQVPS  710
                     PP LPP  Y         G    PP      E +S   ++GG        +
Sbjct  109  HRVPTYYNRPPQLPPPGYLHLTSPAAAGQPYRPPAASGDEEDTSNPSSSGG--------T  160

Query  711  SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              KRFRTKFT +QK++M  FAE++GWRIQK DD  V +FC+E GV+RQV K+WMHN
Sbjct  161  RAKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDATVEQFCAETGVRRQVLKIWMHN  216



>gb|AAM63229.1| unknown [Arabidopsis thaliana]
Length=249

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 112/177 (63%), Gaps = 20/177 (11%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            +YREC KNHAASTGGHVVDGC EFM GG+EGT  +LKCAACNCHR+FHRK +     +  
Sbjct  59   KYRECQKNHAASTGGHVVDGCCEFMAGGEEGTLGALKCAACNCHRSFHRKEVYGHMNSXX  118

Query  588  ----MLPPQHYRGaapppppvr-------apaESSSEDL---------NAGGGQGLMQVP  707
                M+ P  Y   +   P V            SSSED+         N  G   +M + 
Sbjct  119  DYQLMITPAFYSSNSSYKPRVMHPTGEIGRRTSSSSEDMKKILSHRNQNVDGKSLMMMMM  178

Query  708  SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              KKR RTK  ++QK++M EFAE++GWR+QK+D+EE+ KFC  V ++RQVFKVWMHN
Sbjct  179  RKKKRVRTKINEEQKEKMKEFAERLGWRMQKKDEEEIDKFCRMVNLRRQVFKVWMHN  235



>ref|XP_008788352.1| PREDICTED: zinc-finger homeodomain protein 4-like [Phoenix dactylifera]
Length=249

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 118/192 (61%), Gaps = 30/192 (16%)
 Frame = +3

Query  366  PQRFADTSHTT----TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACN  533
            P+    T+H+T     ++RYRECLKNHAAS GG+  DGCGEFMP G+EGT E+LKC+AC+
Sbjct  54   PEAQQPTAHSTKKGGAVVRYRECLKNHAASIGGNATDGCGEFMPSGEEGTLEALKCSACS  113

Query  534  CHRNFHRKGITFQTQN-----------------PPMLPPQHYRGaapppppvrapaESSS  662
            CHRNFHRK I  Q ++                 P  LP Q          P+ A   S S
Sbjct  114  CHRNFHRKEIEGQCRHHHHHLKETKSVAAHRLIPSPLPHQ-------MVMPLGALMASES  166

Query  663  EDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVG  842
            +++   GG      P  KKR RT+F  +QK++M  FAE+IGWR+Q+Q++  V +FC E+G
Sbjct  167  DEMEGTGGA--RAPPMGKKRRRTRFAPEQKEKMLSFAERIGWRLQRQEESVVEEFCQEIG  224

Query  843  VKRQVFKVWMHN  878
            VKR+V KVWMHN
Sbjct  225  VKRKVLKVWMHN  236



>ref|XP_004509268.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
Length=171

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 110/175 (63%), Gaps = 31/175 (18%)
 Frame = +3

Query  366  PQRFADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRN  545
            P+R  D   T   IRY+EC+KNHAAS GGHV DGCGEFMP G++ TP+   CAAC+CHR+
Sbjct  12   PKR--DLDPTLLNIRYKECVKNHAASIGGHVTDGCGEFMPSGEQNTPQHFICAACHCHRS  69

Query  546  FHRKGITFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNA----GGGQGLMQVPSS  713
            FHRK    Q     +L P                   S+ED+N         GL    S+
Sbjct  70   FHRK----QIHPIRLLTP-------------------STEDINMFYYNNNDDGLQL--ST  104

Query  714  kkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            KKR RTKFTQQQK +M EFA+KIGW++QKQ +EEV KFC ++G K QVFKVWMHN
Sbjct  105  KKRSRTKFTQQQKDRMMEFAQKIGWKLQKQHEEEVDKFCCQLGFKTQVFKVWMHN  159



>ref|XP_006853040.1| hypothetical protein AMTR_s00038p00027320 [Amborella trichopoda]
 gb|ERN14507.1| hypothetical protein AMTR_s00038p00027320 [Amborella trichopoda]
Length=237

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 114/189 (60%), Gaps = 16/189 (8%)
 Frame = +3

Query  354  QVLLPQRFADTSHTTTLI----RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKC  521
            ++L+P    D+S +   I    RY+ECLKNHA S GGH +DGCGEFM  G+EGT ESLKC
Sbjct  34   KMLVPVVSGDSSGSGKRIQSNVRYKECLKNHAVSIGGHAIDGCGEFMAAGEEGTLESLKC  93

Query  522  AACNCHRNFHRKGITFQTQNPPM------LPPQHYRGaapppppvrapaESSS----EDL  671
            AACNCHRNFHRK    +   P        LPP    G A       +   + +    E+ 
Sbjct  94   AACNCHRNFHRKEAEGEIPAPQFAAYYRGLPPPASHGPAGYLHVGPSRQSALAITVREEQ  153

Query  672  NAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKR  851
               G   L   P  KKRFRTKFTQ+QK +M  FAEK+GWRIQKQD+ EV +FC E  +KR
Sbjct  154  EEDGVHALN--PMGKKRFRTKFTQEQKDKMLAFAEKVGWRIQKQDEAEVQRFCMEACIKR  211

Query  852  QVFKVWMHN  878
             V KVWMHN
Sbjct  212  HVLKVWMHN  220



>gb|KHG22175.1| hypothetical protein F383_07505 [Gossypium arboreum]
Length=251

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 106/179 (59%), Gaps = 23/179 (13%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN--  581
            RYRECLKNHA   GGH +DGCGEFMP G EGT ++LKCAACNCHRNFHRK     + N  
Sbjct  53   RYRECLKNHAVGIGGHALDGCGEFMPAGTEGTLDALKCAACNCHRNFHRKESELGSPNSV  112

Query  582  --------------PPMLPPQHYRGaapppppvrapaESSSEDLNAGGG------QGLMQ  701
                          PP   P ++R               +    + GGG      +    
Sbjct  113  HTTDLYFHHHHHHQPPQFAP-YFRAPTGYLHVAGQQRPLALPSTSGGGGHSREDQEDASN  171

Query  702  VPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              SS+KRFRTKFTQ+QK++M   AE++GWRIQK D+E V +FC+E GVKRQV KVWMHN
Sbjct  172  QGSSRKRFRTKFTQEQKEKMLSLAERLGWRIQKHDEEIVQQFCNETGVKRQVLKVWMHN  230



>ref|XP_010266504.1| PREDICTED: zinc-finger homeodomain protein 1-like [Nelumbo nucifera]
Length=226

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 109/173 (63%), Gaps = 18/173 (10%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---GITF  569
            T+ RYRECLKNHA   GGH VDGCGEFM  G+EGT ++LKCAACNCHRNFHRK   G  +
Sbjct  46   TVSRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTLDALKCAACNCHRNFHRKETEGDAY  105

Query  570  QTQNPPM---------LPPQHYRGaapppppvrapaESSSEDL-NAGGGQGLMQVPSSkk  719
              Q  P          + P H   A P      A +    ED+ N  GG G+     SKK
Sbjct  106  HHQFSPYYRTPAGYLHVAPHHRPLALPSTSGGGAHSREDQEDVSNPSGGGGV-----SKK  160

Query  720  rfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            RFRTKFTQ+QK +M  FAE++GWRIQK D+  V +FC+E  VKR V KVWMHN
Sbjct  161  RFRTKFTQEQKDKMLAFAERLGWRIQKHDEAAVQQFCTETCVKRHVLKVWMHN  213



>ref|XP_009769511.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Nicotiana sylvestris]
Length=241

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 113/187 (60%), Gaps = 40/187 (21%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            +Y+ECLKNHA S GGH VDGCGEFMP G++G+ +SLKCAACNCHRNFHRK     TQ PP
Sbjct  56   KYKECLKNHAVSIGGHAVDGCGEFMPAGEDGSLDSLKCAACNCHRNFHRK----ITQPPP  111

Query  588  ------------------MLPPQHYRGaapppppvrapaESSS------------EDLNA  677
                              + PP  Y      P        S+S             +LN 
Sbjct  112  NAVEPLPFVNYHSSYYRSLPPPCGYLQYHVAPQQRPLALPSTSGGGGYWEDQEDMSNLNN  171

Query  678  GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQV  857
             GG G      SKKRFRTKF+Q+QK++M E A+K+GWRIQ++D+E V + C+E GV+RQV
Sbjct  172  SGGSG------SKKRFRTKFSQEQKEKMQELADKLGWRIQREDEELVQQLCNETGVRRQV  225

Query  858  FKVWMHN  878
            FKVWMHN
Sbjct  226  FKVWMHN  232



>gb|KHN05023.1| ZF-HD homeobox protein [Glycine soja]
Length=190

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 111/172 (65%), Gaps = 12/172 (7%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQ  578
             +IRY+ECLKNHAA+ GG+  DGCGEFM  G+EGT E+LKC+ACNCHRNFHRK I     
Sbjct  6    IIIRYKECLKNHAAAIGGNATDGCGEFMAAGEEGTLEALKCSACNCHRNFHRKEIESSDS  65

Query  579  N--PPMLPP---QHYRGaapppppvrapaESSSEDLNAGGGQGLMQV-----PSSkkrf-  725
            N  P M+ P   Q  R       P ++ + S S+  +    +  M +     P+ K +  
Sbjct  66   NAIPLMIIPDTTQIIRPILAHLSPNKSGSISPSDLSDEKENEDGMMIKEVENPNEKVKKR  125

Query  726  -rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             RTKFTQ+QK++M  FAE+ GWRIQK D+  V KFC E+G+KR+V KVWMHN
Sbjct  126  FRTKFTQEQKEKMLAFAERAGWRIQKLDESLVQKFCQEIGIKRRVLKVWMHN  177



>ref|XP_003555538.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=200

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 111/172 (65%), Gaps = 12/172 (7%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQ  578
             +IRY+ECLKNHAA+ GG+  DGCGEFM  G+EGT E+LKC+ACNCHRNFHRK I     
Sbjct  16   IIIRYKECLKNHAAAIGGNATDGCGEFMAAGEEGTLEALKCSACNCHRNFHRKEIESSDS  75

Query  579  N--PPMLPP---QHYRGaapppppvrapaESSSEDLNAGGGQGLMQV-----PSSkkrf-  725
            N  P M+ P   Q  R       P ++ + S S+  +    +  M +     P+ K +  
Sbjct  76   NAIPLMIIPDTTQIIRPILAHLSPNKSGSISPSDLSDEKENEDGMMIKEVENPNEKVKKR  135

Query  726  -rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             RTKFTQ+QK++M  FAE+ GWRIQK D+  V KFC E+G+KR+V KVWMHN
Sbjct  136  FRTKFTQEQKEKMLAFAERAGWRIQKLDESLVQKFCQEIGIKRRVLKVWMHN  187



>ref|XP_009769508.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Nicotiana sylvestris]
Length=242

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 115/188 (61%), Gaps = 41/188 (22%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            +Y+ECLKNHA S GGH VDGCGEFMP G++G+ +SLKCAACNCHRNFHRK     TQ PP
Sbjct  56   KYKECLKNHAVSIGGHAVDGCGEFMPAGEDGSLDSLKCAACNCHRNFHRK----ITQPPP  111

Query  588  ------------------MLPPQHYRGaapppppvrapaESSS---------EDL----N  674
                              + PP  Y      P        S+S         ED+    N
Sbjct  112  NAVEPLPFVNYHSSYYRSLPPPCGYLQYHVAPQQRPLALPSTSGGGGYWEDQEDMSNLNN  171

Query  675  AGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQ  854
            +G G G      SKKRFRTKF+Q+QK++M E A+K+GWRIQ++D+E V + C+E GV+RQ
Sbjct  172  SGAGSG------SKKRFRTKFSQEQKEKMQELADKLGWRIQREDEELVQQLCNETGVRRQ  225

Query  855  VFKVWMHN  878
            VFKVWMHN
Sbjct  226  VFKVWMHN  233



>ref|XP_008808961.1| PREDICTED: zinc-finger homeodomain protein 4-like [Phoenix dactylifera]
Length=274

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 119/208 (57%), Gaps = 44/208 (21%)
 Frame = +3

Query  369  QRFADTSHTT---TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCH  539
            QR     ++T    ++RYRECLKNHAAS GG   DGCGEFMP G+EGT E+LKC+ACNCH
Sbjct  58   QRHPGNPYSTKKGVVVRYRECLKNHAASIGGSATDGCGEFMPSGEEGTLEALKCSACNCH  117

Query  540  RNFHRKGITFQTQN-----------------------------------PPMLPPQHYRG  614
            RNFHRK +  ++ +                                    P   P H   
Sbjct  118  RNFHRKEVEGESSSCDCFHYLKGRKVVGQKGLLISGPEAFGYAPAGNSLIPRASPHHM--  175

Query  615  aapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRI  794
                  P+ A   S S+D+   GG  +++ P  KKRFRTKFT +QK++M  FAEK+GWR+
Sbjct  176  ----IMPLGALQTSESDDMEGFGGGAMVRPPMVKKRFRTKFTPEQKEKMLSFAEKVGWRL  231

Query  795  QKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            QKQ++  V +FC E+GVKR+V KVWMHN
Sbjct  232  QKQEESVVQQFCQEIGVKRRVLKVWMHN  259



>emb|CDX88950.1| BnaA04g02360D [Brassica napus]
Length=210

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 105/167 (63%), Gaps = 23/167 (14%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKG---------  560
            RYRECLKNHA +  GH VDGC EFMP G++G+ ++LKCAAC CHRNFHRK          
Sbjct  48   RYRECLKNHAVNIAGHAVDGCCEFMPSGEDGSLDALKCAACCCHRNFHRKETEMISGRAH  107

Query  561  -ITFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkf  737
             +      PP LPP  YR      P   A  E +S   ++GG        +  KRFRTKF
Sbjct  108  IVPTYFNRPPQLPPPGYR-----QPAASADEEDTSNPSSSGG--------TKAKRFRTKF  154

Query  738  tqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            T +QK++M  FAE++GWR+QK DD  V +FC+E GV+RQV K+WMHN
Sbjct  155  TAEQKEKMFAFAERLGWRMQKHDDVAVEQFCAETGVRRQVLKIWMHN  201



>gb|KHN03576.1| ZF-HD homeobox protein [Glycine soja]
Length=277

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 108/180 (60%), Gaps = 21/180 (12%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQ-  578
            ++RYRECLKNHAA+ GG+  DGCGEFMP GKEG+ E+L C+AC+CHRNFHRK +  + Q 
Sbjct  73   VVRYRECLKNHAAAMGGNATDGCGEFMPSGKEGSIEALNCSACHCHRNFHRKEVEGEPQH  132

Query  579  -------------NPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQV---PS  710
                         +P  L   H                 S E  +A  G G++Q+   PS
Sbjct  133  HLNINRRRLILGPHPEALGYPHQMIMPYNIGIGHHLPSESDEQEDAAAGAGMVQLSSRPS  192

Query  711  Skkrfr----tkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            S +  +    TKF+Q QK +M  FAEK+GW+IQKQ++  V  FC E+GVKR+V KVWMHN
Sbjct  193  SAQLVKKRFRTKFSQDQKDKMLNFAEKVGWKIQKQEESVVQHFCQEIGVKRRVLKVWMHN  252



>emb|CDX81284.1| BnaC09g06950D [Brassica napus]
Length=255

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 104/168 (62%), Gaps = 5/168 (3%)
 Frame = +3

Query  390  HTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITF  569
            H  +  R+RECLKN A + GGH VDGC EFMP G EGT ++LKCAAC CHRNFHRK + +
Sbjct  63   HGGSRFRFRECLKNQAVNIGGHAVDGCREFMPAGTEGTIDALKCAACGCHRNFHRKELPY  122

Query  570  QTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkk-----rfrtk  734
                 P  PP  YR  AP       P  S  +       +  M+  S++      RFRTK
Sbjct  123  FHHLAPPTPPGAYRLPAPMSYRPSPPQASPVQLALPPPAEDRMETSSAEAGGMRKRFRTK  182

Query  735  ftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            FT +QK++M   AE+IGWRIQ+QDDE + +FC E GV RQV KVW+HN
Sbjct  183  FTAEQKERMLGLAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHN  230



>ref|XP_006859182.1| hypothetical protein AMTR_s00070p00154800 [Amborella trichopoda]
 gb|ERN20649.1| hypothetical protein AMTR_s00070p00154800 [Amborella trichopoda]
Length=218

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 105/170 (62%), Gaps = 12/170 (7%)
 Frame = +3

Query  387  SHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT  566
            S  + LI YRECLKNHAA+ GGH  DGCGEFM  G+EG+ E+LKCAAC CHRNFHRK I+
Sbjct  40   SKPSYLIGYRECLKNHAAAIGGHANDGCGEFMAAGEEGSIEALKCAACGCHRNFHRKEIS  99

Query  567  FQTQNPPMLPPQHYRGaapppppvrapaESSSED------LNAGGGQGLMQVPSSkkrfr  728
              T  P   P  H             P  + S D         GGG       +  KR+R
Sbjct  100  V-TPLPFSSPYLHNAAPTWDKKLKFPPPLTRSIDNEGFTVFGQGGG-----TKNGTKRYR  153

Query  729  tkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            TKFTQ QK++M  FA+K+GWRIQKQDD  + +FC EVGVKR V KVWMHN
Sbjct  154  TKFTQDQKEKMQAFADKLGWRIQKQDDVALQQFCMEVGVKRHVLKVWMHN  203



>emb|CDY08945.1| BnaC08g11750D [Brassica napus]
Length=210

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 105/167 (63%), Gaps = 23/167 (14%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKG---------  560
            +YRECLKNHA +  GH VDGC EFMP G++G+ ++LKCAAC CHRNFHRK          
Sbjct  48   KYRECLKNHAVNIAGHAVDGCCEFMPSGEDGSLDALKCAACGCHRNFHRKETEMVSGRAH  107

Query  561  -ITFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkf  737
             +      PP LPP  YR      P   A  E +S   ++GG        +  KRFRTKF
Sbjct  108  IVPTYYNRPPQLPPPGYR-----QPAASADEEDTSNPSSSGG--------TKAKRFRTKF  154

Query  738  tqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            T +QK++M  FAE++GWR+QK DD  V +FC+E GV+RQV K+WMHN
Sbjct  155  TAEQKEKMFAFAERLGWRMQKHDDVAVEQFCAETGVRRQVLKIWMHN  201



>ref|XP_010263641.1| PREDICTED: zinc-finger homeodomain protein 5 [Nelumbo nucifera]
Length=356

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 119/218 (55%), Gaps = 58/218 (27%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAAC--------------  530
            T T +RYRECLKNHAAS GGHVVDGCGEFMP G+EGTPE+LKCAAC              
Sbjct  131  TATGVRYRECLKNHAASIGGHVVDGCGEFMPSGEEGTPEALKCAACDCHRNFHRKDMEGE  190

Query  531  -----NCHRNFHRK------------------------------GITFQTQNPPMLPPQH  605
                 NC+  +++                               G+       P+ PP  
Sbjct  191  PQSGANCYYYYNKNHGGCGGRSRIPPPPPQLPPQPLQQHQKFQLGLPTSPSTGPIPPPMM  250

Query  606  YRGaapppppvrapaESSSEDLN------AGGG-QGLMQVPSSkkrfrtkftqqqkqqMH  764
               A           ESSSEDLN      AGG  + L     SKKRFRTKFTQ+QK +M 
Sbjct  251  M--AFCSGGVGGGATESSSEDLNVYQSNAAGGATRPLPPFSLSKKRFRTKFTQEQKDRML  308

Query  765  EFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            EFAEK+GWRIQKQD+ EV +FC+EVGVKRQV KVWMHN
Sbjct  309  EFAEKVGWRIQKQDEPEVQQFCAEVGVKRQVLKVWMHN  346



>ref|XP_002966118.1| hypothetical protein SELMODRAFT_85536, partial [Selaginella moellendorffii]
 gb|EFJ32145.1| hypothetical protein SELMODRAFT_85536, partial [Selaginella moellendorffii]
Length=170

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 104/159 (65%), Gaps = 14/159 (9%)
 Frame = +3

Query  411  YRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPPM  590
            Y +CLKNHAA  GGH +DGCGEFMP G+EGT ++LKCAAC+CHRNFHR+    + +  P 
Sbjct  14   YTQCLKNHAAGIGGHALDGCGEFMPCGEEGTLDALKCAACDCHRNFHRR----EVEGEPS  69

Query  591  LPPQHYRGaapppppvrapaESSSEDL---NAGGGQGLMQVPSSkkrfrtkftqqqkqqM  761
                H+R             E   + +   NAGG       P+ KKRFRTKFT  QK++M
Sbjct  70   CLECHHRKDKKRLMLPSRSGELDDQGVYMPNAGG-------PNLKKRFRTKFTGDQKERM  122

Query  762  HEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              FA+K+GW+IQK D+ EV +FC+EVGVKR V KVWMHN
Sbjct  123  LAFADKVGWKIQKHDEAEVQQFCNEVGVKRHVLKVWMHN  161



>ref|XP_006403985.1| hypothetical protein EUTSA_v10010588mg [Eutrema salsugineum]
 gb|ESQ45438.1| hypothetical protein EUTSA_v10010588mg [Eutrema salsugineum]
Length=292

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 112/177 (63%), Gaps = 20/177 (11%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            +Y+EC KNHAA TGGHVVDGC +FMPGG+EGT  +LKCAAC CHR+FHRK +   ++   
Sbjct  70   KYKECQKNHAALTGGHVVDGCCDFMPGGEEGTLGALKCAACKCHRSFHRKEMYGHSKQEL  129

Query  588  MLPPQHYRGaapppppvr---------apaESSSEDLN-----------AGGGQGLMQVP  707
            + P  +Y  ++      R             SSSED+N             G   +M + 
Sbjct  130  ITPAFYYSNSSYKAVQPRGMHPTGEIGRRTSSSSEDMNKILNHRNQSIDGNGSMRMMMMR  189

Query  708  SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              KKR RTK  ++QK++M EFAE++GWRIQK+D+EE+ KFC  V ++RQVFKVWMHN
Sbjct  190  KKKKRIRTKINEEQKEKMKEFAERLGWRIQKKDEEEIDKFCRLVNLRRQVFKVWMHN  246



>ref|XP_008810728.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=344

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 112/201 (56%), Gaps = 42/201 (21%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ  572
            T + +RYRECL+NHAA+ GGHVVDGCGEFM  G  GTP++LKCAAC CHR+FHRK +   
Sbjct  115  TESSVRYRECLRNHAAAVGGHVVDGCGEFMAYGDAGTPDALKCAACGCHRSFHRKDVDGD  174

Query  573  TQN---------------------------PPMLPPQHYR------------Gaappppp  635
              +                           P   PP   R            GA      
Sbjct  175  PSSYYRGAAAARLPLLLPPPHPQAHHHKPYPMAFPPSPSRAAPGSSSAVVAFGANTSGSG  234

Query  636  vrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEE  815
                  SS E +NAG    ++    SKKRFRTKFT +QK++M  FAE++GWRI KQD+  
Sbjct  235  GTTTESSSEERMNAGAPPPVVV---SKKRFRTKFTAEQKEKMLAFAERVGWRIHKQDEAL  291

Query  816  VHKFCSEVGVKRQVFKVWMHN  878
            V +FC+EVGV+RQV KVWMHN
Sbjct  292  VEQFCAEVGVRRQVLKVWMHN  312



>ref|XP_002965557.1| hypothetical protein SELMODRAFT_68508, partial [Selaginella moellendorffii]
 ref|XP_002983043.1| hypothetical protein SELMODRAFT_48444, partial [Selaginella moellendorffii]
 gb|EFJ15852.1| hypothetical protein SELMODRAFT_48444, partial [Selaginella moellendorffii]
 gb|EFJ32977.1| hypothetical protein SELMODRAFT_68508, partial [Selaginella moellendorffii]
Length=184

