BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22794_g2_i1 len=744 path=[2866:0-237 3104:238-743]

Length=744
                                                                      Score     E

ref|XP_004233607.1|  PREDICTED: probable esterase KAI2                  272   2e-87   
ref|XP_009783363.1|  PREDICTED: probable esterase KAI2                  270   1e-86   
ref|XP_006339830.1|  PREDICTED: probable esterase KAI2-like             269   5e-86   
ref|XP_009590442.1|  PREDICTED: probable esterase KAI2                  268   7e-86   
gb|EPS71370.1|  hypothetical protein M569_03387                         265   7e-85   
ref|XP_006364428.1|  PREDICTED: probable esterase KAI2-like             265   1e-84   
gb|EYU34543.1|  hypothetical protein MIMGU_mgv1a008430mg                268   2e-84   
ref|XP_011097235.1|  PREDICTED: probable esterase KAI2                  265   2e-84   
ref|XP_009627573.1|  PREDICTED: probable esterase KAI2                  257   1e-81   
ref|XP_010272478.1|  PREDICTED: probable strigolactone esterase DAD2    255   9e-81   
gb|ABK95280.1|  unknown                                                 251   1e-80   Populus trichocarpa [western balsam poplar]
ref|XP_007018509.1|  Alpha/beta-Hydrolases superfamily protein          253   5e-80   
emb|CBI19405.3|  unnamed protein product                                248   1e-79   
ref|XP_010248100.1|  PREDICTED: probable strigolactone esterase DAD2    251   3e-79   
ref|XP_009102099.1|  PREDICTED: probable strigolactone esterase D...    251   3e-79   
emb|CDP02567.1|  unnamed protein product                                249   1e-78   
sp|J9U5U9.1|DAD2_PETHY  RecName: Full=Probable strigolactone este...    249   1e-78   
ref|XP_002302409.1|  esterase/lipase/thioesterase family protein        249   1e-78   Populus trichocarpa [western balsam poplar]
ref|XP_011017119.1|  PREDICTED: probable strigolactone esterase DAD2    249   1e-78   
pdb|4DNQ|A  Chain A, Crystal Structure Of Dad2 S96a Mutant              249   2e-78   
pdb|4DNP|A  Chain A, Crystal Structure Of Dad2                          249   2e-78   
ref|XP_010556448.1|  PREDICTED: probable strigolactone esterase D...    249   2e-78   
ref|XP_010664515.1|  PREDICTED: probable strigolactone esterase DAD2    248   3e-78   
ref|XP_009773538.1|  PREDICTED: probable strigolactone esterase DAD2    248   3e-78   
ref|XP_009405896.1|  PREDICTED: probable strigolactone esterase DAD2    248   9e-78   
ref|XP_002510101.1|  sigma factor sigb regulation protein rsbq, p...    247   2e-77   Ricinus communis
ref|XP_004238093.1|  PREDICTED: probable strigolactone esterase DAD2    246   2e-77   
ref|XP_002320690.1|  esterase/lipase/thioesterase family protein        246   2e-77   Populus trichocarpa [western balsam poplar]
ref|XP_007047454.1|  Alpha/beta-Hydrolases superfamily protein          246   2e-77   
ref|XP_010679577.1|  PREDICTED: probable esterase D14L                  246   3e-77   
ref|XP_010060150.1|  PREDICTED: probable strigolactone esterase DAD2    246   4e-77   
ref|XP_006408233.1|  hypothetical protein EUTSA_v10021292mg             246   4e-77   
ref|XP_006601267.1|  PREDICTED: probable strigolactone esterase D...    246   4e-77   
ref|XP_006433632.1|  hypothetical protein CICLE_v10002180mg             246   4e-77   
gb|KFK37836.1|  hypothetical protein AALP_AA3G035500                    246   4e-77   
ref|XP_010091241.1|  hypothetical protein L484_005265                   245   5e-77   
ref|XP_004509088.1|  PREDICTED: probable esterase D14L-like             245   6e-77   
ref|XP_008220326.1|  PREDICTED: probable strigolactone esterase DAD2    245   7e-77   
gb|KDP41626.1|  hypothetical protein JCGZ_16033                         244   1e-76   
ref|XP_006472297.1|  PREDICTED: probable strigolactone esterase D...    244   1e-76   
ref|XP_007222998.1|  hypothetical protein PRUPE_ppa010005mg             244   1e-76   
ref|XP_004287973.1|  PREDICTED: sigma factor SigB regulation prot...    244   1e-76   
ref|XP_011074357.1|  PREDICTED: probable strigolactone esterase DAD2    244   1e-76   
ref|XP_010999869.1|  PREDICTED: probable strigolactone esterase DAD2    244   2e-76   
emb|CDP01202.1|  unnamed protein product                                244   2e-76   
ref|XP_009597842.1|  PREDICTED: probable strigolactone esterase DAD2    244   2e-76   
ref|XP_008787185.1|  PREDICTED: probable strigolactone esterase D14     244   3e-76   
ref|XP_006829226.1|  hypothetical protein AMTR_s00001p00272350          243   3e-76   
ref|XP_003557012.1|  PREDICTED: probable strigolactone esterase D...    243   3e-76   
gb|AFK34773.1|  unknown                                                 243   4e-76   
gb|KHG16187.1|  Sigma factor sigB regulation rsbQ                       243   4e-76   
ref|XP_002882324.1|  esterase/lipase/thioesterase family protein        243   4e-76   
ref|XP_009354089.1|  PREDICTED: probable strigolactone esterase DAD2    243   4e-76   
ref|XP_007160910.1|  hypothetical protein PHAVU_001G027400g             243   5e-76   
ref|XP_008362739.1|  PREDICTED: probable strigolactone esterase DAD2    243   5e-76   
ref|XP_009130408.1|  PREDICTED: probable strigolactone esterase D...    243   6e-76   
ref|XP_003562367.1|  PREDICTED: probable esterase D14L                  243   8e-76   
ref|XP_008805678.1|  PREDICTED: probable strigolactone esterase DAD2    243   8e-76   
ref|XP_004498996.1|  PREDICTED: probable strigolactone esterase D...    242   9e-76   
emb|CDY42894.1|  BnaC05g47570D                                          244   1e-75   
ref|NP_001132725.1|  Sigma factor sigB regulation protein rsbQ          242   1e-75   Zea mays [maize]
ref|XP_002524966.1|  sigma factor sigb regulation protein rsbq, p...    242   1e-75   Ricinus communis
gb|KDP32035.1|  hypothetical protein JCGZ_12496                         242   1e-75   
ref|XP_010271812.1|  PREDICTED: probable esterase D14L                  242   1e-75   
ref|XP_010517275.1|  PREDICTED: probable strigolactone esterase D...    241   2e-75   
ref|XP_008362748.1|  PREDICTED: probable strigolactone esterase DAD2    241   2e-75   
ref|XP_002465088.1|  hypothetical protein SORBIDRAFT_01g031880          242   2e-75   Sorghum bicolor [broomcorn]
gb|AAM65892.1|  unknown                                                 241   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149700.1|  PREDICTED: sigma factor SigB regulation prot...    241   2e-75   
ref|XP_007205717.1|  hypothetical protein PRUPE_ppa009957mg             241   2e-75   
ref|XP_006296725.1|  hypothetical protein CARUB_v10014401mg             241   2e-75   
ref|XP_003589086.1|  Sigma factor sigB regulation protein rsbQ          241   2e-75   
ref|NP_566220.1|  putative strigolactone esterase D14                   241   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009342785.1|  PREDICTED: probable esterase KAI2                  241   3e-75   
ref|XP_006849318.1|  hypothetical protein AMTR_s00164p00017630          241   3e-75   
ref|XP_006380654.1|  hydrolase family protein                           241   3e-75   
ref|XP_010463870.1|  PREDICTED: probable strigolactone esterase D...    241   3e-75   
ref|XP_011006779.1|  PREDICTED: probable esterase KAI2                  241   3e-75   
ref|XP_009614275.1|  PREDICTED: probable esterase KAI2                  241   4e-75   
ref|XP_008457773.1|  PREDICTED: probable esterase KAI2                  241   4e-75   
ref|XP_009421091.1|  PREDICTED: probable esterase D14L                  241   5e-75   
ref|XP_003550307.1|  PREDICTED: probable strigolactone esterase D...    240   5e-75   
ref|XP_009354090.1|  PREDICTED: probable strigolactone esterase DAD2    240   5e-75   
ref|XP_003608457.1|  Sigma factor sigB regulation protein rsbQ          240   7e-75   
gb|ABR18336.1|  unknown                                                 240   8e-75   Picea sitchensis
ref|NP_001050445.1|  Os03g0437600                                       239   1e-74   Oryza sativa Japonica Group [Japonica rice]
gb|AFK41000.1|  unknown                                                 239   1e-74   
ref|XP_009587492.1|  PREDICTED: probable esterase D14L                  239   1e-74   
gb|ACN33568.1|  unknown                                                 239   1e-74   Zea mays [maize]
ref|NP_001151350.1|  sigma factor sigB regulation protein rsbQ          239   1e-74   Zea mays [maize]
ref|XP_010942800.1|  PREDICTED: probable strigolactone esterase DAD2    239   2e-74   
ref|XP_003539309.1|  PREDICTED: probable esterase KAI2-like             239   3e-74   
ref|XP_010277133.1|  PREDICTED: probable esterase D14L                  238   3e-74   
ref|XP_006339831.1|  PREDICTED: probable esterase KAI2-like             238   3e-74   
ref|XP_002284043.1|  PREDICTED: probable esterase KAI2                  238   3e-74   Vitis vinifera
gb|AFK40527.1|  unknown                                                 238   3e-74   
ref|XP_008238450.1|  PREDICTED: probable esterase KAI2                  238   3e-74   
ref|XP_004231894.1|  PREDICTED: probable esterase KAI2                  238   4e-74   
gb|EYU44459.1|  hypothetical protein MIMGU_mgv1a011843mg                238   4e-74   
ref|XP_011008514.1|  PREDICTED: probable esterase KAI2                  238   5e-74   
ref|XP_010938958.1|  PREDICTED: probable strigolactone esterase DAD2    238   9e-74   
ref|XP_002307293.1|  hydrolase family protein                           237   1e-73   Populus trichocarpa [western balsam poplar]
ref|XP_010531272.1|  PREDICTED: probable esterase KAI2 isoform X1       237   1e-73   
ref|XP_004983951.1|  PREDICTED: probable esterase D14L-like             236   2e-73   
dbj|BAJ95075.1|  predicted protein                                      236   2e-73   
dbj|BAJ95275.1|  predicted protein                                      236   2e-73   
ref|XP_009360639.1|  PREDICTED: probable strigolactone esterase DAD2    236   2e-73   
ref|XP_003524676.1|  PREDICTED: probable esterase D14L-like             236   2e-73   
ref|XP_003517326.1|  PREDICTED: probable esterase KAI2-like             236   2e-73   
ref|XP_008444562.1|  PREDICTED: probable strigolactone esterase D...    236   3e-73   
ref|XP_004142890.1|  PREDICTED: sigma factor SigB regulation prot...    236   3e-73   
ref|XP_006650237.1|  PREDICTED: probable esterase D14L-like             236   4e-73   
ref|XP_008367645.1|  PREDICTED: probable strigolactone esterase DAD2    235   4e-73   
ref|XP_010905263.1|  PREDICTED: probable esterase D14L                  235   5e-73   
ref|XP_006426038.1|  hypothetical protein CICLE_v10026274mg             235   5e-73   
ref|XP_010070624.1|  PREDICTED: probable esterase KAI2                  235   6e-73   
gb|EYU31294.1|  hypothetical protein MIMGU_mgv1a027102mg                235   7e-73   
ref|XP_008441109.1|  PREDICTED: probable esterase D14L                  235   7e-73   
ref|XP_010688104.1|  PREDICTED: probable strigolactone esterase DAD2    235   9e-73   
ref|XP_004290965.1|  PREDICTED: sigma factor SigB regulation prot...    233   2e-72   
ref|XP_007155860.1|  hypothetical protein PHAVU_003G237900g             234   2e-72   
gb|EPS65751.1|  hypothetical protein M569_09023                         233   3e-72   
gb|KFK30366.1|  hypothetical protein AALP_AA7G251900                    233   4e-72   
ref|XP_003550985.1|  PREDICTED: probable esterase D14L-like             233   4e-72   
ref|XP_009138495.1|  PREDICTED: probable esterase KAI2                  233   4e-72   
ref|XP_009142941.1|  PREDICTED: probable esterase KAI2                  233   4e-72   
emb|CDX79820.1|  BnaA05g03360D                                          233   4e-72   
ref|XP_009342786.1|  PREDICTED: probable esterase KAI2                  233   4e-72   
ref|XP_003550024.1|  PREDICTED: probable esterase KAI2-like             233   6e-72   
ref|XP_010061678.1|  PREDICTED: probable strigolactone esterase D...    232   6e-72   
ref|XP_006466507.1|  PREDICTED: probable esterase KAI2-like             232   8e-72   
ref|XP_004511872.1|  PREDICTED: probable esterase D14L-like             233   8e-72   
ref|XP_009403750.1|  PREDICTED: probable strigolactone esterase DAD2    233   8e-72   
ref|XP_006411882.1|  hypothetical protein EUTSA_v10025969mg             232   9e-72   
emb|CDY44038.1|  BnaA08g15680D                                          232   1e-71   
emb|CDY29553.1|  BnaA03g53980D                                          233   1e-71   
ref|XP_009109374.1|  PREDICTED: probable esterase KAI2                  232   1e-71   
ref|XP_003597120.1|  Sigma factor sigB regulation protein rsbQ          233   1e-71   
ref|XP_008787141.1|  PREDICTED: LOW QUALITY PROTEIN: probable est...    232   1e-71   
gb|ACJ85126.1|  unknown                                                 233   1e-71   Medicago truncatula
emb|CDY22426.1|  BnaC03g61390D                                          231   2e-71   
ref|XP_009761984.1|  PREDICTED: probable esterase KAI2                  231   2e-71   
ref|XP_004141889.1|  PREDICTED: sigma factor SigB regulation prot...    231   2e-71   
gb|EPS64213.1|  hydrolase, alpha/beta fold family protein               231   2e-71   
ref|XP_007156746.1|  hypothetical protein PHAVU_002G013800g             231   2e-71   
emb|CDY17923.1|  BnaC04g02960D                                          231   3e-71   
ref|XP_006284314.1|  hypothetical protein CARUB_v10005485mg             231   3e-71   
ref|XP_002866945.1|  hypothetical protein ARALYDRAFT_912591             231   3e-71   
ref|XP_008340844.1|  PREDICTED: probable esterase KAI2                  230   4e-71   
gb|EYU44463.1|  hypothetical protein MIMGU_mgv1a011794mg                230   4e-71   
emb|CDP02566.1|  unnamed protein product                                230   6e-71   
ref|XP_007155857.1|  hypothetical protein PHAVU_003G237600g             230   6e-71   
ref|XP_008660429.1|  PREDICTED: probable strigolactone esterase D14     231   7e-71   
ref|NP_195463.1|  probable esterase KAI2                                229   8e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009386270.1|  PREDICTED: probable strigolactone esterase DAD2    230   8e-71   
ref|XP_004985292.1|  PREDICTED: probable strigolactone esterase D...    231   9e-71   
pdb|3W06|A  Chain A, Crystal Structure Of Arabidopsis Thaliana Dw...    229   9e-71   
pdb|4IHA|A  Chain A, Crystal Structure Of Rice Dwarf14 (d14) In C...    229   1e-70   
pdb|4HRX|A  Chain A, Crystal Structure Of Kai2                          230   1e-70   
pdb|3W04|A  Chain A, Crystal Structure Of Oryza Sativa Dwarf14 (d14)    229   2e-70   
gb|EMT06220.1|  hypothetical protein F775_07019                         229   2e-70   
pdb|3VXK|A  Chain A, Crystal Structure Of Osd14                         229   2e-70   
ref|XP_003558555.1|  PREDICTED: probable strigolactone esterase D14     229   2e-70   
ref|XP_001769317.1|  predicted protein                                  228   2e-70   
