BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22797_g2_i1 len=4213 path=[10322:0-780 14184:781-781
@11103@!:782-1201 @6690@!:1202-2658 6730:2659-3545 2064:3546-4212]

Length=4213
                                                                      Score     E

gb|AGW97551.1|  clp protease proteolytic subunit                        301   4e-90   
gb|AGW97041.1|  clp protease proteolytic subunit                        300   1e-89   
ref|YP_001468333.1|  ATP-dependent Clp protease proteolytic subunit     300   1e-89   Ipomoea purpurea
gb|AGW97126.1|  clp protease proteolytic subunit                        299   2e-89   
gb|AGW96362.1|  clp protease proteolytic subunit                        298   6e-89   
gb|AGW97296.1|  clp protease proteolytic subunit                        297   1e-88   
gb|AGW97466.1|  clp protease proteolytic subunit                        296   3e-88   
gb|AGW98144.1|  clp protease proteolytic subunit                        295   5e-88   
gb|AGW96871.1|  clp protease proteolytic subunit                        295   6e-88   
gb|AGW97720.1|  clp protease proteolytic subunit                        295   6e-88   
gb|AGW98994.1|  clp protease proteolytic subunit                        295   7e-88   
gb|AGW98655.1|  clp protease proteolytic subunit                        294   1e-87   
gb|AGW98484.1|  clp protease proteolytic subunit                        293   4e-87   
gb|AGW97211.1|  clp protease proteolytic subunit                        290   3e-86   
gb|AGW98910.1|  clp protease proteolytic subunit                        289   6e-86   
gb|AGW97805.1|  clp protease proteolytic subunit                        289   1e-85   
gb|AGW98570.1|  clp protease proteolytic subunit                        288   3e-85   
gb|AGW96700.1|  clp protease proteolytic subunit                        286   1e-84   
gb|AGW98824.1|  clp protease proteolytic subunit                        285   3e-84   
gb|AGW96956.1|  clp protease proteolytic subunit                        282   2e-83   
gb|AGW98740.1|  clp protease proteolytic subunit                        247   9e-71   
gb|AEZ48938.1|  clp protease proteolytic subunit                        229   3e-64   
gb|AEX96553.1|  clp protease proteolytic subunit                        228   7e-64   
gb|AEX96546.1|  clp protease proteolytic subunit                        227   9e-64   
ref|YP_007353939.1|  ATP-dependent Clp protease proteolytic subunit     227   9e-64   
gb|AAZ03804.1|  ATP-depedent Clp protease proteolytic subunit           226   1e-63   Yucca schidigera [Mohave yucca]
gb|AEZ48909.1|  clp protease proteolytic subunit                        227   1e-63   
ref|YP_004769971.1|  clp protease proteolytic subunit                   226   1e-63   
ref|YP_009057176.1|  clp protease proteolytic subunit                   226   2e-63   
gb|AGY95325.1|  ATP-dependent Clp protease                              226   2e-63   
gb|ADM92653.1|  clp protease proteolytic subunit protein                226   2e-63   
gb|AEZ48936.1|  clp protease proteolytic subunit                        227   2e-63   
ref|YP_004769653.1|  clp protease proteolytic subunit                   226   2e-63   
emb|CCQ71645.1|  ATP-dependent Clp protease proteolytic subunit         226   2e-63   
ref|YP_008964059.1|  ATP-dependent Clp protease proteolytic subunit     226   2e-63   
ref|YP_007507136.1|  ATP-dependent Clp protease proteolytic subunit     226   2e-63   
gb|AEZ48940.1|  clp protease proteolytic subunit                        226   2e-63   
gb|ADM92652.1|  clp protease proteolytic subunit protein                226   2e-63   
gb|AEX96547.1|  clp protease proteolytic subunit                        226   2e-63   
gb|AEX96550.1|  clp protease proteolytic subunit                        226   3e-63   
gb|AEX96541.1|  clp protease proteolytic subunit                        226   3e-63   
gb|AEX96581.1|  clp protease proteolytic subunit                        226   3e-63   
gb|AEX96580.1|  clp protease proteolytic subunit                        226   3e-63   
gb|AEX96542.1|  clp protease proteolytic subunit                        226   3e-63   
ref|YP_009045591.1|  ATP-dependent Clp protease proteolytic subunit     226   3e-63   
gb|AEX96585.1|  clp protease proteolytic subunit                        226   3e-63   
gb|AEX96551.1|  clp protease proteolytic subunit                        225   4e-63   
ref|YP_005097899.1|  ATP-dependent Clp protease proteolytic subunit     225   4e-63   
gb|AEX96582.1|  clp protease proteolytic subunit                        225   4e-63   
ref|YP_001595533.1|  ATP-dependent protease proteolytic subunit         225   4e-63   Lemna minor
gb|AEZ48934.1|  clp protease proteolytic subunit                        225   4e-63   
gb|AEX96556.1|  clp protease proteolytic subunit                        225   4e-63   
gb|AEX96554.1|  clp protease proteolytic subunit                        225   4e-63   
ref|YP_004769836.1|  clp protease proteolytic subunit                   225   4e-63   
gb|AEZ48912.1|  clp protease proteolytic subunit                        225   4e-63   
gb|AGL45361.1|  ClpP                                                    225   5e-63   
ref|YP_008815962.1|  ATP-dependent Clp protease proteolytic subunit     225   5e-63   
gb|ABG74755.1|  ATP-dependent protease catalytic subunit                224   5e-63   Forsythia europaea
ref|YP_008814968.1|  clp protease proteolytic subunit                   224   6e-63   
ref|YP_009108225.1|  clp protease proteolytic subunit                   224   6e-63   
gb|AEX96548.1|  clp protease proteolytic subunit                        225   6e-63   
gb|ADD31104.1|  clp protease proteolytic subunit protein                224   6e-63   Ilex cornuta [Chinese holly]
ref|YP_005089601.1|  clpP gene product                                  224   6e-63   
ref|YP_007475986.1|  clp protease proteolytic subunit                   224   7e-63   
ref|YP_004564028.1|  ATP-dependent Clp protease proteolytic subunit     224   7e-63   
gb|AEX65184.1|  ATP-dependent Clp protease proteolytic subunit          224   7e-63   
gb|AEX65186.1|  ATP-dependent Clp protease proteolytic subunit          224   7e-63   
gb|ACC61147.1|  ClpP                                                    223   8e-63   Agrostemma githago [purple cockle]
ref|YP_003540956.1|  clpP-like protease                                 224   8e-63   Phoenix dactylifera
gb|AAZ03803.1|  ATP-depedent Clp protease proteolytic subunit           224   8e-63   Typha latifolia [common cattail]
ref|YP_009110626.1|  ATP-dependent Clp protease proteolytic subunit     224   8e-63   
gb|ABY85552.1|  ATP-dependent protease proteolytic subunit              224   9e-63   Silene zawadskii
gb|ABY85573.1|  ATP-dependent protease proteolytic subunit              224   9e-63   Silene sorensenis
gb|AEX96576.1|  clp protease proteolytic subunit                        224   1e-62   
ref|YP_003434000.1|  clp protease proteolytic subunit                   224   1e-62   Typha latifolia [common cattail]
gb|AEX96563.1|  clp protease proteolytic subunit                        224   1e-62   
gb|AEX96562.1|  clp protease proteolytic subunit                        224   1e-62   
gb|AFV61837.1|  ATP-dependent Clp protease proteolytic subunit          224   1e-62   
gb|ACC61150.1|  ClpP                                                    223   1e-62   Atocion rupestre
ref|YP_009059544.1|  clpP protease proteolytic subunit                  224   1e-62   
ref|YP_006665805.1|  clp protease proteolytic subunit                   224   1e-62   
gb|AEX96579.1|  clp protease proteolytic subunit                        224   1e-62   
gb|AEX96560.1|  clp protease proteolytic subunit                        224   1e-62   
ref|YP_004935691.1|  clpP gene product                                  224   1e-62   
ref|YP_009048224.1|  clpP-like protease                                 224   1e-62   
gb|AEX96568.1|  clp protease proteolytic subunit                        224   1e-62   
gb|ADD31117.1|  clp protease proteolytic subunit protein                223   1e-62   Heuchera sanguinea
gb|AEX96575.1|  clp protease proteolytic subunit                        224   1e-62   
ref|YP_008815142.1|  clp protease proteolytic subunit                   223   1e-62   
gb|AEZ48924.1|  clp protease proteolytic subunit                        223   1e-62   
ref|NP_054525.1|  ATP-dependent Clp protease proteolytic subunit        223   1e-62   Nicotiana tabacum [American tobacco]
gb|AEX96557.1|  clp protease proteolytic subunit                        224   1e-62   
ref|YP_004935577.1|  ATP-dependent Clp protease proteolytic subunit     223   1e-62   
gb|AEZ48911.1|  clp protease proteolytic subunit                        223   2e-62   
ref|YP_009111680.1|  clp protease proteolytic subunit                   223   2e-62   
ref|YP_008814881.1|  clp protease proteolytic subunit                   223   2e-62   
gb|AJD00749.1|  ATP-dependent Clp protease proteolytic subunit          223   2e-62   
ref|YP_009108401.1|  clp protease proteolytic subunit                   223   2e-62   
gb|AEX65185.1|  ATP-dependent Clp protease proteolytic subunit          223   2e-62   
gb|AEX96578.1|  clp protease proteolytic subunit                        223   2e-62   
gb|AEZ48930.1|  clp protease proteolytic subunit                        223   2e-62   
ref|YP_817507.1|  clp protease proteolytic subunit                      223   2e-62   Coffea arabica [arabica coffee]
ref|YP_008999959.1|  clp protease proteolytic subunit (chloroplast)     223   2e-62   
gb|ADD31102.1|  clp protease proteolytic subunit protein                223   2e-62   Dillenia indica
ref|YP_007890301.1|  ATP-dependent Clp protease proteolytic subunit     223   3e-62   
ref|YP_008999906.1|  clp protease proteolytic subunit                   223   3e-62   
ref|YP_008963505.1|  clp protease proteolytic subunit                   223   3e-62   
gb|AFM83318.1|  clp protease proteolytic subunit                        223   3e-62   
gb|AHF72005.1|  clpP-like protease                                      223   3e-62   
gb|AHY80565.1|  clp protease proteolytic subunit                        223   3e-62   
gb|AEZ48915.1|  clp protease proteolytic subunit                        223   3e-62   
gb|ABY85510.1|  ATP-dependent protease proteolytic subunit              223   3e-62   Silene littorea
gb|ACN49434.1|  clp protease proteolytic subunit                        223   3e-62   
ref|YP_740142.1|  clp protease proteolytic subunit                      223   3e-62   Daucus carota [carrots]
gb|ADD31100.1|  clp protease proteolytic subunit protein                223   3e-62   Antirrhinum majus [garden snapdragon]
gb|ABU85179.1|  clp protease proteolytic subunit                        223   3e-62   Anethum graveolens
gb|AHH24298.1|  ATP-dependent Clp protease proteolytic subunit          223   3e-62   
ref|NP_054959.1|  ATP-dependent Clp protease proteolytic subunit        223   3e-62   Spinacia oleracea
gb|AEX65187.1|  ATP-dependent Clp protease proteolytic subunit          222   3e-62   
ref|YP_007475814.1|  clp protease proteolytic subunit                   223   3e-62   
ref|YP_003359383.1|  ATP-dependent protease subunit                     222   4e-62   Olea europaea
gb|AGX28868.2|  clpP-like protease                                      223   4e-62   
gb|AEX96561.1|  clp protease proteolytic subunit                        223   4e-62   
ref|YP_005087718.1|  ATP-dependent Clp protease proteolytic subunit     222   4e-62   
gb|ABY85762.1|  ATP-dependent protease proteolytic subunit              222   4e-62   Silene aegyptiaca
ref|YP_001542472.1|  clp protease proteolytic subunit                   222   4e-62   Ceratophyllum demersum [hornwort]
ref|YP_005089358.1|  clpP gene product                                  222   4e-62   
gb|AEX96543.1|  clp protease proteolytic subunit                        223   4e-62   
gb|ABY84433.1|  ATP-dependent protease proteolytic subunit              222   4e-62   Silene flos-jovis
gb|AEX65183.1|  ATP-dependent Clp protease proteolytic subunit          222   4e-62   
ref|YP_009026462.1|  ATP-dependent Clp protease proteolytic subunit     222   5e-62   
gb|AEX96570.1|  clp protease proteolytic subunit                        222   5e-62   
dbj|BAQ19666.1|  clp protease proteolytic subunit                       222   5e-62   
ref|YP_007475900.1|  clp protease proteolytic subunit                   222   5e-62   
ref|YP_009020064.1|  clp protease proteolytic subunit                   222   5e-62   
ref|YP_008081675.1|  clpP-like protease                                 222   6e-62   
gb|AEZ48927.1|  clp protease proteolytic subunit                        222   6e-62   
gb|AEZ48917.1|  clp protease proteolytic subunit                        222   6e-62   
gb|AGE93480.1|  clp protease proteolytic subunit                        222   6e-62   
gb|AEX96555.1|  clp protease proteolytic subunit                        222   7e-62   
gb|AJC00295.1|  ATP-dependent Clp protease proteolytic subunit          221   7e-62   
gb|AEZ48918.1|  clp protease proteolytic subunit                        222   7e-62   
gb|AEZ48910.1|  clp protease proteolytic subunit                        222   7e-62   
ref|YP_009108614.1|  Clp protease proteolytic subunit                   221   7e-62   
ref|YP_001671708.1|  ATP-dependent Clp protease proteolytic subunit     221   8e-62   Carica papaya [mamon]
gb|AEZ48916.1|  clp protease proteolytic subunit                        221   8e-62   
ref|YP_008963716.1|  clp protease proteolytic subunit                   221   8e-62   
gb|AGE93222.1|  clp protease proteolytic subunit                        221   8e-62   
ref|YP_008994314.1|  clp protease proteolytic subunit                   221   9e-62   
ref|YP_009048599.1|  clpP-like protease                                 221   9e-62   
gb|AEX96566.1|  clp protease proteolytic subunit                        221   9e-62   
gb|ADD31111.1|  clp protease proteolytic subunit protein                221   9e-62   Berberidopsis corallina
gb|AEZ48928.1|  clp protease proteolytic subunit                        221   9e-62   
ref|YP_003587490.1|  Clp protease proteolytic subunit                   221   1e-61   
gb|AGE93308.1|  clp protease proteolytic subunit                        221   1e-61   
ref|YP_009108868.1|  Clp protease proteolytic subunit                   221   1e-61   
ref|YP_740675.1|  clp protease proteolytic subunit                      221   1e-61   Nandina domestica
ref|YP_009093975.1|  clp protease proteolytic subunit                   221   1e-61   
gb|AHW52209.1|  clp protease proteolytic subunit                        221   1e-61   
ref|NP_084822.1|  ATP-dependent Clp protease proteolytic subunit        220   2e-61   Lotus japonicus
gb|AIW05836.1|  Clp protease proteolytic subunit                        220   2e-61   
ref|YP_008082606.1|  clp protease proteolytic subunit                   220   2e-61   
ref|YP_007890398.1|  clp protease proteolytic subunit                   220   2e-61   
ref|YP_007476072.1|  clp protease proteolytic subunit                   221   2e-61   
ref|YP_538961.1|  ATP-dependent Clp protease proteolytic subunit        220   2e-61   Gossypium hirsutum [American cotton]
ref|YP_007317273.1|  ATP-dependent Clp protease proteolytic subunit     220   2e-61   
gb|AEX96567.1|  clp protease proteolytic subunit                        220   2e-61   
ref|YP_006503385.1|  ATP-dependent Clp protease proteolytic subunit     220   3e-61   
ref|YP_006576139.1|  ClpP                                               220   3e-61   
ref|YP_005296125.1|  clpP gene product                                  219   3e-61   
ref|YP_009092792.1|  clp protease proteolytic subunit                   220   3e-61   
gb|ADD31101.1|  clp protease proteolytic subunit protein                219   4e-61   Aucuba japonica
ref|YP_006073290.1|  ATP-dependent Clp protease proteolytic subunit     219   4e-61   
gb|AEZ48942.1|  clp protease proteolytic subunit                        219   4e-61   
ref|YP_007889886.1|  clp protease proteolytic subunit                   219   4e-61   
ref|YP_008993459.1|  clpP                                               219   4e-61   
ref|YP_009108699.1|  Clp protease proteolytic subunit                   219   4e-61   
ref|YP_009108254.1|  clp protease proteolytic subunit                   219   5e-61   
gb|ABY85489.1|  ATP-dependent protease proteolytic subunit              219   5e-61   Silene samia
ref|YP_009114473.1|  clp protease proteolytic subunit                   219   5e-61   
ref|YP_009093825.1|  ATP-dependent Clp protease proteolytic subunit     219   5e-61   
gb|AEX96544.1|  clp protease proteolytic subunit                        219   5e-61   
ref|NP_862778.1|  ATP-dependent Clp protease proteolytic subunit        219   5e-61   Calycanthus floridus var. glaucus
gb|ABU85333.1|  clp protease proteolytic subunit                        219   5e-61   Elaeis oleifera
ref|YP_008577093.1|  ATP-dependent Clp protease proteolytic subunit     219   5e-61   
gb|ADO33472.1|  clp protease proteolytic subunit                        219   6e-61   
ref|YP_004769739.1|  ClpP                                               219   6e-61   
ref|YP_008578198.1|  ATP-dependent Clp protease proteolytic subunit     219   6e-61   
ref|YP_003933985.1|  clp protease proteolytic subunit                   219   6e-61   
gb|AIW05243.1|  Clp protease proteolytic subunit                        219   6e-61   
ref|YP_008965564.1|  clp protease proteolytic subunit                   219   7e-61   
ref|YP_007475644.1|  clp protease proteolytic subunit                   219   7e-61   
gb|AIW05497.1|  Clp protease proteolytic subunit                        219   7e-61   
ref|YP_008993373.1|  clpP                                               219   7e-61   
ref|YP_009041112.1|  ATP-dependent Clp protease proteolytic subunit     219   7e-61   
ref|YP_001294123.1|  clp protease proteolytic subunit                   219   7e-61   Chloranthus spicatus [cha-ran]
gb|AGM51172.1|  clp protease proteolytic subunit                        219   7e-61   
gb|ABU85425.1|  clp protease proteolytic subunit                        218   7e-61   Musa acuminata [banana]
gb|AHI87553.1|  clp protease proteolytic subunit                        219   7e-61   
ref|YP_913212.1|  ATP-dependent protease proteolytic subunit            218   8e-61   Gossypium barbadense [Egyptian cotton]
gb|AHA12949.1|  clp protease proteolytic subunit                        219   8e-61   
ref|YP_008993201.1|  clpP                                               219   9e-61   
gb|AGQ55782.2|  clp protease proteolytic subunit                        219   9e-61   
ref|YP_008993545.1|  clpP                                               218   9e-61   
gb|AGK25556.1|  clpP-like protease                                      218   1e-60   
ref|YP_009027804.1|  clp protease proteolytic subunit                   218   1e-60   
gb|ABY85594.1|  ATP-dependent protease proteolytic subunit              218   1e-60   Silene integripetala
ref|YP_008854450.1|  clp protease proteolytic subunit                   218   1e-60   
ref|YP_358605.1|  ATP-dependent Clp protease proteolytic subunit        218   1e-60   Phalaenopsis aphrodite subsp. formosana
ref|YP_008575393.1|  ATP-dependent Clp protease proteolytic subunit     218   1e-60   
gb|AEX58480.1|  clp protease proteolytic subunit                        218   1e-60   
gb|AGQ55699.2|  clp protease proteolytic subunit                        218   1e-60   
gb|AEX96545.1|  clp protease proteolytic subunit                        218   1e-60   
ref|NP_054384.1|  ATP-dependent Clp protease proteolytic subunit        218   1e-60   Epifagus virginiana
ref|YP_009092328.1|  clp protease proteolytic subunit                   218   1e-60   
ref|NP_904123.1|  ATP-dependent Clp protease proteolytic subunit        218   1e-60   Amborella trichopoda
ref|YP_008082758.1|  clp protease proteolytic subunit                   218   1e-60   
ref|YP_008575138.1|  ATP-dependent Clp protease proteolytic subunit     218   1e-60   
gb|AGM14961.1|  ATP-dependent Clp protease proteolytic subunit          218   1e-60   
ref|YP_636324.1|  ATP-dependent Clp protease proteolytic subunit        218   1e-60   Eucalyptus globulus subsp. globulus
ref|YP_008577518.1|  ATP-dependent Clp protease proteolytic subunit     218   1e-60   
ref|YP_740227.1|  clp protease proteolytic subunit                      218   1e-60   Liriodendron tulipifera
gb|AIW05412.1|  Clp protease proteolytic subunit                        218   1e-60   
ref|YP_009109022.1|  clp protease proteolytic subunit                   218   1e-60   
ref|YP_009000358.1|  clpP protein                                       218   2e-60   
ref|YP_784411.1|  clp protease proteolytic subunit                      218   2e-60   Drimys granadensis
gb|ADD31113.1|  clp protease proteolytic subunit protein                218   2e-60   Cornus florida [flowering dogwood]
gb|AHA13207.1|  clp protease proteolytic subunit                        218   2e-60   
ref|YP_004842263.1|  clp protease proteolytic subunit                   218   2e-60   
ref|YP_740590.1|  clp protease proteolytic subunit                      218   2e-60   Platanus occidentalis [American sycamore]
ref|YP_004021341.1|  clp protease proteolytic subunit                   218   2e-60   
ref|YP_009108522.1|  proteolytic subunit of the Clp protease            218   2e-60   
ref|YP_009109229.1|  clp protease proteolytic subunit                   218   2e-60   
ref|YP_004563892.1|  clp protease proteolytic subunit                   218   2e-60   
ref|YP_008081482.1|  ATP-dependent Clp protease proteolytic subunit     218   2e-60   
ref|YP_001294209.1|  clp protease proteolytic subunit                   217   2e-60   Buxus microphylla
ref|YP_006073129.1|  clp protease proteolytic subunit                   217   3e-60   
ref|YP_008963626.1|  ATP-dependent Clp protease proteolytic subunit     217   3e-60   
gb|AIW51358.1|  clp protease proteolytic subunit                        218   3e-60   
ref|YP_008577263.1|  ATP-dependent Clp protease proteolytic subunit     217   3e-60   
ref|YP_008963330.1|  clp protease proteolytic subunit                   217   3e-60   
ref|YP_004286029.1|  clp protease proteolytic subunit                   217   3e-60   
gb|AEX96572.1|  clp protease proteolytic subunit                        217   3e-60   
ref|YP_004021690.1|  clp protease proteolytic subunit                   217   3e-60   