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 112/176 (64%), Gaps = 18/176 (10%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHR------KGIT  566
            +RYRECLKNHAA  GGH +DGCGEFMP G+EGT ESLKC+AC+CHRNFHR      K + 
Sbjct  1    VRYRECLKNHAAGIGGHALDGCGEFMPSGEEGTIESLKCSACDCHRNFHRREVEGAKDVM  60

Query  567  FQTQNPPMLPPQHY---RGaapppppvrapaESS--SEDLNAGGGQGLMQ------VPSS  713
             + +   +LP Q +    G+    P       +S  S+D + G             +PS+
Sbjct  61   SKKKPSSVLPLQQHGSPLGSMARSPGALVALSNSDQSDDHDLGAQHQTTYSLAHHLIPSA  120

Query  714  kkrf-rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             K+  RTKFT +QK++M  FA ++GW+IQK D+ EV +FC++VGVKR V KVWMHN
Sbjct  121  IKKRFRTKFTNEQKEKMFHFAHRLGWKIQKHDEGEVQQFCADVGVKRHVLKVWMHN  176



>emb|CDY24844.1| BnaA08g14660D [Brassica napus]
Length=210

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 104/167 (62%), Gaps = 23/167 (14%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKG---------  560
            RYRECLKNHA +  GH VDGC EFMP G++G+ ++LKCAAC CHRNFHRK          
Sbjct  48   RYRECLKNHAVNIAGHAVDGCCEFMPSGEDGSLDALKCAACCCHRNFHRKETEMISGRAH  107

Query  561  -ITFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkf  737
             +      PP LPP  YR      P   A  E +S   ++GG        +  KRFRTKF
Sbjct  108  IVPTYFNRPPQLPPPGYR-----QPAASADEEDTSNPSSSGG--------TKAKRFRTKF  154

Query  738  tqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            T +QK++M  FAE++GWR+QK DD  V +FC E G++RQV K+WMHN
Sbjct  155  TAEQKEKMFAFAERLGWRMQKHDDVAVEQFCGETGIRRQVIKIWMHN  201



>ref|XP_010930367.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
Length=277

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 113/191 (59%), Gaps = 33/191 (17%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQ  578
             ++RYRECLKNHAAS GG   DGCGEFMP G+EGT E+LKC+ACNCHRNFHRK +  ++ 
Sbjct  74   VVVRYRECLKNHAASIGGTATDGCGEFMPSGEEGTLEALKCSACNCHRNFHRKDVEGESS  133

Query  579  NPPMLPPQHYRGaappppp-------------------------------vrapaESSSE  665
            +       H +G                                      + A   S S+
Sbjct  134  SCDCF--HHLKGRKMLGQKGLLISGPEAFGYAPAGNSLIPRPSPHHMIMPLGALQTSESD  191

Query  666  DLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGV  845
            ++   GG  +++ P  KKRFRTKFT +QK++M  FAEK+GWR+QKQ++  V +FC E+GV
Sbjct  192  EMEGVGGGAMVRPPMVKKRFRTKFTPEQKEKMLSFAEKVGWRLQKQEESVVQQFCQEIGV  251

Query  846  KRQVFKVWMHN  878
            KR+V KVWMHN
Sbjct  252  KRRVLKVWMHN  262



>ref|XP_001752347.1| predicted protein [Physcomitrella patens]
 gb|EDQ83080.1| predicted protein [Physcomitrella patens]
Length=298

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 113/198 (57%), Gaps = 40/198 (20%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------  563
            +RYREC KNHAAS GGH +DGCGEFMPGG+EGT ++L+CAAC+CHRNFHR+ +       
Sbjct  91   VRYRECQKNHAASIGGHALDGCGEFMPGGEEGTVDALRCAACDCHRNFHRREVEGEVLCE  150

Query  564  --------------TFQTQNPP------------MLPPQHYRGaapppppvrapaESSSE  665
                             +Q+PP             LPP            +     + S+
Sbjct  151  CKRKQKPGVQLGAAVITSQHPPGGTIPSTPMATLALPPSAGVMTPLTMAALSTGGPTDSD  210

Query  666  DL-----NAGGGQGL-MQVPSSkkrf-rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
            +      N+GGG  + M+ PS+ K+  RTKFT +QK QM  FAEK+GWRIQK D+  V +
Sbjct  211  EQDDGLGNSGGGMMMSMRSPSAIKKRFRTKFTNEQKDQMCAFAEKVGWRIQKHDEASVQE  270

Query  825  FCSEVGVKRQVFKVWMHN  878
            FC+  G+KR V KVWMHN
Sbjct  271  FCATAGIKRHVLKVWMHN  288



>ref|NP_194197.1| ZF-HD homeobox protein [Arabidopsis thaliana]
 sp|Q9SB61.1|ZHD2_ARATH RecName: Full=Zinc-finger homeodomain protein 2; Short=AtZHD2; 
AltName: Full=Homeobox protein 22; Short=AtHB-22; AltName: 
Full=Protein MATERNAL EFFECT EMBRYO ARREST 68 [Arabidopsis 
thaliana]
 gb|AAL27510.1|AF439841_1 AT4g24660/F22K18_140 [Arabidopsis thaliana]
 emb|CAA22997.1| putative protein [Arabidopsis thaliana]
 emb|CAB79376.1| putative protein [Arabidopsis thaliana]
 gb|AAM78073.1| AT4g24660/F22K18_140 [Arabidopsis thaliana]
 gb|AEE84939.1| ZF-HD homeobox protein [Arabidopsis thaliana]
Length=220

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 106/170 (62%), Gaps = 17/170 (10%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------  563
            IRYRECLKNHA + GGH VDGC EFMP G++GT ++LKCAAC CHRNFHRK         
Sbjct  47   IRYRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLDALKCAACGCHRNFHRKETESIGGRA  106

Query  564  ----TFQTQNP-PMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfr  728
                T+  + P P  PP +    +P  P     A    ED +     G      + KRFR
Sbjct  107  HRVPTYYNRPPQPHQPPGYLHLTSPAAPYRPPAASGDEEDTSNPSSSG-----GTTKRFR  161

Query  729  tkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            TKFT +QK++M  FAE++GWRIQK DD  V +FC+E GV+RQV K+WMHN
Sbjct  162  TKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHN  211



>gb|ADE77597.1| unknown [Picea sitchensis]
Length=249

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 111/187 (59%), Gaps = 29/187 (16%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-----TF  569
            +RYREC+KNHAAS GGH +DGCGEFMP G EGT E+LKCAACNCHRNFHR+ +      +
Sbjct  54   VRYRECMKNHAASIGGHAIDGCGEFMPSGDEGTLEALKCAACNCHRNFHRREVEGEPPCY  113

Query  570  QTQNP-----------PM---LPPQHYRGaapppppvrapaESSS---------EDLNAG  680
               NP           P+   LP     G    P P    A  S           D+   
Sbjct  114  YCYNPRKDSRKRPAGSPLPLALPSTSPPGLIARPSPQMIMAFGSGPTHENDQQEHDMALH  173

Query  681  GGQGL-MQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQV  857
            G  G  M +P  KKRFRTKFTQ+QK +M  FAEK+GWRIQK D+  V +FC E+GVKR V
Sbjct  174  GLHGASMAMPIMKKRFRTKFTQEQKDKMCSFAEKLGWRIQKHDEAAVQQFCMELGVKRHV  233

Query  858  FKVWMHN  878
             KVWMHN
Sbjct  234  LKVWMHN  240



>emb|CDX73775.1| BnaC08g22280D [Brassica napus]
Length=215

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 100/158 (63%), Gaps = 17/158 (11%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP-  584
            +Y+EC KNH  STGGHVVDGC EFMPGGKEGT  +LKCAAC+CHR+FHRK +     +  
Sbjct  62   KYKECQKNHTVSTGGHVVDGCCEFMPGGKEGTLGALKCAACSCHRSFHRKEVYEHINSTQ  121

Query  585  PMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMH  764
             ++ P  YR                S  L     Q        KKR RTK  ++QK++M 
Sbjct  122  ELMSPAFYR----------------SGSLYKAMIQPRGLYLPKKKRIRTKINEEQKEKMK  165

Query  765  EFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            EFAE++GWRI K+D+EE+ KFC  V ++RQVFKVWMHN
Sbjct  166  EFAERLGWRILKKDEEEIDKFCRLVNLRRQVFKVWMHN  203



>ref|XP_010272957.1| PREDICTED: zinc-finger homeodomain protein 1-like [Nelumbo nucifera]
Length=225

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 104/171 (61%), Gaps = 11/171 (6%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---GITF  569
            T+ RYRECLKNHA S GGH VDGCGEFM  G+EGT ++LKCAACNCHRNFHRK   G  +
Sbjct  46   TVSRYRECLKNHAVSIGGHAVDGCGEFMAAGEEGTLDALKCAACNCHRNFHRKETEGEVY  105

Query  570  QTQNPPML--------PPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrf  725
              Q  P             H+R  A P          S ED             SSKKRF
Sbjct  106  HHQFSPYYRTPAGYLHVAPHHRPLALPSTSGGGGGAQSREDQEDDVSNPSGGGGSSKKRF  165

Query  726  rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            RTKFTQ+QK +M  FAEK+GWRIQK D+  V +FC+E  VKR V KVWMHN
Sbjct  166  RTKFTQEQKDKMLAFAEKLGWRIQKHDEAAVQQFCTETCVKRHVLKVWMHN  216



>ref|XP_002867654.1| ATHB22/MEE68 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43913.1| ATHB22/MEE68 [Arabidopsis lyrata subsp. lyrata]
Length=214

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 110/177 (62%), Gaps = 27/177 (15%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------  563
            +RYRECLKNHA + GGH VDGC EFMP G++GT ++LKCAAC CHRNFHRK         
Sbjct  37   LRYRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLDALKCAACGCHRNFHRKETESIGGRA  96

Query  564  ----TFQTQNP-PMLPPQHY-------RGaapppppvrapaESSSEDLNAGGGQGLMQVP  707
                T+  + P P  PP +         G     P   A  E++S   ++GG        
Sbjct  97   HRVPTYYNRPPQPHQPPGYLHLTSPTATGQPIRLPVASADEENTSNPSSSGG--------  148

Query  708  SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            ++ KRFRTKFT +QK++M  FAE++GWRIQK DD  V +FC+E GV+RQV K+WMHN
Sbjct  149  TTAKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHN  205



>gb|ABY61024.1| zinc finger-homeodomain protein 2 [Saruma henryi]
Length=258

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 113/188 (60%), Gaps = 30/188 (16%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI------  563
            ++RYRECLKNHAAS GG+  DGCGEFMP G+EG+ E+LKC+AC+CHRNFHRK I      
Sbjct  58   VVRYRECLKNHAASMGGNATDGCGEFMPSGEEGSIEALKCSACSCHRNFHRKEIEGETSW  117

Query  564  ----------------------TFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNA  677
                                   F      ++P  H +           P+ES  +D   
Sbjct  118  DCCHLKARKVVGQKGVLIAGSDAFGYPTGSLIPRPHPQ-MIMSYNLGALPSESDEQDGGV  176

Query  678  GGG-QGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQ  854
            GGG      +P  KKRFRTKFTQ+QK++M  FAEK+GWRIQKQ++  V +FC E+GVKR+
Sbjct  177  GGGSMACRPLPLVKKRFRTKFTQEQKEKMLSFAEKVGWRIQKQEESVVQQFCQEIGVKRR  236

Query  855  VFKVWMHN  878
            V KVWMHN
Sbjct  237  VLKVWMHN  244



>ref|XP_001777987.1| predicted protein [Physcomitrella patens]
 gb|EDQ57200.1| predicted protein [Physcomitrella patens]
Length=165

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 106/162 (65%), Gaps = 27/162 (17%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            +IRYREC +NHA +TGG+VVDGCGEFMPGG+EGT  +L+CAAC+CHRNFHRK    +T  
Sbjct  18   VIRYRECNRNHAITTGGYVVDGCGEFMPGGEEGTVAALRCAACDCHRNFHRKETEGETS-  76

Query  582  PPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPS---Skkrfrtkftqqqk  752
                                   +    + N    +G+M VP+    +KRFRTKFT +QK
Sbjct  77   ----------------------CDCKYINRNDPRKRGMM-VPAPIMGRKRFRTKFTNEQK  113

Query  753  qqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            ++M  FAEK+GW+IQK D+  V +FC+EVGVKR V KVWMHN
Sbjct  114  EKMGVFAEKLGWKIQKHDEAAVQEFCAEVGVKRHVLKVWMHN  155



>ref|XP_009115766.1| PREDICTED: zinc-finger homeodomain protein 7 [Brassica rapa]
 ref|XP_009115767.1| PREDICTED: zinc-finger homeodomain protein 7 [Brassica rapa]
 emb|CDX77960.1| BnaA09g31550D [Brassica napus]
Length=219

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 102/158 (65%), Gaps = 17/158 (11%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP-  584
            +Y+EC KNHA STGGHVVDGC EFMPGG+EGT  +LKCAAC+CHR+FHRK +     +  
Sbjct  62   KYKECQKNHAVSTGGHVVDGCCEFMPGGEEGTLGALKCAACSCHRSFHRKEVYEHINSTQ  121

Query  585  PMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMH  764
             ++ P  YR                S  L     Q        KKR RTK  ++QK++M 
Sbjct  122  ELMSPAFYR----------------SGSLYKAMIQPRGLYLPKKKRIRTKINEEQKEKMK  165

Query  765  EFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            EFAE++GWRI K+D+EE++KFC  V ++RQVFKVWMHN
Sbjct  166  EFAERLGWRILKKDEEEINKFCRLVNLRRQVFKVWMHN  203



>ref|XP_010515469.1| PREDICTED: zinc-finger homeodomain protein 7-like [Camelina sativa]
Length=259

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 107/180 (59%), Gaps = 23/180 (13%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            +Y EC KNHAASTGGHVVDGC EF+ GG+EGT  +LKCAACNCHR+FH+K +    Q+  
Sbjct  65   KYCECQKNHAASTGGHVVDGCCEFLAGGEEGTFGALKCAACNCHRSFHKKEVYGHKQDQM  124

Query  588  MLPPQHYRGaapppppv----------rapaESSSEDL---------NAGG----GQGLM  698
            M+ P  Y   +                     SSSED+         N  G         
Sbjct  125  MITPAFYNSNSSYKAMQPRVMHPMGEIGRRTSSSSEDMKKILSHRNQNVDGRCLMMMMTT  184

Query  699  QVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
                 KKR RTK  ++QK++M EFAE++GWR+QK+D+EE+ KFC  V ++RQVFKVWMHN
Sbjct  185  TTRKKKKRVRTKINEEQKEKMKEFAERLGWRMQKKDEEEIDKFCKVVNLRRQVFKVWMHN  244



>emb|CDY54719.1| BnaA09g52500D [Brassica napus]
Length=241

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 103/168 (61%), Gaps = 5/168 (3%)
 Frame = +3

Query  390  HTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITF  569
            H  +  R+RECLKN A + GGH VDGC EFMP G EGT ++LKCAAC CHRNFHRK + +
Sbjct  49   HGGSRFRFRECLKNQAVNIGGHAVDGCREFMPAGTEGTIDALKCAACGCHRNFHRKELPY  108

Query  570  QTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkk-----rfrtk  734
               + P  P   YR  AP          S  +       +  M+  S++      RFRTK
Sbjct  109  FHHHAPPPPRGFYRLPAPVSYRPSPSQASPVQLALPPPAEDRMETSSAEAGGIRKRFRTK  168

Query  735  ftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            FT +QK++M   AE+IGWRIQ+QDDE + +FC E GV RQV KVW+HN
Sbjct  169  FTAEQKERMLGLAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHN  216



>emb|CDY03431.1| BnaC01g16510D [Brassica napus]
Length=223

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 106/175 (61%), Gaps = 25/175 (14%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT---  575
            IRYRECLKNHA + GGH VDGC EFMP G++G+ ++LKCAAC CHRNFHRK     +   
Sbjct  48   IRYRECLKNHAVNIGGHAVDGCCEFMPSGEDGSLDALKCAACGCHRNFHRKETEIMSGRA  107

Query  576  -------QNPPMLPPQHY-------RGaapppppvrapaESSSEDLNAGGGQGLMQVPSS  713
                     PP LP   Y           P  PP     E +S   ++GG        + 
Sbjct  108  HRAPTYYNRPPQLPLPGYLHLTSPAAAGQPYRPPASGDEEDTSNPSSSGG--------TR  159

Query  714  kkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             KRFRTKFT +QK++M  FAE++GWRIQK DD  V +FC+E GV+RQV K+WMHN
Sbjct  160  AKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDAAVEQFCAETGVRRQVLKIWMHN  214



>ref|XP_002982727.1| hypothetical protein SELMODRAFT_17376, partial [Selaginella moellendorffii]
 gb|EFJ16480.1| hypothetical protein SELMODRAFT_17376, partial [Selaginella moellendorffii]
Length=161

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = +3

Query  411  YRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPPM  590
            YRECLKNHAAS GGH +DGCGEFMP G+EGT E+LKCAAC+CHRNFH++  T  T     
Sbjct  1    YRECLKNHAASIGGHALDGCGEFMPCGEEGTMEALKCAACDCHRNFHKRETTCNTAAATA  60

Query  591  LPPQHYRGaapppppvrapaESSSEDLNAG--GGQGLMQVPSSkkrfrtkftqqqkqqMH  764
                    +A    P    A  S   L++   G    M   S KKRFRTKF+  QK++M+
Sbjct  61   SALPLAASSAASLGPRTGNAPMSLLALSSRGEGDHHDMSPLSMKKRFRTKFSMDQKEKMY  120

Query  765  EFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             FAEK+GWRIQK D+  V  FC+EVGVKR V KVWMHN
Sbjct  121  MFAEKVGWRIQKHDEAAVQHFCAEVGVKRHVLKVWMHN  158



>ref|XP_006426297.1| hypothetical protein CICLE_v10027024mg [Citrus clementina]
 ref|XP_006466284.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis]
 gb|ESR39537.1| hypothetical protein CICLE_v10027024mg [Citrus clementina]
 gb|KDO60627.1| hypothetical protein CISIN_1g026161mg [Citrus sinensis]
Length=242

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 109/202 (54%), Gaps = 37/202 (18%)
 Frame = +3

Query  369  QRFADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNF  548
            Q  A+ +H     RYRECLKNHA   GGH +DGCGEFM  G EGT + LKCAACNCHRNF
Sbjct  37   QATAEAAHPGRKARYRECLKNHAVGIGGHALDGCGEFMAAGDEGTLDGLKCAACNCHRNF  96

Query  549  HRKGITFQTQNP----------------PMLPPQ----------------HYRGaapppp  632
            HRK +      P                P   PQ                H+R  A P  
Sbjct  97   HRKEVDSSVVTPMAAGVPAAGGGEVFFHPSQVPQFTPYYRTPAGYLHVAAHHRPLALPST  156

Query  633  pvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDE  812
                 +    ED +  GG G      S+KRFRTKFT +QK +M E AEK+GWRIQK D+E
Sbjct  157  SGGGHSREDQEDASNLGGSG-----GSRKRFRTKFTPEQKDRMLELAEKLGWRIQKHDEE  211

Query  813  EVHKFCSEVGVKRQVFKVWMHN  878
             V +FC++ GVKR V KVWMHN
Sbjct  212  VVQQFCNDTGVKRHVLKVWMHN  233



>ref|XP_003550152.1| PREDICTED: ZF-HD homeobox protein At5g65410-like [Glycine max]
Length=286

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 111/190 (58%), Gaps = 32/190 (17%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK--------  557
            ++RYRECLKNHAA+ GG+  DGCGEFMP GKEG+ E+L C+AC+CHRNFHRK        
Sbjct  73   VVRYRECLKNHAAAMGGNATDGCGEFMPSGKEGSIEALNCSACHCHRNFHRKEVEGEPQH  132

Query  558  ----------------GITFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQ  689
                             + + T     +PP               P+ES  ++ +A  G 
Sbjct  133  HLNINRRRLILGPHPEALGYPTAAARSVPPHQMIMPYNIGIGHHLPSESDEQE-DAAAGA  191

Query  690  GLMQV---PSSkkrfr----tkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVK  848
            G++Q+   PSS +  +    TKF+Q QK +M  FAEK+GW+IQKQ++  V  FC E+GVK
Sbjct  192  GMVQLSSRPSSAQLVKKRFRTKFSQDQKDKMLNFAEKVGWKIQKQEESVVQHFCQEIGVK  251

Query  849  RQVFKVWMHN  878
            R+V KVWMHN
Sbjct  252  RRVLKVWMHN  261



>ref|XP_009112180.1| PREDICTED: zinc-finger homeodomain protein 1-like [Brassica rapa]
Length=256

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 104/169 (62%), Gaps = 6/169 (4%)
 Frame = +3

Query  390  HTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT-  566
            H  +  R+RECLKN A + GGH VDGC EFMP G EGT ++LKCAAC CHRNFHRK +  
Sbjct  63   HGGSRFRFRECLKNQAVNIGGHAVDGCREFMPAGTEGTIDALKCAACGCHRNFHRKELPY  122

Query  567  FQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkk-----rfrt  731
            F    PP  P   YR  AP       P  S  +       +  M+  S++      RFRT
Sbjct  123  FHHLAPPPPPRGSYRVPAPVSYRPSPPQASPVQLALPPPAEDRMETSSAEAGGIRKRFRT  182

Query  732  kftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            KFT +QK++M   AE+IGWRIQ+QDDE + +FC E GV RQV KVW+HN
Sbjct  183  KFTAEQKERMLGLAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHN  231



>ref|XP_009421143.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=282

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 113/193 (59%), Gaps = 41/193 (21%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK--------  557
            +++YRECLKNHAA+ GG+  DGCGEFMP G+EGT E+LKC+ACNCHRNFHRK        
Sbjct  83   VVKYRECLKNHAAAIGGNATDGCGEFMPSGEEGTLEALKCSACNCHRNFHRKEVEGESSY  142

Query  558  ---------------GITFQTQNP-----------PMLPPQHYRGaapppppvrapaESS  659
                           G+     +P           P  PP           P+ A   S 
Sbjct  143  DCYHPFKGRKVIGQRGLLISGADPFGYNPGSNSLIPRPPPH-------MIMPLGAMQTSE  195

Query  660  SEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEV  839
            S+++   GG  + + P  KKRFRTKFT +QK++M  FAEK GWR+QKQ++  V +FC E+
Sbjct  196  SDEMEGAGGGMMARPPLVKKRFRTKFTAEQKEKMLHFAEKAGWRLQKQEESAVQQFCQEI  255

Query  840  GVKRQVFKVWMHN  878
            GVKR+V KVWMHN
Sbjct  256  GVKRRVLKVWMHN  268



>ref|XP_009596949.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Nicotiana tomentosiformis]
Length=227

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 101/167 (60%), Gaps = 17/167 (10%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ----T  575
            +Y+ECLKNHA   GGH VDGCGEFMP G++GT ++LKCAACNCHRNFHRK          
Sbjct  52   KYKECLKNHAVGIGGHAVDGCGEFMPAGEDGTLDALKCAACNCHRNFHRKETQLHHLPYY  111

Query  576  QNPP------MLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkf  737
              PP      +LPPQ                E   E  N            +KKRFRT+F
Sbjct  112  GTPPCGYVQHVLPPQRPLALPSTSGGGGGYREDQEELCNPNNS-------VTKKRFRTRF  164

Query  738  tqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             Q+QK++M E AEK+GWRIQ+QD+  V + C+E+ +KR VFKVWMHN
Sbjct  165  NQEQKEKMLELAEKLGWRIQRQDEGVVQQLCNEICIKRHVFKVWMHN  211