ref|XP_006649588.1|  PREDICTED: probable strigolactone esterase D...    230   3e-70   
ref|NP_001150635.1|  LOC100284268                                       229   3e-70   Zea mays [maize]
ref|NP_001049306.1|  Os03g0203200                                       229   4e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001766839.1|  predicted protein                                  228   4e-70   
ref|XP_010432057.1|  PREDICTED: probable esterase KAI2                  228   5e-70   
ref|XP_010437222.1|  PREDICTED: probable esterase KAI2                  228   5e-70   
gb|KDP32038.1|  hypothetical protein JCGZ_12499                         227   6e-70   
ref|XP_010446656.1|  PREDICTED: probable esterase KAI2                  228   6e-70   
ref|XP_002468316.1|  hypothetical protein SORBIDRAFT_01g043630          228   1e-69   Sorghum bicolor [broomcorn]
ref|XP_006364425.1|  PREDICTED: probable esterase KAI2-like             226   1e-69   
ref|XP_011099337.1|  PREDICTED: LOW QUALITY PROTEIN: probable est...    226   1e-69   
ref|XP_004233449.1|  PREDICTED: probable esterase KAI2                  226   2e-69   
ref|XP_008344337.1|  PREDICTED: probable esterase KAI2                  224   9e-69   
dbj|BAJ94658.1|  predicted protein                                      225   1e-68   
ref|XP_008340833.1|  PREDICTED: probable esterase KAI2                  224   2e-68   
gb|AHW84477.1|  alpha-beta hydrolase KAI2a                              223   3e-68   
dbj|BAJ96506.1|  predicted protein                                      224   4e-68   
ref|XP_001772484.1|  predicted protein                                  223   5e-68   
ref|XP_001769564.1|  predicted protein                                  222   6e-68   
ref|XP_002984394.1|  hypothetical protein SELMODRAFT_445910             221   1e-67   
gb|EAZ27449.1|  hypothetical protein OsJ_11398                          220   7e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009774997.1|  PREDICTED: probable esterase D14L                  214   1e-66   
gb|KDO79007.1|  hypothetical protein CISIN_1g046596mg                   218   2e-66   
gb|AAR89004.1|  putative hydrolases                                     220   2e-66   Oryza sativa Japonica Group [Japonica rice]
gb|AHW84478.1|  alpha-beta hydrolase KAI2b                              218   2e-66   
ref|XP_002972818.1|  hypothetical protein SELMODRAFT_441991             218   4e-66   
ref|XP_002524972.1|  sigma factor sigb regulation protein rsbq, p...    214   1e-64   Ricinus communis
ref|XP_008656620.1|  PREDICTED: probable esterase D14L isoform X1       209   6e-64   
ref|XP_002524969.1|  sigma factor sigb regulation protein rsbq, p...    210   3e-63   Ricinus communis
gb|EMT26461.1|  hypothetical protein F775_28903                         207   1e-62   
ref|XP_001765232.1|  predicted protein                                  205   2e-61   
gb|ABD98032.1|  catalytic hydrolase                                     205   3e-61   Striga asiatica [witchweed]
gb|KHN07666.1|  Sigma factor sigB regulation protein rsbQ               202   7e-61   
ref|XP_002531937.1|  sigma factor sigb regulation protein rsbq, p...    204   9e-61   Ricinus communis
emb|CAJ91149.1|  hydrolase                                              201   2e-60   Platanus x hispanica [London plane tree]
ref|XP_010030510.1|  PREDICTED: LOW QUALITY PROTEIN: probable est...    202   6e-60   
ref|XP_008680178.1|  PREDICTED: probable esterase D14L                  195   1e-58   
ref|XP_001760483.1|  predicted protein                                  198   1e-58   
gb|ABK26781.1|  unknown                                                 196   9e-58   Picea sitchensis
gb|KHN36273.1|  Sigma factor sigB regulation protein rsbQ               196   1e-57   
gb|ABK21599.1|  unknown                                                 196   1e-57   Picea sitchensis
ref|XP_010087288.1|  hypothetical protein L484_009421                   194   3e-57   
ref|XP_001767298.1|  predicted protein                                  194   6e-57   
ref|XP_001767650.1|  predicted protein                                  191   7e-56   
ref|XP_001782872.1|  predicted protein                                  191   8e-56   
gb|KDP32036.1|  hypothetical protein JCGZ_12497                         189   2e-55   
gb|KCW59519.1|  hypothetical protein EUGRSUZ_H02271                     191   2e-55   
tpg|DAA45887.1|  TPA: hypothetical protein ZEAMMB73_234551              181   8e-54   
ref|XP_006425426.1|  hypothetical protein CICLE_v10026257mg             186   9e-54   
ref|XP_006466978.1|  PREDICTED: probable strigolactone esterase D...    186   1e-53   
ref|XP_006425422.1|  hypothetical protein CICLE_v10026256mg             185   2e-53   
gb|ABK22456.1|  unknown                                                 185   2e-53   Picea sitchensis
gb|ABK22436.1|  unknown                                                 183   8e-53   Picea sitchensis
gb|ABR17129.1|  unknown                                                 182   2e-52   Picea sitchensis
gb|ACN40675.1|  unknown                                                 182   4e-52   Picea sitchensis
emb|CBI33729.3|  unnamed protein product                                179   2e-51   
ref|XP_008775243.1|  PREDICTED: probable strigolactone esterase D...    177   2e-50   
ref|XP_001780905.1|  predicted protein                                  176   5e-50   
ref|WP_019184503.1|  hypothetical protein                               175   1e-49   
gb|AFI78790.1|  putative D14 protein                                    172   9e-49   
ref|XP_010904531.1|  PREDICTED: probable strigolactone esterase D...    173   9e-49   
ref|XP_006844369.1|  hypothetical protein AMTR_s00142p00063260          173   1e-48   
ref|XP_001775211.1|  predicted protein                                  172   3e-48   
ref|WP_036504924.1|  alpha/beta hydrolase                               170   7e-48   
gb|EJL22584.1|  putative hydrolase or acyltransferase of alpha/be...    170   9e-48   
ref|WP_021232077.1|  hypothetical protein                               169   1e-47   
ref|WP_037527489.1|  alpha/beta hydrolase                               167   7e-47   
ref|XP_010257604.1|  PREDICTED: probable strigolactone esterase D14     166   4e-46   
gb|ABK23563.1|  unknown                                                 166   6e-46   Picea sitchensis
ref|WP_038689659.1|  alpha/beta hydrolase                               164   2e-45   
ref|XP_002969138.1|  hypothetical protein SELMODRAFT_267235             164   2e-45   
ref|XP_002531585.1|  sigma factor sigb regulation protein rsbq, p...    164   3e-45   Ricinus communis
emb|CAN72706.1|  hypothetical protein VITISV_043785                     163   4e-45   Vitis vinifera
ref|XP_010254192.1|  PREDICTED: probable strigolactone esterase D...    163   5e-45   
ref|XP_002308316.2|  hydrolase family protein                           163   5e-45   Populus trichocarpa [western balsam poplar]
ref|XP_010915037.1|  PREDICTED: probable strigolactone esterase D14     162   6e-45   
emb|CAN75737.1|  hypothetical protein VITISV_025902                     162   9e-45   Vitis vinifera
gb|ABK95696.1|  unknown                                                 162   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_002281367.2|  PREDICTED: probable strigolactone esterase DAD2    163   1e-44   Vitis vinifera
gb|AFK48687.1|  unknown                                                 157   1e-44   
ref|XP_002276657.1|  PREDICTED: probable strigolactone esterase D...    161   2e-44   Vitis vinifera
emb|CBI28105.3|  unnamed protein product                                162   3e-44   
ref|XP_008810138.1|  PREDICTED: probable strigolactone esterase D14     160   3e-44   
ref|XP_010249846.1|  PREDICTED: probable strigolactone esterase D...    162   6e-44   
ref|XP_011016315.1|  PREDICTED: probable strigolactone esterase D14     159   1e-43   
ref|XP_008242593.1|  PREDICTED: probable strigolactone esterase D...    159   2e-43   
gb|EYU29771.1|  hypothetical protein MIMGU_mgv1a011443mg                159   2e-43   
ref|XP_002515580.1|  sigma factor sigb regulation protein rsbq, p...    159   3e-43   Ricinus communis
gb|AFI78791.1|  putative D14 protein                                    159   6e-43   
ref|XP_011084099.1|  PREDICTED: probable strigolactone esterase D...    157   6e-43   
ref|XP_002323351.1|  hypothetical protein POPTR_0016s06260g             157   8e-43   Populus trichocarpa [western balsam poplar]
ref|XP_007202641.1|  hypothetical protein PRUPE_ppa012103mg             154   8e-43   
ref|WP_015185878.1|  alpha/beta hydrolase                               157   8e-43   
gb|KDP21908.1|  hypothetical protein JCGZ_03046                         157   1e-42   
ref|XP_008793437.1|  PREDICTED: probable strigolactone esterase D14     156   1e-42   
ref|XP_002284711.1|  PREDICTED: probable strigolactone esterase D...    157   1e-42   Vitis vinifera
ref|XP_008650647.1|  PREDICTED: probable esterase D14L                  152   2e-42   
ref|XP_010276343.1|  PREDICTED: probable strigolactone esterase D14     155   3e-42   
ref|WP_015015700.1|  alpha/beta hydrolase                               155   4e-42   
gb|KDP32037.1|  hypothetical protein JCGZ_12498                         151   5e-42   
gb|KDP32313.1|  hypothetical protein JCGZ_13238                         154   1e-41   
ref|XP_009590511.1|  PREDICTED: probable strigolactone esterase D14     154   1e-41   
gb|AFG58315.1|  hypothetical protein CL715Contig1_03                    148   2e-41   
ref|XP_007202666.1|  hypothetical protein PRUPE_ppa012403mg             150   2e-41   
ref|XP_009336865.1|  PREDICTED: probable strigolactone esterase DAD2    153   3e-41   
ref|XP_011039520.1|  PREDICTED: probable strigolactone esterase D...    152   5e-41   
ref|XP_008386980.1|  PREDICTED: probable strigolactone esterase D...    152   8e-41   
ref|WP_001188394.1|  Sigma factor sigB regulation protein rsbQ          152   9e-41   
ref|WP_001188388.1|  Sigma factor sigB regulation protein rsbQ          152   9e-41   
ref|WP_001188391.1|  Sigma factor sigB regulation protein rsbQ          152   1e-40   
ref|WP_001188392.1|  sigma factor sigB regulation protein rsbQ          152   1e-40   
ref|WP_001188390.1|  sigma factor sigB regulation protein rsbQ          152   1e-40   
ref|WP_001188403.1|  Sigma factor sigB regulation protein rsbQ          151   1e-40   
ref|WP_022689338.1|  alpha/beta hydrolase                               151   1e-40   
ref|WP_016560088.1|  putative sigma factor SigB regulation protei...    151   1e-40   
ref|WP_004433721.1|  putative sigma factor SigB regulation protei...    151   2e-40   
ref|WP_004447844.1|  putative sigma factor SigB regulation protei...    151   2e-40   
ref|WP_017860661.1|  sigma factor sigB regulation protein rsbQ          150   3e-40   
ref|WP_001188393.1|  Sigma factor sigB regulation protein rsbQ          150   3e-40   
ref|WP_022688298.1|  alpha/beta hydrolase                               150   3e-40   
ref|WP_020775087.1|  putative sigma factor SigB regulation protei...    150   4e-40   
ref|WP_001188389.1|  Sigma factor sigB regulation protein rsbQ          150   4e-40   
ref|WP_015148485.1|  alpha/beta hydrolase                               150   4e-40   
ref|WP_004441994.1|  putative sigma factor SigB regulation protei...    150   4e-40   
ref|WP_004445034.1|  putative sigma factor SigB regulation protei...    150   5e-40   
ref|WP_004422691.1|  putative sigma factor SigB regulation protei...    150   5e-40   
ref|WP_020766232.1|  putative sigma factor SigB regulation protei...    150   5e-40   
ref|WP_017719358.1|  sigma factor sigB regulation protein rsbQ          150   5e-40   
ref|XP_010088862.1|  hypothetical protein L484_020849                   150   6e-40   
dbj|GAL86213.1|  sigma factor sigB regulation protein rsbQ              149   6e-40   
gb|KHN22565.1|  Sigma factor sigB regulation protein rsbQ               147   6e-40   
ref|WP_015180356.1|  alpha/beta hydrolase                               149   7e-40   
ref|WP_028978522.1|  sigma factor sigB regulation protein rsbQ          149   8e-40   
ref|XP_009793012.1|  PREDICTED: probable esterase KAI2                  149   9e-40   
ref|WP_004760501.1|  putative sigma factor SigB regulation protei...    149   9e-40   
ref|XP_008337455.1|  PREDICTED: probable strigolactone esterase D...    150   9e-40   
ref|WP_004754923.1|  sigma factor sigB regulation protein rsbQ          149   1e-39   
ref|WP_017214009.1|  sigma factor sigB regulation protein rsbQ          149   1e-39   
ref|WP_002995491.1|  putative sigma factor SigB regulation protei...    149   1e-39   
ref|WP_002180191.1|  putative sigma factor SigB regulation protei...    149   1e-39   
ref|XP_010049926.1|  PREDICTED: probable strigolactone esterase D...    149   1e-39   
gb|AFI78788.1|  putative D14 protein                                    149   1e-39   
gb|EMK19109.1|  putative sigma factor SigB regulation protein rsbQ      149   2e-39   
ref|WP_002153420.1|  putative sigma factor SigB regulation protei...    148   2e-39   
ref|XP_008241150.1|  PREDICTED: probable strigolactone esterase D...    149   2e-39   
ref|XP_010036529.1|  PREDICTED: probable strigolactone esterase D...    148   4e-39   
ref|XP_006829224.1|  hypothetical protein AMTR_s00001p00272330          142   4e-39   
ref|WP_020779195.1|  putative sigma factor SigB regulation protei...    147   5e-39   
ref|WP_016560584.1|  putative sigma factor SigB regulation protei...    147   5e-39   
ref|WP_004767272.1|  putative sigma factor SigB regulation protei...    147   5e-39   
ref|XP_010688158.1|  PREDICTED: probable strigolactone esterase D14     147   6e-39   
ref|WP_015202924.1|  alpha/beta fold family hydrolase                   147   6e-39   
ref|XP_004287076.1|  PREDICTED: sigma factor SigB regulation prot...    146   1e-38   
ref|XP_003555187.1|  PREDICTED: probable strigolactone esterase D...    146   2e-38   
ref|WP_025179345.1|  sigma factor sigB regulation protein rsbQ          145   2e-38   
emb|CDY25341.1|  BnaC01g30100D                                          146   2e-38   
ref|XP_003520729.1|  PREDICTED: probable strigolactone esterase D...    145   2e-38   
ref|XP_010488539.1|  PREDICTED: probable esterase KAI2                  145   2e-38   
ref|XP_007013251.1|  Alpha/beta-Hydrolases superfamily protein          146   3e-38   
ref|XP_010087549.1|  hypothetical protein L484_014054                   145   3e-38   
ref|XP_010466844.1|  PREDICTED: probable esterase KAI2                  145   3e-38   
ref|XP_010513427.1|  PREDICTED: probable esterase KAI2                  144   6e-38   
ref|XP_009352488.1|  PREDICTED: probable strigolactone esterase D...    145   7e-38   
ref|WP_010572662.1|  sigma factor sigB regulation protein rsbQ          144   7e-38   