gb|AEZ48913.1|  clp protease proteolytic subunit                        217   3e-60   
ref|YP_762286.1|  clp protease proteolytic subunit                      217   3e-60   Morus indica
sp|P56772.2|CLPP1_ARATH  RecName: Full=ATP-dependent Clp protease...    217   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|YP_009027912.1|  ATP-dependent Clp protease proteolytic subun...    216   4e-60   
ref|YP_008994098.1|  ATP-dependent Clp protease proteolytic subunit     217   4e-60   
ref|YP_086990.1|  ATP-dependent Clp protease proteolytic subunit        216   5e-60   Panax ginseng [Chinese ginseng]
ref|YP_009114894.1|  ATP-dependent Clp protease proteolytic subunit     216   5e-60   
ref|YP_009109302.1|  clp protease proteolytic subunit                   216   5e-60   
ref|YP_009027995.1|  ATP-dependent Clp protease proteolytic subun...    216   7e-60   
ref|YP_009109156.1|  clp protease proteolytic subunit                   216   8e-60   
ref|YP_009109085.1|  clp protease proteolytic subunit                   216   8e-60   
ref|YP_008758213.1|  clpP-like protease                                 216   9e-60   
gb|AIW51284.1|  clp protease proteolytic subunit                        216   9e-60   
ref|YP_006503714.1|  clp protease proteolytic subunit                   216   1e-59   
ref|YP_004327687.1|  ATP-dependent Clp protease proteolytic subunit     215   1e-59   
sp|Q5QA83.1|CLPP_ACOGR  RecName: Full=ATP-dependent Clp protease ...    216   1e-59   Acorus gramineus [shi chang pu]
ref|YP_001294295.1|  clp protease proteolytic subunit                   216   1e-59   Illicium oligandrum
ref|YP_538790.1|  ATP-dependent Clp protease proteolytic subunit        215   1e-59   Glycine max [soybeans]
ref|YP_008145735.1|  clp protease proteolytic subunit                   215   1e-59   
gb|AGW04877.1|  clp protease proteolytic subunit protein                215   1e-59   
gb|AAZ03799.1|  ATP-depedent Clp protease proteolytic subunit           215   1e-59   Acorus americanus [sweetflag]
ref|YP_005089977.1|  clpP gene product                                  215   2e-59   
ref|YP_009108459.1|  ATP-dependent Clp protease proteolytic subunit     215   2e-59   
ref|NP_051083.1|  ATP-dependent Clp protease proteolytic subunit        214   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AEZ48943.1|  clp protease proteolytic subunit                        215   2e-59   
ref|YP_008081390.1|  ATP-dependent Clp protease proteolytic subunit     215   2e-59   
ref|YP_004286127.1|  clp protease proteolytic subunit                   214   2e-59   
gb|AIZ57553.1|  ATP-depenent Clp protease proteolytic subunit           214   3e-59   
ref|YP_001123311.1|  ATP-dependent protease subunit                     214   3e-59   Barbarea verna
ref|YP_004841808.1|  clp protease proteolytic subunit                   214   3e-59   
gb|AAZ03802.1|  ATP-depedent Clp protease proteolytic subunit           214   3e-59   Ranunculus macranthus
ref|YP_009108784.1|  Clp protease proteolytic subunit                   214   3e-59   
gb|AFM83381.1|  clp protease proteolytic subunit                        214   3e-59   
ref|YP_001430129.1|  ATP-dependent Clp protease proteolytic subunit     214   4e-59   Cuscuta reflexa [giant dodder]
gb|AIW05921.1|  Clp protease proteolytic subunit                        214   4e-59   
ref|YP_004940534.1|  clpP gene product                                  214   4e-59   
ref|YP_001123839.1|  ATP-dependent Clp protease proteolytic subunit     214   4e-59   
ref|YP_007026163.1|  clp protease proteolytic subunit                   214   4e-59   
ref|YP_004021229.1|  clp protease proteolytic subunit                   214   4e-59   
gb|AIW56892.1|  clp protease proteolytic subunit                        213   4e-59   
ref|NP_039323.1|  ATP-dependent Clp protease proteolytic subunit        214   5e-59   
ref|YP_001294377.1|  ATP-dependent Clp protease proteolytic subunit     214   5e-59   
ref|YP_009040345.1|  clp protease proteolytic subunit                   213   5e-59   
ref|YP_008081290.1|  Clp protease proteolytic subunit (chloroplast)     214   5e-59   
gb|ADD31121.1|  clp protease proteolytic subunit protein                213   5e-59   
gb|ADH10397.1|  clp protease proteolytic subunit                        214   5e-59   
ref|YP_009033910.1|  ATP-dependent Clp protease proteolytic subunit     213   6e-59   
ref|YP_003097504.1|  ATP-dependent Clp protease proteolytic subunit     214   6e-59   
ref|YP_319788.1|  ATP-dependent Clp protease proteolytic subunit        213   6e-59   
ref|YP_001123575.1|  ATP-dependent protease subunit                     213   6e-59   
ref|YP_005090203.1|  clpP gene product                                  213   7e-59   
gb|EPS74507.1|  hypothetical protein M569_00224                         213   7e-59   
gb|AGW04343.1|  Clp protease proteolytic subunit                        213   7e-59   
emb|CCW72401.1|  clpP                                                   213   7e-59   
ref|NP_848084.2|  ATP-dependent Clp protease proteolytic subunit        213   7e-59   
gb|ADD31106.1|  clp protease proteolytic subunit protein                213   8e-59   
ref|YP_009020769.1|  clp protease proteolytic subunit                   213   8e-59   
ref|YP_009046939.1|  ATP-dependent Clp protease proteolytic subunit     213   8e-59   
ref|YP_001687238.1|  ATP-dependent Clp protease proteolytic subunit     213   8e-59   
ref|YP_398353.1|  ATP-dependent Clp protease proteolytic subunit        213   8e-59   
ref|YP_009051586.1|  ATP-dependent CLP protease proteolytic subunit     213   9e-59   
gb|AEP94879.1|  clp protease proteolytic subunit                        213   9e-59   
ref|YP_001542553.1|  clp protease proteolytic subunit                   213   1e-58   
ref|YP_002720137.1|  clpP                                               212   1e-58   
ref|YP_665583.1|  ATP-dependent Clp protease proteolytic subunit        212   1e-58   
ref|YP_001123662.1|  ATP-dependent Clp protease proteolytic subunit     212   1e-58   
ref|YP_001123055.1|  ATP-dependent protease subunit                     212   1e-58   
ref|YP_009002280.1|  ATP-dependent Clp protease proteolytic subunit     212   1e-58   
ref|YP_001123398.1|  ATP-dependent Clp protease proteolytic subunit     212   1e-58   
ref|XP_002993920.1|  hypothetical protein SELMODRAFT_137715             213   1e-58   
ref|YP_007374739.1|  ATP-dependent Clp protease proteolytic subun...    213   1e-58   
ref|YP_008592513.1|  ATP-dependent Clp protease proteolytic subunit     212   1e-58   
ref|YP_002836115.1|  clp protease proteolytic subunit                   212   1e-58   
ref|NP_777437.1|  ATP-dependent Clp protease proteolytic subunit        212   1e-58   
ref|YP_001718462.1|  ATP-dependent Clp protease proteolytic subunit     212   1e-58   
gb|ADD31110.1|  clp protease proteolytic subunit protein                212   1e-58   
ref|YP_009054454.1|  clp protease proteolytic subunit                   212   2e-58   
dbj|BAG50149.1|  ATP-dependent Clp protease proteolytic subunit         212   2e-58   
ref|YP_004021760.1|  clp protease proteolytic subunit                   212   2e-58   
ref|YP_567102.1|  ATP-dependent Clp protease proteolytic subunit        212   2e-58   
ref|YP_006460367.1|  clp protease proteolytic subunit                   212   2e-58   
ref|YP_784498.1|  clp protease proteolytic subunit                      212   2e-58   
ref|YP_588142.1|  ATP-dependent Clp protease proteolytic subunit        211   2e-58   
ref|YP_009048046.1|  clpP-like protease                                 212   2e-58   
ref|YP_004123449.1|  ClpP                                               211   2e-58   
ref|NP_783256.1|  ATP-dependent Clp protease proteolytic subunit        211   2e-58   
ref|YP_001837385.1|  ATP-dependent Clp protease proteolytic subunit     211   3e-58   
ref|NP_683797.1|  ATP-dependent Clp protease proteolytic subunit        211   3e-58   
gb|ADD31115.1|  clp protease proteolytic subunit protein                212   3e-58   
ref|YP_007353791.1|  ATP-dependent Clp protease proteolytic subunit     211   3e-58   
ref|YP_004072487.1|  ATP-dependent protease                             211   3e-58   
ref|YP_009108950.1|  clp protease proteolytic subunit                   211   3e-58   
ref|YP_009020244.1|  clp protease proteolytic subunit                   211   4e-58   
ref|YP_009109476.1|  ATP-dependent Clp protease proteolytic subunit     211   5e-58   
gb|AIS38263.1|  clp protease proteolytic subunit                        211   5e-58   
ref|YP_004465212.1|  clp protease proteolytic subunit                   210   5e-58   
ref|YP_002149757.1|  clp protease proteolytic subunit                   210   6e-58   
ref|YP_009041001.1|  ClpP                                               210   6e-58   
gb|AJD22480.1|  ClpP                                                    210   6e-58   
ref|YP_001004211.1|  clp protease proteolytic subunit                   210   6e-58   
ref|YP_007375068.1|  clp protease proteolytic subunit                   210   7e-58   
ref|YP_636436.1|  ATP-dependent Clp protease proteolytic subunit        210   7e-58   
ref|YP_053179.1|  ATP-dependent Clp protease proteolytic subunit        210   9e-58   
ref|YP_008474588.1|  Clp protease proteolytic subunit                   210   9e-58   
dbj|BAO01518.1|  ATP-dependent Clp protease proteolytic subunit         209   1e-57   
ref|YP_004021175.1|  clp protease proteolytic subunit                   209   1e-57   
gb|ABW22759.1|  clp protease proteolytic subunit                        209   1e-57   
ref|YP_009019913.1|  clp protease proteolytic subunit                   209   1e-57   
ref|YP_009048135.1|  clpP-like protease                                 210   1e-57   
ref|YP_009114259.1|  ATP-dependent clp protease proteolytic subunit     209   1e-57   
gb|ADD31116.1|  clp protease proteolytic subunit protein                209   1e-57   
ref|YP_002586911.1|  clp protease proteolytic subunit                   209   1e-57   
gb|ABY85720.1|  ATP-dependent protease proteolytic subunit              209   2e-57   
ref|YP_001123224.1|  ATP-dependent protease subunit                     209   2e-57   
gb|AEZ48933.1|  clp protease proteolytic subunit                        209   2e-57   
ref|YP_001023726.1|  ATP-dependent Clp protease proteolytic subunit     209   2e-57   
ref|NP_904176.1|  ATP-dependent Clp protease proteolytic subunit        208   3e-57   
ref|YP_636469.1|  ATP-dependent Clp protease proteolytic subunit        209   3e-57   
ref|YP_009033714.1|  proteolytic subunit 2 of clp protease (chlor...    209   4e-57   
ref|YP_009024817.1|  clp protease proteolytic subunit                   208   4e-57   
ref|YP_008520164.1|  clpP-like protease                                 209   4e-57   
ref|YP_003934583.1|  clp protease proteolytic subunit                   208   4e-57   
ref|YP_006666055.1|  clp protease proteolytic subunit                   207   6e-57   
gb|AGZ19167.1|  clp protease proteolytic subunit                        208   6e-57   
ref|YP_635771.1|  ATP-dependent Clp protease proteolytic subunit        208   6e-57   
gb|ADD31109.1|  clp protease proteolytic subunit protein                207   7e-57   
ref|YP_008592782.1|  clpP-like protease                                 208   7e-57   
gb|AAZ03801.1|  ATP-depedent Clp protease proteolytic subunit           207   7e-57   
gb|AEZ48920.1|  clp protease proteolytic subunit                        207   9e-57   
ref|YP_005088832.1|  ATP-dependent Clp protease proteolytic subunit     206   1e-56   
ref|YP_004940609.1|  clpP gene product                                  206   1e-56   
ref|YP_005352976.1|  clpP gene product                                  206   1e-56   
ref|YP_009027071.1|  clp protease proteolytic subunit                   206   2e-56   
ref|YP_003795605.1|  clp protease proteolytic subunit                   206   2e-56   
ref|YP_004376535.1|  clp protease proteolytic subunit                   206   3e-56   
ref|YP_008964382.1|  clp protease proteolytic subunit                   205   4e-56   
ref|YP_009027147.1|  clp protease proteolytic subunit                   205   4e-56   
gb|ABY85678.1|  ATP-dependent protease proteolytic subunit              205   5e-56   
ref|YP_008963420.1|  clp protease proteolytic subunit                   205   5e-56   
ref|YP_001430063.1|  ATP-dependent Clp protease proteolytic subunit     205   5e-56   
gb|AGW04954.1|  clp protease proteolytic subunit protein                204   6e-56   
gb|AHZ58087.1|  ATP-dependent Clp protease proteolytic subunit          204   6e-56   
sp|Q2QD64.1|CLPP_CUCSA  RecName: Full=ATP-dependent Clp protease ...    204   7e-56   
ref|YP_209504.1|  ATP-dependent Clp protease proteolytic subunit        205   7e-56   
ref|NP_569653.1|  ATP-dependent Clp protease proteolytic subunit        204   7e-56   
ref|YP_009004068.1|  clp protease proteolytic subunit                   204   7e-56   
ref|YP_004276301.1|  ATP-dependent Clp protease proteolytic subunit     204   9e-56   
gb|AFR59950.1|  clp protease proteolytic subunit                        204   9e-56   
gb|ACJ85982.1|  unknown                                                 204   9e-56   
ref|YP_001122831.1|  clp protease proteolytic subunit                   204   1e-55   
ref|YP_007889749.1|  clp protease proteolytic subunit                   204   1e-55   
ref|YP_009109873.1|  clp protease proteolytic subunit                   203   2e-55   
ref|YP_247625.1|  ATP-dependent Clp protease proteolytic subunit        203   2e-55   
gb|AIJ28414.1|  clp protease proteolytic subunit                        203   2e-55   
ref|YP_009032848.1|  clp protease proteolytic subunit                   203   3e-55   
ref|YP_003434369.1|  clp protease proteolytic subunit                   202   3e-55   
gb|AGE93394.1|  clp protease proteolytic subunit                        202   4e-55   
gb|AHF71474.1|  clpP-like protease                                      202   4e-55   
gb|ADD31114.1|  clp protease proteolytic subunit protein                202   5e-55   
gb|AES87789.2|  ATP-dependent Clp protease proteolytic protein          202   5e-55   
ref|YP_008854619.1|  clp protease proteolytic subunit                   202   6e-55   
ref|XP_003605592.1|  ATP-dependent Clp protease proteolytic subunit     202   6e-55   
gb|AHB16182.1|  clp protease proteolytic subunit                        202   7e-55   
ref|NP_817171.1|  ATP-dependent Clp protease proteolytic subunit        201   7e-55   
gb|AJD00273.1|  clp protease proteolytic subunit                        202   7e-55   
gb|AFM54242.1|  ClpP                                                    201   9e-55   
gb|AFM54243.1|  ClpP                                                    201   9e-55   
ref|YP_006503816.1|  ATP-dependent Clp protease proteolytic subunit     201   1e-54   
ref|YP_008563113.1|  clp protease proteolytic subunit                   201   1e-54   
ref|YP_009040825.1|  clp protease proteolytic subunit (chloroplast)     201   1e-54   
gb|ACP51518.1|  ATP-dependent Clp protease proteolytic subunit          201   1e-54   
ref|YP_001312231.1|  ATP-dependent Clp protease proteolytic subunit     201   2e-54   
ref|YP_001936542.1|  ATP-dependent Clp protease proteolytic subunit     201   2e-54   
gb|ABU85256.1|  clp protease proteolytic subunit                        201   2e-54   
gb|AFR45475.1|  ATP-dependent Clp protease proteolytic subunit          200   2e-54   
ref|YP_004276371.1|  ATP-dependent Clp protease proteolytic subunit     200   2e-54   
ref|YP_538874.1|  ATP-dependent Clp protease proteolytic subunit        200   2e-54   
gb|ADD31122.1|  clp protease proteolytic subunit protein                199   4e-54   
gb|AGN74004.1|  ATP-dependent Clp protease proteolytic subunit (c...    199   4e-54   
ref|YP_740501.1|  clp protease proteolytic subunit                      199   4e-54   
ref|YP_007374823.1|  ATP-dependent Clp protease proteolytic subunit     199   5e-54   
gb|AGW04497.1|  clp protease proteolytic subunit protein                200   6e-54   
ref|YP_007475729.1|  clp protease proteolytic subunit                   200   6e-54   
ref|YP_002970669.1|  Clp protease proteolytic subunit                   199   6e-54   
gb|AGW05031.1|  clp protease proteolytic subunit protein                199   6e-54   
gb|AFS64384.1|  ATP-dependent Clp protease proteolytic subunit          199   6e-54   
gb|AFR13721.1|  ATP-dependent Clp protease proteolytic subunit          199   7e-54   
gb|AHZ57980.1|  Clp protease proteolytic subunit                        199   7e-54   
ref|YP_001468330.1|  ribosomal protein S18                              196   7e-54   
dbj|BAL03693.1|  ATP-dependent Clp protease proteolytic subunit         199   8e-54   
gb|AGW04800.1|  clp protease proteolytic subunit protein                199   8e-54   
gb|AEZ48939.1|  clp protease proteolytic subunit                        198   1e-53   
gb|AHA12863.1|  clp protease proteolytic subunit                        198   1e-53   
gb|AAZ03800.1|  ATP-depedent Clp protease proteolytic subunit           197   2e-53   
ref|YP_009033800.1|  proteolytic subunit 2 of clp protease              198   2e-53   
gb|AFS64465.1|  ATP-dependent Clp protease proteolytic subunit          197   3e-53   
ref|YP_009027297.1|  clp protease proteolytic subunit                   197   3e-53   
ref|YP_003934463.1|  ATP-dependent Clp protease proteolytic subunit     197   3e-53   
gb|AGW96359.1|  ribosomal protein S18                                   194   3e-53   
gb|AGW04420.1|  clp protease proteolytic subunit protein                197   3e-53   
gb|AGV52580.1|  clp protease proteolytic subunit                        197   4e-53   
gb|AGW98737.1|  ribosomal protein S18                                   193   4e-53   
gb|AGW97718.1|  ribosomal protein S18                                   193   4e-53   
ref|YP_009032683.1|  clp protease proteolytic subunit                   197   4e-53   
dbj|BAL72617.1|  ATP-dependent Clp protease proteolytic subunit         196   5e-53   
gb|AET46589.1|  ATP-dependent Clp protease proteolytic subunit          196   5e-53   
ref|YP_008474499.1|  Clp protease proteolytic subunit                   196   7e-53   
gb|AGW98567.1|  ribosomal protein S18                                   192   9e-53   
gb|AGW98227.1|  ribosomal protein S18                                   192   9e-53   
gb|AGW45920.1|  clp protease proteolytic subunit                        196   9e-53   
gb|AGW97208.1|  ribosomal protein S18                                   192   9e-53   
ref|YP_002905140.1|  ATP-dependent Clp protease proteolytic subunit     196   1e-52   
ref|YP_001381704.1|  clp protease proteolytic subunit                   195   1e-52   
ref|YP_003934209.1|  ATP-dependent Clp protease proteolytic subunit     195   1e-52   
gb|AET45301.1|  ATP-dependent Clp protease proteolytic subunit          196   1e-52   
gb|AGW96698.1|  ribosomal protein S18                                   192   1e-52   
gb|ACP51276.1|  ATP-dependent Clp protease proteolytic subunit          195   2e-52   
gb|AGW98992.1|  ribosomal protein S18                                   191   2e-52   
gb|ACP52511.1|  ATP-dependent Clp protease proteolytic subunit          195   2e-52   
ref|YP_004891401.1|  ATP-dependent Clp protease proteolytic subunit     194   2e-52   
ref|YP_004891725.1|  ATP-dependent Clp protease proteolytic subunit     194   2e-52   
ref|YP_008082331.1|  ATP-dependent Clp protease proteolytic subunit     194   2e-52   
gb|AET47093.1|  ATP-dependent Clp protease proteolytic subunit          194   2e-52   
gb|AGS43998.1|  clp protease proteolytic subunit                        194   3e-52   
gb|ACP51830.1|  ATP-dependent Clp protease proteolytic subunit          194   3e-52   
sp|P36387.1|CLPP_PINCO  RecName: Full=ATP-dependent Clp protease ...    194   3e-52   
gb|AET49180.1|  ATP-dependent Clp protease proteolytic subunit          194   4e-52   
gb|AET46302.1|  ATP-dependent Clp protease proteolytic subunit          194   4e-52   
gb|AET44804.1|  ATP-dependent Clp protease proteolytic subunit          193   5e-52   
gb|AET46733.1|  ATP-dependent Clp protease proteolytic subunit          193   6e-52   
gb|AET46018.1|  ATP-dependent Clp protease proteolytic subunit          192   9e-52   
gb|AET48171.1|  ATP-dependent Clp protease proteolytic subunit          192   1e-51   
gb|ACP52196.1|  ATP-dependent Clp protease proteolytic subunit          192   1e-51   
gb|ACP51767.1|  ATP-dependent Clp protease proteolytic subunit          192   1e-51   
ref|YP_004733784.1|  clp protease proteolytic subunit                   192   2e-51   
ref|YP_008082258.1|  ATP-dependent Clp protease proteolytic subunit     191   3e-51   
gb|ACP50832.1|  ATP-dependent Clp protease proteolytic subunit          191   4e-51   
gb|AIJ27999.1|  clp protease proteolytic subunit                        191   5e-51   
gb|AET45372.1|  ATP-dependent Clp protease proteolytic subunit          190   6e-51   
ref|NP_042379.1|  ATP-dependent Clp protease proteolytic subunit        190   6e-51   
gb|AET47164.1|  ATP-dependent Clp protease proteolytic subunit          190   6e-51   
ref|YP_002519561.1|  ATP-dependent Clp protease proteolytic subunit     190   8e-51   
ref|YP_009027226.1|  clp protease proteolytic subunit                   190   8e-51   
gb|AGW04569.1|  clp protease proteolytic subunit protein                190   9e-51   
gb|ADD31120.1|  clp protease proteolytic subunit protein                190   9e-51   
ref|YP_009072266.1|  clp protease proteolytic subunit                   191   1e-50   
gb|AIJ28221.1|  clp protease proteolytic subunit                        190   1e-50   
gb|ADD31119.1|  clp protease proteolytic subunit protein                189   1e-50   
gb|ACP34131.1|  ATP-dependent protease subunit                          189   1e-50   
ref|YP_008855115.1|  clp protease proteolytic subunit                   190   2e-50   
ref|YP_005352732.1|  clpP gene product                                  189   2e-50   
gb|AGC38270.1|  ATP-dependent Clp protease proteolytic subunit          189   2e-50   
gb|ADB07660.1|  ATP-dependent Clp protease proteolytic subunit          189   2e-50   
gb|AFU95004.1|  ClpP                                                    191   2e-50   
gb|AFU95010.1|  ClpP                                                    191   2e-50   
gb|AFU95021.1|  ClpP                                                    191   3e-50   