>emb|CDY71124.1| BnaCnng71430D [Brassica napus]
Length=257

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 114/180 (63%), Gaps = 16/180 (9%)
 Frame = +3

Query  384  TSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI  563
            T+  T  +RYREC +NHAAS+GGHV+D CG+FM  G+EGT ESL CAAC+CHR+FHR  I
Sbjct  69   TTSPTRSVRYRECQRNHAASSGGHVIDVCGKFMSSGEEGTAESLLCAACDCHRSFHRNEI  128

Query  564  ---------TFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLN------AGGGQGLM  698
                     +F     P++               R PAESS+ED+N       G G    
Sbjct  129  DGMFVVKFNSFGHSPRPLVSRHVSPIMMSFARGGRDPAESSTEDVNKFHQYFCGNGVDQS  188

Query  699  QVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            Q    KKRFRTKF Q+QK++M EFAEKIGWR+ K +D EV+ FC E+ +KRQ+FKVWMHN
Sbjct  189  QY-HPKKRFRTKFNQEQKEKMEEFAEKIGWRMSKPEDSEVNLFCREINLKRQLFKVWMHN  247



>ref|XP_011003997.1| PREDICTED: zinc-finger homeodomain protein 2-like [Populus euphratica]
Length=268

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 114/191 (60%), Gaps = 28/191 (15%)
 Frame = +3

Query  390  HTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK-GIT  566
            ++ + ++Y+ECL+NHAAS GGH  DGCGEFMP G EGT + L CAAC CHRNFHR+ G T
Sbjct  51   YSISSVKYKECLRNHAASIGGHANDGCGEFMPRGDEGTRDWLTCAACGCHRNFHRRQGST  110

Query  567  FQTQNPPML---PPQHYRGaapppppvrapa----------------------ESSSEDL  671
             + Q   +L   PPQ  +      P                            +  SE  
Sbjct  111  KRQQQQKLLLSPPPQTQQFLLYGAPTDINMKPVHDFISRPHEDDDDDLDDLDHDRRSETP  170

Query  672  NAGGGQGLM--QVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGV  845
              G G+G M     S+ KRFRTKFTQ+QK++M EFAEKIGWRIQK DD  +++FC+E+GV
Sbjct  171  ERGEGKGFMVKNAGSNNKRFRTKFTQEQKERMLEFAEKIGWRIQKHDDMALNQFCNEIGV  230

Query  846  KRQVFKVWMHN  878
            KR V KVWMHN
Sbjct  231  KRNVLKVWMHN  241



>ref|XP_010912718.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
 ref|XP_010912719.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
 ref|XP_010912720.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
Length=276

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 115/199 (58%), Gaps = 39/199 (20%)
 Frame = +3

Query  384  TSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK--  557
            +S    +++YRECLKNHAAS GG+  DGCGEFMP G+EGT E+LKC+ACNCHRNFHRK  
Sbjct  68   SSKKGVVVKYRECLKNHAASIGGNATDGCGEFMPSGEEGTLEALKCSACNCHRNFHRKEV  127

Query  558  --------------------------------GITFQTQNPPMLPPQHYRGaapppppvr  641
                                            G    T +    P  H+        P+ 
Sbjct  128  DGEASSCDCFHYLKERKVLGQKGLLISGPEAFGYAAATNSLISRPSPHH-----MIMPLG  182

Query  642  apaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVH  821
            A   S S+++   GG  +++ P  KKRFRTKFT +QK++M  FAEK+GWR+QKQ++  V 
Sbjct  183  ALQTSESDEMEGVGGGAMVRPPMVKKRFRTKFTPEQKEKMLSFAEKVGWRLQKQEESVVQ  242

Query  822  KFCSEVGVKRQVFKVWMHN  878
            + C E+GVKR+V KVWMHN
Sbjct  243  QLCQEIGVKRRVLKVWMHN  261



>ref|XP_008452084.1| PREDICTED: zinc-finger homeodomain protein 6-like [Cucumis melo]
Length=241

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 109/185 (59%), Gaps = 35/185 (19%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------  563
            +RY +CLKNHA  TGGHV+DGCGEFMP G++GTP+S KCAAC CHR+FHR+ +       
Sbjct  49   VRYSQCLKNHAVKTGGHVLDGCGEFMPSGEDGTPDSFKCAACECHRSFHRRVLEEEDVTN  108

Query  564  ------TFQTQNPPMLP------------PQHYRGaapppp---pvrapaESSSEDLNAG  680
                     +  PP               P+  R A           APAESSS+   A 
Sbjct  109  NTSRLHILTSAAPPYTSQFNNGNNNNNQYPRRTRVAPVMMTFGGSTEAPAESSSDGAEAS  168

Query  681  GGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVF  860
            G Q        KKR RTKF+ +QK +M E A K+GW+IQK D+EEV KFC+E+GVKRQ F
Sbjct  169  GRQ-------QKKRSRTKFSGEQKGKMMELANKLGWKIQKDDEEEVLKFCNEIGVKRQNF  221

Query  861  KVWMH  875
            KVWMH
Sbjct  222  KVWMH  226



>ref|XP_009802158.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Nicotiana sylvestris]
Length=235

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 106/166 (64%), Gaps = 16/166 (10%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            +Y+ECLKNHA   GGH VDGCGEFMP G++G+ ++LKCAACNCHRNFHRK    Q  +PP
Sbjct  52   KYKECLKNHAVGIGGHAVDGCGEFMPAGEDGSLDALKCAACNCHRNFHRKET--QIHHPP  109

Query  588  ML--PPQHYRGaapppppvrapaESSSEDLNAGGG----QGLMQVPSSkkrfr---tkft  740
                PP  Y     PP    A   +S      GGG    Q  M  P++    +   T+F 
Sbjct  110  YYRTPPCGYFQHVMPPQRPLALPSTS-----GGGGYREDQEEMCNPNNSGTKKRFRTRFN  164

Query  741  qqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            Q+QK++M E AE +GWRIQ+QD+  V + C+E+G+KR VFKVWMHN
Sbjct  165  QEQKEKMLELAENLGWRIQRQDEGVVQQLCNEIGIKRHVFKVWMHN  210



>ref|XP_001772697.1| predicted protein [Physcomitrella patens]
 gb|EDQ62561.1| predicted protein [Physcomitrella patens]
Length=192

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 102/161 (63%), Gaps = 9/161 (6%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
            I Y+EC +NHA  +GG+ VDGCGEFMP G+EGT ESLKCAAC+CHRN+HRK     T +P
Sbjct  25   ISYKECNRNHAIFSGGYAVDGCGEFMPSGEEGTIESLKCAACDCHRNYHRKETA--TPHP  82

Query  585  PMLPP--QHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkf-tqqqkq  755
              LP   Q           +  P  ++S D + G G+     PS+ K+      T  Q++
Sbjct  83   LALPSPSQMISPVNQFQHYLLGPRPANSGDGDGGFGRS----PSTMKKRFRTKFTSNQRE  138

Query  756  qMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            +M  F+EK+GWRIQK D+  V +FCS+VGVKR V KVWMHN
Sbjct  139  KMGAFSEKLGWRIQKHDEPAVQEFCSDVGVKRHVLKVWMHN  179



>ref|XP_009407034.1| PREDICTED: zinc-finger homeodomain protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=296

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 105/194 (54%), Gaps = 38/194 (20%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT------  566
            IRYRECL+NHAAS GGHV+DGCGEFMP G   +PE+LKCAAC CHR+FHRK         
Sbjct  69   IRYRECLRNHAASIGGHVLDGCGEFMPEGDPSSPEALKCAACGCHRSFHRKEAEGDAAAA  128

Query  567  ---------------------------FQTQ---NPPMLPPQHYRGaapppppvrapaES  656
                                       +Q Q     P  P                  ES
Sbjct  129  DSYYRGAARVPLLLPPPPHPQSQHHNHYQKQFQFGTPTTPSSGIVAFGGNASGSGGTTES  188

Query  657  SSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSE  836
            SSE+    G       P  +KRFRTKFT +QK++M  FAE++GWRIQKQD+  V +FC+E
Sbjct  189  SSEERMTAGAPTPATTP--RKRFRTKFTMEQKEKMLAFAERMGWRIQKQDEGLVEQFCAE  246

Query  837  VGVKRQVFKVWMHN  878
             GV+RQV KVWMHN
Sbjct  247  TGVRRQVLKVWMHN  260



>ref|XP_009403385.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403391.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403399.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=259

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 109/182 (60%), Gaps = 26/182 (14%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK-------  557
             +++YRECLKNHAAS GG+  DGCGEFMP G+EGT E+LKC+AC+CHRNFHRK       
Sbjct  68   VVVKYRECLKNHAASIGGNATDGCGEFMPSGEEGTLEALKCSACSCHRNFHRKEAEGEPS  127

Query  558  --------------GITFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGL  695
                             +   +   +P    R             ++S  D   G   G+
Sbjct  128  CDCFQPIRWSKMMGAFGYSPASRSFIP----RATPHSMIMPLGAMQASESDEMEGVVGGV  183

Query  696  M-QVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWM  872
            M + P  KKRFRTKFT +QK++M  FAEK+GWR+QKQ++  V +FC E+GVKR+V KVWM
Sbjct  184  MARPPMVKKRFRTKFTPEQKEKMLSFAEKLGWRLQKQEESMVQQFCQEIGVKRRVLKVWM  243

Query  873  HN  878
            HN
Sbjct  244  HN  245



>ref|XP_009109241.1| PREDICTED: zinc-finger homeodomain protein 2-like [Brassica rapa]
Length=210

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 103/167 (62%), Gaps = 23/167 (14%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKG---------  560
            RYRECLKNHA +  GH VDGC EFM  G++G+ ++LKCAAC CHRNFHRK          
Sbjct  48   RYRECLKNHAVNIAGHAVDGCCEFMHSGEDGSLDALKCAACCCHRNFHRKETEMISGRAH  107

Query  561  -ITFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkf  737
             +      PP LPP  YR      P   A  E +S   ++GG        +  KRFRTKF
Sbjct  108  IVPTYFNRPPQLPPPGYR-----QPAASADEEDTSNPSSSGG--------TKAKRFRTKF  154

Query  738  tqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            T +QK++M  FAE++GWR+QK DD  V +FC E G++RQV K+WMHN
Sbjct  155  TAEQKEKMFAFAERLGWRMQKHDDVAVEQFCGETGIRRQVIKIWMHN  201



>ref|XP_009592418.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nicotiana 
tomentosiformis]
Length=170

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 106/166 (64%), Gaps = 29/166 (17%)
 Frame = +3

Query  447  GGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-------------TFQTQNPP  587
            GGH++DGCG+FMP  +EG   +LKCAACNCHRNFHR+                + T NPP
Sbjct  2    GGHILDGCGKFMPSEEEG---ALKCAACNCHRNFHRRETFSEAETQIARPRPPYSTFNPP  58

Query  588  MLPPQHYRGaapppp----pvrapaESSSEDLN-----AGGGQGLMQVPSSkkrfrtkft  740
            +    +Y                 AESSSEDLN     AGGGQ       SKKRFRTKFT
Sbjct  59   IHSSSNYHHNYSTASPVMMTFGRNAESSSEDLNLFNSNAGGGQS----SKSKKRFRTKFT  114

Query  741  qqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             +QK++MHEFAEK+GW IQKQD++E+  FC++VGVKRQVF++WMHN
Sbjct  115  AEQKERMHEFAEKVGWSIQKQDEQELQHFCNQVGVKRQVFRIWMHN  160



>ref|XP_009802157.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Nicotiana sylvestris]
Length=238

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 109/172 (63%), Gaps = 25/172 (15%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            +Y+ECLKNHA   GGH VDGCGEFMP G++G+ ++LKCAACNCHRNFHRK    Q  +PP
Sbjct  52   KYKECLKNHAVGIGGHAVDGCGEFMPAGEDGSLDALKCAACNCHRNFHRKET--QIHHPP  109

Query  588  ------------MLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPS---Skkr  722
                        ++PPQ  R  A P            ED      Q  M  P+   +KKR
Sbjct  110  YYRTPPCGYFQHVMPPQ--RPLALPSTSGGGGGGGYRED------QEEMCNPNNSGTKKR  161

Query  723  frtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            FRT+F Q+QK++M E AE +GWRIQ+QD+  V + C+E+G+KR VFKVWMHN
Sbjct  162  FRTRFNQEQKEKMLELAENLGWRIQRQDEGVVQQLCNEIGIKRHVFKVWMHN  213



>ref|XP_003635057.1| PREDICTED: zinc-finger homeodomain protein 2-like [Vitis vinifera]
Length=244

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 106/179 (59%), Gaps = 27/179 (15%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT-------  566
            RYRECLKNHA S GGH VDGCGEFM  G EGT ++LKCAACNCHRNFHRK +        
Sbjct  45   RYRECLKNHAVSIGGHAVDGCGEFMAAGAEGTLDALKCAACNCHRNFHRKEMEGGGEGFH  104

Query  567  -------------FQTQNPPMLPPQHYRGaapppppvrapaES--SSEDLNAGGGQGLMQ  701
                         ++T    +    H+R  A P         S    ED++   G G   
Sbjct  105  HHHHPHQPQFSPYYRTPAGYLHVAAHHRPLALPSTSGGGGTHSRDDQEDVSNPSGAG---  161

Query  702  VPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              SSKKRFRTKFTQ+QK +M   AE++GWRIQK D+  V +FCSE GVKR V KVWMHN
Sbjct  162  --SSKKRFRTKFTQEQKDKMFGLAERLGWRIQKHDEAVVQQFCSETGVKRHVLKVWMHN  218



>ref|XP_006286279.1| hypothetical protein CARUB_v10007856mg [Capsella rubella]
 gb|EOA19177.1| hypothetical protein CARUB_v10007856mg [Capsella rubella]
Length=224

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 106/177 (60%), Gaps = 27/177 (15%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
            +RYRECLKNHA + GGH VDGC EFMP G++GT ++LKCAAC CHRNFHRK         
Sbjct  47   MRYRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLDALKCAACGCHRNFHRKETEIVGGRG  106

Query  585  PMLPPQHYR-------------------GaapppppvrapaESSSEDLNAGGGQGLMQVP  707
              +P  + R                   G    PP   A  E +S   ++GG        
Sbjct  107  QRVPTYYNRPPQPHPPPGYLHLTSPTAAGQPYRPPMASADEEDTSNPSSSGG--------  158

Query  708  SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            ++ KRFRTKFT +QK++M  FAE++GWRIQK DD  V +FC+E GV+RQV K+WMHN
Sbjct  159  NTAKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHN  215



>ref|XP_009596948.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Nicotiana tomentosiformis]
Length=229

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 102/169 (60%), Gaps = 19/169 (11%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ----T  575
            +Y+ECLKNHA   GGH VDGCGEFMP G++GT ++LKCAACNCHRNFHRK          
Sbjct  52   KYKECLKNHAVGIGGHAVDGCGEFMPAGEDGTLDALKCAACNCHRNFHRKETQLHHLPYY  111

Query  576  QNPP------MLPPQHYRG--aapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrt  731
              PP      +LPPQ      +           E   E  N            +KKRFRT
Sbjct  112  GTPPCGYVQHVLPPQRPLALPSTSGGGGGGGYREDQEELCNPNNS-------VTKKRFRT  164

Query  732  kftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            +F Q+QK++M E AEK+GWRIQ+QD+  V + C+E+ +KR VFKVWMHN
Sbjct  165  RFNQEQKEKMLELAEKLGWRIQRQDEGVVQQLCNEICIKRHVFKVWMHN  213



>ref|XP_006413402.1| hypothetical protein EUTSA_v10026163mg [Eutrema salsugineum]
 dbj|BAJ34347.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54855.1| hypothetical protein EUTSA_v10026163mg [Eutrema salsugineum]
Length=227

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 106/177 (60%), Gaps = 27/177 (15%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
            IRYRECLKNHA + GGH VDGC EFMP G++G+ ++LKCAAC CHRNFHRK         
Sbjct  50   IRYRECLKNHAVNIGGHAVDGCCEFMPSGEDGSLDALKCAACGCHRNFHRKETEIIGGRA  109

Query  585  PMLPPQHYR-------------------GaapppppvrapaESSSEDLNAGGGQGLMQVP  707
              +P  + R                   G    PP   A  E +S   ++GG        
Sbjct  110  HRVPTYYNRPPQLPPPPGYLHLTSPATAGQPYRPPAASADQEDTSNPSSSGG--------  161

Query  708  SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            ++ KRFRTKFT +QK++M  FAE++GWRIQK DD  V +FC+E GV+RQV K+WMHN
Sbjct  162  TTAKRFRTKFTAEQKEKMLIFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHN  218



>ref|XP_010433740.1| PREDICTED: zinc-finger homeodomain protein 2-like [Camelina sativa]
Length=225

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 106/177 (60%), Gaps = 27/177 (15%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
            +RYRECLKNHA + GGH VDGC EFMP G++GT ++LKCAAC CHRNFHRK         
Sbjct  48   MRYRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLDALKCAACGCHRNFHRKETEIIGGRA  107

Query  585  PMLPPQHYR-------------------GaapppppvrapaESSSEDLNAGGGQGLMQVP  707
              +P  + R                   G    PP   A  E +S   ++GG        
Sbjct  108  HRVPTYYNRPPQPHPPPGYLHLASPVATGQPYRPPVGSADEEDTSNPSSSGG--------  159

Query  708  SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            ++ KRFRTKFT +QK++M  FAE++GWRIQK DD  V +FC+E GV+RQV K+WMHN
Sbjct  160  TTAKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHN  216



>ref|XP_010438998.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X3 
[Camelina sativa]
Length=225

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 105/176 (60%), Gaps = 27/176 (15%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            RYRECLKNHA + GGH VDGC EFMP G++GT ++LKCAAC CHRNFHRK          
Sbjct  49   RYRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLDALKCAACGCHRNFHRKETEIIGGRAN  108

Query  588  MLPPQHYR-------------------GaapppppvrapaESSSEDLNAGGGQGLMQVPS  710
             +P  + R                   G    PP   A  E +S   ++GG        +
Sbjct  109  RVPTYYNRPPQPHPPPGYLHLASPVGTGQPYRPPVGSADEEDTSNPSSSGG--------T  160

Query  711  SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            + KRFRTKFT +QK++M  FAE++GWRIQK DD  V +FC+E GV+RQV K+WMHN
Sbjct  161  TAKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHN  216



>ref|XP_010438997.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Camelina sativa]
Length=239

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 105/176 (60%), Gaps = 27/176 (15%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            RYRECLKNHA + GGH VDGC EFMP G++GT ++LKCAAC CHRNFHRK          
Sbjct  49   RYRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLDALKCAACGCHRNFHRKETEIIGGRAN  108

Query  588  MLPPQHYR-------------------GaapppppvrapaESSSEDLNAGGGQGLMQVPS  710
             +P  + R                   G    PP   A  E +S   ++GG        +
Sbjct  109  RVPTYYNRPPQPHPPPGYLHLASPVGTGQPYRPPVGSADEEDTSNPSSSGG--------T  160

Query  711  SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            + KRFRTKFT +QK++M  FAE++GWRIQK DD  V +FC+E GV+RQV K+WMHN
Sbjct  161  TAKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHN  216



>ref|XP_001778248.1| predicted protein [Physcomitrella patens]
 gb|EDQ56915.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 111/198 (56%), Gaps = 40/198 (20%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---------  557
             RYREC KNHAAS GGH +DGCGEFMPGG+EGT  +L+CAAC+CHRNFHR+         
Sbjct  62   FRYRECQKNHAASIGGHALDGCGEFMPGGQEGTVGALRCAACDCHRNFHRREVEGEVLCE  121

Query  558  -------------GITFQTQNP-------PM----LPPQHYRGaapppppvrapaESSSE  665
                         GI    Q P       PM    LPP            + A   + S+
Sbjct  122  CKRKPKPGMQLGAGIVTPHQLPGGTNTSTPMGALALPPSAGAMTPLTTAALSAGGLTDSD  181

Query  666  DLN------AGGGQGLMQVPSSkkrf-rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
            + +      AGG    M+ PS+ K+  RTKF+ +QK QM  FAE++GWRIQK D+  V +
Sbjct  182  EQDDGLGNSAGGMMISMRSPSAIKKRFRTKFSTEQKDQMCAFAEELGWRIQKHDEAAVQE  241

Query  825  FCSEVGVKRQVFKVWMHN  878
            FC+ VGVKR V KVWMHN
Sbjct  242  FCTTVGVKRHVLKVWMHN  259



>ref|XP_003519839.2| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=295

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 111/190 (58%), Gaps = 33/190 (17%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKG------ITF  569
            RYRECLKNHA   GGH +DGCGEFM  G EGT ++LKCAAC+CHRNFHRK       + F
Sbjct  97   RYRECLKNHAVGIGGHALDGCGEFMAAGMEGTLDALKCAACSCHRNFHRKEADSSAVVAF  156

Query  570  QTQNPPML-----PPQ---HYRGaapppppvrapaESSS------EDLNAGGG-------  686
               +P ++     PPQ   +YR  A           S+          + GGG       
Sbjct  157  SGGDPYLIPHHHPPPQFAAYYRHPAGYLHVAGQQHRSAVGGTLALPSTSGGGGTQSTRED  216

Query  687  -QGLMQVPS-----SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVK  848
             + +   PS     SKKRFRTKFT +QK++M E AEK+GWRIQKQD+  V  FC+E GVK
Sbjct  217  QEDISNNPSAGGTGSKKRFRTKFTVEQKEKMLELAEKLGWRIQKQDEAVVQAFCNETGVK  276

Query  849  RQVFKVWMHN  878
            R V KVWMHN
Sbjct  277  RHVLKVWMHN  286



>ref|XP_010448536.1| PREDICTED: zinc-finger homeodomain protein 2 [Camelina sativa]
Length=224

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 105/176 (60%), Gaps = 27/176 (15%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            RYRECLKNHA + GGH VDGC EFMP G++GT ++LKCAAC CHRNFHRK          
Sbjct  48   RYRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLDALKCAACGCHRNFHRKETEIIGGRAH  107

Query  588  MLPPQHYR-------------------GaapppppvrapaESSSEDLNAGGGQGLMQVPS  710
             +P  + R                   G    PP   A  E +S   ++GG        +
Sbjct  108  RVPTYYNRPPHPHPPPGYLHLTSPPAAGQPYRPPVGSADEEDTSNPSSSGG--------T  159

Query  711  SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            + KRFRTKFT +QK++M  FAE++GWRIQK DD  V +FC+E GV+RQV K+WMHN
Sbjct  160  TAKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHN  215



>ref|XP_003622365.1| Zinc finger-homeodomain protein [Medicago truncatula]
 gb|AFK37422.1| unknown [Medicago truncatula]
 gb|KEH42846.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=191

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 96/174 (55%), Gaps = 14/174 (8%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQ  578
             +++Y+ECLKNHAA+ GG+ +DGCGEFMP G+  T E+LKC ACNCHRNFHRK I     
Sbjct  5    IVVKYKECLKNHAATIGGNAIDGCGEFMPSGENDTLEALKCCACNCHRNFHRKEIESDFN  64

Query  579  NP-------PMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkf  737
            +P        ++P  +              +ES+S    +   +  ++   ++       
Sbjct  65   SPSQHYANLSLIPDHNINAPFLAHFSPNNKSESTSPSDQSYYEKDFIKDVENRTEKMILK  124

Query  738  tqqqkqqMHE-------FAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             + + +   E       FAEK  WRIQK ++  V KFC E+G+KR++ KVWMHN
Sbjct  125  KRSRTKFSKEQKEKMLCFAEKAEWRIQKLEESVVQKFCQEIGIKRRILKVWMHN  178



>ref|XP_010438996.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Camelina sativa]
Length=259

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 105/176 (60%), Gaps = 27/176 (15%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            RYRECLKNHA + GGH VDGC EFMP G++GT ++LKCAAC CHRNFHRK          
Sbjct  49   RYRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLDALKCAACGCHRNFHRKETEIIGGRAN  108