ref|XP_010047757.1|  PREDICTED: probable strigolactone esterase D...    144   7e-38   
ref|WP_006100972.1|  sigma factor sigB regulation protein rsbQ          144   1e-37   
ref|WP_009632309.1|  putative hydrolase or acyltransferase of alp...    143   1e-37   
ref|XP_002885644.1|  hydrolase, alpha/beta fold family protein          144   2e-37   
ref|XP_003620539.1|  Sigma factor sigB regulation protein rsbQ          144   2e-37   
gb|KEH33533.1|  sigma factor sigb regulation rsbq-like protein          143   2e-37   
ref|XP_004148713.1|  PREDICTED: sigma factor SigB regulation prot...    143   3e-37   
gb|KHN20708.1|  Sigma factor sigB regulation protein rsbQ               143   3e-37   
ref|XP_003528932.1|  PREDICTED: probable strigolactone esterase D...    143   3e-37   
ref|XP_009105901.1|  PREDICTED: probable esterase KAI2                  142   3e-37   
gb|ACU23567.1|  unknown                                                 142   3e-37   
gb|ACU18194.1|  unknown                                                 142   3e-37   
ref|XP_003534182.1|  PREDICTED: probable strigolactone esterase D...    142   4e-37   
ref|XP_010047759.1|  PREDICTED: probable strigolactone esterase D14     142   5e-37   
ref|XP_006298308.1|  hypothetical protein CARUB_v10014373mg             142   5e-37   
emb|CDP03366.1|  unnamed protein product                                142   5e-37   
gb|KHN16591.1|  Sigma factor sigB regulation protein rsbQ               139   5e-37   
ref|NP_189085.1|  hydrolase, alpha/beta fold family protein             142   7e-37   
gb|KFK39741.1|  alpha beta fold family protein                          142   8e-37   
ref|WP_008238867.1|  sigma factor sigB regulation protein rsbQ          141   8e-37   
ref|XP_004253481.2|  PREDICTED: probable strigolactone esterase D...    141   1e-36   
ref|XP_010047758.1|  PREDICTED: probable strigolactone esterase D...    141   1e-36   
ref|XP_008463365.1|  PREDICTED: probable strigolactone esterase DAD2    141   1e-36   
ref|XP_004512949.1|  PREDICTED: probable strigolactone esterase D...    140   3e-36   
ref|XP_006338161.1|  PREDICTED: probable strigolactone esterase D...    140   3e-36   
gb|ACU22869.1|  unknown                                                 140   3e-36   
ref|XP_010532830.1|  PREDICTED: probable strigolactone esterase DAD2    139   4e-36   
ref|XP_009102512.1|  PREDICTED: probable esterase KAI2                  139   5e-36   
ref|XP_008650580.1|  PREDICTED: probable strigolactone esterase D14     139   6e-36   
ref|XP_007152801.1|  hypothetical protein PHAVU_004G160800g             139   6e-36   
ref|NP_001241469.1|  uncharacterized protein LOC100810465               139   7e-36   
ref|XP_006418750.1|  hypothetical protein EUTSA_v10002637mg             139   1e-35   
ref|XP_008650089.1|  PREDICTED: probable strigolactone esterase D...    139   1e-35   
ref|XP_010535293.1|  PREDICTED: probable strigolactone esterase D...    137   1e-35   
ref|WP_002624812.1|  hypothetical protein                               138   2e-35   
ref|WP_012793407.1|  sigma factor sigB regulation protein rsbQ          137   3e-35   
gb|KHN43574.1|  Sigma factor sigB regulation protein rsbQ               136   3e-35   
ref|WP_017290672.1|  hypothetical protein                               137   5e-35   
gb|KDO54133.1|  hypothetical protein CISIN_1g024033mg                   137   5e-35   
ref|WP_008504079.1|  sigma factor sigB regulation protein rsbQ          136   7e-35   
ref|WP_029705745.1|  hypothetical protein                               136   8e-35   
ref|XP_006451072.1|  hypothetical protein CICLE_v10009167mg             136   9e-35   
ref|XP_007160357.1|  hypothetical protein PHAVU_002G314800g             135   1e-34   
ref|WP_037584422.1|  sigma factor sigB regulation protein rsbQ          135   1e-34   
ref|WP_013376127.1|  sigma factor sigB regulation protein rsbQ          136   1e-34   
gb|EAU62388.1|  hydrolase                                               136   1e-34   
ref|XP_010036530.1|  PREDICTED: probable strigolactone esterase D...    135   2e-34   
ref|XP_006475729.1|  PREDICTED: probable strigolactone esterase D...    135   2e-34   
ref|XP_002440707.1|  hypothetical protein SORBIDRAFT_09g005500          135   3e-34   
ref|XP_010048019.1|  PREDICTED: probable esterase KAI2                  134   3e-34   
ref|NP_001043470.1|  Os01g0595600                                       135   4e-34   
ref|WP_002617123.1|  hypothetical protein                               134   4e-34   
gb|KFA89484.1|  sigma factor sigB regulation protein rsbQ               134   6e-34   
ref|WP_013378081.1|  sigma factor sigB regulation protein rsbQ          134   8e-34   
ref|WP_015189075.1|  alpha/beta hydrolase fold protein                  133   1e-33   
gb|EMS58892.1|  hypothetical protein TRIUR3_31182                       129   2e-33   
ref|XP_010497843.1|  PREDICTED: probable esterase KAI2                  127   3e-33   
gb|KFE68732.1|  Hydrolase                                               131   5e-33   
ref|XP_008443004.1|  PREDICTED: probable strigolactone esterase D...    131   7e-33   
ref|WP_011056999.1|  hypothetical protein                               130   1e-32   
ref|XP_010233316.1|  PREDICTED: crocetin glucosyltransferase, chl...    136   1e-32   
gb|KFJ92677.1|  sigma factor SigB regulation protein RsbQ               130   2e-32   
ref|WP_026096837.1|  hypothetical protein                               129   2e-32   
ref|WP_024124341.1|  hydrolase of unknown specificity RsbQ              130   2e-32   
ref|WP_003461339.1|  sigma factor sigB regulation protein rsbQ          130   2e-32   
ref|WP_002618074.1|  sigma factor sigB regulation protein rsbQ          129   2e-32   
ref|WP_024535508.1|  sigma factor sigB regulation protein rsbQ          129   3e-32   
ref|WP_002629594.1|  hypothetical protein                               130   3e-32   
ref|XP_009387332.1|  PREDICTED: probable strigolactone esterase D...    128   3e-32   
ref|WP_017676697.1|  MULTISPECIES: sigma factor sigB regulation p...    129   4e-32   
ref|WP_037456855.1|  hypothetical protein                               129   5e-32   
ref|XP_004165210.1|  PREDICTED: sigma factor SigB regulation prot...    129   5e-32   
ref|XP_004136551.1|  PREDICTED: sigma factor SigB regulation prot...    129   6e-32   
ref|XP_004969067.1|  PREDICTED: probable esterase KAI2-like             129   9e-32   
ref|XP_002531940.1|  sigma factor sigb regulation protein rsbq, p...    124   1e-31   
ref|WP_009856953.1|  hydrolase                                          128   1e-31   
ref|WP_036671764.1|  sigma factor sigB regulation protein rsbQ          127   2e-31   
ref|XP_008675439.1|  PREDICTED: probable esterase KAI2                  128   2e-31   
gb|EGG36872.1|  sigma factor SigB regulation protein rsbQ               127   2e-31   
ref|XP_003565814.1|  PREDICTED: probable strigolactone esterase D...    127   2e-31   
ref|XP_006829225.1|  hypothetical protein AMTR_s00001p00272340          122   2e-31   
ref|XP_002441619.1|  hypothetical protein SORBIDRAFT_09g030500          127   3e-31   
ref|WP_036149379.1|  sigma factor sigB regulation protein rsbQ          126   4e-31   
ref|WP_036640383.1|  sigma factor sigB regulation protein rsbQ          126   5e-31   
ref|WP_015738018.1|  sigma factor sigB regulation protein rsbQ          126   5e-31   
ref|WP_036220704.1|  sigma factor sigB regulation protein rsbQ          125   8e-31   
ref|WP_036659474.1|  sigma factor sigB regulation protein rsbQ          125   9e-31   
ref|WP_036119461.1|  MULTISPECIES: sigma factor sigB regulation p...    125   9e-31   
ref|NP_001056487.1|  Os05g0590300                                       126   1e-30   
ref|WP_024841701.1|  sigma factor sigB regulation protein rsbQ          125   1e-30   
ref|WP_006207217.1|  sigma factor sigB regulation protein rsbQ          125   1e-30   
gb|EAY99242.1|  hypothetical protein OsI_21204                          125   1e-30   
gb|AIE75800.1|  Hydrolase of unknown specificity RsbQ                   125   1e-30   
ref|XP_004961029.1|  PREDICTED: probable strigolactone esterase D...    125   2e-30   
ref|WP_004226375.1|  sigma factor sigB regulation protein rsbQ          124   2e-30   
ref|WP_008179217.1|  sigma factor sigB regulation protein rsbQ          124   2e-30   
ref|WP_012295583.1|  sigma factor sigB regulation protein rsbQ          124   3e-30   
ref|XP_006646064.1|  PREDICTED: probable strigolactone esterase D...    124   4e-30   
ref|WP_035363489.1|  hypothetical protein                               123   4e-30   
ref|WP_035722041.1|  hypothetical protein                               123   6e-30   
ref|WP_020890226.1|  Hydrolase of unknown specificity RsbQ              123   7e-30   
gb|AIQ61570.1|  sigma factor sigB regulation protein rsbQ               122   1e-29   
gb|AFI78787.1|  putative D14a protein                                   122   1e-29   
ref|WP_027076055.1|  sigma factor sigB regulation protein rsbQ          122   1e-29   
ref|WP_034258005.1|  sigma factor sigB regulation protein rsbQ          122   1e-29   
ref|WP_021762801.1|  sigma factor SigB regulation protein rsbQ          122   1e-29   
ref|WP_026481200.1|  sigma factor sigB regulation protein rsbQ          122   2e-29   
ref|WP_017381080.1|  hypothetical protein                               122   2e-29   
ref|WP_025114518.1|  sigma factor sigB regulation protein rsbQ          122   2e-29   
gb|KIG11262.1|  hypothetical protein BurMR1_1922                        122   2e-29   
ref|WP_026914807.1|  hypothetical protein                               122   2e-29   
ref|WP_016994873.1|  sigma factor sigB regulation protein rsbQ          122   2e-29   
ref|WP_036273061.1|  hypothetical protein                               122   2e-29   
ref|XP_006654865.1|  PREDICTED: probable esterase KAI2-like             122   2e-29   
ref|WP_029035624.1|  sigma factor sigB regulation protein rsbQ          121   3e-29   
ref|WP_023960384.1|  glycerol-1-phosphate dehydrogenase                 121   3e-29   
ref|WP_034257323.1|  sigma factor sigB regulation protein rsbQ          121   3e-29   
ref|WP_029500664.1|  sigma factor sigB regulation protein rsbQ          121   3e-29   
ref|WP_026365999.1|  sigma factor sigB regulation protein rsbQ          121   3e-29   
ref|WP_028449979.1|  sigma factor SigB regulation protein RsbQ          121   4e-29   
ref|WP_019822663.1|  alpha/beta hydrolase fold protein                  121   5e-29   
ref|WP_035856025.1|  hypothetical protein                               120   5e-29   
ref|WP_036682278.1|  sigma factor sigB regulation protein rsbQ          120   6e-29   
ref|WP_015619583.1|  alpha/beta hydrolase fold protein                  120   6e-29   
dbj|BAJ97678.1|  predicted protein                                      121   6e-29   
gb|KHD77206.1|  sigma factor sigB regulation protein rsbQ               120   6e-29   
ref|WP_013838708.1|  sigma factor sigB regulation protein rsbQ          120   7e-29   
ref|WP_030509517.1|  sigma factor sigB regulation protein rsbQ          120   7e-29   
ref|WP_036358593.1|  sigma factor sigB regulation protein rsbQ          120   8e-29   
ref|XP_002455886.1|  hypothetical protein SORBIDRAFT_03g026840          120   1e-28   
ref|WP_037106996.1|  sigma factor sigB regulation protein rsbQ          120   1e-28   
ref|WP_024363850.1|  sigma factor sigB regulation protein rsbQ          120   1e-28   
ref|WP_012560060.1|  sigma factor sigB regulation protein rsbQ          120   1e-28   
gb|ETT59604.1|  alpha/beta hydrolase fold protein                       120   1e-28   
ref|WP_012830351.1|  sigma factor sigB regulation protein rsbQ          119   1e-28   
ref|WP_010873490.1|  hypothetical protein                               119   1e-28   
ref|WP_035071058.1|  sigma factor sigB regulation protein rsbQ          119   2e-28   
ref|WP_020620569.1|  hypothetical protein                               119   2e-28   
ref|XP_002524971.1|  sigma factor sigb regulation protein rsbq, p...    118   2e-28   
ref|WP_034631077.1|  sigma factor sigB regulation protein rsbQ          119   2e-28   
gb|AIQ49952.1|  sigma factor sigB regulation protein rsbQ               119   2e-28   
gb|KFE63575.1|  Hydrolase                                               119   2e-28   
ref|WP_008498269.1|  alpha/beta hydrolase                               119   2e-28   
ref|WP_029947887.1|  sigma factor sigB regulation protein rsbQ          119   2e-28   
gb|KFA94301.1|  sigma factor SigB regulation protein RsbQ               119   2e-28   
gb|EYF00932.1|  Hydrolase a bacterial sensing module having protein     119   2e-28   
ref|WP_030603505.1|  sigma factor sigB regulation protein rsbQ          119   3e-28   
ref|WP_009540104.1|  hypothetical protein                               119   3e-28   
ref|WP_030650795.1|  sigma factor sigB regulation protein rsbQ          119   3e-28   
emb|CDP14293.1|  unnamed protein product                                119   4e-28   
ref|WP_035753475.1|  sigma factor sigB regulation protein rsbQ          118   4e-28   
ref|WP_036369133.1|  sigma factor sigB regulation protein rsbQ          118   4e-28   
ref|WP_036811846.1|  sigma factor sigB regulation protein rsbQ          118   4e-28   
gb|ELT43376.1|  alpha/beta hydrolase fold protein                       118   4e-28   
ref|WP_020602539.1|  hypothetical protein                               118   5e-28   
emb|CCQ45138.1|  alpha/beta hydrolase fold family protein               118   5e-28   
ref|WP_034751569.1|  sigma factor sigB regulation protein rsbQ          118   5e-28   
ref|WP_018619911.1|  hypothetical protein                               118   5e-28   
ref|WP_029053359.1|  hypothetical protein                               118   5e-28   
ref|WP_009738975.1|  sigma factor sigB regulation protein rsbQ          118   6e-28   
gb|EWM18494.1|  esterase/lipase                                         118   6e-28   
ref|WP_026236251.1|  sigma factor sigB regulation protein rsbQ          117   7e-28   
ref|XP_003566837.1|  PREDICTED: probable strigolactone esterase D14     117   8e-28   
gb|AFK46821.1|  unknown                                                 117   9e-28   
ref|WP_034923383.1|  sigma factor sigB regulation protein rsbQ          117   9e-28   
ref|WP_009032685.1|  sigma factor sigB regulation protein rsbQ          117   9e-28   
ref|WP_026629021.1|  hypothetical protein                               117   1e-27   
ref|WP_030007399.1|  hypothetical protein                               117   1e-27   
ref|WP_012308264.1|  alpha/beta fold family hydrolase                   117   1e-27   
ref|WP_027863674.1|  sigma factor sigB regulation protein rsbQ          117   1e-27   
ref|WP_022822358.1|  sigma factor sigB regulation protein rsbQ          117   1e-27   
ref|WP_023915199.1|  sigma factor sigB regulation protein rsbQ          117   1e-27   