>gb|AGW97551.1| clp protease proteolytic subunit (chloroplast) [Ipomoea nil]
Length=204

 Score =   301 bits (770),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 180/180 (100%), Positives = 180/180 (100%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
             KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEELLRG
Sbjct  145   KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEELLRG  204


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASWIDI
Sbjct  1    MPIGVPKVPFRNPGDEDASWIDI  23



>gb|AGW97041.1| clp protease proteolytic subunit (chloroplast) [Ipomoea diamantinensis]
Length=204

 Score =   300 bits (767),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 178/180 (99%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
             KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFS+DEE LRG
Sbjct  145   KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSEDEEFLRG  204


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASWIDI
Sbjct  1    MPIGVPKVPFRNPGDEDASWIDI  23



>ref|YP_001468333.1| ATP-dependent Clp protease proteolytic subunit [Ipomoea purpurea]
 gb|ABV02373.1| clp protease proteolytic subunit [Ipomoea purpurea]
 gb|AGW96786.1| clp protease proteolytic subunit (chloroplast) [Ipomoea amnicola]
 gb|AGW97636.1| clp protease proteolytic subunit (chloroplast) [Ipomoea orizabensis]
 gb|AGW98229.1| clp protease proteolytic subunit (chloroplast) [Ipomoea tricolor]
Length=204

 Score =   300 bits (767),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 179/180 (99%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
             KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEE LRG
Sbjct  145   KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEEFLRG  204


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASWIDI
Sbjct  1    MPIGVPKVPFRNPGDEDASWIDI  23



>gb|AGW97126.1| clp protease proteolytic subunit (chloroplast) [Ipomoea dumetorum]
Length=204

 Score =   299 bits (765),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 178/180 (99%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQE+DSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEVDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
             KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEE LRG
Sbjct  145   KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEEFLRG  204


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASW+DI
Sbjct  1    MPIGVPKVPFRNPGDEDASWVDI  23



>gb|AGW96362.1| clp protease proteolytic subunit (chloroplast) [Ipomoea batatas]
 gb|AGW96446.1| clp protease proteolytic subunit (chloroplast) [Ipomoea batatas]
 gb|AGW96532.1| clp protease proteolytic subunit (chloroplast) [Ipomoea batatas]
 gb|AGW96616.1| clp protease proteolytic subunit (chloroplast) [Ipomoea trifida]
 gb|AGW97975.1| clp protease proteolytic subunit (chloroplast) [Ipomoea setosa]
 gb|AGW98059.1| clp protease proteolytic subunit (chloroplast) [Ipomoea splendor-sylvae]
 gb|AGW98314.1| clp protease proteolytic subunit (chloroplast) [Ipomoea trifida]
 gb|AGW98399.1| clp protease proteolytic subunit (chloroplast) [Ipomoea cordatotriloba]
Length=204

 Score =   298 bits (762),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 177/180 (98%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQE+DSEI+NQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEVDSEISNQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
             KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEE LRG
Sbjct  145   KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEEFLRG  204


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASWIDI
Sbjct  1    MPIGVPKVPFRNPGDEDASWIDI  23



>gb|AGW97296.1| clp protease proteolytic subunit (chloroplast) [Ipomoea hederifolia]
Length=204

 Score =   297 bits (760),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 176/180 (98%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEI+NQ+VGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEISNQLVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
              EALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEE LRG
Sbjct  145   NEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEEFLRG  204


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASW+DI
Sbjct  1    MPIGVPKVPFRNPGDEDASWVDI  23



>gb|AGW97466.1| clp protease proteolytic subunit (chloroplast) [Ipomoea murucoides]
 gb|AGW97890.1| clp protease proteolytic subunit (chloroplast) [Ipomoea polpha]
Length=204

 Score =   296 bits (757),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 176/180 (98%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQE+DSEI+NQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEVDSEISNQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
             KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVF SARQARIYGIIDDIEFSDDEE LRG
Sbjct  145   KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFLSARQARIYGIIDDIEFSDDEEFLRG  204


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASWIDI
Sbjct  1    MPIGVPKVPFRNPGDEDASWIDI  23



>gb|AGW98144.1| clp protease proteolytic subunit (chloroplast) [Ipomoea ternifolia]
Length=204

 Score =   295 bits (755),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 176/180 (98%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEI+NQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEISNQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
             KEALKLRERIAEIY+QRTGNPTSIISRDMDRDVF SARQARIYGIIDDIEFSDDEE LRG
Sbjct  145   KEALKLRERIAEIYSQRTGNPTSIISRDMDRDVFLSARQARIYGIIDDIEFSDDEEFLRG  204


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASW+DI
Sbjct  1    MPIGVPKVPFRNPGDEDASWVDI  23



>gb|AGW96871.1| clp protease proteolytic subunit (chloroplast) [Ipomoea argillicola]
Length=204

 Score =   295 bits (755),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 176/180 (98%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYR+RFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRQRFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
             KEALKLRERIAEIY+QRTGNPT IISRDMDRDVFFSARQARIYGIIDDIEFSDDEE LRG
Sbjct  145   KEALKLRERIAEIYSQRTGNPTWIISRDMDRDVFFSARQARIYGIIDDIEFSDDEEFLRG  204


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASWIDI
Sbjct  1    MPIGVPKVPFRNPGDEDASWIDI  23



>gb|AGW97720.1| clp protease proteolytic subunit (chloroplast) [Ipomoea pedicellaris]
Length=205

 Score =   295 bits (755),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIED+TKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDETKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q+VRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGEL LEM
Sbjct  85    QSVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELFLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             KEAL LRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG
Sbjct  145   KEALTLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  188


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASW+DI
Sbjct  1    MPIGVPKVPFRNPGDEDASWVDI  23



>gb|AGW98994.1| clp protease proteolytic subunit (chloroplast) [Turbina corymbosa]
Length=205

 Score =   295 bits (754),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 162/164 (99%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIED TKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDGTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             KEAL+LRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG
Sbjct  145   KEALELRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  188


 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASW+DI
Sbjct  1    MPIGVPKVPFRNPGDEDASWVDI  23



>gb|AGW98655.1| clp protease proteolytic subunit (chloroplast) [Ipomoea pes-tigridis]
Length=205

 Score =   294 bits (753),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 161/164 (98%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTK+IFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKEIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGV+TICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPGVNTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             KEALKLRERIAEIYAQRTGNPTSIIS+DMDRDVFFSARQARIYG
Sbjct  145   KEALKLRERIAEIYAQRTGNPTSIISQDMDRDVFFSARQARIYG  188


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASW+DI
Sbjct  1    MPIGVPKVPFRNPGDEDASWVDI  23



>gb|AGW98484.1| clp protease proteolytic subunit (chloroplast) [Ipomoea minutiflora]
Length=204

 Score =   293 bits (749),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 175/180 (97%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQ IDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQAIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGVSTICIGLAASMGSFILAGGAIT+RAAFPHARVMIHQPRTSFFESHA ELLLE+
Sbjct  85    QTVRPGVSTICIGLAASMGSFILAGGAITKRAAFPHARVMIHQPRTSFFESHAVELLLEV  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
             KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEE LRG
Sbjct  145   KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEEFLRG  204


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASWIDI
Sbjct  1    MPIGVPKVPFRNPGDEDASWIDI  23



>gb|AGW97211.1| clp protease proteolytic subunit (chloroplast) [Ipomoea eriocarpa]
 gb|AGW97381.1| clp protease proteolytic subunit (chloroplast) [Ipomoea involucrata]
Length=204

 Score =   290 bits (743),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTK+IFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKEIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGV+TICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPGVNTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             KEALKLRE IAEIYAQRTG P SIISRDMDRD FFSARQARIYG
Sbjct  145   KEALKLRECIAEIYAQRTGTPASIISRDMDRDAFFSARQARIYG  188


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASW+DI
Sbjct  1    MPIGVPKVPFRNPGDEDASWVDI  23



>gb|AGW98910.1| clp protease proteolytic subunit (chloroplast) [Stictocardia 
macalusoi]
Length=205

 Score =   289 bits (740),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIED TKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDGTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRP V+T+CIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPDVNTVCIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             KEALKLRERIAEIYAQRTGNPTSIIS+DMDRDVFFSARQARIYG
Sbjct  145   KEALKLRERIAEIYAQRTGNPTSIISQDMDRDVFFSARQARIYG  188


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASW+DI
Sbjct  1    MPIGVPKVPFRNPGDEDASWVDI  23



>gb|AGW97805.1| clp protease proteolytic subunit (chloroplast) [Ipomoea pes-caprae]
Length=204

 Score =   289 bits (739),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYR+RFLFLVQEIDSEIANQIVGLLVYLNIED TKDIFLYINSPGGDVISGV+IYDMM
Sbjct  25    NRLYRQRFLFLVQEIDSEIANQIVGLLVYLNIEDGTKDIFLYINSPGGDVISGVSIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRP VSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRPDVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
             KEALKLRE IAEIY+QRTGNPT IISRDMDRDVFFSARQARIYGIIDDI+FSDDEE LRG
Sbjct  145   KEALKLREHIAEIYSQRTGNPTWIISRDMDRDVFFSARQARIYGIIDDIDFSDDEEFLRG  204


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASW+DI
Sbjct  1    MPIGVPKVPFRNPGDEDASWVDI  23



>gb|AGW98570.1| clp protease proteolytic subunit (chloroplast) [Ipomoea obscura]
Length=204

 Score =   288 bits (736),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 173/180 (96%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRP VST+CIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFES A ELLLE+
Sbjct  85    QTVRPDVSTVCIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESQAAELLLEV  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
             +EALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEE LRG
Sbjct  145   EEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGIIDDIEFSDDEEFLRG  204


 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASW+DI
Sbjct  1    MPIGVPKVPFRNPGDEDASWVDI  23



>gb|AGW96700.1| clp protease proteolytic subunit (chloroplast) [Argyreia nervosa]
Length=205

 Score =   286 bits (731),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEIANQI+GLLVYLNIEDDTK+IFLYINSPGGDVI GVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEIANQILGLLVYLNIEDDTKEIFLYINSPGGDVICGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVR GV+TICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM
Sbjct  85    QTVRSGVNTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             KEALKLRERIAEIYAQRTGNPTSIIS DMDRDVF SARQARIYG
Sbjct  145   KEALKLRERIAEIYAQRTGNPTSIISEDMDRDVFLSARQARIYG  188


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASW+DI
Sbjct  1    MPIGVPKVPFRNPGDEDASWVDI  23



>gb|AGW98824.1| clp protease proteolytic subunit (chloroplast) [Operculina macrocarpa]
Length=205

 Score =   285 bits (729),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTK++FLYINSPGGDVISGVAIYDMM
Sbjct  25    NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKELFLYINSPGGDVISGVAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGV+TICIGLAASMGSFILAGG ITRRAAFPHARVMIHQPR+SFFE+H GEL++EM
Sbjct  85    QTVRPGVNTICIGLAASMGSFILAGGVITRRAAFPHARVMIHQPRSSFFETHTGELIVEM  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSA QA++YG
Sbjct  145   KEALKLRERIAEIYAQRTGNPTSIISRDMDRDVFFSAEQAQLYG  188


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  38   MPIGVPKVPFRNPGDEDASWIDI  106
            MPIGVPKVPFRNPGDEDASW+DI
Sbjct  1    MPIGVPKVPFRNPGDEDASWVDI  23



>gb|AGW96956.1| clp protease proteolytic subunit (chloroplast) [Ipomoea cairica]
Length=204

 Score =   282 bits (722),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRERFLFLVQ IDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISG+AIYDMM
Sbjct  25    NRLYRERFLFLVQAIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGIAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFES A ELLLE+
Sbjct  85    QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESQAVELLLEV  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYGiiddiefsddeeLLRG  1451
             +EALKLRERIAEIYAQRTGNP  IISRDMDRDVFFSARQARIYGIIDDI FSDDEE LRG
Sbjct  145   EEALKLRERIAEIYAQRTGNPAWIISRDMDRDVFFSARQARIYGIIDDIGFSDDEEFLRG  204



>gb|AGW98740.1| clp protease proteolytic subunit (chloroplast) [Merremia quinquefolia]
Length=205

 Score =   247 bits (630),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER +FLVQ IDSE+ NQIV LL++L IEDDTKD+FLYINS GGDVISG+AIYDMM
Sbjct  25    NRLYRERVIFLVQGIDSELGNQIVCLLIFLTIEDDTKDMFLYINSLGGDVISGMAIYDMM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             QTVRP V+T+CIGLAASMGSF+LAGG IT RAAFPHARVMIHQPR+SFFE    E++LE 
Sbjct  85    QTVRPDVNTLCIGLAASMGSFLLAGGVITGRAAFPHARVMIHQPRSSFFEGQTVEVVLEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             KEALKLRERIAEIYAQRTG PTSIISRD+DRDVFFSA++A++YG
Sbjct  145   KEALKLRERIAEIYAQRTGKPTSIISRDLDRDVFFSAKEAQLYG  188



>gb|AEZ48938.1| clp protease proteolytic subunit, partial [Ravenea hildebrandtii]
Length=211