Query  588  MLPPQHYR-------------------GaapppppvrapaESSSEDLNAGGGQGLMQVPS  710
             +P  + R                   G    PP   A  E +S   ++GG        +
Sbjct  109  RVPTYYNRPPQPHPPPGYLHLASPVGTGQPYRPPVGSADEEDTSNPSSSGG--------T  160

Query  711  SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            + KRFRTKFT +QK++M  FAE++GWRIQK DD  V +FC+E GV+RQV K+WMHN
Sbjct  161  TAKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHN  216



>ref|XP_009607017.1| PREDICTED: zinc-finger homeodomain protein 4-like [Nicotiana 
tomentosiformis]
Length=261

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 104/176 (59%), Gaps = 17/176 (10%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            +++Y+ECLKNHAA+ GG+  DGCGEFMP G+EGT E L C+ CNCHRNFHRK    +   
Sbjct  67   MVKYKECLKNHAAAMGGNATDGCGEFMPSGEEGTFEFLTCSVCNCHRNFHRKETEGELIR  126

Query  582  PPMLPPQH----YRGaapppppvrapaES--------SSEDLNAGGGQGLMQVPSSkkrf  725
               +   H    Y  +   P  +     +          ED    GG G+M  P + ++ 
Sbjct  127  KVYVGHPHKAFVYAASRAAPHQMIMSYNNHLGSFPYIEQEDGIINGGCGVMARPLNYQQL  186

Query  726  rtkf-----tqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              K      +Q+QK++M  FAEKIGW++QKQ+D  V +FC EVGVKR+V KVWMHN
Sbjct  187  VKKRFRTKFSQEQKEKMLNFAEKIGWKMQKQEDAMVQQFCQEVGVKRRVLKVWMHN  242



>ref|NP_172896.1| homeobox protein 31 [Arabidopsis thaliana]
 ref|NP_973826.1| homeobox protein 31 [Arabidopsis thaliana]
 sp|Q9M9S0.1|ZHD4_ARATH RecName: Full=Zinc-finger homeodomain protein 4; Short=AtZHD4; 
AltName: Full=Homeobox protein 31; Short=AtHB-31; AltName: 
Full=Protein FLORAL TRANSITION AT THE MERISTEM 2 [Arabidopsis 
thaliana]
 gb|AAF43944.1|AC012188_21 Contains similarity to a hypothetical protein from Arabidopsis 
thaliana gb|AC004136.2 [Arabidopsis thaliana]
 gb|AAL66963.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20372.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH30294.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29163.1| homeobox protein 31 [Arabidopsis thaliana]
 gb|AEE29164.1| homeobox protein 31 [Arabidopsis thaliana]
Length=312

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 114/186 (61%), Gaps = 27/186 (15%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT--  575
            +I+Y+ECLKNHAA+ GG+  DGCGEFMP G++G+ E+L C+ACNCHRNFHRK +  +   
Sbjct  87   MIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHRNFHRKEVEGELAA  146

Query  576  -------QNPP----MLPPQHYRGaap--------ppppvrapaESSSEDLNAGGG----  686
                   Q+PP    ML  Q  R A P                  S SED     G    
Sbjct  147  TAMSPYHQHPPHRKLMLNHQKIRSAMPHQMIMPIGVSNYRYMHNNSESEDFMEEDGVTTA  206

Query  687  -QGLMQVPSSkkrf-rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVF  860
             + L  +P ++K+  RTKFT +QK++M  FAEK+GW+IQ+Q+D  V +FC E+GVKR+V 
Sbjct  207  SRSLPNLPYNQKKRFRTKFTPEQKEKMLSFAEKVGWKIQRQEDCVVQRFCEEIGVKRRVL  266

Query  861  KVWMHN  878
            KVWMHN
Sbjct  267  KVWMHN  272



>ref|XP_006305389.1| hypothetical protein CARUB_v10009782mg [Capsella rubella]
 ref|XP_006305390.1| hypothetical protein CARUB_v10009782mg [Capsella rubella]
 gb|EOA38287.1| hypothetical protein CARUB_v10009782mg [Capsella rubella]
 gb|EOA38288.1| hypothetical protein CARUB_v10009782mg [Capsella rubella]
Length=317

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 111/185 (60%), Gaps = 26/185 (14%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI------  563
            +++Y+ECLKNHAA+ GG+  DGCGEFMP G++G+ E+L C+ACNCHRNFHRK +      
Sbjct  92   MVKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHRNFHRKEVEGEPAM  151

Query  564  -TFQTQNPP---MLPPQHYRGaap--------ppppvrapaESSSEDLNAGGGQGLMQVP  707
              +  Q PP   ML     R A P                  S S+D     G G+    
Sbjct  152  SPYHQQPPPRKLMLNHHKIRSAMPHQMIMPIGVSNYRYMHNNSESDDFMEEDGVGVTAAS  211

Query  708  SS--------kkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFK  863
             S        KKRFRTKFT +QK++M  FAEK+GW+IQ+Q+D  V +FC E+GVKR+V K
Sbjct  212  RSLPHMPYNQKKRFRTKFTPEQKEKMLNFAEKVGWKIQRQEDCVVQRFCEEIGVKRRVLK  271

Query  864  VWMHN  878
            VWMHN
Sbjct  272  VWMHN  276



>ref|XP_009416998.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416999.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=267

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 107/187 (57%), Gaps = 27/187 (14%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHR--------  554
             ++RYRECLKNHAAS GG+  DGCGEFMP G+EGT E+LKC+AC+CHRNFHR        
Sbjct  67   VVVRYRECLKNHAASIGGNATDGCGEFMPSGEEGTLEALKCSACSCHRNFHRKETEGEPC  126

Query  555  ---------------KGITFQTQNP----PMLPPQHYRGaapppppvrapaESSSEDLNA  677
                           KG+     +     P       R             ++S  D   
Sbjct  127  CDWFYPLRGRKVMGHKGLLISGSDAFGYSPACNSLIPRATPHNMIMPLGVMQTSESDEME  186

Query  678  GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQV  857
            G G  + +    KKRFRTKFT +QK++M  FAEK+GWR+QKQ++  V +FC E+GVKR+V
Sbjct  187  GVGAMMARPVVVKKRFRTKFTPEQKEKMLSFAEKVGWRLQKQEESVVQQFCQEIGVKRRV  246

Query  858  FKVWMHN  878
             KVWMHN
Sbjct  247  LKVWMHN  253



>gb|AAZ07989.1| zinc finger homeodomain protein 1 [Physcomitrella patens]
Length=340

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 111/198 (56%), Gaps = 40/198 (20%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---------  557
             RYREC KNHAAS GGH +DGCGEFMPGG+EGT  +L+CAAC+CHRNFHR+         
Sbjct  134  FRYRECQKNHAASIGGHALDGCGEFMPGGQEGTVGALRCAACDCHRNFHRREVEGEVLCE  193

Query  558  -------------GITFQTQNP-------PM----LPPQHYRGaapppppvrapaESSSE  665
                         GI    Q P       PM    LPP            + A   + S+
Sbjct  194  CKRKPKPGMQLGAGIVTPHQLPGGTNTSTPMGALALPPSAGAMTPLTTAALSAGGLTDSD  253

Query  666  DLN------AGGGQGLMQVPSSkkrf-rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
            + +      AGG    M+ PS+ K+  RTKF+ +QK QM  FAE++GWRIQK D+  V +
Sbjct  254  EQDDGLGNSAGGMMISMRSPSAIKKRFRTKFSTEQKDQMCAFAEELGWRIQKHDEAAVQE  313

Query  825  FCSEVGVKRQVFKVWMHN  878
            FC+ VGVKR V KVWMHN
Sbjct  314  FCTTVGVKRHVLKVWMHN  331



>ref|XP_009392577.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=257

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 107/187 (57%), Gaps = 31/187 (17%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQ  578
             +++YREC KNHAAS GG   DGCGEFMP G+EGTPE+LKC+AC CHRNFHRK    +T+
Sbjct  61   VVVKYRECHKNHAASIGGSATDGCGEFMPSGEEGTPEALKCSACGCHRNFHRK----ETE  116

Query  579  NPPMLPPQH-YRGaapppppvrapaESS-------------------------SEDLNAG  680
              P     H +RG              S                         SE     
Sbjct  117  GEPSCDCFHPFRGRKVMMGQKGFLVSGSDAFGYSPASNSLVPRVVMPLGAMQTSESDEME  176

Query  681  GGQGLMQVPSSkkrf-rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQV  857
            G  G++ +P+  K+  RT+FT +QK++M  FAEK+GWR+QKQ++  V +FC E GVKR+V
Sbjct  177  GVGGMVPMPAMVKKRFRTRFTTEQKEKMLSFAEKVGWRLQKQEESVVQQFCQETGVKRRV  236

Query  858  FKVWMHN  878
             KVWMHN
Sbjct  237  LKVWMHN  243



>ref|XP_006280898.1| hypothetical protein CARUB_v10026891mg [Capsella rubella]
 gb|EOA13796.1| hypothetical protein CARUB_v10026891mg [Capsella rubella]
Length=292

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 98/177 (55%), Gaps = 19/177 (11%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITF-----  569
             R+RECLKN A + GGH VDGCGEFMP G EGT ++LKCAAC CHRNFHRK + +     
Sbjct  77   FRFRECLKNQAVNIGGHAVDGCGEFMPAGIEGTIDALKCAACGCHRNFHRKELPYFHHAP  136

Query  570  --------------QTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVP  707
                          +   P    P   +             E S + +     +      
Sbjct  137  PQHQAPPPPPPGFYRLPAPVSYRPPPSQAPPLQLALPPPQRERSEDPMETSSAEAGGGGG  196

Query  708  SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              +KRFRTKFT +QK++M   AE+IGWRIQ+QDDE + +FC E GV RQV KVW+HN
Sbjct  197  GIRKRFRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHN  253



>ref|XP_001785616.1| predicted protein [Physcomitrella patens]
 gb|EDQ49563.1| predicted protein [Physcomitrella patens]
Length=315

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 109/200 (55%), Gaps = 42/200 (21%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT---  575
            +RYREC KNHAA  GGH +DGCGEFMPGG EG+ ++L+CAACNCHRNFHR+ +  +    
Sbjct  107  VRYRECQKNHAAGMGGHAMDGCGEFMPGGGEGSVDALRCAACNCHRNFHRREVEGEVLCD  166

Query  576  --QNPPM-----------------------------------LPPQHYRGaapppppvra  644
              + P M                                   + P      +   P    
Sbjct  167  CKRKPKMGAPLGTGIVNTGQPPTLTSTTPVTTLALTASVAGQMTPLAMAALSAGGPTDSD  226

Query  645  paESSSEDLNAGGGQGL-MQVPSSkkrf-rtkftqqqkqqMHEFAEKIGWRIQKQDDEEV  818
              +    ++ +GGG  + M+ PS+ K+  RTKFT +QK +M  FAEK+GWRIQK D+  V
Sbjct  227  EQDDGPGNVTSGGGMMMSMRSPSAIKKRFRTKFTTEQKDKMCAFAEKLGWRIQKHDEAAV  286

Query  819  HKFCSEVGVKRQVFKVWMHN  878
             +FC+ VGVKR V KVWMHN
Sbjct  287  QEFCTTVGVKRHVLKVWMHN  306



>ref|XP_007154109.1| hypothetical protein PHAVU_003G091100g [Phaseolus vulgaris]
 gb|ESW26103.1| hypothetical protein PHAVU_003G091100g [Phaseolus vulgaris]
Length=271

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 111/190 (58%), Gaps = 32/190 (17%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            ++RYRECLKNHAA+ GG+  DGCGEFMP G+EGT E+L C+AC+CHRNFHRK +  +  +
Sbjct  68   MVRYRECLKNHAAAMGGNATDGCGEFMPSGEEGTIEALNCSACHCHRNFHRKEVEGEAAS  127

Query  582  --------------------PP---------MLPPQHYRGaapppppvrapaESSSEDLN  674
                                PP         +LP +         P       S S++  
Sbjct  128  CDYHPFNRRRLILGPHKNLLPPEALGYPTGNILPSRSVPPHQMIMPYSIGHLPSESDEQE  187

Query  675  AGGGQGLMQVPSSkkrf--rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVK  848
             GGG  +   PS   +   RTKFTQ+QK++M  FAE++GW+IQKQ++  V +FC E+GVK
Sbjct  188  DGGGM-VQPRPSQLVKKRFRTKFTQEQKEKMLNFAERVGWKIQKQEESVVQQFCQEIGVK  246

Query  849  RQVFKVWMHN  878
            R+V KVWMHN
Sbjct  247  RRVLKVWMHN  256



>ref|XP_009613099.1| PREDICTED: zinc-finger homeodomain protein 4 [Nicotiana tomentosiformis]
Length=304

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 119/211 (56%), Gaps = 52/211 (25%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ---  572
            ++RY+ECLKNHAA+ GG+  DGCGEFMP G+EGT E+L C+ACNCHRNFHRK +  +   
Sbjct  75   IVRYKECLKNHAAAMGGNATDGCGEFMPSGEEGTIEALICSACNCHRNFHRKEMEGEQQL  134

Query  573  TQNPP-----------------------------------MLP-----PQHYRGaapppp  632
             Q PP                                   ++P     P H++       
Sbjct  135  LQLPPSSCDYYNLNRGGKKVYLGHSHNHHKGLLGPEPFGTIIPSRAAAPHHHQMIMSYNN  194

Query  633  pvrapaESSS-EDLNAGGGQGLMQVPSS--------kkrfrtkftqqqkqqMHEFAEKIG  785
                P+ES   ED+N GGG   M +           KKRFRTKFTQ+QK++M  FAEK+G
Sbjct  195  MGSLPSESEEHEDINGGGGVMAMAMARPLHHHNQIVKKRFRTKFTQEQKEKMFNFAEKVG  254

Query  786  WRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            W+IQKQ++  V +FC E+G+KR+V KVWMHN
Sbjct  255  WKIQKQEETVVQQFCQELGIKRRVLKVWMHN  285



>ref|XP_006841247.1| hypothetical protein AMTR_s00135p00085840 [Amborella trichopoda]
 gb|ERN02922.1| hypothetical protein AMTR_s00135p00085840 [Amborella trichopoda]
Length=231

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 114/186 (61%), Gaps = 35/186 (19%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---GITF  569
            T  RYRECLKNHA S GGH VDGCGEFMP G++G+  +LKCAAC CHRNFHRK   G  F
Sbjct  42   TANRYRECLKNHAVSMGGHAVDGCGEFMPAGEDGSLGALKCAACGCHRNFHRKESDGEIF  101

Query  570  QTQNPPMLPPQHYRGaapppppvrapaE--------SSS-------EDL-NAGG------  683
            +        P  Y G+   P P  A A         SSS       ED+ N  G      
Sbjct  102  RQY------PHFYGGSVGGPAPYAAAAHRAAPLALPSSSGGHSRDDEDVSNVPGSGAGHS  155

Query  684  -GQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVF  860
             GQGL  +   KKRFRTKF+Q+QK +M  FAEK+GWRIQKQD+ EV +FC+E  VKR V 
Sbjct  156  HGQGLGVI---KKRFRTKFSQEQKDKMLAFAEKVGWRIQKQDEAEVQRFCAEACVKRHVL  212

Query  861  KVWMHN  878
            KVWMHN
Sbjct  213  KVWMHN  218



>ref|XP_009117900.1| PREDICTED: zinc-finger homeodomain protein 4-like [Brassica rapa]
 ref|XP_009117901.1| PREDICTED: zinc-finger homeodomain protein 4-like [Brassica rapa]
 emb|CDY53549.1| BnaA09g57080D [Brassica napus]
Length=314

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 112/182 (62%), Gaps = 23/182 (13%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT--  575
            +I Y+ECLKNHAA+ GG+  DGCGEFMP G++G+ E+L C+ACNCHRNFHRK +  +T  
Sbjct  90   IITYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHRNFHRKEVEGETAA  149

Query  576  -------QNPP----MLPPQHYRGaappp-------ppvrapaESSSEDLNAGGGQGLMQ  701
                   Q PP    ML   + R A P            R    S S+D     G     
Sbjct  150  TAISSFHQPPPPRKLMLNHHNIRSAMPHKMIMPVGVSNYRYMHHSESDDFMEEDGVTTAS  209

Query  702  VP---SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWM  872
             P   + KKRFRTKFT +QK++M  FAEK+GW++Q+Q+D  V +FC E+GVKR+V KVWM
Sbjct  210  RPPPYNQKKRFRTKFTPEQKEKMLSFAEKVGWKLQRQEDSVVQRFCEEIGVKRRVLKVWM  269

Query  873  HN  878
            HN
Sbjct  270  HN  271



>ref|XP_006426395.1| hypothetical protein CICLE_v10027184mg [Citrus clementina]
 gb|ESR39635.1| hypothetical protein CICLE_v10027184mg [Citrus clementina]
Length=219

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 95/169 (56%), Gaps = 14/169 (8%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            ++RY+ECLKNHAA+ GG   DGCGEFMP G+EG+ ESLKC+ACNCHRNFHRK I      
Sbjct  41   VVRYKECLKNHAAAIGGSATDGCGEFMPSGEEGSIESLKCSACNCHRNFHRKEIGCDAHY  100

Query  582  PPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqq----  749
              +    H +          +   +S E +   G       P+     + +   ++    
Sbjct  101  HHL----HQQAMMMLSGNSGSAHSASDEKVERRGVVVGRPAPADDDDHQKRMMMRKRFRT  156

Query  750  ------kqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
                  K++M  FAE+  WRIQK D+  V +FC E+G+KR+V KVWMHN
Sbjct  157  KFTQEQKEKMLSFAERADWRIQKLDESVVQQFCQEIGIKRRVLKVWMHN  205



>emb|CDX81638.1| BnaC08g39630D [Brassica napus]
Length=315

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 111/182 (61%), Gaps = 23/182 (13%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT--  575
            +I Y+ECLKNHAA+ GG+  DGCGEFMP G++G+ E+L C+ACNCHRNFHRK +  +T  
Sbjct  91   IITYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHRNFHRKEVEGETAT  150

Query  576  -------QNPP----MLPPQHYRGaa-------pppppvrapaESSSEDLNAGGGQGLMQ  701
                   Q PP    ML   + R A              R    S S+D     G     
Sbjct  151  TAISSFHQPPPPRKLMLNHHNIRSAMPHQMIMPVGVSNYRYMHHSESDDFMEEDGVTTAS  210

Query  702  VP---SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWM  872
             P   + KKRFRTKFT +QK++M  FAEK+GW++Q+Q+D  V +FC E+GVKR+V KVWM
Sbjct  211  RPPPYNPKKRFRTKFTPEQKEKMLSFAEKVGWKLQRQEDSVVQRFCEEIGVKRRVLKVWM  270

Query  873  HN  878
            HN
Sbjct  271  HN  272



>gb|EPS61017.1| hypothetical protein M569_13783, partial [Genlisea aurea]
Length=244

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 107/203 (53%), Gaps = 49/203 (24%)
 Frame = +3

Query  384  TSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK--  557
            +SH  T  RYRECLKNHA   GGH +DGCGEF+  G+EGT ESLKCAAC+CHRNFHR+  
Sbjct  45   SSHAKT--RYRECLKNHAVGIGGHALDGCGEFIAAGEEGTLESLKCAACSCHRNFHRREN  102

Query  558  --GITF---------------------------------QTQNPPMLPPQHYRGaapppp  632
              G+ F                                 Q + PP+L      G   P  
Sbjct  103  DGGVPFNFHHHQQQLLLAHHPHAHFGYRGPSGYLHLTPPQNRAPPLLALPSSSGGGAPAG  162

Query  633  pvrapaES-SSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDD  809
              R   E   S   ++GGG+   +   +         Q+QK +M  F+E++GWRIQKQD+
Sbjct  163  GSRDEMEDYYSNPSSSGGGKKRFRTKFT---------QEQKDKMLNFSERLGWRIQKQDE  213

Query  810  EEVHKFCSEVGVKRQVFKVWMHN  878
            E V +FC EVG+KR V KVWMHN
Sbjct  214  ELVQQFCHEVGIKRHVLKVWMHN  236



>gb|ABY61029.1| zinc finger-homeodomain protein 1 [Asparagus officinalis]
Length=274

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 114/187 (61%), Gaps = 19/187 (10%)
 Frame = +3

Query  354  QVLLPQRFADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACN  533
            Q ++P++ A       +++YRECLKNHAAS GG+  DGCGEFMP G+EGT E+LKC+AC 
Sbjct  58   QAIVPKKPA------AVVKYRECLKNHAASIGGNATDGCGEFMPSGEEGTLEALKCSACG  111

Query  534  CHRNFHRK---GITFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLM--  698
            CHRNFHRK   G  F   NP     +++ G       +       S  +  G    +   
Sbjct  112  CHRNFHRKETEGDPF-GGNPSCDCRRNFIGGHGHKGVLIPRPTPHSMIMPLGAASAMQTS  170

Query  699  -------QVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQV  857
                   + P  KKRFRTKF+ +QK++M  FAE+ GW++QKQ++  V +FC E+GVKR+V
Sbjct  171  ESDEMMPRPPLMKKRFRTKFSAEQKEKMLAFAERAGWKLQKQEEGVVQRFCQEIGVKRRV  230

Query  858  FKVWMHN  878
             KVWMHN
Sbjct  231  LKVWMHN  237



>ref|XP_009150629.1| PREDICTED: zinc-finger homeodomain protein 1-like [Brassica rapa]
Length=293

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 102/184 (55%), Gaps = 32/184 (17%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT------  566
             R+RECLKN A + GGH VDGCGEFMP G EGT ++LKCAAC CHRNFHRK +       
Sbjct  79   FRFRECLKNQAVNIGGHAVDGCGEFMPAGIEGTIDALKCAACGCHRNFHRKELPYFHHHA  138

Query  567  -------------FQTQNPPM--LPPQHYRGaapppppvrapaESSSEDLN-----AGGG  686
                         F     P+   PP           P     E S + +      AGGG
Sbjct  139  PPHQPPPPPPPPGFYRLPAPVSYRPPPSQAPPLQLALPPPPQRERSEDRMETSSAEAGGG  198

Query  687  QGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKV  866
             G+ +      RFRTKFT +QK++M   AE IGWRIQ+QDDE + +FC E GV RQV KV
Sbjct  199  SGIRK------RFRTKFTPEQKERMLALAESIGWRIQRQDDEVIQRFCQETGVPRQVLKV  252

Query  867  WMHN  878
            W+HN
Sbjct  253  WLHN  256



>ref|XP_006385095.1| hypothetical protein POPTR_0004s23860g, partial [Populus trichocarpa]
 gb|ERP62892.1| hypothetical protein POPTR_0004s23860g, partial [Populus trichocarpa]
Length=312

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 107/202 (53%), Gaps = 43/202 (21%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK--------  557
            ++RYRECLKNHAAS GG+  DGCGEFMP G+EG+ E+L C+ACNCHRNFHRK        
Sbjct  92   MVRYRECLKNHAASMGGNATDGCGEFMPSGEEGSIEALTCSACNCHRNFHRKEIEGEHTS  151

Query  558  ---------------------------------GITFQTQNPPMLPPQHYRGaapppppv  638
                                              + + T    ++P +            
Sbjct  152  CTGDHCYHNSPVHFNRLGRKVILGHHKSILAPEALGYPTATGTLIPSRASAPHHQMIMSY  211

Query  639  rapaESSSEDLNAGGGQGLMQVPSSkkrfr--tkftqqqkqqMHEFAEKIGWRIQKQDDE  812
               +  S  D    GG  LM  P+   + R  TKF+Q+QK++M  FAEK+GW++QKQ++ 
Sbjct  212  NMGSLPSESDEQEDGGGVLMARPAQLMKKRFRTKFSQEQKEKMLNFAEKVGWKLQKQEET  271