>ref|XP_004233607.1| PREDICTED: probable esterase KAI2 [Solanum lycopersicum]
Length=275

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 153/172 (89%), Gaps = 1/172 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLFSKLIL+ ASPRF+N ++Y+GGFE  +IE++  AM++NY+AWV GFAPLA
Sbjct  102  VVASIFRPDLFSKLILVSASPRFINTDDYYGGFESEDIEQLCQAMESNYKAWVSGFAPLA  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSVFRT+F FDLR +LSRVTVPCHIIQSS D+A+P
Sbjct  162  VGGDMNSVAVQEFSRTLFNMRPDIALSVFRTVFTFDLRHYLSRVTVPCHIIQSSMDVAMP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDADAA  514
            V V+EY+H NLGGKSIVE++STEGHLPHLSAPE TIPVLLRHI HDI ADA+
Sbjct  222  VTVSEYLHRNLGGKSIVEIISTEGHLPHLSAPEATIPVLLRHISHDITADAS  273



>ref|XP_009783363.1| PREDICTED: probable esterase KAI2 [Nicotiana sylvestris]
Length=273

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 153/170 (90%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLFSKLIL+ ASPRF+N ++Y+GGFE+ +I+++  AM++NY++W+ GFAPL 
Sbjct  102  VIASIFRPDLFSKLILLSASPRFINADDYYGGFEKEDIDQLSQAMESNYKSWIDGFAPLV  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            +G D+ + AV+EFSRTLFNMRPDIALSVFRTIF FDLR FLSRVTVPCHIIQSSKDLAVP
Sbjct  162  IGGDMDSVAVQEFSRTLFNMRPDIALSVFRTIFTFDLRHFLSRVTVPCHIIQSSKDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDAD  508
            VAV+EYIH NLGGKSIVEV+STEGHLP LSAPE+T+PVLLRHI HDI +D
Sbjct  222  VAVSEYIHQNLGGKSIVEVISTEGHLPQLSAPEVTVPVLLRHISHDISSD  271



>ref|XP_006339830.1| PREDICTED: probable esterase KAI2-like [Solanum tuberosum]
Length=284

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 151/172 (88%), Gaps = 1/172 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLFSKLIL+ ASPRF+N ++Y+GGFE  +IE++  AM++NY AWV GFAPLA
Sbjct  111  VVASIFRPDLFSKLILVSASPRFINTDDYYGGFESEDIEQLCQAMESNYNAWVSGFAPLA  170

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSVFRT+F FDLR +LSRVTVPCHIIQSS D+A+P
Sbjct  171  VGGDMNSVAVQEFSRTLFNMRPDIALSVFRTVFTFDLRHYLSRVTVPCHIIQSSMDVAMP  230

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDADAA  514
            V V+EY+H NLGGKSIVE++STEGHLPHLSAPE TIPVLLRHI HDI A A+
Sbjct  231  VTVSEYLHRNLGGKSIVEIISTEGHLPHLSAPEATIPVLLRHISHDITAHAS  282



>ref|XP_009590442.1| PREDICTED: probable esterase KAI2 [Nicotiana tomentosiformis]
Length=273

 Score =   268 bits (685),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 152/171 (89%), Gaps = 1/171 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLFSKLIL+ ASPRF+N ++Y+GGFE+ +I+++  AM++NY++W+ GFAPL 
Sbjct  102  VIASIFRPDLFSKLILLSASPRFINADDYYGGFEKEDIDQLSQAMESNYKSWIDGFAPLV  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            +G D+ + AV+EFSRTLFNMRPDIALSVFRTIF FDLR FLSRVTVPCHIIQSSKDLAVP
Sbjct  162  IGGDMDSVAVQEFSRTLFNMRPDIALSVFRTIFTFDLRHFLSRVTVPCHIIQSSKDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDADA  511
             AV+EYIH NLGGKSIVEV+STEGHLP LSAPE+T+PVLLRHI HDI +D 
Sbjct  222  EAVSEYIHQNLGGKSIVEVISTEGHLPQLSAPEVTVPVLLRHISHDISSDT  272



>gb|EPS71370.1| hypothetical protein M569_03387, partial [Genlisea aurea]
Length=264

 Score =   265 bits (678),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 149/166 (90%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF K++++ ASPRF+N ++Y+GGFEQ EI+++ +AM+ANY++WV GFAPLAV
Sbjct  97   VASILRPDLFHKIVMVSASPRFVNADDYYGGFEQSEIDELCAAMEANYKSWVSGFAPLAV  156

Query  185  GADV-PAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+   AV+EFSRTLFN RPDIALSVFRT+F FDLR FL+RVTVPCHIIQSSKDLAVPV
Sbjct  157  GGDMRSTAVQEFSRTLFNTRPDIALSVFRTVFTFDLRHFLARVTVPCHIIQSSKDLAVPV  216

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             VAEY+H NLGGKSIVEV+ TEGHLPHLS+PE+TIPVLLRHI+HDI
Sbjct  217  TVAEYLHQNLGGKSIVEVIPTEGHLPHLSSPEMTIPVLLRHIRHDI  262



>ref|XP_006364428.1| PREDICTED: probable esterase KAI2-like [Solanum tuberosum]
Length=272

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 150/166 (90%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLFSKLIL+ ASPRF+N +EY+GGFE+ +I+++  AM++NY++W+ GFAPL 
Sbjct  102  VVASIFRPDLFSKLILLSASPRFINSDEYYGGFEKEDIDQLCQAMESNYKSWIDGFAPLV  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            +G D+ + AV+EFSRTLFNMRPDI+LSVFRTIF FDLR FLSRVTVPCHIIQSSKDLAVP
Sbjct  162  IGGDMDSVAVQEFSRTLFNMRPDISLSVFRTIFTFDLRHFLSRVTVPCHIIQSSKDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHD  496
            VAV+EYIH NLGGKSIVEV+STEGHLP LSAPE+T+PVLLRHI H+
Sbjct  222  VAVSEYIHRNLGGKSIVEVISTEGHLPQLSAPEVTVPVLLRHISHN  267



>gb|EYU34543.1| hypothetical protein MIMGU_mgv1a008430mg [Erythranthe guttata]
Length=374

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLF KLILI ASPRFLN  +Y+GGFEQ EI+++  AM+ NY++WV GFAPL 
Sbjct  205  VIASIFRPDLFHKLILIAASPRFLNTVDYYGGFEQEEIDQLSGAMETNYKSWVSGFAPLV  264

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLF+MRPDIALSVFRT+FNFDLR +L RVTVPCHI+QSSKDLAVP
Sbjct  265  VGGDMDSVAVQEFSRTLFSMRPDIALSVFRTVFNFDLREYLGRVTVPCHIVQSSKDLAVP  324

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            VAVAEY+H NLGGKS+VEV+STEGHLP LSAPE+TIPVLLRHIQHDI
Sbjct  325  VAVAEYLHQNLGGKSVVEVMSTEGHLPQLSAPEVTIPVLLRHIQHDI  371



>ref|XP_011097235.1| PREDICTED: probable esterase KAI2 [Sesamum indicum]
Length=271

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLF KLI+I ASPRF+N ++Y+GGFEQ +IE++ +AM+ NY++W+ GFAPL 
Sbjct  102  VIASIFRPDLFHKLIMISASPRFVNTDDYYGGFEQEDIEQLCNAMETNYKSWISGFAPLV  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSVFRTIF FD R FL RVTVPCHIIQSS+DLAVP
Sbjct  162  VGGDMDSVAVQEFSRTLFNMRPDIALSVFRTIFTFDSRHFLGRVTVPCHIIQSSRDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            VAVAEY+H NLGGKSIVEVVSTEGHLP LSAPELT+ +LLRHIQHDI
Sbjct  222  VAVAEYLHQNLGGKSIVEVVSTEGHLPQLSAPELTVLMLLRHIQHDI  268



>ref|XP_009627573.1| PREDICTED: probable esterase KAI2 [Nicotiana tomentosiformis]
Length=275

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 151/174 (87%), Gaps = 3/174 (2%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLFSKLIL+ ASPRF+N ++Y+GGFE  +IE++  AM++NY+AWV GFAPL 
Sbjct  102  VVASIFRPDLFSKLILVSASPRFINTDDYYGGFELKDIEQLCQAMESNYKAWVSGFAPLV  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIAL VFRT+F FDLR FLS VTVPCHIIQSS D+AVP
Sbjct  162  VGGDMDSVAVQEFSRTLFNMRPDIALIVFRTVFTFDLRHFLSCVTVPCHIIQSSMDVAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVST-EGHLPHLSAPELTIPVLLRHIQHDI-DADAA  514
            VAVA+Y+H NLGGKSIVE++S  EGHLPHLSAPE TIPVLLRHI HDI ++DAA
Sbjct  222  VAVAQYLHRNLGGKSIVEIISNIEGHLPHLSAPEATIPVLLRHISHDIYNSDAA  275



>ref|XP_010272478.1| PREDICTED: probable strigolactone esterase DAD2 [Nelumbo nucifera]
Length=266

 Score =   255 bits (651),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRPDLF+KL+LIGASPRFLND +YHGGFEQGEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPDLFTKLVLIGASPRFLNDADYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC IIQ++KD++VP+
Sbjct  163  VGADVPDAVREFSRTLFNMRPDISLFVCRTVFNSDLRGILGLVKVPCCIIQTAKDVSVPI  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            +VA Y+ ++LGG++ VE++ TEGHLPHLSAP L    L R +Q
Sbjct  223  SVANYLKNHLGGRNTVEILDTEGHLPHLSAPGLLASRLRRALQ  265



>gb|ABK95280.1| unknown [Populus trichocarpa]
Length=167

 Score =   251 bits (641),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KLI+IGASPRFLND++YHGGFEQ EIE VF AM+ANYEAWV+GFAPLA
Sbjct  4    ILASIRRPELFTKLIMIGASPRFLNDKDYHGGFEQEEIESVFVAMEANYEAWVKGFAPLA  63

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RT+FN DLRG L  V VPC +IQ+SKD++VP 
Sbjct  64   VGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDLRGILGLVKVPCCVIQTSKDVSVPA  123

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            +VA+Y+ ++LGGK+ VE++ TEGHLPHLSAP +  PV+ R + 
Sbjct  124  SVAKYLKNHLGGKATVEMLRTEGHLPHLSAPAMLAPVIRRALS  166



>ref|XP_007018509.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY15734.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=266

 Score =   253 bits (646),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKLILIGASPRFLND +YHGGFEQGEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPELFSKLILIGASPRFLNDNDYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC ++Q+++D++VP 
Sbjct  163  VGADVPTAVREFSRTLFNMRPDISLFVCRTVFNSDLRGVLGLVRVPCCVVQTARDVSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VAEY+ ++LGG++ +E++ TEGHLPHLSAP L   VL R
Sbjct  223  SVAEYLRTHLGGRTTIEILKTEGHLPHLSAPALLAQVLRR  262



>emb|CBI19405.3| unnamed protein product [Vitis vinifera]
Length=167

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KL+LIGASPRFLND +YHGGFE+GEIEKVFSAM+ANY+AWV GFAPL+
Sbjct  4    ILASIRRPELFTKLVLIGASPRFLNDHDYHGGFEEGEIEKVFSAMEANYDAWVHGFAPLS  63

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RTIFN DLRG L  V VPC IIQ++KD++VP 
Sbjct  64   VGADVPAAVREFSRTLFNMRPDITLFVSRTIFNSDLRGVLGLVKVPCCIIQTAKDVSVPT  123

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ VE+++ EGHLPHLSAP L  PVL R
Sbjct  124  SVALYLKNHLGGRNTVEMLNVEGHLPHLSAPMLLAPVLRR  163



>ref|XP_010248100.1| PREDICTED: probable strigolactone esterase DAD2 [Nelumbo nucifera]
Length=266

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRPDLF+KLILIGASPRFLND +YHGGFEQGEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPDLFTKLILIGASPRFLNDTDYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC IIQ++KD++VPV
Sbjct  163  VGADVPVAVREFSRTLFNMRPDISLFVCRTVFNSDLRGILGLVKVPCCIIQTAKDVSVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPEL  460
            +VA Y+ ++LGG++  E+++ EGHLPHLSAP L
Sbjct  223  SVANYLKTHLGGRNTTEILNIEGHLPHLSAPAL  255



>ref|XP_009102099.1| PREDICTED: probable strigolactone esterase D14 homolog [Brassica 
rapa]
Length=267

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            I+A+IRRP+LFSKLILIGASPRFLND++YHGGFE+GEIEKVFSAM+ANYEAWV+GFAPLA
Sbjct  104  IIASIRRPELFSKLILIGASPRFLNDDDYHGGFEEGEIEKVFSAMEANYEAWVQGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC +IQ++KD++VP 
Sbjct  164  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVKVPCCVIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            +VAEY+  NLGG + VE + TEGHLPHLSAP
Sbjct  224  SVAEYLKDNLGGDTKVETLKTEGHLPHLSAP  254



>emb|CDP02567.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF KLI+I ASPRF+N ++Y GGFE+ +++++ +A++ANY++W  GFAPL V
Sbjct  103  IASIFRPDLFEKLIMIAASPRFINTDDYFGGFEKEDVDQLCNAIEANYKSWCSGFAPLVV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSVFRTIF FDLR FL RVTVP HI+QS+KDLAVP+
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVFRTIFTFDLRHFLCRVTVPSHIVQSTKDLAVPL  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            AV+EY+H NLGG+S+VEV+STEGHLP LS+P++TIPV+LRHI+HDI
Sbjct  223  AVSEYLHQNLGGQSLVEVISTEGHLPQLSSPDITIPVILRHIRHDI  268



>sp|J9U5U9.1|DAD2_PETHY RecName: Full=Probable strigolactone esterase DAD2; Short=3.1.-.-; 
AltName: Full=Protein DECREASED APICAL DOMINANCE 2 [Petunia 
x hybrida]
 gb|AFR68698.1| DAD2 [Petunia x hybrida]
Length=267

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKLILIGASPRFLNDE+YHGGFEQGEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RT+FN D+RG L  V VPCHI Q+++D +VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRGVLGLVKVPCHIFQTARDHSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
            +VA Y+ ++LGGK+ V  ++ EGHLPHLSAP L    L R + H
Sbjct  223  SVATYLKNHLGGKNTVHWLNIEGHLPHLSAPTLLAQELRRALSH  266



>ref|XP_002302409.1| esterase/lipase/thioesterase family protein [Populus trichocarpa]
 gb|EEE81682.1| esterase/lipase/thioesterase family protein [Populus trichocarpa]
Length=266

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KLI+IGASPRFLND++YHGGFEQ EIE VF AM+ANYEAWV+GFAPLA
Sbjct  103  ILASIRRPELFTKLIMIGASPRFLNDKDYHGGFEQEEIESVFVAMEANYEAWVKGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RT+FN DLRG L  V VPC +IQ+SKD++VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDLRGILGLVKVPCCVIQTSKDVSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA+Y+ ++LGGK+ VE++ TEGHLPHLSAP +  PV+ R
Sbjct  223  SVAKYLKNHLGGKATVEMLRTEGHLPHLSAPAMLAPVIRR  262