 Score =   229 bits (583),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +3

Query  879   YGS*GKQFPLINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGD  1058
             Y   G  F LINRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG 
Sbjct  28    YAPKGTYFVLINRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGW  87

Query  1059  VISGVAIYDMMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFF  1238
             VI G+AIYD MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+
Sbjct  88    VIPGIAIYDTMQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFY  147

Query  1239  ESHAGelllemkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E+ AGE +LE +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+++G
Sbjct  148   EAQAGEFILEAEELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQVHG  202



>gb|AEX96553.1| clp protease proteolytic subunit (chloroplast) [Crinum asiaticum]
Length=204

 Score =   228 bits (580),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAYG  188



>gb|AEX96546.1| clp protease proteolytic subunit (chloroplast) [Manfreda virginica]
Length=204

 Score =   227 bits (579),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA++A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSAKEAQAHG  188



>ref|YP_007353939.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Tectona grandis]
 emb|CCP47155.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Tectona grandis]
 emb|CCP47244.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Tectona grandis]
 emb|CCP47333.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Tectona grandis]
Length=195

 Score =   227 bits (578),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPEVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +AR YG
Sbjct  143   AEELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEARAYG  187



>gb|AAZ03804.1| ATP-depedent Clp protease proteolytic subunit [Yucca schidigera]
 gb|AEZ48922.1| clp protease proteolytic subunit, partial [Hesperaloe parviflora]
 gb|AEZ48923.1| clp protease proteolytic subunit, partial [Hosta ventricosa]
Length=195

 Score =   226 bits (577),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  187



>gb|AEZ48909.1| clp protease proteolytic subunit [Agapanthus praecox]
Length=203

 Score =   227 bits (578),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAYG  187



>ref|YP_004769971.1| clp protease proteolytic subunit (chloroplast) [Wolffia australiana]
 gb|AEK94532.1| clp protease proteolytic subunit [Wolffia australiana]
Length=201

 Score =   226 bits (577),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAYG  187



>ref|YP_009057176.1| clp protease proteolytic subunit (chloroplast) [Allium cepa]
 gb|AHC94612.1| clp protease proteolytic subunit (chloroplast) [Allium cepa]
 gb|AHC94693.1| clp protease proteolytic subunit (chloroplast) [Allium cepa]
Length=204

 Score =   226 bits (577),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             +INRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD
Sbjct  23    VINRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYD  82

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +L
Sbjct  83    TMQFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFIL  142

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E L+LRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  143   EAEELLRLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|AGY95325.1| ATP-dependent Clp protease, partial [Petrosavia stellaris]
Length=188

 Score =   226 bits (576),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  13    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  72

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SFFE+ AGE +LE 
Sbjct  73    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFFEAQAGEFILEA  132

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ YG
Sbjct  133   EELLKLRETLTKVYVQRTGNPFWVVSEDMERDVFMSATEAQAYG  176



>gb|ADM92653.1| clp protease proteolytic subunit protein [Franklinia alatamaha]
Length=197

 Score =   226 bits (576),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             LINRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD
Sbjct  24    LINRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYD  83

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ V+P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +L
Sbjct  84    TMQFVQPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFIL  143

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  144   EAEELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  189



>gb|AEZ48936.1| clp protease proteolytic subunit, partial [Potarophytum riparium]
Length=214

 Score =   227 bits (578),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  891   GKQFPLINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISG  1070
             G  F LINRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED T+D++L+INSPGG VI G
Sbjct  36    GYYFVLINRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDATRDLYLFINSPGGWVIPG  95

Query  1071  VAIYDMMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHA  1250
             +AIYD MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ A
Sbjct  96    IAIYDTMQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQA  155

Query  1251  GelllemkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             GE +LE +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ YG
Sbjct  156   GEFILEAEELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAYG  206



>ref|YP_004769653.1| clp protease proteolytic subunit (chloroplast) [Spirodela polyrhiza]
 gb|AEK94365.1| clp protease proteolytic subunit (chloroplast) [Spirodela polyrhiza]
Length=201

 Score =   226 bits (577),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAYG  187



>emb|CCQ71645.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Salvia miltiorrhiza]
Length=198

 Score =   226 bits (576),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             L+NRLYRER LFL QE+DSEI+NQ++GL+VYL+IED+TKD++L+INSPGG VI GVAIYD
Sbjct  25    LLNRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDETKDLYLFINSPGGWVIPGVAIYD  84

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHA VMIHQP +SF+E+  GE +L
Sbjct  85    TMQFVRPEVHTICMGLAASMGSFILVGGEITKRLAFPHAWVMIHQPASSFYEAQTGEFIL  144

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE + ++Y QRTG P  ++S DM+RDVF SA +AR YG
Sbjct  145   EAEELLKLRETLTKVYVQRTGKPLWVVSEDMERDVFMSATEARAYG  190



>ref|YP_008964059.1| ATP-dependent Clp protease proteolytic subunit [Ajuga reptans]
 gb|AHA84887.1| ATP-dependent Clp protease proteolytic subunit [Ajuga reptans]
Length=196

 Score =   226 bits (576),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPEVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +AR YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEARAYG  188



>ref|YP_007507136.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Salvia miltiorrhiza]
 gb|AFQ30953.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Salvia miltiorrhiza]
Length=196

 Score =   226 bits (576),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IED+TKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDETKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPEVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTG P  ++S DM+RDVF SA +AR YG
Sbjct  145   EELLKLRETLTKVYVQRTGKPLWVVSEDMERDVFMSATEARAYG  188



>gb|AEZ48940.1| clp protease proteolytic subunit, partial [Sparganium eurycarpum]
Length=195

 Score =   226 bits (575),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  187



>gb|ADM92652.1| clp protease proteolytic subunit protein [Davidia involucrata]
Length=195

 Score =   226 bits (575),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +S++E+  GE +LE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSYYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +YAQRTG P  ++S D++RDVF SA +A+ YG
Sbjct  143   AEELLKLRETLTRVYAQRTGKPLWVVSEDLERDVFMSATEAKAYG  187



>gb|AEX96547.1| clp protease proteolytic subunit (chloroplast) [Polianthes sp. 
Pires 2011-05]
Length=204

 Score =   226 bits (576),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE LLE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFLLEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA++A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSAKEAQAHG  188



>gb|AEX96550.1| clp protease proteolytic subunit (chloroplast) [Gilliesia graminea]
Length=204

 Score =   226 bits (575),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|AEX96541.1| clp protease proteolytic subunit (chloroplast) [Agapanthus africanus]
Length=204

 Score =   226 bits (575),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAYG  188



>gb|AEX96581.1| clp protease proteolytic subunit (chloroplast) [Brodiaea californica]
 gb|AEX96583.1| clp protease proteolytic subunit (chloroplast) [Dichelostemma 
congestum]
 gb|AEX96584.1| clp protease proteolytic subunit (chloroplast) [Dichelostemma 
ida-maia]
Length=204

 Score =   226 bits (575),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|AEX96580.1| clp protease proteolytic subunit (chloroplast) [Androstephium 
coeruleum]
Length=204

 Score =   226 bits (575),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+A+YD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAVYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  IIS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWIISEDMERDVFMSATEAQAHG  188



>gb|AEX96542.1| clp protease proteolytic subunit (chloroplast) [Anemarrhena asphodeloides]
Length=204

 Score =   226 bits (575),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_009045591.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Cypripedium macranthos]
 gb|AHI16774.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
(chloroplast) [Cypripedium macranthos]
Length=204

 Score =   226 bits (575),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|AEX96585.1| clp protease proteolytic subunit (chloroplast) [Xanthorrhoea 
preissii]
Length=204

 Score =   226 bits (575),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|AEX96551.1| clp protease proteolytic subunit (chloroplast) [Tulbaghia violacea]
 gb|AEX96552.1| clp protease proteolytic subunit (chloroplast) [Amaryllis belladonna]
Length=204

 Score =   225 bits (574),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_005097899.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Colocasia esculenta]
 gb|AEK48432.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Colocasia esculenta]
 gb|AEK48518.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Colocasia esculenta]
Length=202

 Score =   225 bits (574),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAYG  188



>gb|AEX96582.1| clp protease proteolytic subunit (chloroplast) [Dichelostemma 
capitatum]
Length=204

 Score =   225 bits (574),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE+
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEV  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_001595533.1| ATP-dependent protease proteolytic subunit [Lemna minor]
 gb|ABD48520.1| ATP-dependent protease proteolytic subunit [Lemna minor]
Length=202

 Score =   225 bits (574),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAYG  188



>gb|AEZ48934.1| clp protease proteolytic subunit, partial [Phormium tenax]
Length=195

 Score =   225 bits (573),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+TKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  187



>gb|AEX96556.1| clp protease proteolytic subunit (chloroplast) [Aphyllanthes 
monspeliensis]
 gb|AEX96574.1| clp protease proteolytic subunit (chloroplast) [Eriospermum cervicorne]
 gb|AEX96577.1| clp protease proteolytic subunit (chloroplast) [Ruscus aculeatus]
Length=204

 Score =   225 bits (574),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|AEX96554.1| clp protease proteolytic subunit (chloroplast) [Eucharis x grandiflora]
Length=204

 Score =   225 bits (574),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_004769836.1| clp protease proteolytic subunit (chloroplast) [Wolffiella lingulata]
 gb|AEK94449.1| clp protease proteolytic subunit [Wolffiella lingulata]
Length=202

 Score =   225 bits (574),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAYG  188



>gb|AEZ48912.1| clp protease proteolytic subunit, partial [Asparagus officinalis]
 gb|AEZ48932.1| clp protease proteolytic subunit, partial [Nolina atopocarpa]
Length=195

 Score =   225 bits (573),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  187



>gb|AGL45361.1| ClpP (chloroplast) [Sesamum indicum]
Length=195

 Score =   225 bits (573),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+ SEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VISGV IYD 
Sbjct  23    VNRLYRERLLFLGQEVQSEISNQLMGLMVYLSIEDDTKDLYLFINSPGGWVISGVGIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TICIGLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVRPDVHTICIGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LK+RE +  +Y +RTG P  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKIRETLTRVYVERTGKPLWVVSEDMERDVFMSATEAKAYG  187



>ref|YP_008815962.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Lindenbergia philippensis]
 emb|CDI43943.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Lindenbergia philippensis]
Length=196

 Score =   225 bits (573),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPEVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|ABG74755.1| ATP-dependent protease catalytic subunit [Forsythia europaea]
 gb|ADD31103.1| clp protease proteolytic subunit protein (chloroplast) [Ehretia 
acuminata]
Length=196

 Score =   224 bits (572),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>ref|YP_008814968.1| clp protease proteolytic subunit (chloroplast) [Brassaiopsis 
hainla]
 ref|YP_008815055.1| clp protease proteolytic subunit (chloroplast) [Metapanax delavayi]
 ref|YP_008815229.1| clp protease proteolytic subunit (chloroplast) [Kalopanax septemlobus]
 gb|AGG39067.1| clp protease proteolytic subunit (chloroplast) [Brassaiopsis 
hainla]
 gb|AGG39154.1| clp protease proteolytic subunit (chloroplast) [Metapanax delavayi]
 gb|AGG39328.1| clp protease proteolytic subunit (chloroplast) [Kalopanax septemlobus]
Length=195

 Score =   224 bits (572),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL Q IDSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQAIDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE I  +Y Q+TG P  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETITRVYVQKTGKPFWVVSEDMERDVFMSATEAQAYG  187



>ref|YP_009108225.1| clp protease proteolytic subunit [Boulardia latisquama]
 emb|CDI06850.1| clp protease proteolytic subunit [Boulardia latisquama]
Length=194

 Score =   224 bits (572),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             INRLYRER LFL QEIDSEI+NQI+GL+VY +IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    INRLYRERLLFLGQEIDSEISNQIMGLMVYFSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SFFE+ AGE +LE
Sbjct  83    MQFVRPEVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFFEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG    ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETLTRVYVQRTGKSLLVVSEDMERDVFMSATEAKAYG  187



>gb|AEX96548.1| clp protease proteolytic subunit (chloroplast) [Allium fistulosum]
 gb|AEX96549.1| clp protease proteolytic subunit (chloroplast) [Allium cepa]
Length=204

 Score =   225 bits (573),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E L+LRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLRLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|ADD31104.1| clp protease proteolytic subunit protein (chloroplast) [Ilex 
cornuta]
Length=196

 Score =   224 bits (572),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>ref|YP_005089601.1| clpP gene product (chloroplast) [Silene latifolia]
 gb|ABY85636.1| ATP-dependent protease proteolytic subunit [Silene latifolia]
 gb|AEC04109.1| clp protease proteolytic subunit (chloroplast) [Silene latifolia]
Length=196

 Score =   224 bits (572),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VISGVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVISGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPVSSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGKPIWVVSEDMERDVFMSAEEAQAHG  188



>ref|YP_007475986.1| clp protease proteolytic subunit [Bismarckia nobilis]
 gb|AGE93050.1| clp protease proteolytic subunit [Bismarckia nobilis]
Length=204

 Score =   224 bits (572),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+++G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQVHG  188



>ref|YP_004564028.1| ATP-dependent Clp protease proteolytic subunit [Olea woodiana 
subsp. woodiana]
 emb|CBS29376.1| ATP-dependent Clp protease proteolytic subunit [Olea woodiana 
subsp. woodiana]
Length=196

 Score =   224 bits (571),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDSM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|AEX65184.1| ATP-dependent Clp protease proteolytic subunit, partial (chloroplast) 
[Didierea madagascariensis]
Length=195

 Score =   224 bits (571),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEIANQ++GL+VYL+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEIANQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  187



>gb|AEX65186.1| ATP-dependent Clp protease proteolytic subunit, partial (chloroplast) 
[Portulacaria afra]
Length=195

 Score =   224 bits (571),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEIANQ++GL+VYL+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEIANQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  187



>gb|ACC61147.1| ClpP [Agrostemma githago]
Length=172

 Score =   223 bits (569),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  1     NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  60

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  61    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  120

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  121   EELLKLRETLTRVYVQRTGKPVWVVSEDMERDVFMSAAEAQAHG  164



>ref|YP_003540956.1| clpP-like protease [Phoenix dactylifera]
 gb|ADD63233.1| clpP-like protease (chloroplast) [Phoenix dactylifera]
 gb|ADF28171.1| clpP-like protease (chloroplast) [Phoenix dactylifera]
Length=204

 Score =   224 bits (572),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+++G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQVHG  188



>gb|AAZ03803.1| ATP-depedent Clp protease proteolytic subunit [Typha latifolia]
 gb|AEZ48914.1| clp protease proteolytic subunit, partial [Brocchinia micrantha]
 gb|AEZ48921.1| clp protease proteolytic subunit, partial [Fosterella caulescens]
 gb|AEZ48926.1| clp protease proteolytic subunit, partial [Kingia australis]
 gb|AEZ48929.1| clp protease proteolytic subunit, partial [Navia saxicola]
 gb|AEZ48931.1| clp protease proteolytic subunit, partial [Neoregelia carolinae]
 gb|AEZ48935.1| clp protease proteolytic subunit, partial [Pitcairnia feliciana]
 gb|AEZ48937.1| clp protease proteolytic subunit, partial [Puya laxa]
Length=195

 Score =   224 bits (571),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  187



>ref|YP_009110626.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Hesperelaea palmeri]
 emb|CED79786.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Hesperelaea palmeri]
Length=196

 Score =   224 bits (571),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVA+YD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAVYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|ABY85552.1| ATP-dependent protease proteolytic subunit [Silene zawadskii]
Length=196

 Score =   224 bits (571),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VISGVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVISGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGKPIWVVSEDMERDVFMSAAEAQAHG  188



>gb|ABY85573.1| ATP-dependent protease proteolytic subunit [Silene sorensenis]
Length=196

 Score =   224 bits (571),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VISGVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVISGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGKPIWVVSEDMERDVFMSAAEAQAHG  188



>gb|AEX96576.1| clp protease proteolytic subunit (chloroplast) [Ophiopogon japonicus]
Length=197

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_003434000.1| clp protease proteolytic subunit [Typha latifolia]
 gb|ADA63724.1| clp protease proteolytic subunit [Typha latifolia]
Length=203

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  187



>gb|AEX96563.1| clp protease proteolytic subunit (chloroplast) [Kniphofia linearifolia]
Length=204

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+TKDI+L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTKDIYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|AEX96562.1| clp protease proteolytic subunit (chloroplast) [Haworthia cymbiformis]
Length=204

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+TKDI+L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTKDIYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|AFV61837.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Origanum vulgare subsp. vulgare]
Length=196

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IED+TKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDETKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPEVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTKVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|ACC61150.1| ClpP [Atocion rupestre]
 gb|ACC61153.1| ClpP [Viscaria vulgaris]
 gb|ACC61156.1| ClpP [Petrocoptis pyrenaica]
Length=172

 Score =   223 bits (567),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  1     NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  60

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  61    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  120

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  121   EELLKLRETLTRVYVQRTGKPIWVVSEDMERDVFMSAAEAQAHG  164



>ref|YP_009059544.1| clpP protease proteolytic subunit [Iris gatesii]
 gb|AIN79006.1| clpP protease proteolytic subunit [Iris gatesii]
Length=204

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPNVHTICMGLAASMGSFILVGGEITKRIAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_006665805.1| clp protease proteolytic subunit (chloroplast) [Elodea canadensis]
 gb|AEY84678.1| clp protease proteolytic subunit (chloroplast) [Elodea canadensis]
Length=206

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+TKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYETQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E L+LRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ YG
Sbjct  143   AEELLRLRETLTKVYVQRTGNPLWVISEDMERDVFMSAAEAQAYG  187



>gb|AEX96579.1| clp protease proteolytic subunit (chloroplast) [Maianthemum stellatum]
Length=204

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFVLEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|AEX96560.1| clp protease proteolytic subunit (chloroplast) [Aloe vera]
Length=204

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+TKDI+L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTKDIYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_004935691.1| clpP gene product (chloroplast) [Sesamum indicum]
 gb|AEO92731.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Sesamum indicum]
Length=196

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+ SEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VISGV IYD M
Sbjct  25    NRLYRERLLFLGQEVQSEISNQLMGLMVYLSIEDDTKDLYLFINSPGGWVISGVGIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TICIGLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVRPDVHTICIGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LK+RE +  +Y +RTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKIRETLTRVYVERTGKPLWVVSEDMERDVFMSATEAKAYG  188



>ref|YP_009048224.1| clpP-like protease (chloroplast) [Calanthe triplicata]
 gb|AHF71823.1| clpP-like protease (chloroplast) [Calanthe triplicata]
Length=203

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V T+C+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AG+ +LE
Sbjct  83    MQFVSPDVHTVCMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGDFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAYG  187



>gb|AEX96568.1| clp protease proteolytic subunit (chloroplast) [Ledebouria cordifolia]
Length=204

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+TKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDETKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|ADD31117.1| clp protease proteolytic subunit protein (chloroplast) [Heuchera 
sanguinea]
Length=196

 Score =   223 bits (569),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>gb|AEX96575.1| clp protease proteolytic subunit (chloroplast) [Liriope spicata]
Length=205

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_008815142.1| clp protease proteolytic subunit (chloroplast) [Schefflera delavayi]
 gb|AGG39241.1| clp protease proteolytic subunit (chloroplast) [Schefflera delavayi]
Length=195

 Score =   223 bits (569),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL Q +DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQAVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y Q+TG P  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETLTRVYVQKTGKPFWVVSEDMERDVFMSATEAQAYG  187



>gb|AEZ48924.1| clp protease proteolytic subunit, partial [Iris virginica]
Length=196

 Score =   223 bits (569),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD+FL+INSPGG VI G+AIYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLFLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVSPDVHTICMGLAASMGSFILVGGEITKRIAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRT NP  +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRENLTKVYVQRTSNPLWVISEDMERDVFMSATEAQAHG  187