Query  813  EVHKFCSEVGVKRQVFKVWMHN  878
             V +FC E+GVKR+V KVWMHN
Sbjct  272  VVQQFCQEIGVKRRVLKVWMHN  293



>gb|EYU31214.1| hypothetical protein MIMGU_mgv1a022645mg [Erythranthe guttata]
Length=255

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 103/162 (64%), Gaps = 6/162 (4%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
            ++Y ECLKNHAA+ GG   DGCGEFM GG+EG+ E+LKC+ACNCHRNFHRK    +  + 
Sbjct  76   VKYMECLKNHAAAIGGTATDGCGEFMAGGEEGSLEALKCSACNCHRNFHRKIQLAEHHHQ  135

Query  585  PMLPPQHYRGaapppppvrapaESSSEDLNAGGG----QGLMQVPSSkkrfrtkftqqqk  752
             M   +  R  +     +    E++   L  GGG      L      KKR+RTKF+Q+QK
Sbjct  136  LMFMKK--RSTSGSGVYINGAGEAAEIGLAIGGGGHNQTSLSSGELGKKRYRTKFSQEQK  193

Query  753  qqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            ++M  FAE+  W+I K D+ EV  FC E+G+KR+V KVWMHN
Sbjct  194  EKMQVFAERASWKITKLDESEVRSFCQEIGIKRKVLKVWMHN  235



>ref|XP_003551238.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=250

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 109/189 (58%), Gaps = 36/189 (19%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            +Y+ECLKNHA   GGH +DGC EF+P G+EGT ++LKCAACNCHRNFHRK    +T +  
Sbjct  57   KYQECLKNHAVGIGGHALDGCAEFLPAGEEGTLDALKCAACNCHRNFHRK----ETPDGT  112

Query  588  MLPPQH-------------YRGaapppppvrapaESSSEDLNAGGG--------QGLMQV  704
             L P H             YR  A           + +    +GGG        QG +  
Sbjct  113  YLLPFHHRHQPPPPPFAPYYRAPAGYLHMTGPQHATLALPSTSGGGGTQSPREDQGDLSD  172

Query  705  P-----------SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKR  851
            P           SSKKRFRTKFTQQQK +M  FAEK+GWRIQK D+  V +FCSE GV+R
Sbjct  173  PPTSGATTHGGSSSKKRFRTKFTQQQKDKMLAFAEKLGWRIQKHDEGVVQEFCSETGVQR  232

Query  852  QVFKVWMHN  878
             V KVWMHN
Sbjct  233  HVLKVWMHN  241



>ref|XP_002892806.1| ATHB31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69065.1| ATHB31 [Arabidopsis lyrata subsp. lyrata]
Length=311

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 113/186 (61%), Gaps = 27/186 (15%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK--------  557
            +I+Y+ECLKNHAA+ GG+  DGCGEFMP G++G+ E+L C+ACNCHRNFHRK        
Sbjct  86   MIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHRNFHRKEVEGEPAA  145

Query  558  -GITFQTQNPP----MLPPQHYRGaap--------ppppvrapaESSSEDLNAGGG----  686
              I+   Q PP    ML     R A P                  S SED     G    
Sbjct  146  TAISPYHQPPPHRKLMLNHHKIRSAMPHQMIMPIGVSNYRYMHNNSESEDFMEEDGVTTA  205

Query  687  -QGLMQVP-SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVF  860
             + L  +P + KKRFRTKFT +QK++M  FAEK+GW+IQ+Q+D  V +FC E+GVKR+V 
Sbjct  206  SRSLPNLPFNQKKRFRTKFTPEQKEKMLSFAEKVGWKIQRQEDCVVQRFCEEIGVKRRVL  265

Query  861  KVWMHN  878
            KVWMHN
Sbjct  266  KVWMHN  271



>ref|XP_006878601.1| hypothetical protein AMTR_s00011p00255340 [Amborella trichopoda]
 gb|ERM94746.1| hypothetical protein AMTR_s00011p00255340 [Amborella trichopoda]
Length=242

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 110/190 (58%), Gaps = 39/190 (21%)
 Frame = +3

Query  411  YRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT-----  575
            Y ECLKNHAA+ GGH +DGC EFMP G+EG+ ESLKCAACNCHRNFHRK     +     
Sbjct  47   YGECLKNHAAAIGGHALDGCCEFMPSGEEGSIESLKCAACNCHRNFHRKDSEENSIPQSC  106

Query  576  ------------QNPPMLP----PQHYRGaapppppvrapaESSSEDLN-----------  674
                         N   LP    PQ      P       P +SSSEDL+           
Sbjct  107  LYCYHRSPKAVKSNNHFLPLPSSPQGVIPGPPFSMVAFGPNDSSSEDLHNQVIRPMCVVS  166

Query  675  --AGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVK  848
              + G +G     S  KRFRTKFTQ+QK++M  FAE++GWRIQKQD+  V +FC EVGVK
Sbjct  167  KQSNGNKG-----SDHKRFRTKFTQEQKERMLGFAERVGWRIQKQDEGAVQRFCDEVGVK  221

Query  849  RQVFKVWMHN  878
            R V KVWMHN
Sbjct  222  RHVLKVWMHN  231



>ref|XP_007023152.1| Homeobox protein 31 [Theobroma cacao]
 gb|EOY25774.1| Homeobox protein 31 [Theobroma cacao]
Length=292

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 116/219 (53%), Gaps = 47/219 (21%)
 Frame = +3

Query  363  LPQRFADTSHT--TTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNC  536
            +P    D  H     ++RYRECLKNHAA+ GG+  DGCGEFMP G+EG+ E+L C+ACNC
Sbjct  51   IPTNLDDDHHVGFKKVVRYRECLKNHAAAMGGNATDGCGEFMPSGEEGSIEALTCSACNC  110

Query  537  HRNFHRKGI-------------------------TFQTQNPPMLPPQ-------------  602
            HRNFHRK I                          F   +  +LPP+             
Sbjct  111  HRNFHRKEIEGEPSPSSCDCYPSHSPHLSRAGRKLFLGHHKSILPPEALGLGYPTATGTL  170

Query  603  -HYRGa------apppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqM  761
             H R A                  S S+D   GGG         KKRFRTKFTQ+QK++M
Sbjct  171  IHSRAAPTPTPHQMIMSYNMGSLPSESDDQADGGGVVTRPHQLVKKRFRTKFTQEQKEKM  230

Query  762  HEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              FA+K+GW+IQKQ++  V +FC E+GVKR+V KVWMHN
Sbjct  231  LNFADKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHN  269



>ref|XP_007156949.1| hypothetical protein PHAVU_002G031000g [Phaseolus vulgaris]
 gb|ESW28943.1| hypothetical protein PHAVU_002G031000g [Phaseolus vulgaris]
Length=353

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 118/214 (55%), Gaps = 59/214 (28%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAAC----NCHR----------  542
            IRYRECL+NHAAS G HVVDGCGEFM  G+EGTPESL+CAAC    N HR          
Sbjct  137  IRYRECLRNHAASMGSHVVDGCGEFMASGEEGTPESLRCAACECHRNFHRKEVEGELQPQ  196

Query  543  -------------------------NFHRKGITFQTQNPPMLPPQHYRGaapppppvrap  647
                                     N H   + + T +P  L   H+R       P   P
Sbjct  197  QPPPLSLLPQQQQQQHAPNYHSYYPNNHNGHLHYPTPSPSSL---HHRLVGSSGTPSLVP  253

Query  648  ---------aESSSEDLN-----AGGGQGLMQVP---SSkkrfrtkftqqqkqqMHEFAE  776
                     AESSSEDLN      GG    + V    SSKKRFRTKF++QQK +M EFAE
Sbjct  254  PVMMAFGGPAESSSEDLNMFQSNTGGAHAQLSVQAPVSSKKRFRTKFSKQQKDRMMEFAE  313

Query  777  KIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            KIGW+IQK +++EV  FCS+ GVKRQVFKVWMHN
Sbjct  314  KIGWKIQKHNEQEVQHFCSQAGVKRQVFKVWMHN  347



>ref|XP_006466561.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis]
Length=219

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 102/170 (60%), Gaps = 16/170 (9%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT-----  566
            ++RY+ECLKNHAA+ GG   DGCGEFMP G+EG+ ESLKC+ACNCHRNFHRK I      
Sbjct  41   VVRYKECLKNHAAAIGGSATDGCGEFMPSGEEGSIESLKCSACNCHRNFHRKEIGCDAHY  100

Query  567  --FQTQNPPMLP----PQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfr  728
                 Q   ML       H                 +  D +    + +M+     KRFR
Sbjct  101  HHLHQQAMMMLSGNSGSAHSASDEKDERRGVVVGRPAPADDDDHQKRMMMR-----KRFR  155

Query  729  tkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            TKFTQ+QK++M  FAE+  WRIQK D+  V +FC EVG+KR+V KVWMHN
Sbjct  156  TKFTQEQKEKMLSFAERADWRIQKLDESVVQQFCQEVGIKRRVLKVWMHN  205



>emb|CBI19232.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 96/162 (59%), Gaps = 33/162 (20%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---GITFQTQ  578
            RYRECLKNHA   GGH VDGCGEFMP G EGT + L+CAACNCHRNFHRK   G T   Q
Sbjct  104  RYRECLKNHAVGIGGHAVDGCGEFMPAGDEGTLDGLRCAACNCHRNFHRKESEGDTLYHQ  163

Query  579  NPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSS--kkrfrtkftqqqk  752
              P     +YR  A                       G + V  S  KKRFRTKFTQ+QK
Sbjct  164  FSP-----YYRTPA-----------------------GYLHVAPSHLKKRFRTKFTQEQK  195

Query  753  qqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             +M  FAE +GWRIQK D+  V +FC E  VKR V KVWMHN
Sbjct  196  DKMLAFAETLGWRIQKHDEAAVQQFCQETCVKRHVLKVWMHN  237



>ref|XP_010444532.1| PREDICTED: zinc-finger homeodomain protein 1 [Camelina sativa]
Length=285

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 99/184 (54%), Gaps = 35/184 (19%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
             R+RECLKN A + GGH VDGCGEFMP G EGT ++LKCAAC CHRNFHRK + +    P
Sbjct  75   FRFRECLKNQAVNIGGHAVDGCGEFMPAGIEGTIDALKCAACGCHRNFHRKELPYLHHAP  134

Query  585  PM-------------LP-PQHYR------------GaapppppvrapaESSSEDLNAGGG  686
            P              LP P  YR               P       P E+SS +   GG 
Sbjct  135  PQQHQPPPPPPGFYRLPAPVSYRPPPSQAPPLQLALPPPQRERSEDPMETSSAEAGGGGV  194

Query  687  QGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKV  866
            +   +   +          +QK++M   AE+IGWRIQ+QDDE + +FC E GV RQV KV
Sbjct  195  RKRFRTKFT---------AEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKV  245

Query  867  WMHN  878
            W+HN
Sbjct  246  WLHN  249



>ref|XP_006346746.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Solanum tuberosum]
Length=243

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 100/196 (51%), Gaps = 43/196 (22%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK-----  557
            T    +Y+ECLKNHA   GGH VDGCGEF+P G++G+ +SLKCAACNCHRNFHRK     
Sbjct  48   TNNKPKYKECLKNHAVGVGGHAVDGCGEFLPAGEDGSIDSLKCAACNCHRNFHRKIAPPP  107

Query  558  ----------------------GITFQTQNPP-------MLPPQHYRGaapppppvrapa  650
                                     ++T  PP       + P Q            R   
Sbjct  108  LATAAATGGEPVPFVYHSHNQLPTYYRTLPPPCGYLQYHVAPHQRPLALPSTSGGYREDQ  167

Query  651  ESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFC  830
            E  S    +GG +   +   S         Q QK++M E A+K+GWRIQ++D+E V + C
Sbjct  168  EDISNPNYSGGSKKRFRTKFS---------QVQKEKMQELADKLGWRIQREDEELVQQLC  218

Query  831  SEVGVKRQVFKVWMHN  878
            +E G+ RQVFKVWMHN
Sbjct  219  NETGITRQVFKVWMHN  234



>ref|XP_009762783.1| PREDICTED: zinc-finger homeodomain protein 4-like [Nicotiana 
sylvestris]
Length=306

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 117/213 (55%), Gaps = 54/213 (25%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT--  575
            ++RY+ECLKNHAA+ GG+  DGCGEFMP G+EGT E+L C+ACNCHRNFHRK I  +   
Sbjct  75   IVRYKECLKNHAAAMGGNATDGCGEFMPSGEEGTIEALICSACNCHRNFHRKEIEGEQQL  134

Query  576  --------------------------------------QNPPMLP-----PQHYRGaapp  626
                                                  Q   ++P     P H++     
Sbjct  135  LQLQPPPSSCDYYNLNRGGKKVYLGHSHNHHKSLLGPEQYGTIIPSRATAPHHHQMIMSY  194

Query  627  pppvrapaESSS-EDLNAGGGQGLMQVPSS--------kkrfrtkftqqqkqqMHEFAEK  779
                  P+ES   ED+N GGG   M +           KKRFRTKFTQ+QK++M  FAEK
Sbjct  195  NNMGSLPSESEEHEDINGGGGVMAMAMARPLHHHNQMVKKRFRTKFTQEQKEKMFNFAEK  254

Query  780  IGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            +GW+IQKQ++  V +FC E+G+KR+V KVWMHN
Sbjct  255  VGWKIQKQEETVVQQFCQELGIKRRVLKVWMHN  287



>ref|XP_008460585.1| PREDICTED: zinc-finger homeodomain protein 4 [Cucumis melo]
Length=298

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 104/202 (51%), Gaps = 44/202 (22%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---------  557
            I+Y+ECLKNHAAS GG+  DGCGEFMP G+EG+ E+L C+ACNCHRNFHRK         
Sbjct  75   IKYKECLKNHAASMGGNATDGCGEFMPSGEEGSIEALTCSACNCHRNFHRKEIEGEPYDW  134

Query  558  --------------------------------GITFQTQNPPMLPPQHYRGaapppppvr  641
                                            G TF +       P H   +        
Sbjct  135  LHHSRLGRKLLVGGKNMIGPPEPAAFAYPTAGGATFISSRAATTQPHHMIMSYNMLGGGG  194

Query  642  apaESSSEDLNAGGGQGLMQVPSSkkrfr---tkftqqqkqqMHEFAEKIGWRIQKQDDE  812
              +ES  ++   G G G      +    +   TKFT +QK++M  FAEK+GW+IQKQ++ 
Sbjct  195  GHSESEEQEEGIGAGVGGRVYSGAMMNKKRFRTKFTTEQKEKMLRFAEKVGWKIQKQEES  254

Query  813  EVHKFCSEVGVKRQVFKVWMHN  878
             V +FC E+GVKR+V KVWMHN
Sbjct  255  VVQQFCQEIGVKRRVLKVWMHN  276



>ref|XP_009404830.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 106/181 (59%), Gaps = 27/181 (15%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---------  557
            ++YRECLKNHAAS GG+  DGCGEFMPGG+EGT E+LKC+AC CHRNFHRK         
Sbjct  54   VKYRECLKNHAASIGGNATDGCGEFMPGGEEGTLEALKCSACGCHRNFHRKETEGESSWG  113

Query  558  --------------GITFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGL  695
                          G+     +   L P+      P         ++S  D   G G  +
Sbjct  114  CYHPLTARNAMNQRGLLLSGADAFGLVPR----PLPHMIMPPGAMQTSESDEMEGVGDEM  169

Query  696  MQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMH  875
             +    KKR RTKFT +QK++M  FAEK+GWR+QKQ++  V + C E+GV+R+V KVWMH
Sbjct  170  ARPILVKKRLRTKFTPEQKEKMLCFAEKVGWRLQKQEESAVQQLCQEIGVRRRVLKVWMH  229

Query  876  N  878
            N
Sbjct  230  N  230



>ref|NP_201344.1| homeobox protein 25 [Arabidopsis thaliana]
 sp|Q9FKP8.1|ZHD1_ARATH RecName: Full=Zinc-finger homeodomain protein 1; Short=AtZHD1; 
AltName: Full=Homeobox protein 25; Short=AtHB-25; AltName: 
Full=Zinc finger homeodomain transcription factor 2 [Arabidopsis 
thaliana]
 dbj|BAB11563.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO00745.1| putative protein [Arabidopsis thaliana]
 gb|AAP13412.1| At5g65410 [Arabidopsis thaliana]
 gb|AED98048.1| homeobox protein 25 [Arabidopsis thaliana]
Length=279

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 104/181 (57%), Gaps = 31/181 (17%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITF-----  569
             R+RECLKN A + GGH VDGCGEFMP G EGT ++LKCAAC CHRNFHRK + +     
Sbjct  73   FRFRECLKNQAVNIGGHAVDGCGEFMPAGIEGTIDALKCAACGCHRNFHRKELPYFHHAP  132

Query  570  ------------------QTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGL  695
                               +  PP  P Q        PPP R  +E   E  +A  G G+
Sbjct  133  PQHQPPPPPPGFYRLPAPVSYRPP--PSQAPPLQLALPPPQRERSEDPMETSSAEAGGGI  190

Query  696  MQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMH  875
             +      R RTKFT +QK++M   AE+IGWRIQ+QDDE + +FC E GV RQV KVW+H
Sbjct  191  RK------RHRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLH  244

Query  876  N  878
            N
Sbjct  245  N  245



>gb|AFW79306.1| ZF-HD homeobox protein [Zea mays]
 gb|AIB04296.1| ZF-HD transcription factor, partial [Zea mays]
Length=242

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 103/180 (57%), Gaps = 27/180 (15%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            RY ECL+NHAA+ GGHVVDGCGEFMPG  +    SLKCAAC CHR+FHRK    +  +  
Sbjct  41   RYHECLRNHAAALGGHVVDGCGEFMPGDGD----SLKCAACGCHRSFHRKDDARRRHHQL  96

Query  588  MLPPQHYRGaap---------------------ppppvrapaESSSEDLNAGGGQGLMQV  704
            MLP        P                              ESSSE+     G   +Q 
Sbjct  97   MLPATATSSRVPLLLPPPHPHYAPPPFPYHGTPSGGGGGTATESSSEERGPPSGAAAVQA  156

Query  705  PS--SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
                 +KRFRTKFT +QK+QM  FAE++GWR+QKQDD  V  FC +VGV+RQVFKVWMHN
Sbjct  157  QGHVRRKRFRTKFTPEQKEQMLAFAERLGWRLQKQDDALVQHFCDQVGVRRQVFKVWMHN  216



>ref|XP_004236700.1| PREDICTED: zinc-finger homeodomain protein 2-like [Solanum lycopersicum]
Length=247

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 99/197 (50%), Gaps = 44/197 (22%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKG----  560
            T    +Y+ECLKNHA   GGH VDGCGEF+P G++G+ +SLKCAACNCHRNFHRK     
Sbjct  51   TNNKPKYKECLKNHAVGIGGHAVDGCGEFLPAGEDGSIDSLKCAACNCHRNFHRKIAPPP  110

Query  561  ------------------------ITFQTQNPP-------MLPPQHYRGaapppppvrap  647
                                      ++T  PP       + P Q            R  
Sbjct  111  IAAAAAGVGGEPVPFVYHSHNQLPTYYRTLPPPCGYLQYHVAPNQRPLALPSTSGGYRED  170

Query  648  aESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKF  827
             E  S    +GG +   +   S         Q QK +M E A+K+GWRIQ++D+E V + 
Sbjct  171  QEDISHPNYSGGSKKRFRTKFS---------QVQKDKMQELADKLGWRIQREDEELVQQL  221

Query  828  CSEVGVKRQVFKVWMHN  878
            C+E G+ RQVFKVWMHN
Sbjct  222  CNETGITRQVFKVWMHN  238



>gb|ABK22835.1| unknown [Picea sitchensis]
Length=249

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 111/190 (58%), Gaps = 35/190 (18%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFH-----------  551
            +RYREC+KNHAA+ GG   DGCGEFMP G+EGT E+LKC+AC CHRNFH           
Sbjct  53   VRYRECMKNHAAAMGGSATDGCGEFMPSGEEGTLEALKCSACECHRNFHRREVEGEPSCD  112

Query  552  -----------RKGITFQTQ---------NPPMLPPQHYRGaapppppvrapa-ESSSED  668
                       R G+   ++         +P   PP +     PP   +      S S++
Sbjct  113  CFRIRDQLNRKRSGVLVSSRAQGAAAIAPDPFAFPPNNLLPRLPPQAIMSYSTGPSESDE  172

Query  669  LNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVK  848
            L    G  L +    KKRFRTKFTQ+QK +M +FAEK+GWRIQK D++ V +FC ++GVK
Sbjct  173  LE---GTFLSRPAILKKRFRTKFTQEQKDRMLDFAEKVGWRIQKHDEQAVQQFCQDIGVK  229

Query  849  RQVFKVWMHN  878
            R+V KVWMHN
Sbjct  230  RRVLKVWMHN  239



>ref|XP_007143929.1| hypothetical protein PHAVU_007G114300g [Phaseolus vulgaris]
 gb|ESW15923.1| hypothetical protein PHAVU_007G114300g [Phaseolus vulgaris]
Length=197

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 106/180 (59%), Gaps = 16/180 (9%)
 Frame = +3

Query  378  ADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK  557
            AD      +IRY ECLKNHAA  GG+  DGCGEF+  G+EGT E LKC+ACNCHRNFHRK
Sbjct  8    ADKRADKKVIRYTECLKNHAARIGGNATDGCGEFIADGEEGTLEGLKCSACNCHRNFHRK  67

Query  558  GITFQTQ--NPPMLPPQHYR----------GaapppppvrapaESSSED-LNAGGGQGLM  698
             I        P M+ P   +            +    P     E   ED +    G    
Sbjct  68   EIESSDSYFTPLMIMPDTTQIGPIWAHLSPNKSGSISPSDVSDEKDCEDGMTKEEGNPTE  127

Query  699  QVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            +V   KKRFRTKFTQ+QK++M  FAE+ GWR+QK D+  V KFC E+G+KR+V KVW+HN
Sbjct  128  KV---KKRFRTKFTQEQKEKMLLFAERAGWRLQKLDESVVQKFCQEIGIKRRVLKVWIHN  184



>gb|EPS61775.1| hypothetical protein M569_13018, partial [Genlisea aurea]
Length=276

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 107/188 (57%), Gaps = 32/188 (17%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
            ++YRECLKNHAAS GG+  DGCGEFMP G++GT E+L C+AC CHRNFHRK +  + +NP
Sbjct  82   VKYRECLKNHAASMGGNATDGCGEFMPSGEDGTMEALTCSACGCHRNFHRKEV--EGENP  139

Query  585  --------------------------PMLPPQHYRGaapppppvrapaESSSEDLNAGGG  686
                                       ++PP  +     P      P+ES  ++   GGG
Sbjct  140  SCETLGFHPPPPPHPHPHHHHHHGGGALIPPPPHHQMIMPYSIGSIPSESDDQEEGGGGG  199

Query  687  QGLMQVPSSkkrfrtkftqqqkqqMHE----FAEKIGWRIQKQDDEEVHKFCSEVGVKRQ  854
               M + +  +  + +F  +  Q+  E    FAEK+GW+IQKQ++  V +FC EVGVKR+
Sbjct  200  GSGMIIATQTQLVKKRFRTKFTQEQKEKMLIFAEKVGWKIQKQEESVVQQFCQEVGVKRR  259

Query  855  VFKVWMHN  878
            V KVWMHN
Sbjct  260  VLKVWMHN  267



>ref|XP_007047820.1| ZF-HD homeobox protein, putative [Theobroma cacao]
 gb|EOX91977.1| ZF-HD homeobox protein, putative [Theobroma cacao]
Length=259

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 100/181 (55%), Gaps = 29/181 (16%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN--  581
            RYRECLKNHA   GGH VDGCGEFM  G EGT ++LKCAACNCHRNFHRK     + N  
Sbjct  54   RYRECLKNHAVGIGGHAVDGCGEFMAAGAEGTLDALKCAACNCHRNFHRKEPELGSPNSV  113