>ref|XP_011017119.1| PREDICTED: probable strigolactone esterase DAD2 [Populus euphratica]
Length=266

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KLI+IGASPRFLND++YHGGFEQ EIE VF AM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPELFTKLIMIGASPRFLNDKDYHGGFEQKEIESVFVAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RT+FN DLRG L  V VPC IIQ+SKD++VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDLRGILGLVKVPCCIIQTSKDVSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA+Y+ ++LGGK+ VE++ TEGHLPHLSAP +  PV+ R
Sbjct  223  SVAKYLKNHLGGKATVEMLRTEGHLPHLSAPAMLAPVIRR  262



>pdb|4DNQ|A Chain A, Crystal Structure Of Dad2 S96a Mutant
 pdb|4DNQ|B Chain B, Crystal Structure Of Dad2 S96a Mutant
 pdb|4DNQ|C Chain C, Crystal Structure Of Dad2 S96a Mutant
 pdb|4DNQ|D Chain D, Crystal Structure Of Dad2 S96a Mutant
 pdb|4DNQ|E Chain E, Crystal Structure Of Dad2 S96a Mutant
 pdb|4DNQ|F Chain F, Crystal Structure Of Dad2 S96a Mutant
 pdb|4DNQ|G Chain G, Crystal Structure Of Dad2 S96a Mutant
 pdb|4DNQ|H Chain H, Crystal Structure Of Dad2 S96a Mutant
 pdb|4DNQ|I Chain I, Crystal Structure Of Dad2 S96a Mutant
 pdb|4DNQ|J Chain J, Crystal Structure Of Dad2 S96a Mutant
 pdb|4DNQ|K Chain K, Crystal Structure Of Dad2 S96a Mutant
 pdb|4DNQ|L Chain L, Crystal Structure Of Dad2 S96a Mutant
Length=269

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKLILIGASPRFLNDE+YHGGFEQGEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  105  ILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLA  164

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RT+FN D+RG L  V VPCHI Q+++D +VP 
Sbjct  165  VGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRGVLGLVKVPCHIFQTARDHSVPA  224

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
            +VA Y+ ++LGGK+ V  ++ EGHLPHLSAP L    L R + H
Sbjct  225  SVATYLKNHLGGKNTVHWLNIEGHLPHLSAPTLLAQELRRALSH  268



>pdb|4DNP|A Chain A, Crystal Structure Of Dad2
Length=269

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKLILIGASPRFLNDE+YHGGFEQGEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  105  ILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLA  164

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RT+FN D+RG L  V VPCHI Q+++D +VP 
Sbjct  165  VGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRGVLGLVKVPCHIFQTARDHSVPA  224

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
            +VA Y+ ++LGGK+ V  ++ EGHLPHLSAP L    L R + H
Sbjct  225  SVATYLKNHLGGKNTVHWLNIEGHLPHLSAPTLLAQELRRALSH  268



>ref|XP_010556448.1| PREDICTED: probable strigolactone esterase D14 homolog [Tarenaya 
hassleriana]
Length=266

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRPDLFSKLILIGASPRFLND++YHGGFE+ EIEKVFSAM+ANYEAWV G+APLA
Sbjct  103  ILASIRRPDLFSKLILIGASPRFLNDDDYHGGFEESEIEKVFSAMEANYEAWVHGYAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLR  L  V VPC +IQ++KD++VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDISLFVCRTVFNSDLRVILGLVKVPCCVIQTAKDVSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            +VAEY+ S+LGGK+ VE ++TEGHLPHLSAP
Sbjct  223  SVAEYLRSHLGGKTTVETLNTEGHLPHLSAP  253



>ref|XP_010664515.1| PREDICTED: probable strigolactone esterase DAD2 [Vitis vinifera]
Length=266

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KL+LIGASPRFLND +YHGGFE+GEIEKVFSAM+ANY+AWV GFAPL+
Sbjct  103  ILASIRRPELFTKLVLIGASPRFLNDHDYHGGFEEGEIEKVFSAMEANYDAWVHGFAPLS  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RTIFN DLRG L  V VPC IIQ++KD++VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDITLFVSRTIFNSDLRGVLGLVKVPCCIIQTAKDVSVPT  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ VE+++ EGHLPHLSAP L  PVL R
Sbjct  223  SVALYLKNHLGGRNTVEMLNVEGHLPHLSAPMLLAPVLRR  262



>ref|XP_009773538.1| PREDICTED: probable strigolactone esterase DAD2 [Nicotiana sylvestris]
Length=267

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKLILIGASPRFLNDE+YHGGFEQGEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RT+FN D+RG L  V VPCHI Q+++D +VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRGVLGLVKVPCHIFQTARDHSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
            +VA Y+ ++LGG++ V  ++ EGHLPHLSAP L    L R + H
Sbjct  223  SVATYLKNHLGGRNTVHWLNIEGHLPHLSAPTLLAQELRRALSH  266



>ref|XP_009405896.1| PREDICTED: probable strigolactone esterase DAD2 [Musa acuminata 
subsp. malaccensis]
Length=284

 Score =   248 bits (633),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILAAIRRP+LF KLIL+GASPRFLND +YHGGFE+GEIEKVF+AM+ANY+AWVRGFAPLA
Sbjct  119  ILAAIRRPELFLKLILVGASPRFLNDRDYHGGFERGEIEKVFAAMEANYDAWVRGFAPLA  178

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V  PC +IQ++KD++VPV
Sbjct  179  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRAPCVVIQTAKDVSVPV  238

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ VE++  EGHLPHLSAP   +PVL R
Sbjct  239  SVAAYLKAHLGGRTTVELLPIEGHLPHLSAPAALVPVLRR  278



>ref|XP_002510101.1| sigma factor sigb regulation protein rsbq, putative [Ricinus 
communis]
 gb|EEF52288.1| sigma factor sigb regulation protein rsbq, putative [Ricinus 
communis]
Length=266

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKLILIGASPRFLND++YHGGFE+ +IE VF+AM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPELFSKLILIGASPRFLNDKDYHGGFERPDIENVFTAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RT+FN DLRG L  V VPC IIQ++KD++VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDLRGILGLVKVPCCIIQTAKDVSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            +VAEY+  +LGG++ VE++ TEGHLPHLSAP L   VL R + 
Sbjct  223  SVAEYLRIHLGGRNTVEILRTEGHLPHLSAPALLAQVLRRALS  265



>ref|XP_004238093.1| PREDICTED: probable strigolactone esterase DAD2 [Solanum lycopersicum]
Length=267

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKLILIGASPRFLNDE+YHGGFE GEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPELFSKLILIGASPRFLNDEDYHGGFELGEIEKVFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RT+FN D+RG L  V VPCHI Q+++D +VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRGVLGLVKVPCHIFQTARDHSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
            +VA Y+ +NLGG + V  ++ EGHLPHLSAP L    L R + H
Sbjct  223  SVATYLKNNLGGWNTVHWLNIEGHLPHLSAPNLLAQELRRALTH  266



>ref|XP_002320690.1| esterase/lipase/thioesterase family protein [Populus trichocarpa]
 gb|EEE99005.1| esterase/lipase/thioesterase family protein [Populus trichocarpa]
Length=266

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF K+ILIGASPRFLNDE+YHGGFEQ EIE VF AM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPELFIKMILIGASPRFLNDEDYHGGFEQEEIESVFKAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREF+RTLFNMRPDI L V RT+FN DLRG L  V VPC IIQ+SKD++VP 
Sbjct  163  VGADVPLAVREFTRTLFNMRPDITLFVSRTVFNSDLRGILGLVKVPCCIIQTSKDVSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VAEY+ ++LGG++ VE + TEGHLPHLSAP +  PV+ R
Sbjct  223  SVAEYLKNHLGGENTVETLRTEGHLPHLSAPAMLAPVIKR  262



>ref|XP_007047454.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX91611.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=270

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RPDLFSK+I+I ASPR+LND +Y+GGFEQ +++++F AM ANY+AW  GFAPLAV
Sbjct  103  LASISRPDLFSKIIMISASPRYLNDVDYYGGFEQEDLDQLFEAMGANYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  LS VTVPCHI+QS KDLAVPV
Sbjct  163  GGDLESVAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILSLVTVPCHILQSVKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLGG+SIVEV+S++GHLP LS+P++ IPVLLRHI++DI
Sbjct  223  VVSEYLHQNLGGQSIVEVMSSDGHLPQLSSPDIVIPVLLRHIRYDI  268



>ref|XP_010679577.1| PREDICTED: probable esterase D14L [Beta vulgaris subsp. vulgaris]
Length=270

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLFSKLILI ASPR+LND +Y+GGFEQ +++++F AMQ+NY+AW  GFAPLAV
Sbjct  103  IASIMRPDLFSKLILISASPRYLNDVDYYGGFEQEDLDQLFEAMQSNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D R  L  VTV CHIIQS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDFRHLLCHVTVSCHIIQSIKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLGG SIVEV+S+EGHLP LS+P+  IPVLLRHI+HDI
Sbjct  223  VVSEYLHQNLGGDSIVEVMSSEGHLPQLSSPDSVIPVLLRHIRHDI  268



>ref|XP_010060150.1| PREDICTED: probable strigolactone esterase DAD2 [Eucalyptus grandis]
 gb|KCW66720.1| hypothetical protein EUGRSUZ_F00478 [Eucalyptus grandis]
Length=265

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KLILIGASPRFLND++YHGGFE GEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPELFTKLILIGASPRFLNDKDYHGGFELGEIEKVFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC I+Q++KD++VP 
Sbjct  163  VGADVPAAVQEFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPCCIVQTAKDVSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            +VA Y+ ++LGG++ VE+++ EGHLPHLSAP L   VL R ++
Sbjct  223  SVAAYLKNHLGGRNTVEMLNIEGHLPHLSAPGLLAQVLRRALR  265



>ref|XP_006408233.1| hypothetical protein EUTSA_v10021292mg [Eutrema salsugineum]
 gb|ESQ49686.1| hypothetical protein EUTSA_v10021292mg [Eutrema salsugineum]
Length=279

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            I+A+IRRP+LFSKLILIGASPRFLNDE+YHGGFE+GEIEKVFSAM+ANYEAWV+GFAPLA
Sbjct  116  IIASIRRPELFSKLILIGASPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVQGFAPLA  175

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VP  +IQ++KD++VP 
Sbjct  176  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPSCVIQTAKDVSVPA  235

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            +VAEY+ ++LGG + VE + TEGHLPHLSAP
Sbjct  236  SVAEYLRAHLGGDTKVETLKTEGHLPHLSAP  266



>ref|XP_006601267.1| PREDICTED: probable strigolactone esterase DAD2-like isoform 
X2 [Glycine max]
Length=266

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+IRRPDLFSKLILIGASPRFLND++YHGGFEQGEIE+VFSAM+ANYEAWV GFAPLA
Sbjct  103  MLASIRRPDLFSKLILIGASPRFLNDKDYHGGFEQGEIEQVFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC I+Q+++D++VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGILGLVNVPCCIMQTARDMSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPE  457
            +VA Y+  ++ GKS ++ + TEGHLPHLSAP 
Sbjct  223  SVATYMRDHIAGKSTIQWLDTEGHLPHLSAPS  254



>ref|XP_006433632.1| hypothetical protein CICLE_v10002180mg [Citrus clementina]
 gb|ESR46872.1| hypothetical protein CICLE_v10002180mg [Citrus clementina]
 gb|KDO81506.1| hypothetical protein CISIN_1g024681mg [Citrus sinensis]
Length=264

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+IRRPDLF+KLILIGASPRFLNDE+YHGGFE+ EI+KVF AM+ANYEAW  G+APLA
Sbjct  101  LLASIRRPDLFTKLILIGASPRFLNDEDYHGGFEEAEIDKVFRAMEANYEAWAYGYAPLA  160

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V +T+F+ DLRG L  V VPC IIQ+SKD++VPV
Sbjct  161  VGADVPAAVREFSRTLFNMRPDISLFVSKTVFDTDLRGILGLVRVPCVIIQTSKDVSVPV  220

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VAEY+  +LGG++ VE++  EGHLPHLSAP +  PV+ R
Sbjct  221  SVAEYLQRHLGGRNTVELLKIEGHLPHLSAPAIVGPVIRR  260



>gb|KFK37836.1| hypothetical protein AALP_AA3G035500 [Arabis alpina]
Length=267

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            I+A+IRRPDLFSKLILIGASPRFLNDE+YHGGFE+GEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  104  IIASIRRPDLFSKLILIGASPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVHGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VP  +IQ++KD++VP 
Sbjct  164  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPSCVIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            +VAEY+  +LGG + VE + TEGHLPHLSAP
Sbjct  224  SVAEYLKDHLGGVTTVETLKTEGHLPHLSAP  254



>ref|XP_010091241.1| hypothetical protein L484_005265 [Morus notabilis]
 gb|EXB43804.1| hypothetical protein L484_005265 [Morus notabilis]
Length=266

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILAAIRRP+LFSKL+L+GASPRFLND++YHGGFE GEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  103  ILAAIRRPELFSKLVLVGASPRFLNDKDYHGGFEHGEIEKVFSAMEANYEAWVSGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RT+FN DLRG L  V VPC ++Q+++D++VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDLRGVLGLVKVPCCVMQTARDVSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+  +LGG++ VE++ TEGHLPHLSAP L    L R
Sbjct  223  SVAGYLRDHLGGRNTVEMLETEGHLPHLSAPALFAQKLRR  262



>ref|XP_004509088.1| PREDICTED: probable esterase D14L-like [Cicer arietinum]
Length=270

 Score =   245 bits (626),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A++ RPDLFSK+IL+ ASPR+LND +Y GGFEQ E++++F AM ANY+AW  GFAP+AV
Sbjct  103  VASVSRPDLFSKIILVSASPRYLNDRDYFGGFEQEELDQLFDAMAANYKAWCSGFAPMAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRT+FNMRPDI+LSV RTIF  D+R  L  VTVPCHIIQS+KDLAVPV
Sbjct  163  GGDMESVAVQEFSRTMFNMRPDISLSVLRTIFQSDIRQILCLVTVPCHIIQSTKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             VAEYIH ++GG S+VEV+STEGHLP LS+P++ IPV+L+HI+HDI A
Sbjct  223  VVAEYIHQHVGGPSVVEVMSTEGHLPQLSSPDVVIPVILKHIRHDIAA  270



>ref|XP_008220326.1| PREDICTED: probable strigolactone esterase DAD2 [Prunus mume]
Length=268

 Score =   245 bits (625),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 141/168 (84%), Gaps = 4/168 (2%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKL+LIGASPRFLND +YHGGFEQ EIEKVFSAM+ANY AWV+GFAPLA
Sbjct  104  ILASIRRPNLFSKLVLIGASPRFLNDRDYHGGFEQEEIEKVFSAMEANYSAWVQGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V R +FN DLRG L  V VPC IIQ++KD++VP 
Sbjct  164  VGADVPAAVREFSRTLFNMRPDISLFVSRAVFNSDLRGVLGLVRVPCCIIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
            +VA Y+  +LGG++ V ++ TEGHLPHLSAP L    L+R ++H + +
Sbjct  224  SVATYLRDHLGGRNTVVMLETEGHLPHLSAPSL----LIRKLRHALSS  267