>ref|NP_054525.1| ATP-dependent Clp protease proteolytic subunit [Nicotiana tabacum]
 ref|YP_358703.1| ATP-dependent Clp protease proteolytic subunit [Nicotiana sylvestris]
 ref|YP_398889.1| ATP-dependent Clp protease proteolytic subunit [Nicotiana tomentosiformis]
 ref|YP_004891632.1| clpP gene product (chloroplast) [Nicotiana undulata]
 sp|P12210.1|CLPP_TOBAC RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Nicotiana tabacum]
 sp|Q33C07.1|CLPP_NICTO RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Nicotiana tomentosiformis]
 sp|Q3C1K4.1|CLPP_NICSY RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Nicotiana sylvestris]
 gb|AAA84867.1| ClpP protease [Nicotiana tabacum]
 emb|CAA77422.1| ATP-dependent protease proteolytic subuni [Nicotiana tabacum]
 dbj|BAE46679.1| ATP-dependent protease proteolytic subunit [Nicotiana sylvestris]
 dbj|BAE48028.1| ATP-dependent protease proteolytic subunit [Nicotiana tomentosiformis]
 gb|AEO95594.1| clp protease proteolytic subunit (chloroplast) [Nicotiana undulata]
 gb|AEO95704.1| clp protease proteolytic subunit [synthetic construct]
Length=196

 Score =   223 bits (569),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IED+TKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDETKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFVLEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|AEX96557.1| clp protease proteolytic subunit (chloroplast) [Asparagus officinalis]
 gb|AEX96558.1| clp protease proteolytic subunit (chloroplast) [Asparagus asparagoides]
 gb|AEX96559.1| clp protease proteolytic subunit (chloroplast) [Hemiphylacus 
alatostylus]
 gb|AEX96573.1| clp protease proteolytic subunit (chloroplast) [Dasylirion wheeleri]
Length=204

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_004935577.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eleutherococcus senticosus]
 gb|AEO92644.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eleutherococcus senticosus]
Length=196

 Score =   223 bits (569),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q IDSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQAIDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y Q+TG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETITRVYVQKTGKPFWVVSEDMERDVFMSATEAQAYG  188



>gb|AEZ48911.1| clp protease proteolytic subunit, partial [Apostasia wallichii]
Length=201

 Score =   223 bits (569),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQ+VGLLVYL+IEDDT+D++L+INSPGG VI G++IYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQLVGLLVYLSIEDDTRDLYLFINSPGGWVIPGISIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQTHG  187



>ref|YP_009111680.1| clp protease proteolytic subunit (chloroplast) [Apios americana]
 gb|AHI95809.1| clp protease proteolytic subunit (chloroplast) [Apios americana]
Length=197

 Score =   223 bits (569),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             LINRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDD KD++L+INSPGG VI G+AIYD
Sbjct  24    LINRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDNKDLYLFINSPGGWVIPGIAIYD  83

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ V+P V T+C+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +L
Sbjct  84    TMQFVQPDVQTVCMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFIL  143

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE I ++Y QRT  P  +IS DM+RDVF SA +A+ +G
Sbjct  144   EAEELLKLRETITKVYVQRTSKPLWVISEDMERDVFMSAAEAQAHG  189



>ref|YP_008814881.1| clp protease proteolytic subunit (chloroplast) [Aralia undulata]
 gb|AGG38980.1| clp protease proteolytic subunit (chloroplast) [Aralia undulata]
Length=195

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL Q IDSEI+NQ++GL+VYL+IEDDTKD++L++NSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQAIDSEISNQLIGLMVYLSIEDDTKDLYLFMNSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFVLE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE I  +Y Q+TG P  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETITRVYVQKTGKPFWVVSEDMERDVFMSATEAQAYG  187



>gb|AJD00749.1| ATP-dependent Clp protease proteolytic subunit [Scrophularia 
takesimensis]
Length=195

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE++SEI+NQ++GL+VYL+IEDDTKD++L++N+PGG V+ GVAIYD 
Sbjct  23    VNRLYRERLLFLGQEVNSEISNQLIGLMVYLSIEDDTKDLYLFLNTPGGWVLPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFIL GGAIT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPEVHTICMGLAASMGSFILIGGAITKRLAFPHARVMIHQPASSFYEAQTGEFVLE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  187



>ref|YP_009108401.1| clp protease proteolytic subunit (chloroplast) [Orobanche californica]
 emb|CDH98511.1| clp protease proteolytic subunit (chloroplast) [Orobanche californica]
Length=196

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAI+D M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIFDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPEVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|AEX65185.1| ATP-dependent Clp protease proteolytic subunit, partial (chloroplast) 
[Mollugo verticillata]
Length=195

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  187



>gb|AEX96578.1| clp protease proteolytic subunit (chloroplast) [Sansevieria trifasciata]
Length=195

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRIAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPFWVISEDMERDVFMSATEAQAHG  188



>gb|AEZ48930.1| clp protease proteolytic subunit, partial [Neoastelia spectabilis]
Length=201

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  187



>ref|YP_817507.1| clp protease proteolytic subunit [Coffea arabica]
 sp|A0A360.1|CLPP_COFAR RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Coffea arabica]
 gb|ABJ89703.1| clp protease proteolytic subunit [Coffea arabica]
Length=196

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q +DSEI+NQ++GL++YL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQAVDSEISNQLIGLMIYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>ref|YP_008999959.1| clp protease proteolytic subunit (chloroplast) (chloroplast) 
[Agrostemma githago]
 gb|AGZ17950.1| clp protease proteolytic subunit (chloroplast) [Agrostemma githago]
Length=196

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGKPVWVVSEDMERDVFMSAAEAQAHG  188



>gb|ADD31102.1| clp protease proteolytic subunit protein (chloroplast) [Dillenia 
indica]
Length=196

 Score =   223 bits (567),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+D+EI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD +
Sbjct  25    NRLYRERLLFLGQEVDNEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTI  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RDVF SAR+A+ YG
Sbjct  145   EELLKLRETITRVYVQRTGKPLWLVSEDMERDVFMSAREAQAYG  188



>ref|YP_007890301.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Cistanche deserticola]
 gb|AFZ99585.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Cistanche deserticola]
Length=195

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  864   VKRRMYGS*GKQFPLINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYIN  1043
             V  R+ G     +  +NRLYR RFLFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+IN
Sbjct  8     VPFRLPGEEDASWVDVNRLYRARFLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFIN  67

Query  1044  SPGGDVISGVAIYDMMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQP  1223
             SPGG +I GVAI+D+MQ V+P V+TICIGLAASMGSFIL GG IT+R A PHARVMIHQP
Sbjct  68    SPGGWIIPGVAIFDIMQLVQPEVNTICIGLAASMGSFILVGGEITKRLALPHARVMIHQP  127

Query  1224  RTSFFESHAGelllemkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +SFF+S  GE ++E +E + LRE +  +Y QRTG P  ++S+DM+RDV  SA +A+ YG
Sbjct  128   ASSFFKSQTGEFIMEAEEIMNLREILTRVYVQRTGKPLWVVSKDMERDVLMSATEAQAYG  187



>ref|YP_008999906.1| clp protease proteolytic subunit [Petrosavia stellaris]
 ref|YP_008999912.1| clp protease proteolytic subunit [Petrosavia stellaris]
 gb|AGY95358.1| clp protease proteolytic subunit [Petrosavia stellaris]
 gb|AGY95367.1| clp protease proteolytic subunit [Petrosavia stellaris]
Length=203

 Score =   223 bits (568),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SFFE+ AGE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFFEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPFWVVSEDMERDVFMSATEAQAHG  187



>ref|YP_008963505.1| clp protease proteolytic subunit (chloroplast) [Penthorum chinense]
 gb|AFR25685.1| clp protease proteolytic subunit (chloroplast) [Penthorum chinense]
Length=195

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ++GL++YL+IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLIGLMIYLSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E L LRE I  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLNLRETITRVYVQRTGKPFWVVSEDMERDVFMSATEAQAHG  187



>gb|AFM83318.1| clp protease proteolytic subunit (chloroplast) [Kingia australis]
Length=204

 Score =   223 bits (568),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>gb|AHF72005.1| clpP-like protease (chloroplast) [Rosa odorata var. gigantea]
Length=195

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL Q +DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQGVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP + TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDIQTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFVLE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE I  +YAQRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETITRVYAQRTGKPLWVVSEDMERDVFMSATEAQAHG  187



>gb|AHY80565.1| clp protease proteolytic subunit [Beta vulgaris subsp. vulgaris]
Length=195

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE LLE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFLLE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTRVYGQRTGKPLWVVSEDMERDVFMSATEAQAHG  187



>gb|AEZ48915.1| clp protease proteolytic subunit, partial [Chamaedorea seifrizii]
Length=195

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED T+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDATRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRIAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+++G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQVHG  187



>gb|ABY85510.1| ATP-dependent protease proteolytic subunit [Silene littorea]
Length=196

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE++SEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVESEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLR  +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRXTLTRVYVQRTGKPIWVVSEDMERDVFMSAAEAQAYG  188



>gb|ACN49434.1| clp protease proteolytic subunit (chloroplast) [Nelumbo nucifera]
 gb|AFH01472.1| clp protease proteolytic subunit (chloroplast) [Nelumbo nucifera]
 gb|AIY33848.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Nelumbo nucifera]
Length=202

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             +INRL+RER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI G+AIYD
Sbjct  23    VINRLHRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYD  82

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ V P V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +L
Sbjct  83    TMQFVPPDVHTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFIL  142

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   EAEELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_740142.1| clp protease proteolytic subunit [Daucus carota]
 ref|YP_004222671.1| clp protease proteolytic subunit [Anthriscus cerefolium]
 sp|Q0G9T7.1|CLPP_DAUCA RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Daucus carota]
 gb|ABI32448.1| clp protease proteolytic subunit [Daucus carota]
 gb|ADD13663.1| clp protease proteolytic subunit [Anthriscus cerefolium]
Length=197

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+DTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVQTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRT  P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTDKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|ADD31100.1| clp protease proteolytic subunit protein (chloroplast) [Antirrhinum 
majus]
Length=196

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q++DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG V+ GVAIYD M
Sbjct  25    NRLYRERLLFLGQDVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVVPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPEVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|ABU85179.1| clp protease proteolytic subunit [Anethum graveolens]
Length=197

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+DTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVQTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRT  P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTDKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|AHH24298.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Japonolirion osense]
Length=204

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAYG  188



>ref|NP_054959.1| ATP-dependent Clp protease proteolytic subunit [Spinacia oleracea]
 sp|Q9M3K5.1|CLPP_SPIOL RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Spinacia oleracea]
 emb|CAB88752.1| ATP-dependent protease proteolytic subunit (chloroplast) [Spinacia 
oleracea]
Length=196

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE LLE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFLLEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYGQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>gb|AEX65187.1| ATP-dependent Clp protease proteolytic subunit, partial (chloroplast) 
[Portulaca oleracea]
Length=195

 Score =   222 bits (566),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI NQ++GL+VYL+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEIGNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  187



>ref|YP_007475814.1| clp protease proteolytic subunit [Pseudophoenix vinifera]
 ref|YP_008578310.1| clpP-like protease (chloroplast) [Cocos nucifera]
 gb|AGE92878.1| clp protease proteolytic subunit [Pseudophoenix vinifera]
 gb|AGS43490.1| clpP-like protease (chloroplast) [Cocos nucifera]
Length=204

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+++G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQVHG  188



>ref|YP_003359383.1| ATP-dependent protease subunit (chloroplast) [Olea europaea]
 ref|YP_004376445.1| ATP-dependent Clp protease proteolytic subunit [Olea europaea 
subsp. europaea]
 ref|YP_004563805.1| ATP-dependent Clp protease proteolytic subunit [Olea europaea 
subsp. cuspidata]
 ref|YP_004564521.1| ATP-dependent Clp protease proteolytic subunit [Olea europaea 
subsp. maroccana]
 gb|ADA69950.1| ATP-dependent protease subunit (chloroplast) [Olea europaea]
 gb|ADD72113.1| clp protease proteolytic subunit [Olea europaea]
 emb|CBR30339.1| ATP-dependent Clp protease proteolytic subunit [Olea europaea 
subsp. europaea]
 emb|CBR23854.1| ATP-dependent Clp protease proteolytic subunit [Olea europaea 
subsp. cuspidata]
 emb|CBR24647.1| ATP-dependent Clp protease proteolytic subunit [Olea europaea 
subsp. europaea]
 emb|CBR30431.1| ATP-dependent Clp protease proteolytic subunit [Olea europaea 
subsp. europaea]
 emb|CBS29266.1| ATP-dependent Clp protease proteolytic subunit [Olea europaea 
subsp. maroccana]
 emb|CBJ04322.1| ATP-dependent Clp protease proteolytic subunit [Olea europaea 
subsp. cuspidata]
 emb|CBR23763.1| ATP-dependent Clp protease proteolytic subunit [Olea europaea 
subsp. cuspidata]
 emb|CCQ09126.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Olea europaea subsp. europaea]
Length=196

 Score =   222 bits (566),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVA+YD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAVYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASM SFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMASFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|AGX28868.2| clpP-like protease (chloroplast) [Veratrum patulum]
Length=201

 Score =   223 bits (567),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+T+D++L+INSPGG VI G+ IYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTRDLYLFINSPGGWVIPGIGIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAYG  187



>gb|AEX96561.1| clp protease proteolytic subunit (chloroplast) [Asphodeline damascena]
Length=204

 Score =   223 bits (567),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+TKDI+ +INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTKDIYFFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_005087718.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium raimondii]
 gb|ADV39187.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium raimondii]
Length=196

 Score =   222 bits (566),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+DTKD++L+INSPGG VISGVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDTKDLYLFINSPGGWVISGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSF+LAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFLLAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRESLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>gb|ABY85762.1| ATP-dependent protease proteolytic subunit [Silene aegyptiaca]
 gb|ABY85783.1| ATP-dependent protease proteolytic subunit [Silene atocioides]
Length=196

 Score =   222 bits (566),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGKPIWVVSEDMERDVFMSAAEAQAHG  188



>ref|YP_001542472.1| clp protease proteolytic subunit [Ceratophyllum demersum]
 gb|ABQ81476.1| clp protease proteolytic subunit [Ceratophyllum demersum]
 emb|CAP62522.1| ATP-dependent protease proteolytic subunit [Ceratophyllum demersum]
Length=202

 Score =   222 bits (566),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QEIDSE++NQIVGL+VYL+IEDDTKD++L+INSPGG VI G+A+YD M
Sbjct  25    NRLYRERLLFLGQEIDSEMSNQIVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIALYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSF+L GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFVLVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_005089358.1| clpP gene product (chloroplast) [Silene vulgaris]
 gb|ABY85531.1| ATP-dependent protease proteolytic subunit [Silene uniflora]
 gb|ABY85657.1| ATP-dependent protease proteolytic subunit [Silene cryptoneura]
 gb|ABY85741.1| ATP-dependent protease proteolytic subunit [Silene schafta]
 gb|ABY86529.1| ATP-dependent protease proteolytic subunit [Heliosperma alpestre]
 gb|AEC04272.1| clp protease proteolytic subunit (chloroplast) [Silene vulgaris]
Length=196

 Score =   222 bits (566),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGKPIWVVSEDMERDVFMSAAEAQAHG  188



>gb|AEX96543.1| clp protease proteolytic subunit (chloroplast) [Camassia scilloides]
Length=204

 Score =   223 bits (567),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IE+DTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIENDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE LLE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFLLEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>gb|ABY84433.1| ATP-dependent protease proteolytic subunit [Silene flos-jovis]
Length=196

 Score =   222 bits (566),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE++SEI+NQI+GL+VYL+IEDDTKD++L+INSPGG VISGV IYD M
Sbjct  25    NRLYRERLLFLGQEVESEISNQIIGLMVYLSIEDDTKDLYLFINSPGGSVISGVGIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGKPIWVVSEDMERDVFMSAAEAQAHG  188



>gb|AEX65183.1| ATP-dependent Clp protease proteolytic subunit, partial (chloroplast) 
[Anredera baselloides]
Length=195

 Score =   222 bits (565),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEIANQ++GL+VYL+IEDDTKD++L+INSPGG VI G+AI+D 
Sbjct  23    VNRLYRERLLFLGQEVDSEIANQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIFDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTRVYVQRTGKPLWVVSDDMERDVFMSATEAQAHG  187



>ref|YP_009026462.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Dendrobium catenatum]
 gb|AGM48220.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Dendrobium catenatum]
 gb|AIR76410.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Dendrobium catenatum]
Length=197

 Score =   222 bits (566),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|AEX96570.1| clp protease proteolytic subunit (chloroplast) [Oziroe biflora]
Length=204

 Score =   222 bits (566),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+TKD++L+INSPGG VI G+A+YD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDETKDLYLFINSPGGWVIPGIAVYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPH RVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHVRVMIHQPASSFYEAQAGEFVLEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>dbj|BAQ19666.1| clp protease proteolytic subunit (chloroplast) [Ananas comosus]
Length=203

 Score =   222 bits (566),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED TKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDATKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRIAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  187



>ref|YP_007475900.1| clp protease proteolytic subunit [Calamus caryotoides]
 gb|AGE92964.1| clp protease proteolytic subunit [Calamus caryotoides]
Length=204

 Score =   222 bits (566),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QEIDSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEIDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_009020064.1| clp protease proteolytic subunit [Prunus mume]
 gb|AHK26898.1| clp protease proteolytic subunit [Prunus mume]
Length=195

 Score =   222 bits (565),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL Q +DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQGVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP + TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP  SF+E+  GE +LE
Sbjct  83    MQFVRPDIQTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPAASFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +A +YAQRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLARVYAQRTGKPLWVVSEDMERDVFMSAIEAQAHG  187



>ref|YP_008081675.1| clpP-like protease (chloroplast) [Cymbidium sinense]
 ref|YP_008081831.1| clpP-like protease (chloroplast) [Cymbidium tracyanum]
 ref|YP_008081909.1| clpP-like protease (chloroplast) [Cymbidium mannii]
 ref|YP_008081753.1| clpP-like protease (chloroplast) [Cymbidium tortisepalum]
 ref|YP_008081597.1| clpP-like protease (chloroplast) [Cymbidium aloifolium]
 gb|AGK25243.1| clpP-like protease (chloroplast) [Cymbidium aloifolium]
 gb|AGK25322.1| clpP-like protease (chloroplast) [Cymbidium sinense]
 gb|AGK25400.1| clpP-like protease (chloroplast) [Cymbidium tortisepalum]
 gb|AGK25478.1| clpP-like protease (chloroplast) [Cymbidium tortisepalum]
 gb|AGK25634.1| clpP-like protease (chloroplast) [Cymbidium tracyanum]
 gb|AGK25712.1| clpP-like protease (chloroplast) [Cymbidium tortisepalum]
 gb|AGK25790.1| clpP-like protease (chloroplast) [Cymbidium mannii]
Length=203

 Score =   222 bits (565),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQ+VGL++YL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQLVGLMIYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSF+L GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVSPDVHTICMGLAASMGSFVLVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  187



>gb|AEZ48927.1| clp protease proteolytic subunit, partial [Lilium superbum]
Length=198

 Score =   222 bits (565),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             LINRL+RER LFL QE+DSEI+NQ+VGL+VYL+IED+T+D +L+INSPGG VI G+AIYD
Sbjct  24    LINRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTRDFYLFINSPGGWVIPGIAIYD  83

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +L
Sbjct  84    TMQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFIL  143

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  144   EAEELLKLRENLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  189



>gb|AEZ48917.1| clp protease proteolytic subunit [Molineria capitulata]
Length=203

 Score =   222 bits (565),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL Q +DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLHRERLLFLGQAVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVLPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  187