Query  582  -----------PPMLPPQ--------HYRGaapppppvrapaES---SSEDLNAGGGQGL  695
                       PP   P         H  G   P             S +D      QG 
Sbjct  114  PTTDLYLHHHQPPQFTPYFRAPAGYLHLAGQQRPLALPSTSGGGGGHSRDDQEDVSNQG-  172

Query  696  MQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMH  875
                SS+KRFRTKFTQ+QK +M   AE +GWRIQK D+  V +FC+E GVKR V KVWMH
Sbjct  173  ----SSRKRFRTKFTQEQKDKMLGLAESLGWRIQKHDEAVVQQFCNENGVKRHVLKVWMH  228

Query  876  N  878
            N
Sbjct  229  N  229



>ref|XP_007048627.1| Homeobox protein 21, putative [Theobroma cacao]
 gb|EOX92784.1| Homeobox protein 21, putative [Theobroma cacao]
Length=253

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 105/192 (55%), Gaps = 33/192 (17%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI------  563
            ++RYRECLKNHAA+ GG+  DGCGEF+P G+EG+ E+ KC+ACNCHRNFHRK I      
Sbjct  49   VVRYRECLKNHAAAMGGNATDGCGEFLPSGEEGSLEAFKCSACNCHRNFHRKEIECDCPF  108

Query  564  --------TFQTQNPPMLPPQHYRGaapppppvrapaESSSE------------------  665
                       T    +L   H+               S +E                  
Sbjct  109  DCYHSALLNNATGRKLILGTPHHNYILGASAAAGTLISSRAEPPHQMIMSYKGGSVPSET  168

Query  666  DLNAGGGQGLMQVPSSkkrf-rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVG  842
            D    GG G  +V    ++  RTKFTQ+QK++M  FAEK GWRIQK D+  V +FC E+G
Sbjct  169  DEKDDGGGGAARVSGKMRKRFRTKFTQEQKEKMLNFAEKAGWRIQKLDESVVQQFCQEIG  228

Query  843  VKRQVFKVWMHN  878
            +KR+V KVWMHN
Sbjct  229  IKRRVLKVWMHN  240



>ref|XP_006417011.1| hypothetical protein EUTSA_v10008236mg [Eutrema salsugineum]
 gb|ESQ35364.1| hypothetical protein EUTSA_v10008236mg [Eutrema salsugineum]
Length=318

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 110/183 (60%), Gaps = 26/183 (14%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT----  575
            +Y+ECLKNHAA+ GG+  DGCGEFMP G++G+ E+L C+ACNCHRNFHRK +  +T    
Sbjct  92   KYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHRNFHRKEVEGETTATA  151

Query  576  -----QNPP----MLPPQHYRGaa-------pppppvrapaESSSEDLNAGGGQGLMQVP  707
                 Q PP    ML   + R A              R    S S+D     G      P
Sbjct  152  ISSYHQTPPPRKLMLNHHNIRSAMPHQMIMPIGVSNYRYMHNSESDDFMEEDGVTTASRP  211

Query  708  ------SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVW  869
                  + KKRFRTKFT +QK++M  FAEK+GW+IQ+Q+D  V +FC E+GVKR+V KVW
Sbjct  212  LPHPPYNQKKRFRTKFTPEQKEKMLSFAEKVGWKIQRQEDCVVQRFCEEIGVKRRVLKVW  271

Query  870  MHN  878
            MHN
Sbjct  272  MHN  274



>ref|XP_003633412.1| PREDICTED: zinc-finger homeodomain protein 4 [Vitis vinifera]
Length=281

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 115/211 (55%), Gaps = 43/211 (20%)
 Frame = +3

Query  363  LPQRFADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHR  542
            +P    D       +RYRECLKNHAA+ GG+  DGCGEFMPGG+EGT E+L C+AC+CHR
Sbjct  59   IPSTLEDHVPYKKAVRYRECLKNHAAAMGGNATDGCGEFMPGGEEGTLEALNCSACHCHR  118

Query  543  NFH-----------------------RKGITFQTQN---PPML------------PPQHY  608
            NFH                       RK I    +N   P  L            PP H 
Sbjct  119  NFHRKEVEGERSSCDCFHSPHLNRVGRKVILGHHKNIIGPEALGYPTGTLISSRPPPPH-  177

Query  609  RGaapppppvrapaESSSEDLNAGGGQGLMQVPS-SkkrfrtkftqqqkqqMHEFAEKIG  785
                           S S++   GGG  + + P   KKRFRTKF+Q+QK++M  FAEK+G
Sbjct  178  ---QMIMSYNMGSLPSESDEQEDGGGGVVARPPQLVKKRFRTKFSQEQKEKMLSFAEKVG  234

Query  786  WRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            W+IQKQ++  V +FC E+GVKR+V KVWMHN
Sbjct  235  WKIQKQEEAVVQQFCQEIGVKRRVLKVWMHN  265



>ref|XP_004495441.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
Length=201

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 103/172 (60%), Gaps = 13/172 (8%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI--TFQT  575
            +++Y+ECLKNHAA+ GG+  DGCGEFMP G+ GT E+L C ACNCHRNFHRK I      
Sbjct  17   VVKYKECLKNHAAAIGGNATDGCGEFMPSGETGTLEALMCCACNCHRNFHRKEIESNCDC  76

Query  576  QNPPM-----LPPQHYRGaapppppvrapaESSSEDL---NAGGGQGLMQVPSSkkrfrt  731
             +P       L P +         P ++ + S S+     N       ++ P+ K   + 
Sbjct  77   SSPSKHYAFSLIPDNVAPILNHLSPNKSGSTSPSDHFYEKNYEYCVNEVENPTEKMIKKR  136

Query  732  kftq---qqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              T+   +QK++M +FAEK GWRIQK ++  V KFC E+G+KR+V KVWMHN
Sbjct  137  SRTKFTQEQKEKMQDFAEKAGWRIQKLEESVVQKFCQEIGIKRRVLKVWMHN  188



>gb|ABY61025.1| zinc finger-homeodomain protein 3, partial [Saruma henryi]
Length=211

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 111/188 (59%), Gaps = 27/188 (14%)
 Frame = +3

Query  366  PQRFADTSHTTTL--IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCH  539
            P R   +  T ++  + YREC++NHAAS GGH  DGC EFM G       SLKCAAC CH
Sbjct  14   PSRSESSPATRSIAGVWYRECMRNHAASIGGHASDGCCEFMEG------PSLKCAACGCH  67

Query  540  RNFHRKGIT-------FQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAG------  680
            RNFHRK +        + T + P+L    Y   A  P         S+ DL         
Sbjct  68   RNFHRKEVPGGGCAEHYSTPHHPLLV---YNAHAHQPLLQSPHQMISAVDLGGSRGPETP  124

Query  681  --GGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQ  854
              GG G   V S KKRFRTKF Q+QK++M  FAEK+GWRIQK++D E+ KFCSE+GVKRQ
Sbjct  125  QEGGSGEFSV-SGKKRFRTKFMQEQKEKMVAFAEKLGWRIQKENDVELEKFCSEIGVKRQ  183

Query  855  VFKVWMHN  878
            V KVWMHN
Sbjct  184  VLKVWMHN  191



>ref|XP_010463122.1| PREDICTED: zinc-finger homeodomain protein 1-like [Camelina sativa]
Length=290

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 99/186 (53%), Gaps = 37/186 (20%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNP  584
             R+RECLKN A + GGH VDGCGEFMP G EGT ++LKCAAC CHRNFHRK + +    P
Sbjct  77   FRFRECLKNQAVTIGGHAVDGCGEFMPAGIEGTIDALKCAACGCHRNFHRKELPYFHHAP  136

Query  585  PM---------------LP-PQHYR------------GaapppppvrapaESSSEDLNAG  680
            P                LP P  YR               P       P E+SS +   G
Sbjct  137  PQQHQHQPPPPPPGFYRLPAPVSYRPPPSQAPPLQLALPPPQRERSEDPMETSSAEAGGG  196

Query  681  GGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVF  860
            G +   +   +          +QK++M   AE+IGWRIQ+QDDE + +FC E GV RQV 
Sbjct  197  GIRKRFRTKFT---------AEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVL  247

Query  861  KVWMHN  878
            KVW+HN
Sbjct  248  KVWLHN  253



>ref|XP_002864955.1| hypothetical protein ARALYDRAFT_919872 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41214.1| hypothetical protein ARALYDRAFT_919872 [Arabidopsis lyrata subsp. 
lyrata]
Length=278

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 106/181 (59%), Gaps = 30/181 (17%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITF-----  569
             R+RECLKN A + GGH VDGCGEFMP G EGT ++LKCAAC CHRNFHRK + +     
Sbjct  71   FRFRECLKNQAVNIGGHAVDGCGEFMPAGIEGTIDALKCAACGCHRNFHRKELPYFHHAP  130

Query  570  ------------------QTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGL  695
                               +  PP  P Q        PPP R  +E   E  +A  G G 
Sbjct  131  PQHQPPPPPPGFYRLPAPVSYRPP--PSQAPPLQLALPPPQRERSEDPMETSSAEAGGGG  188

Query  696  MQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMH  875
            ++     KR+RTKFT +QK++M   AE+IGWRIQ+QDDE + +FC E GV RQV KVW+H
Sbjct  189  IR-----KRYRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLH  243

Query  876  N  878
            N
Sbjct  244  N  244



>ref|XP_009406459.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=271

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 112/198 (57%), Gaps = 32/198 (16%)
 Frame = +3

Query  378  ADTSHTT---TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNF  548
            A  SH+T     +RYRECLKNHAAS GG+  DGCGEFMP G+EG+ E+LKC+AC CHRNF
Sbjct  61   ATNSHSTKKGVAVRYRECLKNHAASIGGNATDGCGEFMPSGEEGSLEALKCSACGCHRNF  120

Query  549  HR-----------------------KGITFQTQNP----PMLPPQHYRGaapppppvrap  647
            HR                       KG+     +     P       R            
Sbjct  121  HRKETEGESSCDCFHPLRGRKVMGQKGLLLSGSDAFGYGPACNGLIPRATPHSMIMPLGA  180

Query  648  aESSSEDLNAGGGQGLMQVP-SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
             ++S  D   G G G+M  P   KKRFRTKFT +QK++M  FAEK+GW++QKQ++  V +
Sbjct  181  IQTSESDEMEGVG-GMMPRPLMVKKRFRTKFTPEQKEKMLSFAEKVGWKLQKQEESVVQQ  239

Query  825  FCSEVGVKRQVFKVWMHN  878
            FC E+GVKR+V KVWMHN
Sbjct  240  FCQEIGVKRRVLKVWMHN  257



>ref|XP_010496079.1| PREDICTED: zinc-finger homeodomain protein 4-like [Camelina sativa]
Length=319

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 106/186 (57%), Gaps = 27/186 (15%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            +I+Y+ECLKNHAA+ GG+  DGCGEFMP G++G+ E+L C+ACNCHRNFHRK +  +   
Sbjct  90   MIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIETLTCSACNCHRNFHRKEVEGEPAA  149

Query  582  PPMLP---------------------PQHYRGaapppppvrapaESSSEDLNAGGG----  686
              M P                     P                  S SED     G    
Sbjct  150  TDMSPYHQPPPPRKLMLNHHKIRSAMPHQMIMPIGVSNYRYMHNNSESEDFMEEDGITTA  209

Query  687  -QGLMQVPSSkkrf-rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVF  860
             + L   P ++K+  RTKFT +QK++M  FAEK+GW+IQ+Q+D  V +FC E+GVKR+V 
Sbjct  210  SRSLPHPPYNQKKRFRTKFTPEQKEKMLNFAEKVGWKIQRQEDCVVQRFCEEIGVKRRVL  269

Query  861  KVWMHN  878
            KVWMHN
Sbjct  270  KVWMHN  275



>ref|XP_009130511.1| PREDICTED: zinc-finger homeodomain protein 1-like [Brassica rapa]
 emb|CDY37827.1| BnaAnng04880D [Brassica napus]
Length=272

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 95/184 (52%), Gaps = 38/184 (21%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITF-----  569
             R+RECLKN A + GGH VDGCGEFMP G EGT E+LKCAAC CHRNFHRK   +     
Sbjct  66   FRFRECLKNQAVNIGGHAVDGCGEFMPAGIEGTIEALKCAACGCHRNFHRKESLYFHHHH  125

Query  570  ---------------------QTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGG  686
                                   + PP   P                  SS+E   AGG 
Sbjct  126  APPQQQHHPPPPGFYRLPAPVSYRPPPSQAPPLQLALPQRERSEDRMETSSAE---AGGI  182

Query  687  QGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKV  866
            +   +          KFT +QK++M   AE+IGWRIQ+QDDE + +FC E GV RQV KV
Sbjct  183  RKRFRT---------KFTAEQKERMLGLAERIGWRIQRQDDEVIQRFCQETGVPRQVLKV  233

Query  867  WMHN  878
            W+HN
Sbjct  234  WLHN  237



>ref|XP_010502266.1| PREDICTED: zinc-finger homeodomain protein 3-like [Camelina sativa]
 ref|XP_010502267.1| PREDICTED: zinc-finger homeodomain protein 3-like [Camelina sativa]
Length=313

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 115/194 (59%), Gaps = 36/194 (19%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-----  563
             +I+Y+ECLKNHAAS GG+ +DGCGEFMP GK+G+ E+L C+ACNCHRNFHR+ +     
Sbjct  85   VVIKYKECLKNHAASKGGNAIDGCGEFMPSGKDGSIEALTCSACNCHRNFHRREVEGEEK  144

Query  564  TFQT-----QNPPMLPPQ-----HYR--------GaapppppvrapaESSSEDL-NAGGG  686
            TF +       PP  PPQ     H++            P     A + S SEDL   GGG
Sbjct  145  TFFSPYLNHHQPP--PPQRKLMFHHKLIKSPLPEQMIMPVGVATAGSNSESEDLMEEGGG  202

Query  687  QGLM-----QVPSSkkrfrtkf-----tqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSE  836
            + L        P S    + K      TQ+QK++M  FAE++GW++Q+Q++  V + C E
Sbjct  203  RSLTFRHPPPPPYSYGHNQKKRFRTKFTQEQKEKMMSFAERVGWKMQRQEESAVQQLCQE  262

Query  837  VGVKRQVFKVWMHN  878
            +G++R+V KVWMHN
Sbjct  263  IGIRRRVLKVWMHN  276



>ref|XP_010243316.1| PREDICTED: zinc-finger homeodomain protein 1-like [Nelumbo nucifera]
Length=226

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 104/173 (60%), Gaps = 18/173 (10%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---GITF  569
            T+ +YRECLKNHA   GGHVVD CGEFM  G+EGT ++LKCAA NCHRNFHRK   G  +
Sbjct  46   TVSKYRECLKNHAVGIGGHVVDECGEFMAVGEEGTLDALKCAAYNCHRNFHRKETEGDAY  105

Query  570  QTQNPPM---------LPPQHYRGaapppppvrapaESSSED-LNAGGGQGLMQVPSSkk  719
              Q  P          + P H   A P        +    ED LN  GG  +     SKK
Sbjct  106  HHQFSPYCRTLVGYLHVAPHHRPLALPSTSGGGVHSWEDQEDVLNPSGGGEV-----SKK  160

Query  720  rfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            RFRTKFT +QK  M  FAE++GWRIQK D+  + +FC+E  VKR V KVWMHN
Sbjct  161  RFRTKFTLEQKDXMLAFAERLGWRIQKHDEAAMQQFCTETCVKRHVLKVWMHN  213



>ref|XP_002285709.1| PREDICTED: zinc-finger homeodomain protein 1 [Vitis vinifera]
Length=230

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 102/172 (59%), Gaps = 15/172 (9%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---GITFQTQ  578
            RYRECLKNHA   GGH VDGCGEFMP G EGT + L+CAACNCHRNFHRK   G T   Q
Sbjct  50   RYRECLKNHAVGIGGHAVDGCGEFMPAGDEGTLDGLRCAACNCHRNFHRKESEGDTLYHQ  109

Query  579  NPPM---------LPPQHYRGaap-ppppvrapaESSSEDLN--AGGGQGLMQVPSSkkr  722
              P          + P  YR  A          +    ED++  +  G G     S KKR
Sbjct  110  FSPYYRTPAGYLHVAPSQYRPLALPSTSGGGGHSREDQEDVSNPSSSGGGGGGSGSLKKR  169

Query  723  frtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            FRTKFTQ+QK +M  FAE +GWRIQK D+  V +FC E  VKR V KVWMHN
Sbjct  170  FRTKFTQEQKDKMLAFAETLGWRIQKHDEAAVQQFCQETCVKRHVLKVWMHN  221



>ref|XP_010908151.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
Length=264

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 109/197 (55%), Gaps = 36/197 (18%)
 Frame = +3

Query  384  TSHTT----TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFH  551
            T+H+T     ++ YRECLKNHAAS GG+  DGCGEFMP G+EGT E+LKC+AC+CHRNFH
Sbjct  59   TTHSTKKGGAVVMYRECLKNHAASIGGNATDGCGEFMPSGEEGTLEALKCSACSCHRNFH  118

Query  552  RKGI--------------------------TFQTQNPP--MLPPQHYRGaapppppvrap  647
            RK I                           F   +P    L P         P      
Sbjct  119  RKEIEGECHHHHLKETKFVGYKGVLISGPEAFGYNHPANHCLIPSPLPHQMVMPLGALMA  178

Query  648  aESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKF  827
            +ES   D    G  G    P  KKR RTKF  +QK++M  FAE+IGWR+Q+Q++  V +F
Sbjct  179  SESDEMD----GVGGARAPPMGKKRVRTKFAPEQKEKMLSFAERIGWRLQRQEESVVEQF  234

Query  828  CSEVGVKRQVFKVWMHN  878
            C E+GV R+V +VWMHN
Sbjct  235  CQEIGVNRKVLRVWMHN  251



>ref|XP_010476498.1| PREDICTED: zinc-finger homeodomain protein 4 [Camelina sativa]
 ref|XP_010476499.1| PREDICTED: zinc-finger homeodomain protein 4 [Camelina sativa]
Length=318

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 106/186 (57%), Gaps = 27/186 (15%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            +I+Y+ECLKNHAA+ GG+  DGCGEFMP G++G+ E+L C+ACNCHRNFHRK +  +   
Sbjct  89   MIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHRNFHRKEVEGEPVA  148

Query  582  PPMLP---------------------PQHYRGaapppppvrapaESSSEDLNAGGG----  686
              M P                     P                  S SED     G    
Sbjct  149  TAMSPYHQPPPPRKLMLNHHKIRSAMPHQMIMPIGVSNYRYMHNNSESEDFMEEDGITTA  208

Query  687  -QGLMQVPSSkkrf-rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVF  860
             + L   P ++K+  RTKFT +QK++M  FAEK+GW+IQ+Q+D  V +FC E+GVKR+V 
Sbjct  209  SRSLPHPPYNQKKRFRTKFTPEQKEKMLNFAEKVGWKIQRQEDCVVQRFCEEIGVKRRVL  268

Query  861  KVWMHN  878
            KVWMHN
Sbjct  269  KVWMHN  274



>gb|KFK28242.1| hypothetical protein AALP_AA8G490700 [Arabis alpina]
Length=287

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 96/186 (52%), Gaps = 34/186 (18%)
 Frame = +3

Query  396  TTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT---  566
            T+  R+RECLKN A + GGH VDGCGEFMP G EGT ++LKCAAC CHRNFHRK +    
Sbjct  72   TSRFRFRECLKNQAVNIGGHAVDGCGEFMPAGIEGTIDALKCAACGCHRNFHRKELPYFH  131

Query  567  -------------FQTQNPPML---PPQHYRGaapppppvrapaESSSED------LNAG  680
                         F     P+    PP          PP +      SED        AG
Sbjct  132  APPQNQPPPPPPGFYRLPAPVSYRPPPSQAPPLQLALPPPQQQQRERSEDRMETSSAEAG  191

Query  681  GGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVF  860
            G +   +   + ++            M   AE+IGWRIQ+QDDE + +FCSE G+ RQV 
Sbjct  192  GIRKRFRTKFTAEQKER---------MLGLAERIGWRIQRQDDEVIQRFCSETGIPRQVL  242

Query  861  KVWMHN  878
            KVW+HN
Sbjct  243  KVWLHN  248



>ref|XP_010458941.1| PREDICTED: zinc-finger homeodomain protein 4-like [Camelina sativa]
Length=320

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 106/187 (57%), Gaps = 28/187 (15%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            +I+Y+ECLKNHAA+ GG+  DGCGEFMP G++G+ E+L C+ACNCHRNFHRK +  +   
Sbjct  90   MIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHRNFHRKEVEGEPAA  149

Query  582  PPMLP----------------------PQHYRGaapppppvrapaESSSEDLNAGGG---  686
              M P                      P                  S SED     G   
Sbjct  150  TAMSPYHQQPHPPRKLMLNHHKIRSAMPHQMIMPIGVSNYRYMHNNSESEDFMEEDGITT  209

Query  687  --QGLMQVPSSkkrf-rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQV  857
              + L   P ++K+  RTKFT +QK++M  FAEK+GW+IQ+Q+D  V +FC E+GVKR+V
Sbjct  210  ASRSLPHPPYNQKKRFRTKFTPEQKEKMLNFAEKVGWKIQRQEDCVVQRFCEEIGVKRRV  269

Query  858  FKVWMHN  878
             KVWMHN
Sbjct  270  LKVWMHN  276



>ref|XP_006394037.1| hypothetical protein EUTSA_v10005568mg [Eutrema salsugineum]
 dbj|BAJ34581.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31323.1| hypothetical protein EUTSA_v10005568mg [Eutrema salsugineum]
Length=286

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 97/176 (55%), Gaps = 18/176 (10%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITF-----  569
             R+RECLKN A + GGH VDGCGEFMP G EGT ++LKCAAC CHRNFHRK + +     
Sbjct  72   FRFRECLKNQAVNIGGHAVDGCGEFMPAGIEGTIDALKCAACGCHRNFHRKELPYFHHHA  131

Query  570  -------------QTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPS  710
                         +   P    P   +           P    SED              
Sbjct  132  PPQQPPPPPPGFYRLPAPVSYRPPPSQAPTLQLALPPPPQRERSEDRMETSSAEAGGGGG  191

Query  711  SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             +KRFRTKFT +QK++M   AE+IGWRIQ+QDDE + +FC E GV RQV KVW+HN
Sbjct  192  IRKRFRTKFTAEQKERMLGLAERIGWRIQRQDDELIQRFCQETGVPRQVLKVWLHN  247



>ref|XP_002875135.1| hypothetical protein ARALYDRAFT_484166 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51394.1| hypothetical protein ARALYDRAFT_484166 [Arabidopsis lyrata subsp. 
lyrata]
Length=318

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 114/194 (59%), Gaps = 34/194 (18%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-----  563
             +I+Y+ECLKNHAA+ GG+ +DGCGEFMP G+EG+ E+L C+ACNCHRNFHR+ I     
Sbjct  88   VVIKYKECLKNHAATMGGNAIDGCGEFMPSGEEGSIEALTCSACNCHRNFHRREIEGEQK  147

Query  564  TFQT------QNPP----------MLPPQHYRGaapppppvrapaESSSEDL---NAGGG  686
            TF +      Q PP          M+     +    P     A + S SEDL   +AGG 
Sbjct  148  TFFSPYLNHHQLPPPQRKLMFHHKMIKSPLPQQMIMPVGVTTAGSNSESEDLMEEDAGGS  207

Query  687  QGLMQVPSSkkrfr----------tkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSE  836
                Q P     +           TKFTQ+QK++M  FAE++GW+IQ+Q++  V + C E
Sbjct  208  LTFRQPPPPPPSYSYGHNQKKRFRTKFTQEQKEKMMSFAERVGWKIQRQEESVVQQLCQE  267