>gb|KDP41626.1| hypothetical protein JCGZ_16033 [Jatropha curcas]
Length=266

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+I+RP+LFSKLILIGASPRFLND +YHGGFE+ +IE VF+AM+ANYEAWV GFAPLA
Sbjct  103  LLASIKRPELFSKLILIGASPRFLNDVDYHGGFERADIENVFAAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RT+FN DLRG L  V  PC IIQ+++D++VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDLRGILGLVKAPCCIIQTARDVSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            +VAEY+ S+LGG+S VE++ TEGHLPHLSAP L   VL R + 
Sbjct  223  SVAEYLKSHLGGRSTVEILRTEGHLPHLSAPGLLAQVLRRALS  265



>ref|XP_006472297.1| PREDICTED: probable strigolactone esterase D14 homolog [Citrus 
sinensis]
Length=264

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+IRRPDLF+KLILIGASPRFLNDE+YHGGFE+ EI+KVF AM+ANYEAW  G+APLA
Sbjct  101  LLASIRRPDLFTKLILIGASPRFLNDEDYHGGFEEAEIDKVFRAMEANYEAWAYGYAPLA  160

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V +T+F+ DLRG L  V VPC I+Q+SKD++VPV
Sbjct  161  VGADVPAAVREFSRTLFNMRPDISLFVSKTVFDTDLRGILGLVRVPCVIMQTSKDVSVPV  220

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VAEY+  +LGG++ VE++  EGHLPHLSAP +  PV+ R
Sbjct  221  SVAEYLQRHLGGRNTVELLKIEGHLPHLSAPAVVGPVIRR  260



>ref|XP_007222998.1| hypothetical protein PRUPE_ppa010005mg [Prunus persica]
 gb|EMJ24197.1| hypothetical protein PRUPE_ppa010005mg [Prunus persica]
Length=268

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 139/164 (85%), Gaps = 4/164 (2%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKL+LIGASPRFLND +YHGGFEQ EIEKVFSAM+ANY AWV+GFAPLA
Sbjct  104  ILASIRRPNLFSKLVLIGASPRFLNDRDYHGGFEQEEIEKVFSAMEANYSAWVQGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V R +FN DLRG L  V VPC IIQ++KD++VP 
Sbjct  164  VGADVPAAVREFSRTLFNMRPDISLFVSRAVFNSDLRGVLGLVRVPCCIIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
            +VA Y+  +LGG++ V ++ TEGHLPHLSAP L    L+R ++H
Sbjct  224  SVAAYLRDHLGGRNTVVMLETEGHLPHLSAPSL----LIRKLRH  263



>ref|XP_004287973.1| PREDICTED: sigma factor SigB regulation protein RsbQ-like [Fragaria 
vesca subsp. vesca]
Length=270

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +AA+ RPDLF+KL++I ASPR+LND +Y+GGFEQ ++E++F A+++NY+AW  GFAPLAV
Sbjct  103  IAAVMRPDLFTKLVMIAASPRYLNDSDYYGGFEQEDLEQLFEAIRSNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  +  VTVPCHI+QS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRQVIGMVTVPCHILQSVKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V EY+H NLGG+SIVEV+S++GHLP LS+P++ IPVLLRHI+HDI
Sbjct  223  VVTEYLHQNLGGESIVEVMSSDGHLPQLSSPDIVIPVLLRHIRHDI  268



>ref|XP_011074357.1| PREDICTED: probable strigolactone esterase DAD2 [Sesamum indicum]
Length=266

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KLILIGASPRFLND+ YHGGFEQGEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPELFTKLILIGASPRFLNDKNYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI L V RT+FN DLRG L  V VPC IIQ+++D++VP 
Sbjct  163  VGADVPDAVREFSRTLFNMRPDITLFVSRTVFNSDLRGVLGLVRVPCSIIQTARDVSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPEL  460
            +VA+Y+ ++LGG+S V ++  EGHLPHLSAP L
Sbjct  223  SVADYLKNHLGGRSTVHMLDIEGHLPHLSAPNL  255



>ref|XP_010999869.1| PREDICTED: probable strigolactone esterase DAD2 [Populus euphratica]
Length=266

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF KLILIGASPRFLNDE+YHGGFE  EIE VF AM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPELFIKLILIGASPRFLNDEDYHGGFELEEIESVFKAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREF+RTLFNMRPDI L V RT+FN DLRG L  V VPC IIQ+SKD++VP 
Sbjct  163  VGADVPLAVREFTRTLFNMRPDITLFVSRTVFNSDLRGILGLVKVPCCIIQTSKDVSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VAEY+ ++LGG++ VE + TEGHLPHLSAP +  PV+ R
Sbjct  223  SVAEYLKNHLGGENTVETLRTEGHLPHLSAPAMLAPVIKR  262



>emb|CDP01202.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKLILIGASPRFLND +YHGGFE GEIEK+FSAM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPELFSKLILIGASPRFLNDNDYHGGFELGEIEKLFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V R +FN DLRG L  V VPC IIQ++KD +VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDITLFVSRQVFNSDLRGVLGFVKVPCSIIQTAKDCSVPT  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG+S V +++ EGHLPHLSAP L    LLR
Sbjct  223  SVATYLKNHLGGRSTVHMLNLEGHLPHLSAPALLAQELLR  262



>ref|XP_009597842.1| PREDICTED: probable strigolactone esterase DAD2 [Nicotiana tomentosiformis]
Length=268

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKLILIGASPRFLNDE+YHGGFEQGEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIF-NFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VGADVPAAVREFSRTLFNMRPDI L V RT+F N D+RG L  V VPCHI Q+++D +VP
Sbjct  163  VGADVPAAVREFSRTLFNMRPDITLFVSRTVFYNSDMRGVLGLVKVPCHIFQTARDHSVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
             +VA Y+ ++LGG++ V  ++ EGHLPHLSAP L    L R + H
Sbjct  223  ASVATYLKNHLGGRNTVHWLNIEGHLPHLSAPTLLAQELRRALSH  267



>ref|XP_008787185.1| PREDICTED: probable strigolactone esterase D14 [Phoenix dactylifera]
Length=280

 Score =   244 bits (623),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILAAIRR D F KLILIGASPRFLND++YHGGFE+GEIE+VF AM++NYEAWVRGFAPLA
Sbjct  117  ILAAIRRSDAFLKLILIGASPRFLNDKDYHGGFEKGEIERVFEAMESNYEAWVRGFAPLA  176

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC ++Q++KD++VP+
Sbjct  177  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPCVVVQTAKDVSVPL  236

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            +VA Y+ ++LGG++ VE+++TEGHLPHLSAP   I  L R + 
Sbjct  237  SVAAYLKAHLGGRTTVEILNTEGHLPHLSAPAAFITALRRSLS  279



>ref|XP_006829226.1| hypothetical protein AMTR_s00001p00272350 [Amborella trichopoda]
 gb|ERM96642.1| hypothetical protein AMTR_s00001p00272350 [Amborella trichopoda]
Length=270

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+I RPDLF+KL+LI ASPR+LND +Y GGF+Q +++++F AM++NY+AWV GFAPLA
Sbjct  102  VLASIARPDLFTKLVLISASPRYLNDTDYFGGFDQEDLDQLFDAMRSNYQAWVSGFAPLA  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFN+RPDIALSV +TIF  DLR  L RVTVPCHI+QS+KDLAVP
Sbjct  162  VGGDMESPAVQEFSRTLFNIRPDIALSVAQTIFQSDLRDVLGRVTVPCHILQSTKDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
            V V+EY+H +LGG SIVEV+S++GHLP LS+P++ IPVLLRHI++DI A
Sbjct  222  VVVSEYLHLHLGGGSIVEVMSSDGHLPQLSSPDIVIPVLLRHIRYDIAA  270



>ref|XP_003557012.1| PREDICTED: probable strigolactone esterase DAD2-like [Glycine 
max]
Length=266

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+IRRPDLFSKLILIGASPRFLND++YHGGFEQGEIE+VFSAM+ANYEAWV GFAPL+
Sbjct  103  MLASIRRPDLFSKLILIGASPRFLNDKDYHGGFEQGEIEQVFSAMEANYEAWVNGFAPLS  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+F+ DLRG L  V VPC I+Q+++D++VP 
Sbjct  163  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFHSDLRGILGLVNVPCCIMQTARDMSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPE  457
            +VA Y+  ++GGKS ++ + TEGHLPHLSAP 
Sbjct  223  SVATYMKDHIGGKSSIQWLDTEGHLPHLSAPS  254



>gb|AFK34773.1| unknown [Lotus japonicus]
Length=271

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLFSKLI + ASPR+LND +Y GGFEQ +++++F AM ANY+AW  G+AP+A+
Sbjct  104  IASISRPDLFSKLIAVSASPRYLNDVDYFGGFEQEDLDQLFDAMAANYKAWCSGWAPMAI  163

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  LS VTVPCHIIQS KDLAVPV
Sbjct  164  GGDMESVAVQEFSRTLFNMRPDIALSVLQTIFQSDMRQVLSLVTVPCHIIQSKKDLAVPV  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             VAEY+H ++GG+SIVEV+STEGHLP LS+P++ +PVLLRHI HDI A
Sbjct  224  VVAEYLHQHVGGESIVEVMSTEGHLPQLSSPDIVVPVLLRHICHDIAA  271



>gb|KHG16187.1| Sigma factor sigB regulation rsbQ [Gossypium arboreum]
Length=275

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IR P LFSKLILIGASPRFLNDE YHGGFE GEIE+VFSAM+ANYEAWV GFAP+ 
Sbjct  112  ILASIRCPQLFSKLILIGASPRFLNDENYHGGFEVGEIEEVFSAMEANYEAWVNGFAPVL  171

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V RTIFN DLRG L +V VPC +IQ++KD++VP 
Sbjct  172  VGADVPTAVREFSRTLFNMRPDISLFVSRTIFNSDLRGELGKVRVPCCVIQTAKDVSVPA  231

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VAEY+ ++LGG++ VE++ TEGHLPHL+AP L   VL R
Sbjct  232  SVAEYLKTHLGGRTTVEILRTEGHLPHLTAPVLLAQVLRR  271



>ref|XP_002882324.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH58583.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=267

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            I+A+IRRP+LFSKLILIG SPRFLNDE+YHGGFE+GEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  104  IIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVHGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VP  +IQ++KD++VP 
Sbjct  164  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGFVRVPTCVIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            +VAEY+ S+LGG + VE + TEGHLPHLSAP
Sbjct  224  SVAEYLRSHLGGDTTVETLKTEGHLPHLSAP  254



>ref|XP_009354089.1| PREDICTED: probable strigolactone esterase DAD2 [Pyrus x bretschneideri]
Length=267

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 138/164 (84%), Gaps = 4/164 (2%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKL+LIGASPRFLND +YHGGFEQ EIEKVFSAM+ANYEAWV+GFAPLA
Sbjct  104  ILASIRRPELFSKLVLIGASPRFLNDRDYHGGFEQEEIEKVFSAMEANYEAWVQGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V R +FN DLRG L  V VPC IIQ++KD++VP 
Sbjct  164  VGADVPTAVREFSRTLFNMRPDISLFVSRAVFNSDLRGVLGLVRVPCWIIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
            +VA Y+  +LGG++ V ++ TEGHLPHLSAP L    L R ++H
Sbjct  224  SVANYLRDHLGGRNTVVILETEGHLPHLSAPGL----LARKLRH  263



>ref|XP_007160910.1| hypothetical protein PHAVU_001G027400g [Phaseolus vulgaris]
 gb|ESW32904.1| hypothetical protein PHAVU_001G027400g [Phaseolus vulgaris]
Length=266

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+IRRP+LFSKLILIGASPRFLND++YHGGFEQGEIE+VFSAM+ANYEAWV GFAPLA
Sbjct  103  MLASIRRPELFSKLILIGASPRFLNDKDYHGGFEQGEIEQVFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  V+VPC I+Q+++D++VP 
Sbjct  163  VGADVPTAVREFSRTLFNMRPDISLFVSRTVFNSDLRGILGLVSVPCCIMQTARDMSVPE  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
             VA+Y+  ++GGKS ++ + T+GHLPHLSAP
Sbjct  223  TVAKYMKEHIGGKSTIQWLDTDGHLPHLSAP  253



>ref|XP_008362739.1| PREDICTED: probable strigolactone esterase DAD2 [Malus domestica]
Length=267

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 138/164 (84%), Gaps = 4/164 (2%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKL+LIGASPRFLND +YHGGFEQ EIE+VFSAM+ANYEAWV GFAPLA
Sbjct  104  ILASIRRPELFSKLVLIGASPRFLNDRDYHGGFEQEEIERVFSAMEANYEAWVNGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC IIQ++KD++VP 
Sbjct  164  VGADVPTAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPCWIIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
            +VA Y+  +LGG++ V ++ TEGHLPHLSAP +    L R ++H
Sbjct  224  SVANYLRDHLGGRNTVVILETEGHLPHLSAPGM----LARKLRH  263



>ref|XP_009130408.1| PREDICTED: probable strigolactone esterase D14 homolog [Brassica 
rapa]
 emb|CDY50870.1| BnaA05g37310D [Brassica napus]
Length=267

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            I+A+IRRP+LF+KLILIGASPRFLNDE+YHGGFE+GEIEKVFSAM+ANYEAWV+G+APLA
Sbjct  104  IIASIRRPELFTKLILIGASPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVQGYAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VP  +IQ++KD++VP 
Sbjct  164  VGADVPEAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPSCVIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            +VAEY+ ++LGG + VE + TEGHLPHLSAP
Sbjct  224  SVAEYLRAHLGGDTTVETLKTEGHLPHLSAP  254



>ref|XP_003562367.1| PREDICTED: probable esterase D14L [Brachypodium distachyon]
Length=271

 Score =   243 bits (619),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+I RPDLFSKL+L+ ASPR+LND +Y+GGFEQ E++++F A+++NY+AW  GFAPL 
Sbjct  103  VLASISRPDLFSKLVLLSASPRYLNDVDYYGGFEQEELDELFEAIRSNYKAWCSGFAPLC  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFN+RPDIALSV +TIF  D+R  LS VTVPCHI+QS+KDLAVP
Sbjct  163  VGGDLESVAVQEFSRTLFNIRPDIALSVAQTIFQSDVRSLLSLVTVPCHIVQSTKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H +LGG SIVEV+ +EGHLP LS+P++  PVLLRHIQHDI
Sbjct  223  VVVSEYLHKHLGGDSIVEVMPSEGHLPQLSSPDIVTPVLLRHIQHDI  269



>ref|XP_008805678.1| PREDICTED: probable strigolactone esterase DAD2 [Phoenix dactylifera]
Length=281

 Score =   243 bits (620),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILAAIRRPD F KLILIGASPRFLNDEEYHGGF +GEIE V +AM++NYEAWVRGFAPLA
Sbjct  117  ILAAIRRPDAFLKLILIGASPRFLNDEEYHGGFGEGEIETVLAAMESNYEAWVRGFAPLA  176

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI L V RT+FN DLRG L  V VPC I+Q++KD++VP+
Sbjct  177  VGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDLRGVLGLVQVPCVIVQTAKDVSVPL  236

Query  362  AVAEYIHSNLGGKSIVEVV-STEGHLPHLSAPELTIPVLLRHIQ  490
            +VA Y+   LGG++ +EV+  TEGHLPHLSAP   +PV+ R + 
Sbjct  237  SVARYLKDRLGGRTTIEVLHHTEGHLPHLSAPAALVPVIRRSLS  280



>ref|XP_004498996.1| PREDICTED: probable strigolactone esterase DAD2-like [Cicer arietinum]
Length=267

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLND-EEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPL  178
            +LA+IRRP+LFSKLILIGASPRFLND E YHGGFEQGEIE+VFSAM+ANYEAWV GFAPL
Sbjct  103  MLASIRRPELFSKLILIGASPRFLNDGENYHGGFEQGEIEQVFSAMEANYEAWVNGFAPL  162