>gb|AGE93480.1| clp protease proteolytic subunit [Xiphidium caeruleum]
Length=204

 Score =   222 bits (565),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+D+EI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDNEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTG P  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGKPLWVISEDMERDVFMSATEAQTHG  188



>gb|AEX96555.1| clp protease proteolytic subunit (chloroplast) [Scadoxus cinnabarinus]
Length=204

 Score =   222 bits (565),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED TKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDYTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|AJC00295.1| ATP-dependent Clp protease proteolytic subunit [Lysimachia coreana]
Length=196

 Score =   221 bits (564),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q +DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQAVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP + F+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASDFYEAQTGEAILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|AEZ48918.1| clp protease proteolytic subunit [Dasypogon bromeliifolius]
Length=203

 Score =   222 bits (565),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPFWVVSEDMERDVFMSATEAQAHG  187



>gb|AEZ48910.1| clp protease proteolytic subunit [Albuca kirkii]
Length=203

 Score =   222 bits (565),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+TKD++L+IN+PGG VI G+A+YD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDETKDLYLFINTPGGWVIPGIAVYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  +IS D++RD+F SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVISEDLERDIFMSATEAQAHG  187



>ref|YP_009108614.1| Clp protease proteolytic subunit [Echites umbellatus]
 gb|AIW05328.1| Clp protease proteolytic subunit [Echites umbellatus]
Length=196

 Score =   221 bits (564),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q +DSEI+NQ++GL++YL+IEDD KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQGVDSEISNQLMGLMIYLSIEDDNKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V T+C+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVRPDVHTVCMGLAASMGSFILVGGTITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  +IS DM+RDVF SA +A++YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVISEDMERDVFMSATEAQVYG  188



>ref|YP_001671708.1| ATP-dependent Clp protease proteolytic subunit [Carica papaya]
 gb|ABY86808.1| ATP-dependent Clp protease proteolytic subunit [Carica papaya]
Length=196

 Score =   221 bits (564),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE DTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIESDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVQTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQVGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|AEZ48916.1| clp protease proteolytic subunit, partial [Chlorophytum rhizopendulum]
Length=194

 Score =   221 bits (564),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+V+L+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVFLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R A PHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQLVPPDVHTICMGLAASMGSFILVGGEITKRLALPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTG P  +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGTPLWVISEDMERDVFMSATEAQAHG  187



>ref|YP_008963716.1| clp protease proteolytic subunit (chloroplast) [Liquidambar formosana]
 gb|ADD31118.1| clp protease proteolytic subunit protein (chloroplast) [Liquidambar 
styraciflua]
 gb|AGL13455.1| clp protease proteolytic subunit (chloroplast) [Liquidambar formosana]
Length=196

 Score =   221 bits (564),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QEI+SEI+NQ++GL+VYL+IEDDTKD++L+INSPGG +I GVAIYD M
Sbjct  25    NRLYRERLLFLGQEINSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWLIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +S+FE+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGKITKRIAFPHARVMIHQPGSSYFEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +YAQRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETITRVYAQRTGKPFWVVSEDMERDVFMSATEAQAHG  188



>gb|AGE93222.1| clp protease proteolytic subunit [Calectasia narragara]
Length=204

 Score =   221 bits (564),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_008994314.1| clp protease proteolytic subunit [Melianthus villosus]
 gb|AGS13032.1| clp protease proteolytic subunit [Melianthus villosus]
Length=195

 Score =   221 bits (563),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ++GL++YL+IE+DTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLIGLMIYLSIENDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP + T+C+GLAASMGSFIL GG IT+R AFPHARVMIHQP  SF+E+  GE +LE
Sbjct  83    MQFVRPDIQTVCMGLAASMGSFILVGGEITKRLAFPHARVMIHQPAASFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +YAQRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLREILTRVYAQRTGKPLWVVSEDMERDVFMSATEAQAHG  187



>ref|YP_009048599.1| clpP-like protease [Paris verticillata]
 gb|AHX80475.1| clpP-like protease [Paris verticillata]
Length=196

 Score =   221 bits (563),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             INRL+RER LFL QE+DSEI+NQIVGL+VYL++ED+T+D++L+INSPGG VISG+AIYD 
Sbjct  23    INRLHRERLLFLGQEVDSEISNQIVGLMVYLSLEDNTRDLYLFINSPGGLVISGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVIPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E L+LRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLRLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  187



>gb|AEX96566.1| clp protease proteolytic subunit (chloroplast) [Bowiea volubilis]
Length=204

 Score =   221 bits (564),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+TKD++L+INSPGG VI G+A+YD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDETKDLYLFINSPGGWVIPGIAVYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG I +R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEIAKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|ADD31111.1| clp protease proteolytic subunit protein (chloroplast) [Berberidopsis 
corallina]
Length=196

 Score =   221 bits (563),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTK+++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKNLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPNVHTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E L+LRE +  +YAQRTG    ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLRLRESLTRVYAQRTGKSLWVVSEDMERDVFMSATEAQTHG  188



>gb|AEZ48928.1| clp protease proteolytic subunit [Lomandra longifolia]
Length=203

 Score =   221 bits (564),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGN   +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNSLWVISEDMERDVFMSATEAQAHG  187



>ref|YP_003587490.1| Clp protease proteolytic subunit [Oncidium hybrid cultivar]
 gb|ACT83132.1| Clp protease proteolytic subunit [Oncidium hybrid cultivar]
Length=203

 Score =   221 bits (564),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ++GL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|AGE93308.1| clp protease proteolytic subunit [Chamaedorea seifrizii]
Length=204

 Score =   221 bits (564),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED T+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDATRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRIAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+++G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQVHG  188



>ref|YP_009108868.1| Clp protease proteolytic subunit [Pentalinon luteum]
 gb|AIW05751.1| Clp protease proteolytic subunit [Pentalinon luteum]
Length=196

 Score =   221 bits (562),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q +DSEI+NQ++GL++YL+IEDD KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQAVDSEISNQLIGLMIYLSIEDDNKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V T+C+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVRPDVHTVCMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYETQAGEFVLEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>ref|YP_740675.1| clp protease proteolytic subunit [Nandina domestica]
 sp|Q09FT6.1|CLPP_NANDO RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Nandina domestica]
 gb|ABI49889.1| clp protease proteolytic subunit [Nandina domestica]
Length=202

 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IED+TKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDETKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFVLEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_009093975.1| clp protease proteolytic subunit (chloroplast) [Nelumbo nucifera]
 gb|ADD31107.1| clp protease proteolytic subunit protein (chloroplast) [Nelumbo 
nucifera]
 gb|AGO98549.1| clp protease proteolytic subunit (chloroplast) [Nelumbo nucifera]
Length=202

 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>gb|AHW52209.1| clp protease proteolytic subunit (chloroplast) [Rhazya stricta]
Length=196

 Score =   221 bits (562),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             +INRLYRER LFL Q +DSEI+NQ++GL++YL++EDD KD++L+INSPGG VI GVAIYD
Sbjct  23    VINRLYRERLLFLGQAVDSEISNQLIGLMIYLSLEDDNKDLYLFINSPGGWVIPGVAIYD  82

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +L
Sbjct  83    TMQFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFIL  142

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  143   EAEELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>ref|NP_084822.1| ATP-dependent Clp protease proteolytic subunit [Lotus japonicus]
 sp|Q9BBQ9.1|CLPP_LOTJA RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Lotus japonicus]
 dbj|BAB33221.1| ATP-dependent protease subunit [Lotus japonicus]
Length=196

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE++SEI+NQ++GL+VYL+IEDD KD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVNSEISNQLIGLMVYLSIEDDKKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V T+C+GLAASMGSF+LAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVQTVCMGLAASMGSFVLAGGKITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETITRVYVQRTGKPLWLVSEDMERDVFMSAAEAQAYG  188



>gb|AIW05836.1| Clp protease proteolytic subunit [Periploca sepium]
Length=196

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q +DSEI+NQ++GL++YL+IEDD KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQAVDSEISNQLIGLMIYLSIEDDNKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V T+C+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVRPDVHTVCMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>ref|YP_008082606.1| clp protease proteolytic subunit (chloroplast) [Utricularia gibba]
 gb|AGL61100.1| clp protease proteolytic subunit (chloroplast) [Utricularia gibba]
Length=195

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLY ER LFL QE+DSEI+NQ++GL++YL++ED+TKD++L+INSPGG V+ G+AIYD 
Sbjct  23    VNRLYHERLLFLGQEVDSEISNQLLGLMIYLSLEDNTKDLYLFINSPGGWVVPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPEVHTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLREILTRVYVQRTGKPIWVVSEDMERDVFMSANEAQAYG  187



>ref|YP_007890398.1| clp protease proteolytic subunit (chloroplast) [Ardisia polysticta]
 gb|AGG36909.1| clp protease proteolytic subunit (chloroplast) [Ardisia polysticta]
Length=195

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL Q +DSEI+NQ++GL++YL+IED+TKD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQTVDSEISNQLIGLMIYLSIEDNTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP + F+E+  GE +LE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASDFYEAQTGEAILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  187



>ref|YP_007476072.1| clp protease proteolytic subunit [Dasypogon bromeliifolius]
 gb|AGE93136.1| clp protease proteolytic subunit [Dasypogon bromeliifolius]
Length=204

 Score =   221 bits (562),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPFWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_538961.1| ATP-dependent Clp protease proteolytic subunit [Gossypium hirsutum]
 ref|YP_005087814.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium darwinii]
 ref|YP_005088305.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium tomentosum]
 ref|YP_005088401.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium herbaceum subsp. africanum]
 ref|YP_005088941.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium mustelinum]
 ref|YP_005089024.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium arboreum]
 ref|YP_006303516.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium gossypioides]
 ref|YP_006503302.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium incanum]
 ref|YP_006503468.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium capitis-viridis]
 ref|YP_006503634.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium robinsonii]
 sp|Q2L926.1|CLPP_GOSHI RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Gossypium hirsutum]
 gb|ABC73652.1| clp protease proteolytic subunit [Gossypium hirsutum]
 gb|ADV38817.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium arboreum]
 gb|ADV38899.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium darwinii]
 gb|ADV38983.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium herbaceum subsp. africanum]
 gb|ADV39066.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium mustelinum]
 gb|ADV39232.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium tomentosum]
 gb|AEB90455.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium gossypioides]
 gb|AEB90538.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium hirsutum]
 gb|AEB90621.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium hirsutum]
 gb|AEB90704.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium barbadense]
 gb|AEB90787.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium barbadense]
 gb|AEB90870.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium barbadense]
 gb|AEH42976.1| ATP-dependent Clp protease proteolytic subunit [Gossypium incanum]
 gb|AEH43142.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium capitis-viridis]
 gb|AEH43308.1| ATP-dependent Clp protease proteolytic subunit [Gossypium robinsonii]
Length=196

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+DTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSF+LAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFLLAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRESLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_007317273.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Camellia sinensis]
 gb|AGA55621.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Camellia sinensis]
Length=195

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL Q +DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQGVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V+P V TIC+GLAASMGSF+L GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVQPDVHTICMGLAASMGSFLLVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  187



>gb|AEX96567.1| clp protease proteolytic subunit (chloroplast) [Drimia altissima]
 gb|AEX96569.1| clp protease proteolytic subunit (chloroplast) [Ornithogalum 
tenuifolium]
Length=204

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+TKD++L+IN+PGG VI G+A+YD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDETKDLYLFINTPGGWVIPGIAVYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS D++RD+F SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDLERDIFMSATEAQAHG  188



>ref|YP_006503385.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium somalense]
 ref|YP_006503551.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium areysianum]
 gb|AEH43059.1| ATP-dependent Clp protease proteolytic subunit [Gossypium somalense]
 gb|AEH43225.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Gossypium areysianum]
Length=196

 Score =   220 bits (560),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+DTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSF+LAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVHPDVHTICMGLAASMGSFLLAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRESLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_006576139.1| ClpP (chloroplast) [Magnolia denudata]
 gb|AEM65242.1| ClpP [Magnolia denudata]
 gb|AEX98359.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Magnolia denudata]
Length=201

 Score =   220 bits (560),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAPTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLREILTRVYVQRTGNPLWVVSEDMERDVFMSAAEAQAHG  187



>ref|YP_005296125.1| clpP gene product (chloroplast) [Pentactina rupicola]
 gb|AEX31757.1| clp protease proteolytic subunit (chloroplast) [Pentactina rupicola]
Length=196

 Score =   219 bits (559),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q +DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQGVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP + TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDIQTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_009092792.1| clp protease proteolytic subunit [Bomarea edulis]
 gb|AIR12627.1| clp protease proteolytic subunit [Bomarea edulis]
Length=204

 Score =   220 bits (560),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+T+D +L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTRDFYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>gb|ADD31101.1| clp protease proteolytic subunit protein (chloroplast) [Aucuba 
japonica]
Length=198

 Score =   219 bits (559),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHA--RVMIHQPRTSFFESHAGelll  1265
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHA  RVMIHQP +SF+E+  GE +L
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHAQIRVMIHQPASSFYEAQTGEFIL  144

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EAEELLKLRESLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  190



>ref|YP_006073290.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Phalaenopsis equestris]
 ref|YP_009107585.1| clp protease proteolytic subunit (chloroplast) [Phalaenopsis 
hybrid cultivar]
 gb|AEB96269.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Phalaenopsis equestris]
 gb|AIU44795.1| clp protease proteolytic subunit (chloroplast) [Phalaenopsis 
hybrid cultivar]
Length=203

 Score =   219 bits (559),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQIVGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQIVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ A + +LE
Sbjct  83    MQFVLPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQARDFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  187



>gb|AEZ48942.1| clp protease proteolytic subunit [Syngonanthus chrysanthus]
Length=199

 Score =   219 bits (559),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYR+R LFL QE+D+EI+NQIVGL+VYL++EDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    LNRLYRQRLLFLGQEVDNEISNQIVGLMVYLSLEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TICIGLAASMGSF+L GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVPPDVHTICIGLAASMGSFVLVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLREILTKVYVQRTGKPLWVVSEDMERDVFMSATEAQTHG  187



>ref|YP_007889886.1| clp protease proteolytic subunit [Francoa sonchifolia]
 gb|AFJ00496.1| clp protease proteolytic subunit [Francoa sonchifolia]
Length=196

 Score =   219 bits (558),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL++YL+IE+DTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLIIYLSIENDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP + TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP  SF+E+  GE +LE 
Sbjct  85    QFVRPDIHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPAASFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +YAQRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLREILTRVYAQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_008993459.1| clpP (chloroplast) [Magnolia kobus]
Length=201

 Score =   219 bits (559),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI GV+IYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGVSIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAPTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLREILTRVYVQRTGNPLWVVSEDMERDVFMSAAEAQAHG  187



>ref|YP_009108699.1| Clp protease proteolytic subunit [Nerium oleander]
 gb|ADD31108.1| clp protease proteolytic subunit protein (chloroplast) [Nerium 
oleander]
 gb|AIW05582.1| Clp protease proteolytic subunit [Nerium oleander]
Length=196

 Score =   219 bits (558),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q +DSEI+NQ++GL++YL+IEDD KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQAVDSEISNQLIGLMIYLSIEDDNKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>ref|YP_009108254.1| clp protease proteolytic subunit [Cistanche phelypaea]
 emb|CDH98442.1| clp protease proteolytic subunit [Cistanche phelypaea]
Length=196

 Score =   219 bits (558),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYR R LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRARLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SFF +  GE +LE 
Sbjct  85    QFVRPEVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFFRAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRT  P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTSKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|ABY85489.1| ATP-dependent protease proteolytic subunit [Silene samia]
Length=196

 Score =   219 bits (558),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAI D M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIXDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGKPIWVVSEDMERDVFMSAAEAQAHG  188



>ref|YP_009114473.1| clp protease proteolytic subunit (chloroplast) [Paeonia obovata]
 gb|AHF71919.1| clpP-like protease (chloroplast) [Paeonia sp. Sd0052]
 gb|AHV83421.1| clp protease proteolytic subunit (chloroplast) [Paeonia obovata]
Length=195

 Score =   219 bits (558),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P + TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVGPDLHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLREILTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  187



>ref|YP_009093825.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Luzuriaga radicans]
 gb|AIT16016.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Luzuriaga radicans]
Length=204

 Score =   219 bits (559),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+T+D +L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTRDFYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSF+L GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFVLVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>gb|AEX96544.1| clp protease proteolytic subunit (chloroplast) [Echeandia sp. 
Steele 1101]
Length=195

 Score =   219 bits (558),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+V+L+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVFLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R A PHARVMIHQP +SF+E+ AGE LLE 
Sbjct  85    QLVPPDVHTICMGLAASMGSFILVGGEITKRLALPHARVMIHQPASSFYEAQAGEFLLEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTG P  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGTPLWVISEDMERDVFMSATEAQAHG  188



>ref|NP_862778.1| ATP-dependent Clp protease proteolytic subunit [Calycanthus floridus 
var. glaucus]
 sp|Q7YJV2.1|CLPP_CALFG RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Calycanthus 
floridus var. glaucus]
 emb|CAD28745.1| ATP-dependent protease proteolytic subunit [Calycanthus floridus 
var. glaucus]
Length=202

 Score =   219 bits (558),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLTIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAPTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>gb|ABU85333.1| clp protease proteolytic subunit [Elaeis oleifera]
Length=195

 Score =   219 bits (558),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RE  LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLHREGLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R A PHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLALPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+++G
Sbjct  143   AEELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQVHG  187



>ref|YP_008577093.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus torquata]
 gb|AGC58502.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus torquata]
Length=196

 Score =   219 bits (558),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQI+GL+VYL+IE+D KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQIIGLMVYLSIENDNKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LK+RE I  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKMRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>gb|ADO33472.1| clp protease proteolytic subunit [Smilax china]
Length=204

 Score =   219 bits (558),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IED T+D FL+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDKTRDFFLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETITKVYVQRTGNPLWVVSEDMERDVFMSATEAQSHG  188



>ref|YP_004769739.1| ClpP [Magnolia kwangsiensis]
 ref|YP_007474395.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Magnolia officinalis]
 ref|YP_007474477.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Magnolia officinalis subsp. biloba]
 ref|YP_007474561.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Magnolia grandiflora]
 ref|YP_008993287.1| clpP (chloroplast) [Magnolia dealbata]
 ref|YP_009026906.1| ATP-dependent Clp protease proteolytic subunit [Magnolia tripetala]
 gb|ADL39081.1| ClpP [Magnolia kwangsiensis]
 gb|AEX98527.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Magnolia officinalis]
 gb|AEX98609.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Magnolia officinalis subsp. biloba]
 gb|AEX98693.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Magnolia officinalis subsp. biloba]
 gb|AEX98777.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Magnolia officinalis subsp. biloba]
 gb|AEX98944.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Magnolia grandiflora]
 gb|AEX99112.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Magnolia grandiflora]
 gb|AHW51982.1| ATP-dependent Clp protease proteolytic subunit [Magnolia tripetala]
Length=201

 Score =   219 bits (558),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G++IYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGISIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAPTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSAAEAQAHG  187



>ref|YP_008578198.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Stockwellia quadrifida]
 gb|AGC59607.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Stockwellia quadrifida]
Length=196

 Score =   219 bits (557),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IE+D KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIENDNKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_003933985.1| clp protease proteolytic subunit [Eucalyptus grandis]
 gb|ADO23613.1| clp protease proteolytic subunit [Eucalyptus grandis]
Length=195

 Score =   219 bits (557),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+D KD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDNKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V+P V TIC+GLAASMGSF+L GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVQPDVHTICMGLAASMGSFVLVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  187