Query  837  VGVKRQVFKVWMHN  878
            +G++R+V KVWMHN
Sbjct  268  IGIRRRVLKVWMHN  281



>ref|XP_011001095.1| PREDICTED: zinc-finger homeodomain protein 2-like [Populus euphratica]
Length=281

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 109/198 (55%), Gaps = 39/198 (20%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK--------  557
            +++Y+EC++NHAAS GGH  DGCGEFMP G +GT + L CAAC CHRNFHR+        
Sbjct  50   VVKYKECMRNHAASIGGHANDGCGEFMPRGDDGTRDWLTCAACGCHRNFHRRESSTKRQH  109

Query  558  --------------------GITFQTQNPP---MLPPQHYRGaapppppvrapaESSSE-  665
                                  T +  NP    M  P            +     S +  
Sbjct  110  QQQLLLSPPPLQPQQFLLYGAPTTKNMNPVHDFMSRPHDEDDDDNGLDDLDNDRRSETPE  169

Query  666  ----DLNAGGGQGLM---QVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
                ++   GG+G M      SS KRFRTKFTQ+QK++M EFAEKIGWRIQK DD  +++
Sbjct  170  RGEVNVMGSGGKGFMVKSTSGSSNKRFRTKFTQEQKERMLEFAEKIGWRIQKHDDMALNQ  229

Query  825  FCSEVGVKRQVFKVWMHN  878
            FC+EVG+KR V KVWMHN
Sbjct  230  FCNEVGIKRNVLKVWMHN  247



>ref|XP_009762039.1| PREDICTED: zinc-finger homeodomain protein 4-like isoform X1 
[Nicotiana sylvestris]
Length=246

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 108/194 (56%), Gaps = 17/194 (9%)
 Frame = +3

Query  348  TQQVLLPQRFADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAA  527
            + Q++  +     S    +++Y+ECL+NHAA+ GG+  DGCGEFMP G+EGT E L C+ 
Sbjct  38   SSQIITSKNGPPISSNKKMMKYKECLENHAAAMGGNATDGCGEFMPSGEEGTFEFLTCSV  97

Query  528  CNCHRNFHRK--------GITFQTQNPPMLPPQHYRGaapppppvrapaES----SSEDL  671
            CNCHRNFHRK         +     +   + P                  S    + ED 
Sbjct  98   CNCHRNFHRKETEGELVRKVYVGHPHKAFVYPASRAAPHQMIMSYNNHMGSIPGINQEDG  157

Query  672  NAGGGQGLMQVPSSkkrfrtkf-----tqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSE  836
               GG G+M  P + ++   K      +Q+QK++M  FAEKIGW++QKQ++  V +FC +
Sbjct  158  IINGGCGVMARPLNYQQLVKKRFRTKFSQEQKEKMLNFAEKIGWKMQKQEEAMVQQFCQQ  217

Query  837  VGVKRQVFKVWMHN  878
            VGVKR++ KVWMHN
Sbjct  218  VGVKRRLLKVWMHN  231



>ref|XP_006376247.1| hypothetical protein POPTR_0013s11330g [Populus trichocarpa]
 gb|ERP54044.1| hypothetical protein POPTR_0013s11330g [Populus trichocarpa]
Length=254

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 103/171 (60%), Gaps = 12/171 (7%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            +++Y+EC++NHAAS GGH  DGCGEFMP G +GT + L CAAC CHRNFHR+  + + Q+
Sbjct  50   VVKYKECMRNHAASIGGHANDGCGEFMPRGDDGTRDWLTCAACGCHRNFHRRESSTKRQH  109

Query  582  PPMLPPQHYR---------GaapppppvrapaESSSEDLNAGGGQGLM---QVPSSkkrf  725
               L               GA             S          G M      SS KRF
Sbjct  110  QQQLLLSPPPLQPQQFLLYGAPTTKNMNPVHDFMSRPHDEDDDDDGFMVKSTSGSSNKRF  169

Query  726  rtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            RTKFTQ+QK++M EFAEKIGWRIQK DD  +++FC+EVG+KR V KVWMHN
Sbjct  170  RTKFTQEQKERMLEFAEKIGWRIQKHDDMALNQFCNEVGIKRNVLKVWMHN  220



>ref|XP_006376248.1| hypothetical protein POPTR_0013s11330g [Populus trichocarpa]
 gb|ERP54045.1| hypothetical protein POPTR_0013s11330g [Populus trichocarpa]
Length=281

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 109/198 (55%), Gaps = 39/198 (20%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK--------  557
            +++Y+EC++NHAAS GGH  DGCGEFMP G +GT + L CAAC CHRNFHR+        
Sbjct  50   VVKYKECMRNHAASIGGHANDGCGEFMPRGDDGTRDWLTCAACGCHRNFHRRESSTKRQH  109

Query  558  --------------------GITFQTQNPP---MLPPQHYRGaapppppvrapaESSSE-  665
                                  T +  NP    M  P            +     S +  
Sbjct  110  QQQLLLSPPPLQPQQFLLYGAPTTKNMNPVHDFMSRPHDEDDDDDGLDDLDNDRRSETPE  169

Query  666  ----DLNAGGGQGLM---QVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
                ++   GG+G M      SS KRFRTKFTQ+QK++M EFAEKIGWRIQK DD  +++
Sbjct  170  RGEVNVVGSGGKGFMVKSTSGSSNKRFRTKFTQEQKERMLEFAEKIGWRIQKHDDMALNQ  229

Query  825  FCSEVGVKRQVFKVWMHN  878
            FC+EVG+KR V KVWMHN
Sbjct  230  FCNEVGIKRNVLKVWMHN  247



>ref|XP_011028421.1| PREDICTED: zinc-finger homeodomain protein 4 [Populus euphratica]
Length=296

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 106/201 (53%), Gaps = 42/201 (21%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK--------  557
            ++RYRECLKNHAAS GG+  DGCGEFMP G+EG+  +L C+ACNCHRNFHRK        
Sbjct  76   MVRYRECLKNHAASMGGNATDGCGEFMPSGEEGSIGALTCSACNCHRNFHRKEIEGEHTS  135

Query  558  --------------------------------GITFQTQNPPMLPPQHYRGaapppppvr  641
                                             + + T    ++P +             
Sbjct  136  CAGDHCYHNSPHFNRLGRKVVLGHHKSILGPEALGYPTATGTLIPSRASAPHHQMIMSYN  195

Query  642  apaESSSEDLNAGGGQGLMQVPSSkkrfr--tkftqqqkqqMHEFAEKIGWRIQKQDDEE  815
              +  S  D    GG  LM  P+   + R  TKF+Q+QK++M  FAEK+GW++QKQ++  
Sbjct  196  MGSLPSESDEQEDGGGVLMARPAQLMKKRFRTKFSQEQKEKMLNFAEKVGWKLQKQEETV  255

Query  816  VHKFCSEVGVKRQVFKVWMHN  878
            V +FC E+GVKR+V KVWMHN
Sbjct  256  VQQFCQEIGVKRRVLKVWMHN  276



>ref|NP_001152263.1| ZF-HD homeobox protein [Zea mays]
 gb|ACG46677.1| ZF-HD homeobox protein [Zea mays]
Length=242

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 103/180 (57%), Gaps = 27/180 (15%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQNPP  587
            RY ECL+NHAA+ GGHVVDGCGEFMPG  +    SLKCAAC CHR+FHRK    +  +  
Sbjct  41   RYHECLRNHAAALGGHVVDGCGEFMPGDGD----SLKCAACGCHRSFHRKDDARRRHHQL  96

Query  588  MLPPQHYRGaap---------------------ppppvrapaESSSEDLNAGGGQGLMQV  704
            +LP        P                              ESSSE+     G   +Q 
Sbjct  97   VLPATATASRVPLLLPPPHPHYAPPPFPYHGTPSGGGGGTATESSSEERGPPSGAAAVQA  156

Query  705  PS--SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
                 +KRFRTKFT +QK+QM  FAE++GWR+QKQDD  V  FC +VGV+RQVFKVWMHN
Sbjct  157  QGHVRRKRFRTKFTPEQKEQMLAFAERLGWRLQKQDDALVQHFCDQVGVRRQVFKVWMHN  216



>ref|XP_009129138.1| PREDICTED: zinc-finger homeodomain protein 3 [Brassica rapa]
Length=300

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 112/187 (60%), Gaps = 37/187 (20%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-----TF-  569
            +Y+ECLKNHAASTGGH +DGCGEFMP G+EG+ E+L C+ACNCHRNFHR+ I     T+ 
Sbjct  86   KYKECLKNHAASTGGHAIDGCGEFMPSGEEGSIEALTCSACNCHRNFHRREIEGEDKTYF  145

Query  570  ------QTQNPPMLPPQHYRGaapp---------pppvrapaESSSEDL---------NA  677
                  Q Q  PM    H    +P                    S EDL         N 
Sbjct  146  SPYHHNQPQRNPMFHHHHKMTKSPLPQQMIMPLGVATTTVSNTESEEDLPFQQPPPPYNH  205

Query  678  GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQV  857
            GG        + KKRFRTKFTQ+QK++M  FAE+IGW++Q+Q++  V KFC E+GV+R+V
Sbjct  206  GGH-------NQKKRFRTKFTQEQKEKMLSFAERIGWKMQRQEESVVQKFCQEIGVRRRV  258

Query  858  FKVWMHN  878
             KVW+HN
Sbjct  259  LKVWIHN  265



>emb|CAN75153.1| hypothetical protein VITISV_035994 [Vitis vinifera]
Length=284

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 104/182 (57%), Gaps = 15/182 (8%)
 Frame = +3

Query  378  ADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK  557
            A T       RYRECLKNHA   GGH VDGCGEFMP G EGT + L+CAACNCHRNFHRK
Sbjct  94   ASTVRKVGNSRYRECLKNHAVGIGGHAVDGCGEFMPAGDEGTLDGLRCAACNCHRNFHRK  153

Query  558  ---GITFQTQNPPM---------LPPQHYRGaap-ppppvrapaESSSEDLN--AGGGQG  692
               G T   Q  P          + P  YR  A          +    ED++  +  G G
Sbjct  154  ESEGDTLYHQFSPYYRTPAGYLHVAPSQYRPLALPSTSGGGGHSREDQEDVSNPSSSGGG  213

Query  693  LMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWM  872
                 S KKRFRTKFTQ+QK +M  FAE +GWRIQK D+  V +FC E  VKR V KVWM
Sbjct  214  GGGSGSLKKRFRTKFTQEQKDKMLAFAETLGWRIQKHDEAAVQQFCQETCVKRHVLKVWM  273

Query  873  HN  878
            HN
Sbjct  274  HN  275



>emb|CDX69541.1| BnaA10g18900D [Brassica napus]
Length=263

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 102/180 (57%), Gaps = 21/180 (12%)
 Frame = +3

Query  396  TTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGT--PESLKCAACNCHRNFHRK----  557
              +  Y+ECLKNHAA  GGH +DGCGEF+P     T  P SL C AC CHRNFHR+    
Sbjct  51   VVVAAYKECLKNHAAGIGGHALDGCGEFIPSPTFNTSDPTSLTCDACGCHRNFHRREDDL  110

Query  558  --------GITFQTQN-----PPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLM  698
                     I F+  N     PP LPP          P    P  SS   L   GG    
Sbjct  111  SAVSAAVPRIEFRPHNRHQLPPPALPPVGVGSQDDDDPASPPPISSSYMLLALSGGA--T  168

Query  699  QVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              P S+KRFRTKF++ QK +M EFAE++GWR+ K DD +V +FC E+GV+R VFKVWMHN
Sbjct  169  AAPVSRKRFRTKFSEFQKGKMFEFAERVGWRMPKADDVDVVEFCREIGVERSVFKVWMHN  228



>ref|XP_009148819.1| PREDICTED: zinc-finger homeodomain protein 4-like [Brassica rapa]
Length=310

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 104/184 (57%), Gaps = 27/184 (15%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQT--  575
            +I+Y+ECLKNHAA+ GG+  DGCGEFMP G++G+ E+L C+ CNCHRNFHRK +  +T  
Sbjct  90   MIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSVCNCHRNFHRKEVEGETTA  149

Query  576  -------QNPP-------------MLPPQHYRGaapppppvrapaESSSEDLNAGGGQGL  695
                   Q PP              +P Q                ES   D     G   
Sbjct  150  TAISSHHQPPPPRKLMVNHHNIRSAMPHQMIMPIGVSNYRYMHNLESG--DFMEQDGVTT  207

Query  696  MQVPSSkkrfr---tkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKV  866
               P +  + +   TKFT +QK++M  FAEK+GW+IQ+Q+D  V +FC E+GVKR+V KV
Sbjct  208  ASRPPAYNQKKRFRTKFTPEQKEKMLSFAEKVGWKIQRQEDCVVQRFCEEIGVKRRVLKV  267

Query  867  WMHN  878
            WMHN
Sbjct  268  WMHN  271



>ref|XP_006290001.1| hypothetical protein CARUB_v10003631mg [Capsella rubella]
 gb|EOA22899.1| hypothetical protein CARUB_v10003631mg [Capsella rubella]
Length=266

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 101/192 (53%), Gaps = 34/192 (18%)
 Frame = +3

Query  384  TSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMP--GGKEGTPESLKCAACNCHRNFHRK  557
             S    ++ Y+ECLKNHAA  GGH +DGCGEFMP        P +L CAAC CHRNFHR+
Sbjct  47   ASEAAAVVTYKECLKNHAAGIGGHALDGCGEFMPSPAFNSNDPTTLTCAACGCHRNFHRR  106

Query  558  ------------GITFQTQNPPMLPPQHYRGaapppppvr-------------apaESSS  662
                         I F+ QN   LPP H  G   P                  A +    
Sbjct  107  EDDPSLASAIVPAIEFRPQNRHQLPPPHPVGIRSPDDDDSASPPPISSSYMLLALSGGGG  166

Query  663  EDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVG  842
               N  G       P S+KRFRTKF+Q QK++M EFAE++GWR+ K DD  V  FC E+G
Sbjct  167  GGGNTAG-------PMSRKRFRTKFSQYQKEKMFEFAERVGWRMPKADDVAVKDFCREIG  219

Query  843  VKRQVFKVWMHN  878
            V + VFKVWMHN
Sbjct  220  VDKSVFKVWMHN  231



>emb|CBI22215.3| unnamed protein product [Vitis vinifera]
Length=238

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 93/162 (57%), Gaps = 29/162 (18%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPG--GKEGTPESLKCAACNCHRNFHRKGITFQ  572
             ++ Y+ECLKNHAAS GGH +DGCGEFMP        P SLKCAAC CHRNFHR+    +
Sbjct  52   VVVAYKECLKNHAASLGGHALDGCGEFMPSPTATSADPTSLKCAACGCHRNFHRR----E  107

Query  573  TQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqk  752
              +PP  P  H                 SS   +   G+   +   S         Q QK
Sbjct  108  PDDPP--PTTH------------NAPPISSSPASGANGRKRFRTKFS---------QGQK  144

Query  753  qqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            ++M EFAE++GW++QK+D+E V +FC+EVGV + V KVWMHN
Sbjct  145  EKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGVLKVWMHN  186



>gb|EPS73952.1| hypothetical protein M569_00810, partial [Genlisea aurea]
Length=199

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 96/167 (57%), Gaps = 24/167 (14%)
 Frame = +3

Query  411  YRECLKNHAASTGGHVVDGCGEFM-PGGKEGTPESLKCAACNCHRNFHRK----------  557
            YREC+KNHAA  GGH VDGCGEFM P    G  +++KCAAC CHRNFHR+          
Sbjct  37   YRECMKNHAAHIGGHAVDGCGEFMKPVYAAG--DAMKCAACGCHRNFHRQVMSPLILYFA  94

Query  558  GITFQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkf  737
             I FQ   P +L P  +R    P PP        +   N+  G+   +   S        
Sbjct  95   DIDFQVTQPGILFP--FRNGLTPSPPEERQQAPVTPMGNSLSGRKRFRTKFS--------  144

Query  738  tqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
             Q+QK +MH F+EKIGW++QK DD EV  FCSE+GV R VFKVWMHN
Sbjct  145  -QEQKDKMHSFSEKIGWKMQKCDDSEVRDFCSEIGVSRGVFKVWMHN  190



>ref|XP_010484369.1| PREDICTED: zinc-finger homeodomain protein 1-like [Camelina sativa]
Length=286

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 98/178 (55%), Gaps = 21/178 (12%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT------  566
             R+RECLKN A + GGH VDGCGEFMP G EGT ++LKCAAC CHRNFHRK +       
Sbjct  73   FRFRECLKNQAVNIGGHAVDGCGEFMPAGIEGTIDALKCAACGCHRNFHRKELPYFHHAP  132

Query  567  --------------FQTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQV  704
                          ++   P    P   +             E S + +     +     
Sbjct  133  PQQHPPPPPPPPGFYRLPAPVSYRPPPSQAPPLQLALPPPQRERSEDPMETSSAEAGGGG  192

Query  705  PSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
               +KRFRTKFT +QK++M   AE+IGWRIQ+QDDE + +FC E GV RQV KVW+HN
Sbjct  193  -GIRKRFRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHN  249



>ref|XP_007156483.1| hypothetical protein PHAVU_003G289700g [Phaseolus vulgaris]
 gb|ESW28477.1| hypothetical protein PHAVU_003G289700g [Phaseolus vulgaris]
Length=219

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 101/182 (55%), Gaps = 27/182 (15%)
 Frame = +3

Query  411  YRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK-----GITFQT  575
            Y+ECLKNHA   GGH +DGCGEFM  G EGT ++LKCAACNCHRNFHRK         + 
Sbjct  30   YKECLKNHAVGIGGHALDGCGEFMAAGAEGTLDALKCAACNCHRNFHRKDPAESSFQLRR  89

Query  576  QNPPMLPPQHYR---GaapppppvrapaESSSEDLNAGGGQGLMQVP-------------  707
               P      YR   G      P R    + +    +G G G  Q P             
Sbjct  90   HRAPQFAAAFYRAPAGYLQVAGPQRGGLATLALPSTSGAGGG-AQSPGEEQENVSEPSGG  148

Query  708  -----SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWM  872
                 S KKRFRTKF+ +QK +M  FAEK+GWRIQK D+  V +FCS+ G++R V KVWM
Sbjct  149  GGGCGSHKKRFRTKFSLEQKDKMLAFAEKLGWRIQKHDESLVQEFCSQTGLQRHVLKVWM  208

Query  873  HN  878
            HN
Sbjct  209  HN  210



>emb|CDY14559.1| BnaC03g49000D [Brassica napus]
Length=293

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 98/179 (55%), Gaps = 21/179 (12%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGIT------  566
             R+RECLKN A + GGH VDGCGEFMP G EGT ++LKCAAC CHRNFHRK +       
Sbjct  78   FRFRECLKNQAVNIGGHAVDGCGEFMPAGIEGTIDALKCAACGCHRNFHRKELPYFHHHG  137

Query  567  -------------FQTQNPPM--LPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQ  701
                         F     P+   PP           P     E S + +     +    
Sbjct  138  PPHQPPPPPPPPGFYRLPAPVSYRPPPSQAPPLQLALPPPPQRERSEDRMETSSAEAGGG  197

Query  702  VPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
                +KRFRTKFT +QK++M   AE IGWRIQ+QDDE + +FC E GV RQV KVW+HN
Sbjct  198  GSGIRKRFRTKFTPEQKERMLALAESIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHN  256



>ref|XP_011012906.1| PREDICTED: zinc-finger homeodomain protein 4-like [Populus euphratica]
Length=280

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 104/199 (52%), Gaps = 40/199 (20%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK--------  557
            ++RYRECLKNHAA+ GG+  DGCGEFMP G+EG+ E+L C+AC CHRNFHRK        
Sbjct  67   MVRYRECLKNHAAAMGGNATDGCGEFMPNGEEGSIEALTCSACTCHRNFHRKEIEGEHTS  126

Query  558  ------------------------------GITFQTQNPPMLPPQHYRGaapppppvrap  647
                                           + + T    ++P +               
Sbjct  127  CGDCYHNNPHFNRVGRKVILGHHKSILAPEALGYPTATGTVVPSRAAAPHHQMIMSYNMG  186

Query  648  aESSSEDLNAGGGQGLMQVPSSkkrfrtkf--tqqqkqqMHEFAEKIGWRIQKQDDEEVH  821
            +  S  D    GG  +M  P+   + R +   TQ+QK++M  FAEK+GW++QKQ++  V 
Sbjct  187  SLPSESDEQEDGGGVVMARPAQLMKKRYRTKFTQEQKEKMLNFAEKVGWKLQKQEETVVQ  246

Query  822  KFCSEVGVKRQVFKVWMHN  878
            +FC E+G+KR+V KVWMHN
Sbjct  247  QFCQEIGIKRRVLKVWMHN  265



>ref|XP_002443023.1| hypothetical protein SORBIDRAFT_08g006490 [Sorghum bicolor]
 gb|EES16861.1| hypothetical protein SORBIDRAFT_08g006490 [Sorghum bicolor]
Length=328

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 106/201 (53%), Gaps = 43/201 (21%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK---------  557
            +RYRECLKNHAA+ GG   DGCGEFMP G+EG+ ++L+C+AC CHRNFHRK         
Sbjct  77   VRYRECLKNHAAAIGGSATDGCGEFMPAGEEGSLDALRCSACGCHRNFHRKEPPGGGGGG  136

Query  558  --------GITFQTQNP-----PMLPPQHYRGaapppp---------------------p  635
                    G      +P     P+    H+RG                            
Sbjct  137  DARQLHGHGHHHHHHHPLSPLSPLAAAHHHRGLLVAALPPAPTRMVMPLSAMHHQQQHHN  196

Query  636  vrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEE  815
              A AES       G   G  Q P ++KRFRTKFT +QK +M  FAE+ GWR+QK DD  
Sbjct  197  SSASAESDDAHNAPGHAHGQQQGPPARKRFRTKFTAEQKARMLGFAEEAGWRLQKLDDAA  256

Query  816  VHKFCSEVGVKRQVFKVWMHN  878
            V +FC EVGVKR+V KVWMHN
Sbjct  257  VQRFCQEVGVKRRVLKVWMHN  277



>ref|XP_002264291.1| PREDICTED: zinc-finger homeodomain protein 2-like [Vitis vinifera]
Length=292

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 106/174 (61%), Gaps = 18/174 (10%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ---  572
            ++RY+EC+ NHAAS G + +DGC EF+ GG++GTPESL CAAC CHR+FHRK + F    
Sbjct  80   IVRYKECMHNHAASMGYYTIDGCCEFVKGGEDGTPESLLCAACECHRSFHRKEVLFHDGT  139

Query  573  ------------TQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSk  716
                           P  LP   +      PP  +   E  SE L  G  +  M+     
Sbjct  140  TEVWYLPRPVTIVAAPIPLPQNIFLYNLRAPPLNQHQNEVPSEILREGETKVEME---GT  196

Query  717  krfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            K+ RTK T++QK++M  FAE++GW+  + +DEE+ KFCS++G+ R+VFKVW++N
Sbjct  197  KKPRTKLTKEQKERMSAFAERLGWKSHRHNDEEIRKFCSDIGISRRVFKVWLNN  250



>ref|XP_010027493.1| PREDICTED: zinc-finger homeodomain protein 2-like [Eucalyptus 
grandis]
 gb|KCW54036.1| hypothetical protein EUGRSUZ_I00022 [Eucalyptus grandis]
Length=216

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 97/160 (61%), Gaps = 8/160 (5%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQN  581
            + +YREC KNHAA+ GG+  DGCGEFMPGG+EGT ++LKC+ACNCHRNFHR+ I      
Sbjct  54   VTKYRECQKNHAAAIGGNARDGCGEFMPGGEEGTLDALKCSACNCHRNFHRREIL-----  108