Query  179  AVGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            AVGADVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  V+VPC I+Q+++D++VP
Sbjct  163  AVGADVPTAVREFSRTLFNMRPDISLFVARTVFNSDLRGILGLVSVPCCIMQTARDMSVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
              VA Y+  +LGGKS V+ + TEGHLPHLSAP
Sbjct  223  ATVATYMKEHLGGKSTVQWLDTEGHLPHLSAP  254



>emb|CDY42894.1| BnaC05g47570D [Brassica napus]
Length=311

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            I+A+IRRP+LF+KLILIGASPRFLNDE+YHGGFE+GEIEKVFSAM+ANYEAWV+G+APLA
Sbjct  148  IIASIRRPELFTKLILIGASPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVQGYAPLA  207

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VP  +IQ++KD++VP 
Sbjct  208  VGADVPEAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPSCVIQTAKDVSVPA  267

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            +VAEY+ ++LGG + VE + TEGHLPHLSAP
Sbjct  268  SVAEYLRAHLGGDTTVETLKTEGHLPHLSAP  298



>ref|NP_001132725.1| Sigma factor sigB regulation protein rsbQ [Zea mays]
 gb|ACF81696.1| unknown [Zea mays]
 gb|ACG38947.1| sigma factor sigB regulation protein rsbQ [Zea mays]
 gb|ACG42200.1| sigma factor sigB regulation protein rsbQ [Zea mays]
 tpg|DAA45888.1| TPA: Sigma factor sigB regulation protein rsbQ [Zea mays]
Length=271

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RPDLF+KL+L+ ASPR+LND +Y+GGFEQ E++++F AM++NY+AW  GFAPL V
Sbjct  104  LASISRPDLFTKLVLLSASPRYLNDVDYYGGFEQDELDELFEAMRSNYKAWCSGFAPLCV  163

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFN+RPDIALSV +TIF  D+R  L  VTVPCHI+QS+KDLAVPV
Sbjct  164  GGDMESVAVQEFSRTLFNIRPDIALSVAQTIFQSDVRSLLPHVTVPCHIVQSTKDLAVPV  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H +LGG SIVEV+ +EGHLP LS+P++ IPVLLRHIQHDI
Sbjct  224  VVSEYLHRHLGGDSIVEVMPSEGHLPQLSSPDIVIPVLLRHIQHDI  269



>ref|XP_002524966.1| sigma factor sigb regulation protein rsbq, putative [Ricinus 
communis]
 gb|EEF37463.1| sigma factor sigb regulation protein rsbq, putative [Ricinus 
communis]
Length=270

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLF+K+++I ASPR+LND +Y+GGFEQ ++ ++F AM+ANY+AW  GFAPLA
Sbjct  102  VVASISRPDLFTKIVMISASPRYLNDVDYYGGFEQEDLNQLFEAMEANYKAWCSGFAPLA  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  V+VPCHI+QS KDLAVP
Sbjct  162  VGGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRSILHMVSVPCHIVQSGKDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
            V V+EY+H NLG +SI EV+ST+GHLP LS+P++ IPVLLRHI+H+I A
Sbjct  222  VVVSEYLHQNLGSESIAEVMSTDGHLPQLSSPDVVIPVLLRHIRHNITA  270



>gb|KDP32035.1| hypothetical protein JCGZ_12496 [Jatropha curcas]
Length=270

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLFSKL++I  SPR+LND +Y+GGFEQ ++ ++F AM++NY+AW  GFAPLAV
Sbjct  103  IASISRPDLFSKLVMISGSPRYLNDVDYYGGFEQEDLNQLFEAMESNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV RTIF  D+R  L  +TVPCHI+QS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVARTIFQSDMRQILHLITVPCHIVQSGKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             V+EY+H NLG +SIVEV+S++GHLP LS+P++ IPVLLRHI++DI A
Sbjct  223  VVSEYLHQNLGSESIVEVMSSDGHLPQLSSPDIVIPVLLRHIRYDIAA  270



>ref|XP_010271812.1| PREDICTED: probable esterase D14L [Nelumbo nucifera]
Length=270

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA++ RPDLFSKLI+I +SPR+LND EY+GGFEQ +++++F+AM+ NY+AW  GFAPLAV
Sbjct  103  LASVARPDLFSKLIMISSSPRYLNDAEYYGGFEQEDLDQLFNAMRENYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFN+RPDIALSV +TIF  DLR  L  VTVPCHI+QSSKDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNIRPDIALSVAQTIFQSDLRQVLGLVTVPCHILQSSKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLGG+SIVEV++++GHLP LS+P++ IPVLLRHI  DI
Sbjct  223  VVSEYLHRNLGGESIVEVMASDGHLPQLSSPDVVIPVLLRHIHFDI  268



>ref|XP_010517275.1| PREDICTED: probable strigolactone esterase D14 homolog [Camelina 
sativa]
Length=267

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            I+A+IRRP+LFSKLILIG SPRFLNDE+YHGGFE+GEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  104  IIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVHGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VP  +IQ++KD++VP 
Sbjct  164  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPTCVIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            +VAEY+ ++LGG + VE + TEGHLPHLSAP
Sbjct  224  SVAEYLRNHLGGDTTVEQLKTEGHLPHLSAP  254



>ref|XP_008362748.1| PREDICTED: probable strigolactone esterase DAD2 [Malus domestica]
Length=267

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 137/164 (84%), Gaps = 4/164 (2%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKL+LIGASPRFLND +YHGGFEQ EIEKVFSAM+ANYEAWV GFAPLA
Sbjct  104  ILASIRRPELFSKLVLIGASPRFLNDRDYHGGFEQEEIEKVFSAMEANYEAWVHGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V R +FN DLRG L  V VPC IIQ++KD++VP 
Sbjct  164  VGADVPTAVREFSRTLFNMRPDISLFVSRAVFNSDLRGVLGLVRVPCWIIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
            +VA Y+  +LGG++ V ++ TEGHLPHLSAP L    L R ++H
Sbjct  224  SVANYLRDHLGGRNTVVILETEGHLPHLSAPGL----LARKLRH  263



>ref|XP_002465088.1| hypothetical protein SORBIDRAFT_01g031880 [Sorghum bicolor]
 gb|EER92086.1| hypothetical protein SORBIDRAFT_01g031880 [Sorghum bicolor]
Length=271

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RPDLF+KL+L+ ASPR+LND +Y+GGFEQ E++++F AM++NY+AW  GFAPL V
Sbjct  104  LASISRPDLFTKLVLLSASPRYLNDVDYYGGFEQDELDELFEAMRSNYKAWCSGFAPLCV  163

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFN+RPDIALSV +TIF  D+R  L  V+VPCHIIQS+KDLAVPV
Sbjct  164  GGDMESVAVQEFSRTLFNIRPDIALSVAQTIFQSDVRSLLPLVSVPCHIIQSTKDLAVPV  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H +LGG SIVEV+ +EGHLP LS+P++ IPVLLRHIQHDI
Sbjct  224  VVSEYLHKHLGGDSIVEVMPSEGHLPQLSSPDIVIPVLLRHIQHDI  269



>gb|AAM65892.1| unknown [Arabidopsis thaliana]
Length=267

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            I+A+IRRP+LFSKLILIG SPRFLNDE+YHGGFE+GEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  104  IIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVHGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VP  +IQ++KD++VP 
Sbjct  164  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPTCVIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            +VAEY+ S+LGG++ VE + TEGHLP LSAP
Sbjct  224  SVAEYLRSHLGGETTVETLKTEGHLPQLSAP  254



>ref|XP_004149700.1| PREDICTED: sigma factor SigB regulation protein RsbQ-like [Cucumis 
sativus]
 ref|XP_004168505.1| PREDICTED: sigma factor SigB regulation protein RsbQ-like [Cucumis 
sativus]
 gb|KGN61970.1| hypothetical protein Csa_2G277610 [Cucumis sativus]
Length=270

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RPDLF K+I++  SPR+LNDE Y GGFEQ ++E++F AMQ+NY+AW  GFAPLAV
Sbjct  103  LASITRPDLFQKIIMLSPSPRYLNDENYFGGFEQEDLEQLFQAMQSNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  LS VTVPCHIIQS KD+AVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRNILSFVTVPCHIIQSMKDMAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLGG SIVEV+ ++GHLP LS+P   IPVLL+HI++DI
Sbjct  223  VVSEYLHRNLGGNSIVEVMESDGHLPQLSSPNTVIPVLLKHIKYDI  268



>ref|XP_007205717.1| hypothetical protein PRUPE_ppa009957mg [Prunus persica]
 gb|EMJ06916.1| hypothetical protein PRUPE_ppa009957mg [Prunus persica]
Length=270

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +AAI RPDLF+KL+++GASPR+LND +Y+GGFEQ ++E++F A+++NY+AW  GFAP+AV
Sbjct  103  IAAITRPDLFTKLVMVGASPRYLNDVDYYGGFEQEDLEQLFDAIRSNYKAWCSGFAPMAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D R  L  +TVPCHI+QS KDLAVPV
Sbjct  163  GGDLDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDTRQILHLITVPCHILQSVKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             V EY+H NLGG+SIVEV+S++GHLP LS+P++ IPV+LRHI++DI A
Sbjct  223  VVTEYLHQNLGGESIVEVMSSDGHLPQLSSPDIVIPVMLRHIRYDIAA  270



>ref|XP_006296725.1| hypothetical protein CARUB_v10014401mg [Capsella rubella]
 gb|EOA29623.1| hypothetical protein CARUB_v10014401mg [Capsella rubella]
Length=267

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            I+A+IRRP+LFSKLILIG SPRFLNDE+YHGGFE+GEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  104  IIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVHGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VP  +IQ++KD++VP 
Sbjct  164  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPTCVIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            +VAEY+ ++LGG + VE + TEGHLPHLSAP
Sbjct  224  SVAEYLRAHLGGDTTVEQLKTEGHLPHLSAP  254



>ref|XP_003589086.1| Sigma factor sigB regulation protein rsbQ [Medicago truncatula]
 gb|AES59337.1| sigma factor sigb regulation rsbq-like protein [Medicago truncatula]
Length=268

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLND-EEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPL  178
            +LA+IRRP+LFSKLILIGASPRFLND E YHGGFEQGEIE+VFSAM+ANYEAWV GFAPL
Sbjct  104  MLASIRRPELFSKLILIGASPRFLNDGENYHGGFEQGEIEQVFSAMEANYEAWVNGFAPL  163

Query  179  AVGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            AVGADVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC I+Q+++D++VP
Sbjct  164  AVGADVPTAVREFSRTLFNMRPDISLFVSRTVFNSDLRGILGLVKVPCCIMQTARDMSVP  223

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
              VA Y+  +LGGKS V+ + TEGHLPHLSAP
Sbjct  224  ATVATYMKEHLGGKSTVQWLDTEGHLPHLSAP  255



>ref|NP_566220.1| putative strigolactone esterase D14 [Arabidopsis thaliana]
 sp|Q9SQR3.1|D14_ARATH RecName: Full=Probable strigolactone esterase D14 homolog; AltName: 
Full=Protein DWARF-14; Short=AtD14 [Arabidopsis thaliana]
 pdb|4IH4|A Chain A, Crystal Structure Of Arabidopsis Dwarf14 Orthologue, 
Atd14
 pdb|4IH4|B Chain B, Crystal Structure Of Arabidopsis Dwarf14 Orthologue, 
Atd14
 pdb|4IH4|C Chain C, Crystal Structure Of Arabidopsis Dwarf14 Orthologue, 
Atd14
 pdb|4IH4|D Chain D, Crystal Structure Of Arabidopsis Dwarf14 Orthologue, 
Atd14
 gb|AAF05858.1|AC011698_9 unknown protein [Arabidopsis thaliana]
 gb|AAL36052.1| AT3g03990/T11I18_10 [Arabidopsis thaliana]
 gb|AAM19918.1| AT3g03990/T11I18_10 [Arabidopsis thaliana]
 gb|AEE74023.1| putative strigolactone esterase D14 [Arabidopsis thaliana]
Length=267

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            I+A+IRRP+LFSKLILIG SPRFLNDE+YHGGFE+GEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  104  IIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVHGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VP  +IQ++KD++VP 
Sbjct  164  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPTCVIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            +VAEY+ S+LGG + VE + TEGHLP LSAP
Sbjct  224  SVAEYLRSHLGGDTTVETLKTEGHLPQLSAP  254



>ref|XP_009342785.1| PREDICTED: probable esterase KAI2 [Pyrus x bretschneideri]
Length=270

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +AAI RPDLF+KL++I ASPR+LND +Y+GGFEQ ++E++F A+++NY+AW  GFAPLAV
Sbjct  103  IAAITRPDLFTKLVMIAASPRYLNDVDYYGGFEQEDLEQLFEAIRSNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  DLR  L  +TVPCHI+QS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDLRQMLGLITVPCHILQSVKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLGG+SIVEV+S++GHLP LS+PE+  PVLL+HI++DI
Sbjct  223  VVSEYLHQNLGGESIVEVMSSDGHLPQLSSPEIVNPVLLKHIRYDI  268



>ref|XP_006849318.1| hypothetical protein AMTR_s00164p00017630 [Amborella trichopoda]
 gb|ERN10899.1| hypothetical protein AMTR_s00164p00017630 [Amborella trichopoda]
Length=268

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
             LA++RRP+LF KL+LIGASPRFLND +YHGGFE GEIEKVF AMQANY AWV GFAP+A
Sbjct  104  CLASLRRPNLFQKLVLIGASPRFLNDRDYHGGFEHGEIEKVFGAMQANYAAWVAGFAPMA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP  VREFSRTLFNMRPDI+L V RTIFN DLRG LS V  PC+IIQ++KD++VP 
Sbjct  164  VGADVPEVVREFSRTLFNMRPDISLFVCRTIFNSDLRGMLSSVKTPCYIIQTAKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA YI ++LGGK+ ++++ TEGHLPHLSAP L    L R
Sbjct  224  SVALYIKAHLGGKATIDMMPTEGHLPHLSAPALLHQALRR  263



>ref|XP_006380654.1| hydrolase family protein [Populus trichocarpa]
 gb|ABK96467.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP58451.1| hydrolase family protein [Populus trichocarpa]
Length=270

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLFSK++++ ASPR+LND +Y+GGFEQ +++++F AMQ NY+AW  GFAPLAV
Sbjct  103  IASISRPDLFSKIVMLSASPRYLNDVDYYGGFEQEDLDQLFEAMQNNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  VTVPCHI+QS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRSILHMVTVPCHILQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
              AEY+H NLGG+SIVEV+S++GHLP LS+P++ IPVLL+HI+++I
Sbjct  223  VAAEYLHQNLGGESIVEVMSSDGHLPQLSSPDIVIPVLLKHIRYNI  268



>ref|XP_010463870.1| PREDICTED: probable strigolactone esterase D14 homolog [Camelina 
sativa]
 ref|XP_010485769.1| PREDICTED: probable strigolactone esterase D14 homolog [Camelina 
sativa]
Length=267

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            I+A+IRRP+LFSKLILIG SPRFLNDE+YHGGFE+GEIEKVFSAM+ANYEAWV GFAPLA
Sbjct  104  IIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVHGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VP  +IQ+ KD++VP 
Sbjct  164  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPTCVIQTVKDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            +VAEY+ ++LGG + VE + TEGHLPHLSAP
Sbjct  224  SVAEYLRTHLGGDTTVEQLKTEGHLPHLSAP  254



>ref|XP_011006779.1| PREDICTED: probable esterase KAI2 [Populus euphratica]
Length=270