>gb|AIW05243.1| Clp protease proteolytic subunit [Aganosma cymosa]
 gb|AIW06006.1| Clp protease proteolytic subunit [Wrightia natalensis]
Length=196

 Score =   219 bits (557),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q +DSEI+NQ++GL++YL+IEDD KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQAVDSEISNQLIGLMIYLSIEDDNKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V T+C+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTVCMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>ref|YP_008965564.1| clp protease proteolytic subunit [Conopholis americana]
 emb|CDI02733.1| clp protease proteolytic subunit [Conopholis americana]
Length=196

 Score =   219 bits (557),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DS+I+NQ++GL+VYL+IEDDTKD++ +INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSDISNQLIGLMVYLSIEDDTKDLYFFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSF+L GG IT+R AFPHARVMIHQP + FF +  GE +LE
Sbjct  83    MQFVRPEVHTICMGLAASMGSFLLVGGEITKRLAFPHARVMIHQPASYFFLTQVGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE I  +Y QRTG P  ++S DM+RD+F SA++A+ YG
Sbjct  143   AEELLKLRETITRVYVQRTGKPLWVVSEDMERDIFMSAKEAQAYG  187



>ref|YP_007475644.1| clp protease proteolytic subunit [Heliconia collinsiana]
 gb|AGE92708.1| clp protease proteolytic subunit [Heliconia collinsiana]
Length=204

 Score =   219 bits (558),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>gb|AIW05497.1| Clp protease proteolytic subunit [Neobracea bahamensis]
Length=196

 Score =   219 bits (557),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q +DSEI+NQ++GL++YL+IEDD KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQAVDSEISNQLIGLMIYLSIEDDNKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V T+C+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTVCMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>ref|YP_008993373.1| clpP (chloroplast) [Magnolia pyramidata]
Length=201

 Score =   219 bits (557),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G++IYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGISIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAPTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSAAEAQAHG  187



>ref|YP_009041112.1| ATP-dependent Clp protease proteolytic subunit [Rhazya stricta]
 gb|AIB08759.1| ATP-dependent Clp protease proteolytic subunit [Rhazya stricta]
Length=196

 Score =   219 bits (557),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q +DSEI+NQ++GL++YL++EDD KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQAVDSEISNQLIGLMIYLSLEDDNKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>ref|YP_001294123.1| clp protease proteolytic subunit [Chloranthus spicatus]
 sp|A6MME7.1|CLPP_CHLSC RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Chloranthus 
spicatus]
 gb|ABQ43284.1| clp protease proteolytic subunit [Chloranthus spicatus]
Length=201

 Score =   219 bits (557),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+ IYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGLTIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHAR+MIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARIMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTGNP  I+S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTRVYVQRTGNPLWIVSEDMERDVFMSATEAQAHG  187



>gb|AGM51172.1| clp protease proteolytic subunit (chloroplast) [Glycine soja]
Length=197

 Score =   219 bits (557),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             LINRLYRER LFL QE+DSEI+NQ++ L+VYL+IE++ KD++L+INSPGG VI G+AIYD
Sbjct  24    LINRLYRERLLFLGQEVDSEISNQLISLMVYLSIEEENKDLYLFINSPGGWVIPGIAIYD  83

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ V+P V T+C+GLAASMGSF+LAGG IT+R AFPHARVMIHQP +SF+E+  GE +L
Sbjct  84    TMQFVQPDVQTVCMGLAASMGSFLLAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFIL  143

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LK+RE I  +Y QRTG P  +IS DM+RDVF SA +A+ +G
Sbjct  144   EAEELLKMRETITRVYVQRTGKPLWVISEDMERDVFMSAAEAQAHG  189



>gb|ABU85425.1| clp protease proteolytic subunit [Musa acuminata]
Length=195

 Score =   218 bits (556),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE++SEI+NQIVGL+VYL+IED+T+D+FL+INSPGG V+SG+AIYD 
Sbjct  23    LNRLHRERLLFLGQEVNSEISNQIVGLMVYLSIEDNTRDLFLFINSPGGWVVSGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+ES  GE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILIGGEITKRLAFPHARVMIHQPASSFYESRTGEFVLE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             M+E LKLRE + ++Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   MEELLKLRETLTKVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  187



>gb|AHI87553.1| clp protease proteolytic subunit (chloroplast) [Chionographis 
japonica]
Length=203

 Score =   219 bits (557),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IED+T+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE LLE
Sbjct  83    MQFVPPEVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFLLE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE I ++Y +RTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETITKVYVKRTGNPLWVVSEDMERDVFMSATEAQAHG  187



>ref|YP_913212.1| ATP-dependent protease proteolytic subunit [Gossypium barbadense]
 sp|A0ZZ60.1|CLPP_GOSBA RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Gossypium barbadense]
 dbj|BAF41272.1| ATP-dependent protease proteolytic subunit [Gossypium barbadense]
Length=196

 Score =   218 bits (556),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+DTKD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDTKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSF+LAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFLLAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+R+VF SA +A+ +G
Sbjct  145   EELLKLRESLTRVYVQRTGKPLWVVSEDMERNVFMSATEAQAHG  188



>gb|AHA12949.1| clp protease proteolytic subunit [Monocostus uniflorus]
 gb|AHA13035.1| clp protease proteolytic subunit [Costus pulverulentus]
Length=204

 Score =   219 bits (557),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_008993201.1| clpP (chloroplast) [Magnolia cathcartii]
 ref|YP_008993631.1| clpP (chloroplast) [Magnolia odora]
 ref|YP_008993803.1| clpP (chloroplast) [Magnolia sinica]
 ref|YP_008993889.1| clpP (chloroplast) [Magnolia sprengeri]
 ref|YP_008993717.1| clpP (chloroplast) [Magnolia salicifolia]
 ref|YP_009048312.1| clpP-like protease (chloroplast) [Magnolia yunnanensis]
 gb|AHF72092.1| clpP-like protease (chloroplast) [Magnolia yunnanensis]
Length=201

 Score =   219 bits (557),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G++IYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGISIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAPTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLREILTRVYVQRTGNPLWVVSEDMERDVFMSAAEAQAHG  187



>gb|AGQ55782.2| clp protease proteolytic subunit (chloroplast) [Lilium longiflorum]
Length=204

 Score =   219 bits (557),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IED+T+D +L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTRDFYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRENLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_008993545.1| clpP (chloroplast) [Magnolia liliifera]
 gb|AEX98276.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Magnolia liliiflora]
Length=201

 Score =   218 bits (556),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G++IYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGISIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAPTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLREILTRVYVQRTGNPLWVVSEDMERDVFMSAAEAQAHG  187



>gb|AGK25556.1| clpP-like protease (chloroplast) [Cymbidium mannii]
Length=203

 Score =   218 bits (556),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQ+VGL++YL+IEDDT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQLVGLMIYLSIEDDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V TIC+GLAASMGSF+L GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVSPDVHTICMGLAASMGSFVLVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGN   +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTKVYVQRTGNSLWVISEDMERDVFMSATEAQAHG  187



>ref|YP_009027804.1| clp protease proteolytic subunit (chloroplast) [Cercis canadensis]
Length=196

 Score =   218 bits (556),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             +INRLYRER LF+ Q ID+E++NQ++GL+VYL++EDDTKD++L+INSPGG VI G++IYD
Sbjct  23    VINRLYRERLLFVGQGIDNELSNQLIGLMVYLSMEDDTKDLYLFINSPGGWVIPGISIYD  82

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ V+P V T+C+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+ A E +L
Sbjct  83    TMQFVKPDVQTVCMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQAAEFVL  142

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE I  +YAQRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   EAEELLKLRETITRVYAQRTGKPLWVVSEDMERDVFMSAAEAQAHG  188



>gb|ABY85594.1| ATP-dependent protease proteolytic subunit [Silene integripetala]
Length=196

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAI D M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIXDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG  T ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGKSTWVVSEDMERDVFMSAAEAQAHG  188



>ref|YP_008854450.1| clp protease proteolytic subunit [Musa textilis]
 gb|AHA12539.1| clp protease proteolytic subunit [Musa textilis]
Length=204

 Score =   218 bits (556),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             L NRL+RER LFL QE++SEI+NQIVGL+VYL+IED+T+D+FL+INSPGG V+SG+AIYD
Sbjct  23    LYNRLHRERLLFLGQEVNSEISNQIVGLMVYLSIEDNTRDLFLFINSPGGWVVSGIAIYD  82

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+ES  GE +L
Sbjct  83    TMQFVPPDVHTICMGLAASMGSFILIGGEITKRLAFPHARVMIHQPASSFYESRTGEFVL  142

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             EM+E LKLRE + ++Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   EMEELLKLRETLTKVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_358605.1| ATP-dependent Clp protease proteolytic subunit [Phalaenopsis 
aphrodite subsp. formosana]
 sp|Q3BAL3.1|CLPP_PHAAO RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Phalaenopsis 
aphrodite subsp. formosana]
 gb|AAW82524.1| ATP-dependent Clp protease proteolytic subunit [Phalaenopsis 
aphrodite subsp. formosana]
Length=204

 Score =   218 bits (556),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQIVGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQIVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ A + +LE 
Sbjct  85    QFVLPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQARDFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_008575393.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus verrucata]
 ref|YP_008575478.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus baxteri]
 ref|YP_008575563.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus diversifolia]
 ref|YP_008575648.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus sieberi]
 ref|YP_008575733.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus elata]
 ref|YP_008575818.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus regnans]
 ref|YP_008575903.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus umbra]
 ref|YP_008575988.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus cloeziana]
 ref|YP_008576073.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus patens]
 ref|YP_008576158.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus marginata]
 ref|YP_008576243.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus curtisii]
 ref|YP_008576328.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus melliodora]
 ref|YP_008576413.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus polybractea]
 ref|YP_008576498.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus cladocalyx]
 ref|YP_008576923.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus deglupta]
 ref|YP_008577008.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus spathulata]
 ref|YP_008577178.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus diversicolor]
 ref|YP_008577348.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus microcorys]
 ref|YP_008577603.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Corymbia gummifera]
 ref|YP_008577688.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Corymbia maculata]
 ref|YP_008577773.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Corymbia eximia]
 ref|YP_008577858.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Corymbia tessellaris]
 ref|YP_008577943.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Angophora floribunda]
 ref|YP_008578028.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Angophora costata]
 ref|YP_008578113.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Allosyncarpia ternata]
 gb|ADH94369.1| photosystem II CP47 chlorophyll apoprotein [Syzygium cumini]
 gb|AGC56632.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus verrucata]
 gb|AGC56717.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus baxteri]
 gb|AGC56802.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus diversifolia]
 gb|AGC56887.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus sieberi]
 gb|AGC56972.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus elata]
 gb|AGC57057.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus regnans]
 gb|AGC57142.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus umbra]
 gb|AGC57227.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus cloeziana]
 gb|AGC57312.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus patens]
 gb|AGC57397.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus marginata]
 gb|AGC57482.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus curtisii]
 gb|AGC57567.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus melliodora]
 gb|AGC57652.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus melliodora]
 gb|AGC57737.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus polybractea]
 gb|AGC57822.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus cladocalyx]
 gb|AGC58332.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus deglupta]
 gb|AGC58417.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus spathulata]
 gb|AGC58587.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus diversicolor]
 gb|AGC58757.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus microcorys]
 gb|AGC59012.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Corymbia gummifera]
 gb|AGC59097.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Corymbia maculata]
 gb|AGC59182.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Corymbia eximia]
 gb|AGC59267.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Corymbia tessellaris]
 gb|AGC59352.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Angophora floribunda]
 gb|AGC59437.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Angophora costata]
 gb|AGC59522.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Allosyncarpia ternata]
Length=196

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+D KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDNKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>gb|AEX58480.1| clp protease proteolytic subunit (chloroplast) [Theobroma grandiflorum]
Length=196

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+DTK+++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDTKELYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RD+F SA +A+ +G
Sbjct  145   EELLKLRETITRVYVQRTGKPLWVVSEDMERDIFMSATEAQAHG  188



>gb|AGQ55699.2| clp protease proteolytic subunit (chloroplast) [Alstroemeria 
aurea]
Length=204

 Score =   218 bits (556),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IED+T+D +L+INSPGG VI G++IYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTRDFYLFINSPGGWVIPGISIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILIGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>gb|AEX96545.1| clp protease proteolytic subunit (chloroplast) [Hosta ventricosa]
Length=211

 Score =   218 bits (556),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 138/171 (81%), Gaps = 7/171 (4%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHA-------RVMIHQPRTSFFESHA  1250
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHA       RVMIHQP +SF+E+ A
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHAYVISNIIRVMIHQPASSFYEAQA  144

Query  1251  GelllemkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             GE +LE +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   GEFILEAEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  195



>ref|NP_054384.1| ATP-dependent Clp protease proteolytic subunit [Epifagus virginiana]
 sp|P30063.1|CLPP_EPIVI RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp [Epifagus virginiana]
 gb|AAA65858.1| protease [Epifagus virginiana]
Length=196

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DS+I+NQ++GL+VYL+IEDDTK+I+L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSDISNQLIGLMVYLSIEDDTKEIYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSF+L GG IT+R AFPHARVMIHQP + FF +  GE +LE 
Sbjct  85    QFVRPEVHTICMGLAASMGSFLLVGGEITKRLAFPHARVMIHQPASYFFGAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  +IS DM+RDVF SA+ A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVISEDMERDVFMSAKDAQAYG  188



>ref|YP_009092328.1| clp protease proteolytic subunit (chloroplast) [Macadamia integrifolia]
 gb|AHB38184.1| clp protease proteolytic subunit (chloroplast) [Macadamia integrifolia]
Length=202

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             +INRL+RER LFL QE+DSEI+NQ++GL+VYL+IEDDT+D++L+INSPGG VI G+AIYD
Sbjct  23    VINRLHRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYD  82

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ V P V TIC+GLAASMGSFI+ GG IT+R AFPHARVMIHQP +SF+E+  GE +L
Sbjct  83    TMQFVPPDVHTICMGLAASMGSFIVVGGEITKRIAFPHARVMIHQPASSFYEAQTGEFVL  142

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE +  +YAQRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   EAEELLKLRETLTRVYAQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>ref|NP_904123.1| ATP-dependent Clp protease proteolytic subunit [Amborella trichopoda]
 sp|Q70XY2.1|CLPP_AMBTC RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Amborella trichopoda]
 emb|CAD45131.1| ATP-dependent protease proteolytic subunit [Amborella trichopoda]
Length=202

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE++ EI+NQIVGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVEGEISNQIVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDAM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSF+LAGG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFVLAGGEITKRLAFPHARVMIHQPASSFYEAPAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              E LKLRE I  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   GELLKLRETITSVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_008082758.1| clp protease proteolytic subunit [Prinsepia utilis]
 gb|AGL94724.1| clp protease proteolytic subunit [Prinsepia utilis]
Length=195

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL Q ID+EI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQGIDNEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP + T+C+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDIQTVCMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LK+RE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKMRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  187



>ref|YP_008575138.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus obliqua]
 ref|YP_008575223.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus radiata]
 ref|YP_008575308.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus delegatensis]
 gb|AGC56377.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus obliqua]
 gb|AGC56462.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus radiata]
 gb|AGC56547.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus delegatensis]
Length=196

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+D KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDNKDLYLFINSPGGWVIPGVAIYDAM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>gb|AGM14961.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Panax ginseng]
 gb|AGM15047.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Panax ginseng]
 gb|AGM15133.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Panax ginseng]
 gb|AGW31894.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Panax ginseng]
Length=195

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             INRLYRER LFL Q + SEI+NQ++GL+VYL+IEDDTKD++L++NSPGG V+ G+AIYD 
Sbjct  23    INRLYRERLLFLGQPVASEISNQLIGLMVYLSIEDDTKDLYLFMNSPGGWVLPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDVHTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFVLE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE I  +Y Q+TG P  ++S D++RDVF SA +A+ YG
Sbjct  143   AEELLKLRETITRVYVQKTGKPFWVVSEDLERDVFMSATEAQAYG  187



>ref|YP_636324.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus globulus subsp. globulus]
 ref|YP_008576583.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus nitens]
 ref|YP_008576668.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus aromaphloia]
 ref|YP_008576753.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus saligna]
 ref|YP_008576838.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus camaldulensis]
 ref|YP_008577433.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus guilfoylei]
 sp|Q49KX3.1|CLPP_EUCGG RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Eucalyptus globulus 
subsp. globulus]
 gb|AAX21052.1| photosystem II CP47 chlorophyll apoprotein (chloroplast) [Eucalyptus 
globulus subsp. globulus]
 gb|AGC57907.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus globulus]
 gb|AGC57992.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus nitens]
 gb|AGC58077.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus aromaphloia]
 gb|AGC58162.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus saligna]
 gb|AGC58247.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus camaldulensis]
 gb|AGC58842.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus guilfoylei]
Length=196

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+D KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDNKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSF+L GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFVLVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_008577518.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus erythrocorys]
 gb|AGC58927.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus erythrocorys]
Length=196

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+D KD++L+INSPGG VI GVA+YD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDNKDLYLFINSPGGWVIPGVAVYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_740227.1| clp protease proteolytic subunit [Liriodendron tulipifera]
 sp|Q0G9J4.1|CLPP_LIRTU RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Liriodendron 
tulipifera]
 gb|ABI32534.1| clp protease proteolytic subunit [Liriodendron tulipifera]
Length=202

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             + NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G++IYD
Sbjct  23    VFNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGISIYD  82

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +L
Sbjct  83    TMQFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAPTGEFIL  142

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   EAEELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSAAEAQAHG  188



>gb|AIW05412.1| Clp protease proteolytic subunit [Epigynum auritum]
Length=196

 Score =   218 bits (554),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q +DSEI+NQ++GL++YL+IEDD KD++L+INSPGG VI GVAIYD M
Sbjct  25    NRLYRERLLFLGQAVDSEISNQLIGLMIYLSIEDDNKDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V T+C+GLAASMGSFIL GG IT+R AFPHARVM+HQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTVCMGLAASMGSFILVGGEITKRLAFPHARVMMHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>ref|YP_009109022.1| clp protease proteolytic subunit [Corallorhiza macrantha]
 gb|AIW51490.1| clp protease proteolytic subunit [Corallorhiza macrantha]
Length=204

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q++  EI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQQVGCEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDAM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AG+ +LE 
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGDFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_009000358.1| clpP protein (chloroplast) [Arabis alpina]
 emb|CCW28205.1| clpP protein (chloroplast) [Arabis alpina]
Length=196

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             LINRLYRER  FL QE+D+EI+NQ++ L++YL+IE DTKD++L+INSPGG VISG+AIYD
Sbjct  23    LINRLYRERLFFLGQEVDTEISNQLISLMIYLSIEKDTKDLYLFINSPGGWVISGMAIYD  82

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ VRP V TIC+GLAAS+ SFIL GGAIT+R AFPHARVMIHQP +SF+E+  GE +L
Sbjct  83    TMQFVRPDVQTICMGLAASIASFILVGGAITKRIAFPHARVMIHQPASSFYEAQTGEFIL  142

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LK+RE + ++Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   EAEELLKIRETVTKVYVQRTGKPIWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_784411.1| clp protease proteolytic subunit [Drimys granadensis]
 sp|Q06GX2.1|CLPP_DRIGR RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Drimys granadensis]
 gb|ABH88321.1| clp protease proteolytic subunit [Drimys granadensis]
Length=202

 Score =   218 bits (555),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAPTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>gb|ADD31113.1| clp protease proteolytic subunit protein (chloroplast) [Cornus 
florida]
Length=196

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI G+AI+D M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIFDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+G+AASMGSFIL GG IT+R AFPHARVMIHQP ++++E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGMAASMGSFILVGGEITKRLAFPHARVMIHQPASAYYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  188



>gb|AHA13207.1| clp protease proteolytic subunit [Thaumatococcus daniellii]
Length=204