Query  582  PPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSSkkrfrtkf-tqqqkqq  758
               + P +   +      +     + S   N G     ++V   KKR      T QQK++
Sbjct  109  --AVHPLNVDASGGLTLHLLKLDPTDSPTDNDGDETPKVEVVEKKKRRYRTKFTAQQKEK  166

Query  759  MHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            M  FA K GWR+QK D+  V + C E+G++R+V KVWMHN
Sbjct  167  MLAFATKAGWRMQKLDEHAVERLCQELGIERRVLKVWMHN  206



>ref|XP_008782488.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=259

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 108/196 (55%), Gaps = 35/196 (18%)
 Frame = +3

Query  384  TSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHR---  554
            TS   T IRYRECL+NHAAS GGHV+DGC EFMP   +   E+ KCAAC CHR+FHR   
Sbjct  50   TSEADTTIRYRECLRNHAASLGGHVLDGCCEFMPSSSD---EAFKCAACGCHRSFHRIDG  106

Query  555  --------KGITFQTQNPPMLP--------------------PQHYRGaapppppvrapa  650
                        ++  +  +                       Q +  ++          
Sbjct  107  DSSPSRSTSNSLYRVHDTRVPLLLPPLHPHHPPPPASYHHHQKQFFFRSSNAASGGTTTE  166

Query  651  ESSSEDLNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFC  830
             SS E LNAG G        S+KRFRTKF+ +QK++M +FAE++GWRIQKQD+  V +FC
Sbjct  167  SSSEE-LNAGAGPPQRPYMVSRKRFRTKFSAEQKERMLDFAERVGWRIQKQDEALVEEFC  225

Query  831  SEVGVKRQVFKVWMHN  878
            +EVGV RQV KVWMHN
Sbjct  226  AEVGVSRQVLKVWMHN  241



>emb|CDY41692.1| BnaC02g34620D [Brassica napus]
Length=300

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 109/187 (58%), Gaps = 37/187 (20%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-----TF-  569
            +Y+ECLKNHAASTGGH +DGCGEFMP G+EG+ E+L C+AC+CHRNFHR+ I     T+ 
Sbjct  86   KYKECLKNHAASTGGHAIDGCGEFMPSGEEGSIEALTCSACHCHRNFHRREIEGEDKTYF  145

Query  570  ------QTQNPPMLPPQHYRGaapp---------pppvrapaESSSEDL---------NA  677
                  Q Q  PM    H    +P                    S ED+         N 
Sbjct  146  SPYHHNQPQRNPMFHHHHKMTRSPLPQQMIMPLGVATTTVSNSESEEDIPFQQPPPPYNH  205

Query  678  GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQV  857
            GG     ++       RTKFTQ+QK++M  FAE+IGW++Q+Q++  V KFC E+GV+R+V
Sbjct  206  GGHNQKKRL-------RTKFTQEQKEKMLSFAERIGWKMQRQEESVVQKFCQEIGVRRRV  258

Query  858  FKVWMHN  878
             KVW+HN
Sbjct  259  LKVWIHN  265



>emb|CDY09363.1| BnaA02g26470D [Brassica napus]
Length=298

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 111/187 (59%), Gaps = 37/187 (20%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-----TF-  569
            +Y+ECLKNHAASTGGH +DGCGEFMP G+EG+ E+L C+AC+CHRNFHR+ I     T+ 
Sbjct  84   KYKECLKNHAASTGGHAIDGCGEFMPSGEEGSIEALTCSACHCHRNFHRREIEGEDKTYF  143

Query  570  ------QTQNPPMLPPQHYRGaapp---------pppvrapaESSSEDL---------NA  677
                  Q Q  PM    H    +P                    S ED+         N 
Sbjct  144  SPYHHNQPQRNPMFHHHHKMTRSPLPQQMIMPLGVATTTVSNSESEEDIPFQQPPPPYNH  203

Query  678  GGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQV  857
            GG        + KKR RTKFTQ+QK++M  FAE+IGW++Q+Q++  V KFC E+GV+R+V
Sbjct  204  GGH-------NQKKRLRTKFTQEQKEKMLSFAERIGWKMQRQEESVVQKFCQEIGVRRRV  256

Query  858  FKVWMHN  878
             KVW+HN
Sbjct  257  LKVWIHN  263



>ref|XP_010527865.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
Length=316

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 107/186 (58%), Gaps = 28/186 (15%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK-----GITF  569
            ++Y+ECLKNHAA+ GG+  DGCGEFMP G+EG+ E+L C+ACNCHRNFHRK      I F
Sbjct  91   VKYKECLKNHAAAMGGNATDGCGEFMPSGEEGSIEALTCSACNCHRNFHRKEVEGEAIPF  150

Query  570  ----------QTQNPPMLPPQHYRGaapppppvrapaES--------SSEDLNAGGGQGL  695
                      Q   P  L   H++  +  P  +  P  S        S + +   GG   
Sbjct  151  PAHYHHHHLQQPSQPRKLMLTHHKIRSAVPHQMIMPYMSTYMPPNSESDDQMEEDGGGVF  210

Query  696  MQVPSSkkrfrtkf-----tqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVF  860
               P+     + K      TQ+QK++M  FAE++GW+IQ+Q++  V +FC EVGVKR+V 
Sbjct  211  PARPAPPYNNQKKRFRTKFTQEQKEKMLNFAERVGWKIQRQEESVVQQFCQEVGVKRRVL  270

Query  861  KVWMHN  878
            KVWMHN
Sbjct  271  KVWMHN  276



>ref|XP_008440565.1| PREDICTED: zinc-finger homeodomain protein 1-like [Cucumis melo]
Length=248

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 103/188 (55%), Gaps = 31/188 (16%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK----------  557
            +YRECLKNHA   GGH +DGCGEF+  G EGT ++LKCAACNCHRNFHRK          
Sbjct  52   KYRECLKNHAVGIGGHALDGCGEFLAAGAEGTLDALKCAACNCHRNFHRKETDNNLNPAV  111

Query  558  GITFQTQNPPMLP-----PQHYRGaapppppvrapaESSSEDLNAGGG------QGLMQV  704
            G+      P +LP       +YR  A            +    + GGG      Q  M  
Sbjct  112  GVGLGIGEPFLLPHPGQFSPYYRTPAGYLHVAPHHRPLALPSTSGGGGTHSREEQEDMSN  171

Query  705  P----------SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQ  854
            P            KKRFRTKFTQ+QK +M   AE +GWRIQK D+  V +FC++ GVKR 
Sbjct  172  PSGGGGGGSSSFGKKRFRTKFTQEQKDRMLGLAETLGWRIQKHDEAVVQQFCNDTGVKRH  231

Query  855  VFKVWMHN  878
            V KVWMHN
Sbjct  232  VLKVWMHN  239



>ref|XP_004143449.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 ref|XP_004160918.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN48718.1| Zinc finger homeodomain protein 1 [Cucumis sativus]
Length=248

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 103/188 (55%), Gaps = 31/188 (16%)
 Frame = +3

Query  408  RYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK----------  557
            +YRECLKNHA   GGH +DGCGEF+  G EGT ++LKCAACNCHRNFHRK          
Sbjct  52   KYRECLKNHAVGIGGHALDGCGEFLAAGAEGTLDALKCAACNCHRNFHRKETDNNLNPAV  111

Query  558  GITFQTQNPPMLP-----PQHYRGaapppppvrapaESSSEDLNAGGG------QGLMQV  704
            G+      P +LP       +YR  A            +    + GGG      Q  M  
Sbjct  112  GVGLGIGEPFLLPHPGQFSPYYRTPAGYLHVAPHHRPLALPSTSGGGGTHSREEQEDMSN  171

Query  705  P----------SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQ  854
            P            KKRFRTKFTQ+QK +M   AE +GWRIQK D+  V +FC++ GVKR 
Sbjct  172  PSGGGGGGSSSFGKKRFRTKFTQEQKDRMLGLAETLGWRIQKHDEAVVQQFCNDTGVKRH  231

Query  855  VFKVWMHN  878
            V KVWMHN
Sbjct  232  VLKVWMHN  239



>ref|XP_002264250.1| PREDICTED: zinc-finger homeodomain protein 4-like [Vitis vinifera]
Length=243

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 107/177 (60%), Gaps = 18/177 (10%)
 Frame = +3

Query  393  TTTLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQ  572
               ++RY+EC+ NHAAS G + +DGCGEF+ GG++G+P++L CAAC CHR+FHRK + F 
Sbjct  29   VVEIVRYKECMHNHAASIGYYTIDGCGEFLKGGEDGSPKALLCAACKCHRSFHRKEVLFH  88

Query  573  TQN---------------PPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVP  707
              N               P  LP          PP  +      SE L  G  +  M+  
Sbjct  89   DDNTKVWYLHRPVTIAAAPNPLPRNILLYNLKAPPLSQQQNGVWSEKLRGGETEVEMK--  146

Query  708  SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
              +K+ RTK T++QK++M  FAE++GW+  + +D+E+ KFCS++G+ R+VFKVW++N
Sbjct  147  -RRKKPRTKLTKEQKERMTAFAERVGWKSHRHNDQEIRKFCSDIGISRRVFKVWLNN  202



>ref|XP_006400038.1| hypothetical protein EUTSA_v10016088mg [Eutrema salsugineum]
 dbj|BAJ34409.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41491.1| hypothetical protein EUTSA_v10016088mg [Eutrema salsugineum]
Length=266

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 105/183 (57%), Gaps = 19/183 (10%)
 Frame = +3

Query  384  TSHTTTLIRYRECLKNHAASTGGHVVDGCGEFMPG--GKEGTPESLKCAACNCHRNFHRK  557
             S    +  Y+ECLKNHAA  GGH +DGCGEFMP        P SL CAAC CHRNFHR+
Sbjct  49   ASEAVAVATYKECLKNHAAGIGGHALDGCGEFMPSLSFNSNDPASLTCAACGCHRNFHRR  108

Query  558  ---GITFQTQNPPMLPPQHYRGaapppppvrapaESSSED-------------LNAGGGQ  689
                 +     P +    H R   PPPPP      S  ED             L A  G 
Sbjct  109  EEDPSSVSAIVPAIEFRPHNRHQLPPPPPPSLGIRSPDEDDSASPPPISSSYMLLALSG-  167

Query  690  GLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVW  869
            G   VP S+KRFRTKF+Q QK++M EF+E++GWR+ K DD  V +FC E+GV+R VFKVW
Sbjct  168  GATAVPMSRKRFRTKFSQFQKEKMFEFSERVGWRMPKADDVAVREFCREIGVERSVFKVW  227

Query  870  MHN  878
            MHN
Sbjct  228  MHN  230



>ref|XP_008339904.1| PREDICTED: zinc-finger homeodomain protein 11-like [Malus domestica]
 ref|XP_008368241.1| PREDICTED: zinc-finger homeodomain protein 11-like [Malus domestica]
Length=322

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 103/207 (50%), Gaps = 46/207 (22%)
 Frame = +3

Query  396  TTLIRYRECLKNHAASTGGHVVDGCGEFM--PGGKEGTPESLKCAACNCHRNFH------  551
            T ++ Y+ECLKNHAAS GGH +DGCGEFM  P      P SLKCAAC CHRNFH      
Sbjct  49   TRVVAYKECLKNHAASLGGHALDGCGEFMPSPSSNPADPTSLKCAACGCHRNFHCRDQYR  108

Query  552  -----------------------------RKGITFQTQNPPM---LPPQHYRGaappppp  635
                                             T   Q+PP    LPP ++         
Sbjct  109  PKNNVIRNRLLPAPKTAHNNHSSSSSPSSSPNPTLSPQSPPPVSHLPPSYFAAPPQMLLA  168

Query  636  vrapaESSSED------LNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQ  797
            + +      ++      LN        + P  KKR RTKF+Q+QK++M  FAEK+GWR+Q
Sbjct  169  LSSGFSGPPDEHPHQHQLNPTAVMKTEKYPGEKKRSRTKFSQEQKEKMSSFAEKVGWRVQ  228

Query  798  KQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            K D+  V  FCSEVG+ R VFKVWMHN
Sbjct  229  KSDERSVEDFCSEVGIGRGVFKVWMHN  255



>ref|XP_003621193.1| ZF-HD homeobox protein [Medicago truncatula]
 gb|ABN05735.1| Homeobox domain, ZF-HD class; ZF-HD homeobox protein Cys/His-rich 
dimerisation region; Homeodomain-like [Medicago truncatula]
 gb|ABN08930.1| Homeobox domain, ZF-HD class; ZF-HD homeobox protein Cys/His-rich 
dimerisation region; Homeodomain-like [Medicago truncatula]
 gb|AES77411.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=341

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 110/193 (57%), Gaps = 39/193 (20%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFM--PGGKEGTPESLKCAACNCHRNFHRKGITFQTQ  578
            I Y+ECLKNHAA+ GGH +DGCGEFM  P      P SLKCAAC CHRNFHR+    + +
Sbjct  86   ITYKECLKNHAANLGGHALDGCGEFMTSPTATPTDPTSLKCAACGCHRNFHRR----EPE  141

Query  579  NPPM----------------LPPQHY---------------RGaapppppvrapaESSSE  665
             PP+                LPP  +                     P  + A + +  E
Sbjct  142  EPPLTTTHVIEYQPHHRHQPLPPPPFSHRSPNSSSPPPISSSYYPSAPHMLLALSAALPE  201

Query  666  DLNAGGGQGLMQVPS--SkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEV  839
            ++ A     LM   S  S+KRFRTKFTQ QK +M +FAEK+GW++QK+DDE VH+FC+E+
Sbjct  202  NVAAPNQTMLMNSHSNNSRKRFRTKFTQDQKDKMLKFAEKVGWKMQKKDDEFVHEFCNEI  261

Query  840  GVKRQVFKVWMHN  878
            GV R V KVWMHN
Sbjct  262  GVDRSVLKVWMHN  274



>emb|CDY33960.1| BnaC02g43770D [Brassica napus]
Length=269

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 93/175 (53%), Gaps = 33/175 (19%)
 Frame = +3

Query  417  ECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITF---------  569
            ECLKN A + GGH VDGCGE+MP G EGT E+LKCAAC CHRNFHRK   +         
Sbjct  71   ECLKNQAVNIGGHAVDGCGEYMPAGIEGTIEALKCAACGCHRNFHRKESLYFHHLAPPPP  130

Query  570  ------------QTQNPPMLPPQHYRGaapppppvrapaESSSEDLNAGGGQGLMQVPSS  713
                        + + PP   P                  SS+E   AGG +   +    
Sbjct  131  PPPGFYRLPAPVRYRPPPSQAPPLQLALPQRERSEDRMETSSAE---AGGIRKRFRT---  184

Query  714  kkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
                  KFT +QK++M   AE+IGWRIQ+QDDE + +FC E GV RQV KVW+HN
Sbjct  185  ------KFTAEQKERMLGLAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHN  233



>ref|XP_010514025.1| PREDICTED: zinc-finger homeodomain protein 3 [Camelina sativa]
 ref|XP_010514026.1| PREDICTED: zinc-finger homeodomain protein 3 [Camelina sativa]
Length=321

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 118/197 (60%), Gaps = 39/197 (20%)
 Frame = +3

Query  399  TLIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGI-----  563
             +I+Y+ECLKNHAAS GG+ +DGCGEFMP G++G+ E+L C+ACNCHRNFHR+ I     
Sbjct  90   VVIKYKECLKNHAASKGGNAIDGCGEFMPSGEDGSIEALTCSACNCHRNFHRREIEGEEK  149

Query  564  TFQT-----QNPPMLPPQ-----HYRGaapppppvrap--------aESSSEDLNAGGGQ  689
            TF +       PP  PPQ     H++    P P             + S SEDL    G 
Sbjct  150  TFFSPYLNHHQPP--PPQRKLMFHHKMIKSPLPQQMIMPIGVATGGSNSESEDLMEEDGG  207

Query  690  GLMQVP--------------SSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHKF  827
            G +                 + KKRFRTKFTQ+QK++M  FAE++GW++Q+Q++ +V + 
Sbjct  208  GSLTFRHPPPPPPPPYSYGHNQKKRFRTKFTQEQKEKMMSFAERVGWKMQRQEESDVQQL  267

Query  828  CSEVGVKRQVFKVWMHN  878
            C E+G+ R+V KVWMHN
Sbjct  268  CQEIGIMRRVLKVWMHN  284



>ref|XP_008353097.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
11-like, partial [Malus domestica]
Length=317

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 103/207 (50%), Gaps = 46/207 (22%)
 Frame = +3

Query  396  TTLIRYRECLKNHAASTGGHVVDGCGEFM--PGGKEGTPESLKCAACNCHRNFH------  551
            T ++ Y+ECLKNHAAS GGH +DGCGEFM  P      P SLKCAAC CHRNFH      
Sbjct  49   TRVVAYKECLKNHAASLGGHALDGCGEFMPSPSSNPADPTSLKCAACGCHRNFHCRDQYR  108

Query  552  -----------------------------RKGITFQTQNPPM---LPPQHYRGaappppp  635
                                             T   Q+PP    LPP ++         
Sbjct  109  PKNNVIRNRLLPAPKTAHNNHSSSSSPSSSPNPTLSPQSPPPVSHLPPSYFAAPPQMLLA  168

Query  636  vrapaESSSED------LNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQ  797
            + +      ++      LN        + P  KKR RTKF+Q+QK++M  FAEK+GWR+Q
Sbjct  169  LSSGFSGPPDEHPHQHQLNPTAVMKTEKYPGEKKRSRTKFSQEQKEKMXVFAEKVGWRVQ  228

Query  798  KQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            K D+  V  FCSEVG+ R VFKVWMHN
Sbjct  229  KSDERSVEDFCSEVGIGRGVFKVWMHN  255



>ref|XP_011005585.1| PREDICTED: zinc-finger homeodomain protein 3-like [Populus euphratica]
Length=269

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 106/200 (53%), Gaps = 41/200 (21%)
 Frame = +3

Query  402  LIRYRECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRKGITFQTQ-  578
            ++RY+ECLKNHAA+ GG+  DGCGEF+PGG+EG+ E+LKC+ACNCHRNFHRK I  +   
Sbjct  58   VVRYKECLKNHAAAIGGNATDGCGEFIPGGEEGSLEALKCSACNCHRNFHRKEIDGECSY  117

Query  579  ---------------------------NPPM-----------LPPQHYRGaapppppvra  644
                                       +PP             PP H    +       A
Sbjct  118  DCHHHYPIMSNIGSGRLISGHHNGIIGSPPQGYPTSSFISSRAPPPHQVVVSYKNGGANA  177

Query  645  paESSSEDLNAGGGQGLMQVPSSkkrf--rtkftqqqkqqMHEFAEKIGWRIQKQDDEEV  818
                S E     GG  L   P  K R   RTKFT++QKQ+M  FAEK GW++QK ++  V
Sbjct  178  ITSESDEKEEDNGGGILTTRPVEKLRKRFRTKFTEEQKQKMLNFAEKAGWKMQKLEESVV  237

Query  819  HKFCSEVGVKRQVFKVWMHN  878
               C E+G+KR+V KVWMHN
Sbjct  238  QGLCQELGIKRRVLKVWMHN  257



>ref|XP_007224765.1| hypothetical protein PRUPE_ppa024080mg [Prunus persica]
 gb|EMJ25964.1| hypothetical protein PRUPE_ppa024080mg [Prunus persica]
Length=349

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 107/206 (52%), Gaps = 48/206 (23%)
 Frame = +3

Query  405  IRYRECLKNHAASTGGHVVDGCGEFMPGGKEGT--PESLKCAACNCHRNFHRK-------  557
            + Y+ECLKNHAAS GGH +DGCGEFMP        P SLKCAAC CHRNFHR+       
Sbjct  66   VAYKECLKNHAASLGGHALDGCGEFMPSPSSNPMDPTSLKCAACGCHRNFHRRDQHRPKT  125

Query  558  ---------------------------------GITFQTQNPPM---LPPQHYRGaappp  629
                                             G T   Q+PP    LPP ++       
Sbjct  126  VLSHHRLLLPAPPTHHHHHSSSPSPTQSPVSSQGPTLSPQSPPPVSHLPPSYFASPPQML  185

Query  630  ppvrapaESSSEDLNAGGGQGLMQV---PSSkkrfrtkftqqqkqqMHEFAEKIGWRIQK  800
              +       S+  + G     M+    P+ KKR RTKF+Q+QK++M+ FAEK+GWR+Q+
Sbjct  186  LALSNGVSGPSDGHHHGLHPTTMKAEKYPNEKKRSRTKFSQEQKEKMNLFAEKVGWRMQR  245

Query  801  QDDEEVHKFCSEVGVKRQVFKVWMHN  878
             D+  V  FC+EVGV+R VFKVWMHN
Sbjct  246  SDERLVEDFCNEVGVRRGVFKVWMHN  271



>ref|XP_008389477.1| PREDICTED: zinc-finger homeodomain protein 11-like [Malus domestica]
Length=333

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 109/216 (50%), Gaps = 48/216 (22%)
 Frame = +3

Query  375  FADTSHTTTLIRYRECLKNHAASTGGHVVDGCGEFM--PGGKEGTPESLKCAACNCHRNF  548
            F   S  T ++ Y+ECLKNHAAS GGH +DGCGEFM  P      P SLKCAAC CHRNF
Sbjct  42   FQPQSTPTMVVAYKECLKNHAASLGGHALDGCGEFMPSPSSNPADPTSLKCAACGCHRNF  101

Query  549  HRKG-------------------------------------ITFQTQNPPM---LPPQHY  608
            HR+                                       T   Q+PP    LPP ++
Sbjct  102  HRRDQYRPKSNVIRNPHRLLPAPKPAHYNHSSSPSPSSSPNPTLSPQSPPPVSHLPPSYF  161

Query  609  RGaapppppvrapaESSSED------LNAGGGQGLMQVPSSkkrfrtkftqqqkqqMHEF  770
                     + +     S++      LN    +   + P  KKR RT+F+Q+QK++M  F
Sbjct  162  ASPPQMLLALSSGFSGPSDEHPHQHQLNPTAVKKTEKYPGEKKRSRTRFSQEQKEKMLSF  221

Query  771  AEKIGWRIQKQDDEEVHKFCSEVGVKRQVFKVWMHN  878
            AEK+GWR+QK ++  V  FCSEVG+ R VFKVWMHN
Sbjct  222  AEKVGWRLQKSEERLVEDFCSEVGIGRGVFKVWMHN  257



>ref|XP_004156724.1| PREDICTED: LOW QUALITY PROTEIN: ZF-HD homeobox protein At5g65410-like 
[Cucumis sativus]
Length=301

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 105/198 (53%), Gaps = 44/198 (22%)
 Frame = +3

Query  417  ECLKNHAASTGGHVVDGCGEFMPGGKEGTPESLKCAACNCHRNFHRK-------------  557
            ECLKNHAAS GG+  DGCGEFMP G+EG+ E+L C ACNCHRNFHRK             
Sbjct  82   ECLKNHAASMGGNATDGCGEFMPSGEEGSIEALTCLACNCHRNFHRKEIEGEPYDWLHHS  141

Query  558  ----------------------------GITFQTQNPPMLPPQHYRGaapppppvrapaE  653
                                        G TF +       P H   +          +E
Sbjct  142  RLGRKLLVGGKNMIGPPEPAAFAYPTAGGATFISSRAATTQPHHMIMSYNMLGGGGGHSE  201

Query  654  SS--SEDLNAG-GGQGLMQVPSSkkrfrtkftqqqkqqMHEFAEKIGWRIQKQDDEEVHK  824
            S    E + AG GG+       +KKRFRTKFT +QK++M  FAEK+GW+IQKQ++  V +
Sbjct  202  SEEQEEGMGAGVGGRVYSXAMMNKKRFRTKFTAEQKEKMLRFAEKVGWKIQKQEESVVQQ  261

Query  825  FCSEVGVKRQVFKVWMHN  878
            FC E+GVKR+V KVWMHN
Sbjct  262  FCQEIGVKRRVLKVWMHN  279



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1774205954430