 Score =   218 bits (555),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E L+LRE + ++Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLRLRETLTKVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_004842263.1| clp protease proteolytic subunit [Pyrus pyrifolia]
 ref|YP_008965517.1| clp protease proteolytic subunit [Pyrus spinosa]
 dbj|BAK69407.1| clp protease proteolytic subunit [Pyrus pyrifolia]
 emb|CDI73589.1| clp protease proteolytic subunit [Pyrus spinosa]
Length=195

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             I RLYRER LFL Q +DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    IYRLYRERLLFLGQGVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP + TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVRPDIQTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETVTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  187



>ref|YP_740590.1| clp protease proteolytic subunit [Platanus occidentalis]
 sp|Q09G21.1|CLPP_PLAOC RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Platanus occidentalis]
 gb|ABI49804.1| clp protease proteolytic subunit [Platanus occidentalis]
Length=202

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ++GL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_004021341.1| clp protease proteolytic subunit [Theobroma cacao]
 gb|ADO64834.1| clp protease proteolytic subunit [Theobroma cacao]
 gb|ADO64915.2| clp protease proteolytic subunit [Theobroma cacao]
 gb|AEX57751.1| clp protease proteolytic subunit (chloroplast) [Theobroma cacao]
 gb|AEX57832.1| clp protease proteolytic subunit (chloroplast) [Theobroma cacao]
 gb|AEX57913.1| clp protease proteolytic subunit (chloroplast) [Theobroma cacao]
 gb|AEX57994.1| clp protease proteolytic subunit (chloroplast) [Theobroma cacao]
 gb|AEX58075.1| clp protease proteolytic subunit (chloroplast) [Theobroma cacao]
 gb|AEX58156.1| clp protease proteolytic subunit (chloroplast) [Theobroma cacao]
 gb|AEX58237.1| clp protease proteolytic subunit (chloroplast) [Theobroma cacao]
 gb|AEX58318.1| clp protease proteolytic subunit (chloroplast) [Theobroma cacao]
 gb|AEX58399.1| clp protease proteolytic subunit (chloroplast) [Theobroma cacao]
 gb|AEX58561.1| clp protease proteolytic subunit (chloroplast) [Theobroma cacao]
Length=196

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+DTK+++L+INSPGG +I GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDTKELYLFINSPGGWIIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RD+F SA +A+ +G
Sbjct  145   EELLKLRETITRVYVQRTGKPLWVVSEDMERDIFMSATEAQAHG  188



>ref|YP_009108522.1| proteolytic subunit of the Clp protease (chloroplast) [Utricularia 
macrorhiza]
 emb|CDL78760.1| proteolytic subunit of the Clp protease (chloroplast) [Utricularia 
macrorhiza]
Length=196

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLY ER LFL QE+DSEI+NQ++GL++YL++ED+TK+++L+INSPGG V+ G+AIYD M
Sbjct  25    NRLYHERLLFLGQEVDSEISNQLLGLMIYLSLEDNTKNLYLFINSPGGWVVPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPEVHTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  145   EELLKLREILTRVYVQRTGKPLWVVSEDMERDVFMSANEAQAYG  188



>ref|YP_009109229.1| clp protease proteolytic subunit [Corallorhiza wisteriana]
 gb|AIW51697.1| clp protease proteolytic subunit [Corallorhiza wisteriana]
Length=207

 Score =   218 bits (555),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q + SEI+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQPVGSEISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDAM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TICIGLAASMGSFIL GG IT+R AFPHARVMIHQP + F+E+ AGE +LE 
Sbjct  85    QFVSPDVHTICIGLAASMGSFILVGGEITKRLAFPHARVMIHQPASYFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_004563892.1| clp protease proteolytic subunit [Nelumbo lutea]
 gb|ACN49349.1| clp protease proteolytic subunit [Nelumbo lutea]
 gb|AFH01565.1| clp protease proteolytic subunit (chloroplast) [Nelumbo lutea]
Length=202

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHA-RVMIHQPRTSFFESHAGelll  1265
             MQ V P V TIC+GLAASMGSFILAGG IT+R AFPHA RVMIHQP +SF+E+  GE +L
Sbjct  83    MQFVPPDVHTICMGLAASMGSFILAGGEITKRLAFPHAWRVMIHQPASSFYEAQTGEFIL  142

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  143   EAEELLKLRETLTRVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_008081482.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Trochodendron aralioides]
 gb|ADD31123.1| clp protease proteolytic subunit protein (chloroplast) [Trochodendron 
aralioides]
 gb|AGJ72174.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Trochodendron aralioides]
Length=202

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL Q++DSEI+NQ++GL+VYL+IEDDT+D++L+INSPGG VI GVAIYD M
Sbjct  25    NRLHRERLLFLGQDVDSEISNQLIGLMVYLSIEDDTRDLYLFINSPGGWVIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETITRVYVQRTGNPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_001294209.1| clp protease proteolytic subunit [Buxus microphylla]
 sp|A6MM61.1|CLPP_BUXMI RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Buxus microphylla]
 gb|ABQ45273.1| clp protease proteolytic subunit [Buxus microphylla]
Length=202

 Score =   217 bits (553),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RER LFL QE+DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHRERLLFLGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P + TIC+GLAASMGSF+L GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVPPDIHTICMGLAASMGSFLLVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE +  +Y QRTGNP  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETVTRVYVQRTGNPLWVVSEDMERDVFMSAIEAQAHG  188



>ref|YP_006073129.1| clp protease proteolytic subunit (chloroplast) [Elaeis guineensis]
 gb|ADZ10893.1| clp protease proteolytic subunit (chloroplast) [Elaeis guineensis]
Length=204

 Score =   217 bits (553),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRL+RE  LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLHREGLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TIC+GLAASMGSFIL GG IT+R A PHARVMIHQP +SF+E+ AGE +LE 
Sbjct  85    QFVPPDVHTICMGLAASMGSFILVGGEITKRLALPHARVMIHQPASSFYEAQAGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  ++S DM+RDVF SA +A+++G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVVSEDMERDVFMSATEAQVHG  188



>ref|YP_008963626.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Lupinus luteus]
 gb|AGK82939.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Lupinus luteus]
Length=196

 Score =   217 bits (552),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+D EI+NQ++GL+VYL+IEDD +D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDGEISNQLIGLMVYLSIEDDNQDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V T+C+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVQTVCMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   QELLKLRETITRVYVQRTGKPLWLVSEDMERDVFMSAAEAQAHG  188



>gb|AIW51358.1| clp protease proteolytic subunit [Corallorhiza maculata var. 
mexicana]
Length=207

 Score =   218 bits (554),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q++  +I+NQ+VGL+VYL+IEDDTKD++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQQVGCDISNQLVGLMVYLSIEDDTKDLYLFINSPGGWVIPGIAIYDAM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V P V TICIGLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AG+ +LE 
Sbjct  85    QFVSPDVHTICIGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGDFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  188



>ref|YP_008577263.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus salmonophloia]
 gb|AGC58672.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Eucalyptus salmonophloia]
Length=196

 Score =   217 bits (552),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+D KD++L+INSPGG +I GVAIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDNKDLYLFINSPGGWIIPGVAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q V+P V TIC+GLAASMGSF+L GG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVQPDVHTICMGLAASMGSFVLVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  145   EELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>ref|YP_008963330.1| clp protease proteolytic subunit [Camellia oleifera]
 ref|YP_009050613.1| clp protease proteolytic subunit (chloroplast) [Camellia grandibracteata]
 ref|YP_009050700.1| clp protease proteolytic subunit (chloroplast) [Camellia leptophylla]
 ref|YP_009050787.1| clp protease proteolytic subunit (chloroplast) [Camellia petelotii]
 ref|YP_009050874.1| clp protease proteolytic subunit (chloroplast) [Camellia pubicosta]
 ref|YP_009050961.1| clp protease proteolytic subunit (chloroplast) [Camellia reticulata]
 gb|AFK81323.1| clp protease proteolytic subunit [Camellia sinensis var. assamica]
 gb|AFK81410.1| clp protease proteolytic subunit [Camellia oleifera]
 gb|AFK81497.1| clp protease proteolytic subunit [Camellia taliensis]
 gb|AIG61277.1| clp protease proteolytic subunit (chloroplast) [Camellia grandibracteata]
 gb|AIG61364.1| clp protease proteolytic subunit (chloroplast) [Camellia leptophylla]
 gb|AIG61451.1| clp protease proteolytic subunit (chloroplast) [Camellia petelotii]
 gb|AIG61538.1| clp protease proteolytic subunit (chloroplast) [Camellia pubicosta]
 gb|AIG61625.1| clp protease proteolytic subunit (chloroplast) [Camellia reticulata]
 gb|AIG61713.1| clp protease proteolytic subunit (chloroplast) [Camellia sinensis 
var. dehungensis]
 gb|AIG61800.1| clp protease proteolytic subunit (chloroplast) [Camellia sinensis 
var. pubilimba]
 gb|AIG61887.1| clp protease proteolytic subunit (chloroplast) [Camellia sinensis 
var. sinensis]
Length=195

 Score =   217 bits (552),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             + RLYRER LFL Q +DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VYRLYRERLLFLGQGVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V+P V TIC+GLAASMGSF+L GG IT+R AFPHARVMIHQP +SF+E+  GE +LE
Sbjct  83    MQFVQPDVHTICMGLAASMGSFLLVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLRETLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAYG  187



>ref|YP_004286029.1| clp protease proteolytic subunit [Gossypium thurberi]
 ref|YP_008992489.1| clp protease proteolytic subunit (chloroplast) [Gossypium anomalum]
 ref|YP_008992575.1| clp protease proteolytic subunit (chloroplast) [Gossypium bickii]
 ref|YP_008992920.1| clp protease proteolytic subunit (chloroplast) [Gossypium sturtianum]
 ref|YP_008992662.1| clp protease proteolytic subunit (chloroplast) [Gossypium herbaceum]
 ref|YP_008992748.1| clp protease proteolytic subunit (chloroplast) [Gossypium longicalyx]
 ref|YP_008992834.1| clp protease proteolytic subunit (chloroplast) [Gossypium stocksii]
 gb|ADD62343.1| clp protease proteolytic subunit [Gossypium thurberi]
 gb|ADZ74328.1| clp protease proteolytic subunit [Gossypium anomalum]
 gb|ADZ74415.1| clp protease proteolytic subunit [Gossypium bickii]
 gb|ADZ74502.1| clp protease proteolytic subunit [Gossypium herbaceum]
 gb|ADZ74622.1| clp protease proteolytic subunit [Gossypium longicalyx]
 gb|ADZ74673.1| clp protease proteolytic subunit [Gossypium stocksii]
 gb|ADZ74760.1| clp protease proteolytic subunit [Gossypium sturtianum]
Length=196

 Score =   217 bits (552),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ++GL+VYL+IE+DTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLIGLMVYLSIENDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHA-RVMIHQPRTSFFESHAGelll  1265
             MQ V+P V TIC+GLAASMGSF+LAGG IT+R AFPHA RVMIHQP +SF+E+  GE +L
Sbjct  83    MQFVQPDVHTICMGLAASMGSFLLAGGEITKRLAFPHARRVMIHQPASSFYEAQTGEFIL  142

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE +  +Y QRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   EAEELLKLRESLTRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHG  188



>gb|AEX96572.1| clp protease proteolytic subunit (chloroplast) [Calibanus hookeri]
Length=210

 Score =   217 bits (553),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 138/170 (81%), Gaps = 6/170 (4%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IEDDT+D++L+INSPGG VI G+AIYD M
Sbjct  25    NRLYRERLLFLGQEVDSEISNQLVGLMVYLSIEDDTRDLYLFINSPGGWVIPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHA------RVMIHQPRTSFFESHAG  1253
             Q V P V TIC+GLAASMGSFIL GG IT+R AFPHA      RVMIHQP +SF+E+ AG
Sbjct  85    QFVSPDVHTICMGLAASMGSFILVGGEITKRLAFPHAMLYQYIRVMIHQPASSFYEAQAG  144

Query  1254  elllemkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +LE +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  145   EFILEAEELLKLRETLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  194



>ref|YP_004021690.1| clp protease proteolytic subunit [Prunus persica]
 ref|YP_009024706.1| clp protease proteolytic subunit (chloroplast) [Prunus kansuensis]
 gb|ADO65000.1| clp protease proteolytic subunit [Prunus persica]
 gb|AHN13601.1| clp protease proteolytic subunit (chloroplast) [Prunus kansuensis]
Length=195

 Score =   217 bits (552),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             + RLYRER LFL Q +DSEI+NQ++GL+VYL+IEDDTKD++L+INSPGG VI GVAIYD 
Sbjct  23    VYRLYRERLLFLGQGVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP + TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP  SF+E+  GE +LE
Sbjct  83    MQFVRPDIQTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPAASFYEAQTGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +YAQRTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTRVYAQRTGKPLWVVSEDMERDVFMSAIEAQAHG  187



>gb|AEZ48913.1| clp protease proteolytic subunit, partial [Belosynapsis ciliata]
Length=195

 Score =   217 bits (552),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRLYRER LFL QE+DSEI+NQ+VGL+VYL+IE+DT+D++L+INSPGG VI G+AIYD 
Sbjct  23    VNRLYRERLLFLGQEVDSEISNQLVGLMVYLSIENDTRDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ V P V T+C+G+AASMGS IL GGAIT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MQFVPPDVHTVCVGMAASMGSIILVGGAITKRLAFPHARVMIHQPASSFYEAQAGEFVLE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  IY +RTG P  ++S DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRETLTSIYVERTGKPLWVVSEDMERDVFMSAIEAQAHG  187



>ref|YP_762286.1| clp protease proteolytic subunit [Morus indica]
 ref|YP_009110361.1| clp protease proteolytic subunit (chloroplast) [Morus mongolica]
 sp|Q09WZ2.1|CLPP_MORIN RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Morus indica]
 gb|ABB20982.1| clp protease proteolytic subunit [Morus indica]
 gb|AIX11686.1| clp protease proteolytic subunit (chloroplast) [Morus mongolica]
Length=196

 Score =   217 bits (552),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +3

Query  906   LINRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYD  1085
             +INRLYRER LFL QE+DSEI+NQ++GL+V+L+IEDDTKD++L+INSPGG VI G+ IYD
Sbjct  23    VINRLYRERLLFLGQEVDSEISNQLIGLMVFLSIEDDTKDLYLFINSPGGWVIPGLGIYD  82

Query  1086  MMQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelll  1265
              MQ V+P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+  GE +L
Sbjct  83    TMQFVQPDVQTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQTGEFIL  142

Query  1266  emkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             E +E LKLRE I  +Y QRTG    +IS DM+RDVF SA +A+ +G
Sbjct  143   EAEELLKLRETITRVYVQRTGKSLWVISEDMERDVFMSATEAQAHG  188



>sp|P56772.2|CLPP1_ARATH RecName: Full=ATP-dependent Clp protease proteolytic subunit 
1; AltName: Full=Endopeptidase ClpP1; Short=pClpP (chloroplast) 
[Arabidopsis thaliana]
Length=196

 Score =   217 bits (552),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER  FL QE+D+EI+NQ++ L++YL+IE DTKD++L+INSPGG VISG+AIYD M
Sbjct  25    NRLYRERLFFLGQEVDTEISNQLISLMIYLSIEKDTKDLYLFINSPGGWVISGMAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAAS+ SFIL GGAIT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVQTICMGLAASIASFILVGGAITKRIAFPHARVMIHQPASSFYEAQTGEFILEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y QRTG P  +IS DM+RDVF SA +A+ YG
Sbjct  145   EELLKLRETITRVYVQRTGKPIWVISEDMERDVFMSATEAQAYG  188



>ref|YP_009027912.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
(chloroplast) [Hirtella racemosa]
 ref|YP_009028410.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Hirtella physophora]
 gb|AHX80619.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Hirtella racemosa]
 gb|AHX81117.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Hirtella physophora]
Length=195

 Score =   216 bits (551),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             INRLYRER LFL Q++DSEI+NQ++GL+VYL+IE +TKD++L+INSPGG VI G+AIYD 
Sbjct  23    INRLYRERLLFLGQDVDSEISNQLIGLMVYLSIESETKDLYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             MQ VRP V T+C+GLAASMGSFIL GG IT+R AFPHARVMIHQP   F+E+ A E +LE
Sbjct  83    MQFVRPDVQTVCMGLAASMGSFILVGGQITKRLAFPHARVMIHQPIAGFYEAQAREFVLE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE +  +YAQRTG P  ++S DM+RDVF SA +A+ YG
Sbjct  143   AEELLKLREILTRVYAQRTGKPLWVVSEDMERDVFMSATEAKAYG  187



>ref|YP_008994098.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Fritillaria taipaiensis]
 ref|YP_009053795.1| clp protease proteolytic subunit (chloroplast) [Fritillaria cirrhosa]
 gb|AGI51270.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Fritillaria taipaiensis]
 gb|AGL80031.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Fritillaria taipaiensis]
 gb|AGL80116.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Fritillaria taipaiensis]
 gb|AHH29752.1| clp protease proteolytic subunit (chloroplast) [Fritillaria unibracteata 
var. wabuensis]
 gb|AHH29836.1| clp protease proteolytic subunit (chloroplast) [Fritillaria cirrhosa]
 gb|AHH29920.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) 
[Fritillaria taipaiensis]
Length=203

 Score =   217 bits (552),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  909   INRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDM  1088
             +NRL+RER LFL QE+DSEI+NQ+VGL+VYL+IED+T+D +L+INSPGG VI G+AIYD 
Sbjct  23    VNRLHRERLLFLGQEVDSEISNQLVGLMVYLSIEDNTRDFYLFINSPGGWVIPGIAIYDT  82

Query  1089  MQTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGellle  1268
             M  V P V TIC+GLAASMGSFIL GG IT+R AFPHARVMIHQP +SF+E+ AGE +LE
Sbjct  83    MLFVPPDVHTICMGLAASMGSFILVGGEITKRLAFPHARVMIHQPASSFYEAQAGEFILE  142

Query  1269  mkealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
              +E LKLRE + ++Y QRTGNP  +IS DM+RDVF SA +A+ +G
Sbjct  143   AEELLKLRENLTKVYVQRTGNPLWVISEDMERDVFMSATEAQAHG  187



>ref|YP_086990.1| ATP-dependent Clp protease proteolytic subunit [Panax ginseng]
 sp|Q68RY2.1|CLPP_PANGI RecName: Full=ATP-dependent Clp protease proteolytic subunit; 
AltName: Full=Endopeptidase Clp (chloroplast) [Panax ginseng]
 gb|AAT98533.1| ATP-dependent protease; catalytic subunit [Panax ginseng]
Length=196

 Score =   216 bits (550),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  912   NRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDDTKDIFLYINSPGGDVISGVAIYDMM  1091
             NRLYRER LFL Q + SEI+NQ++GL+VYL+IEDDTKD++L++NSPGG V+ G+AIYD M
Sbjct  25    NRLYRERLLFLGQPVASEISNQLIGLMVYLSIEDDTKDLYLFMNSPGGWVLPGIAIYDTM  84

Query  1092  QTVRPGVSTICIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGelllem  1271
             Q VRP V TIC+GLAASMGSFILAGG IT+R AFPHARVMIHQP +SF+E+  GE +LE 
Sbjct  85    QFVRPDVHTICMGLAASMGSFILAGGEITKRLAFPHARVMIHQPASSFYEAQTGEFVLEA  144

Query  1272  kealklrerIAEIYAQRTGNPTSIISRDMDRDVFFSARQARIYG  1403
             +E LKLRE I  +Y Q+TG P  ++S D++RDVF SA +A+ YG
Sbjct  145   EELLKLRETITRVYVQKTGKPFWVVSEDLERDVFMSATEAQAYG  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 14119226630928