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLFSK++++ ASPR+LND +Y+GGFEQ +++++F AMQ NY+AW  GFAPLAV
Sbjct  103  IASISRPDLFSKIVMLSASPRYLNDVDYYGGFEQEDLDQLFEAMQNNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  VTVPCHI+QS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRSILHMVTVPCHILQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
              AEY+H NLGG+SIVEV+S++GHLP LS+P++ IPVLL+HI+++I
Sbjct  223  VAAEYLHQNLGGESIVEVMSSDGHLPQLSSPDIVIPVLLKHIRYNI  268



>ref|XP_009614275.1| PREDICTED: probable esterase KAI2 [Nicotiana tomentosiformis]
Length=270

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLF+KL+ + ASPR+LND +Y+GGFEQ +++++F AM++NY+AW  GFAPL 
Sbjct  102  VIASIARPDLFTKLVTVSASPRYLNDSDYYGGFEQEDLDQLFEAMRSNYKAWCSGFAPLV  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + A++EFSRTLFNMRPDIALSV + IF  DLR  L+RVTVPCHIIQS KDLAVP
Sbjct  162  VGGDMDSVAIQEFSRTLFNMRPDIALSVLQIIFLSDLRHLLARVTVPCHIIQSMKDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H +LGG+SIVEV+STEGHLP LS+P++ IPVLLRHI+H I
Sbjct  222  VVVSEYLHQHLGGESIVEVMSTEGHLPQLSSPDVVIPVLLRHIRHVI  268



>ref|XP_008457773.1| PREDICTED: probable esterase KAI2 [Cucumis melo]
Length=270

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF K+I++  SPR+LNDE Y GGFEQ ++E++F AMQ+NY+AW  GFAPLAV
Sbjct  103  VASITRPDLFQKIIMLSPSPRYLNDENYFGGFEQEDLEQLFQAMQSNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  LS VTVPCHIIQS KD+AVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRNILSFVTVPCHIIQSMKDMAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLGG SIVEV+ ++GHLP LS+P + IPVLL+HI++DI
Sbjct  223  VVSEYLHRNLGGDSIVEVMESDGHLPQLSSPNIVIPVLLKHIKYDI  268



>ref|XP_009421091.1| PREDICTED: probable esterase D14L [Musa acuminata subsp. malaccensis]
Length=273

 Score =   241 bits (614),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLFSKL+++ ASPR+LND +Y GGFEQ E++++F AM++NY+AWV GFAPLAV
Sbjct  106  IASISRPDLFSKLVMLSASPRYLNDVDYFGGFEQEELDQLFDAMRSNYKAWVSGFAPLAV  165

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFN+RPDIAL V +TIF  DLR  L  V VPCHI+QSSKDLAVPV
Sbjct  166  GGDMDSVAVQEFSRTLFNIRPDIALCVAQTIFQSDLREILGLVMVPCHILQSSKDLAVPV  225

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLGG+SIVEV+S+EGHLP LS+P++ IPVLLRHI++DI
Sbjct  226  VVSEYLHRNLGGESIVEVMSSEGHLPQLSSPDIVIPVLLRHIRYDI  271



>ref|XP_003550307.1| PREDICTED: probable strigolactone esterase DAD2-like isoform 
X1 [Glycine max]
Length=269

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 134/155 (86%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPR---FLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFA  172
            +LA+IRRPDLFSKLILIGASPR   FLND++YHGGFEQGEIE+VFSAM+ANYEAWV GFA
Sbjct  103  MLASIRRPDLFSKLILIGASPRYNKFLNDKDYHGGFEQGEIEQVFSAMEANYEAWVNGFA  162

Query  173  PLAVGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLA  352
            PLAVGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC I+Q+++D++
Sbjct  163  PLAVGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGILGLVNVPCCIMQTARDMS  222

Query  353  VPVAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPE  457
            VP +VA Y+  ++ GKS ++ + TEGHLPHLSAP 
Sbjct  223  VPASVATYMRDHIAGKSTIQWLDTEGHLPHLSAPS  257



>ref|XP_009354090.1| PREDICTED: probable strigolactone esterase DAD2 [Pyrus x bretschneideri]
Length=267

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 137/164 (84%), Gaps = 4/164 (2%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKL+LIGASPRFLND +YHGGFE  EIEKVFSAM+ANYEAWV GFAPLA
Sbjct  104  ILASIRRPELFSKLVLIGASPRFLNDRDYHGGFEHEEIEKVFSAMEANYEAWVNGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC IIQ+++D++VP 
Sbjct  164  VGADVPTAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPCWIIQTARDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
            +VA Y+  +LGG++ V ++ TEGHLPHLSAP +    L R ++H
Sbjct  224  SVANYLRDHLGGRNTVVILETEGHLPHLSAPGM----LARKLRH  263



>ref|XP_003608457.1| Sigma factor sigB regulation protein rsbQ [Medicago truncatula]
 gb|AES90654.1| sigma factor sigb regulation rsbq-like protein [Medicago truncatula]
Length=270

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+K+ILI ASPR+LND +Y GGFEQ +++++F AM +NY++W  GFAP+AV
Sbjct  103  VASISRPDLFNKIILISASPRYLNDRDYFGGFEQEDLDQLFDAMASNYKSWCSGFAPMAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  VTVPCHIIQS KDLAVPV
Sbjct  163  GGDMESVAVQEFSRTLFNMRPDIALSVLQTIFKSDMRQILCMVTVPCHIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             VAEY+H ++G +SIVEV+STEGHLP LS+P++ IPV+L+HI+HDI A
Sbjct  223  VVAEYLHQHVGSESIVEVMSTEGHLPQLSSPDVVIPVILKHIRHDIAA  270



>gb|ABR18336.1| unknown [Picea sitchensis]
Length=267

 Score =   240 bits (612),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+I RPDLFSK+I I ASPR+LND +Y GGFEQ ++ ++F AMQ+N++AWV GFAPLA
Sbjct  101  ILASIERPDLFSKIITISASPRYLNDIDYFGGFEQEDLNQLFEAMQSNFKAWVSGFAPLA  160

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VGAD+ + AV+EFSRTLFN+RPDIALSV +TIF  D+R  L  VTVPCHI+QSSKDLAVP
Sbjct  161  VGADLDSMAVQEFSRTLFNVRPDIALSVAKTIFQSDMRSMLPHVTVPCHILQSSKDLAVP  220

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            V VA+YIH NLG KSIVE++ +EGHLP LS+P + IPVLLRHI+
Sbjct  221  VTVADYIHQNLGAKSIVEILPSEGHLPQLSSPAIVIPVLLRHIE  264



>ref|NP_001050445.1| Os03g0437600 [Oryza sativa Japonica Group]
 sp|Q10J20.1|D14L_ORYSJ RecName: Full=Probable esterase D14L; AltName: Full=Protein DWARF-14-like; 
Short=Protein D14-like [Oryza sativa Japonica 
Group]
 gb|ABF96818.1| hydrolase, alpha/beta fold family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12359.1| Os03g0437600 [Oryza sativa Japonica Group]
 dbj|BAG96447.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87846.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96649.1| unnamed protein product [Oryza sativa Japonica Group]
Length=271

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLFSKL+L+ ASPR+LND +Y+GGFEQ +++++F AM +NY+AW  GFAPL V
Sbjct  104  IASISRPDLFSKLVLLSASPRYLNDVDYYGGFEQEDLDELFEAMGSNYKAWCSGFAPLCV  163

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFN+RPDIALSV +TIF  D+R  L  VTVPCHI+QS+KDLAVPV
Sbjct  164  GGDMESVAVQEFSRTLFNIRPDIALSVAQTIFQSDVRSLLPLVTVPCHIVQSTKDLAVPV  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H +LGG SIVEV+ +EGHLP LS+P++ IPVLLRHIQHDI
Sbjct  224  VVSEYLHKHLGGDSIVEVMPSEGHLPQLSSPDIVIPVLLRHIQHDI  269



>gb|AFK41000.1| unknown [Medicago truncatula]
Length=270

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+K+ILI ASPR+LND +Y GGFEQ +++++F AM +NY++W  GFAP+AV
Sbjct  103  VASISRPDLFNKIILISASPRYLNDRDYFGGFEQEDLDQLFDAMASNYKSWCSGFAPMAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  VTVPCHIIQS KDLAVPV
Sbjct  163  GGDMESVAVQEFSRTLFNMRPDIALSVLQTIFKSDMRQILCMVTVPCHIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             VAEY+H ++G +SIVEV+STEGHLP LS+P++ +PV+L+HI+HDI A
Sbjct  223  VVAEYLHQHVGSESIVEVMSTEGHLPQLSSPDVVVPVILKHIRHDIAA  270



>ref|XP_009587492.1| PREDICTED: probable esterase D14L [Nicotiana tomentosiformis]
Length=271

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A++ RPDLF+KL+ +  SPR+LND +Y+GGFEQ +++++F AM++NY+AW  GFAPLAV
Sbjct  103  IASVARPDLFTKLVTLSGSPRYLNDVDYYGGFEQEDLDQLFEAMRSNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV + IF  DLR  L  VTVPCHIIQS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVLQIIFQSDLRHLLPHVTVPCHIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDAD  508
             V+EY+H NLGG SIVEV+ST+GHLP LS+P++ IPVLLRHI++DI  D
Sbjct  223  VVSEYLHQNLGGGSIVEVMSTDGHLPQLSSPDVVIPVLLRHIRYDIAVD  271



>gb|ACN33568.1| unknown [Zea mays]
 gb|AFW88164.1| sigma factor sigB regulation protein rsbQ [Zea mays]
Length=271

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RPDLF+KL+L+ ASPR+LND +Y+GGFEQ E++++F AMQ+NY+AW  GFAPL V
Sbjct  104  LASISRPDLFTKLVLLSASPRYLNDVDYYGGFEQDELDELFEAMQSNYKAWCLGFAPLCV  163

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFN+RPDIAL+V +TIF  D+R  L  V+VPCHI+QS+KDLAVPV
Sbjct  164  GGDMESVAVQEFSRTLFNIRPDIALNVAQTIFQSDVRSLLPHVSVPCHIVQSTKDLAVPV  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H +LGG SIVEV+ +EGHLP LS+P++  PVLLRHIQHDI
Sbjct  224  VVSEYLHRHLGGDSIVEVMPSEGHLPQLSSPDIVTPVLLRHIQHDI  269



>ref|NP_001151350.1| sigma factor sigB regulation protein rsbQ [Zea mays]
 gb|ACG42478.1| sigma factor sigB regulation protein rsbQ [Zea mays]
Length=271

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RPDLF+KL+L+ ASPR+LND +Y+GGFEQ E++++F AMQ+NY+AW  GFAPL V
Sbjct  104  LASISRPDLFTKLVLLSASPRYLNDVDYYGGFEQDELDELFEAMQSNYKAWCLGFAPLCV  163

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFN+RPDIAL+V +TIF  D+R  L  V+VPCHI+QS+KDLAVPV
Sbjct  164  GGDMESVAVQEFSRTLFNIRPDIALNVAQTIFQSDVRSLLPHVSVPCHIVQSTKDLAVPV  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H +LGG SIVEV+ +EGHLP LS+P++  PVLLRHIQHDI
Sbjct  224  VVSEYLHRHLGGDSIVEVMPSEGHLPQLSSPDIVTPVLLRHIQHDI  269



>ref|XP_010942800.1| PREDICTED: probable strigolactone esterase DAD2 [Elaeis guineensis]
Length=279

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILAAIRRPD F KLILIGASPRFLND++Y GGFE+GEIE+VF AM++NYEAWVRGFAPLA
Sbjct  116  ILAAIRRPDAFLKLILIGASPRFLNDKDYIGGFEKGEIERVFVAMESNYEAWVRGFAPLA  175

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+F+ DLRG L  V VPC I+Q++KD++VP+
Sbjct  176  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFHSDLRGVLGVVRVPCVIVQTAKDVSVPL  235

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHI  487
            +VA Y+ ++LGG++ VE+++TEGHLPHLSAP   +  L R +
Sbjct  236  SVAAYLKTHLGGRTTVEILNTEGHLPHLSAPAAFVTALRRSL  277



>ref|XP_003539309.1| PREDICTED: probable esterase KAI2-like [Glycine max]
 gb|KHN12972.1| Sigma factor sigB regulation protein rsbQ [Glycine soja]
Length=272

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+KLI++GASPR+LND EY+GGFEQ +++++F AM ANY+AW  GFAPLAV
Sbjct  103  IASISRPDLFTKLIMVGASPRYLNDVEYYGGFEQEDLDQLFDAMAANYKAWCYGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIAL V RTIF  D+R  LS V+VPCHIIQ+ KD+AVP+
Sbjct  163  GGDMESVAVQEFSRTLFNMRPDIALIVSRTIFQSDMRQILSLVSVPCHIIQAEKDMAVPM  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             ++EY+H ++G +SIVEV++T+GHLP LS+P+  IPVLL+HIQ DI+A
Sbjct  223  MISEYLHQHIGAESIVEVMATDGHLPQLSSPDTVIPVLLKHIQLDIEA  270



>ref|XP_010277133.1| PREDICTED: probable esterase D14L [Nelumbo nucifera]
Length=270

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RPDLFSKLI I ASPR+LND +Y+GGFEQ +++++F AM+ NY+AW  GFAPLAV
Sbjct  103  LASIARPDLFSKLITISASPRYLNDVDYYGGFEQEDLDQLFEAMRENYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFN+RPDIALSV +TIF  D R  L  VTVPCHI+QSSKDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNIRPDIALSVAQTIFQSDFRQVLRLVTVPCHILQSSKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             V+EY+H NLGG+SI EV+ ++GHLP LS+P++ IPVLLRHI+HDI A
Sbjct  223  VVSEYLHRNLGGESIAEVMPSDGHLPQLSSPDVVIPVLLRHIRHDIAA  270



>ref|XP_006339831.1| PREDICTED: probable esterase KAI2-like [Solanum tuberosum]
Length=272

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A++ RPDLF+KL+ +  SPR+LND +Y+GGFEQ +++++F AM++NY+AW  GFAPLA+
Sbjct  103  IASVARPDLFTKLVTVSGSPRYLNDVDYYGGFEQEDLDQLFEAMRSNYKAWCSGFAPLAI  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV + IF  DLR  L  VTVPCHIIQS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVLQIIFQSDLRHMLPHVTVPCHIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDAD  508
             V+EY+H NLGG+SIVEV+ST+GHLP LS+P++ +PVLLRHI+ DI  D
Sbjct  223  VVSEYLHQNLGGESIVEVMSTDGHLPQLSSPDVVLPVLLRHIRFDISVD  271



>ref|XP_002284043.1| PREDICTED: probable esterase KAI2 [Vitis vinifera]
 emb|CAN70905.1| hypothetical protein VITISV_044176 [Vitis vinifera]
 emb|CAN74235.1| hypothetical protein VITISV_040226 [Vitis vinifera]
Length=270

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLFSKLI I  SPR+LND +Y+GGFEQ +++++F AM +NY+AW  GFAPLAV
Sbjct  103  IASITRPDLFSKLISINGSPRYLNDVDYYGGFEQEDLDQLFEAMGSNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  DLR  L  VTVPCHI+QS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQVDLRQILCHVTVPCHILQSIKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLGG+SIVEV++++GHLP LS+P++ +PVLLRHI+++I
Sbjct  223  VVSEYLHQNLGGESIVEVMTSDGHLPQLSSPDIVVPVLLRHIRYNI  268



>gb|AFK40527.1| unknown [Medicago truncatula]
Length=268

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLND-EEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPL  178
            +LA+IRRP+LFSKLILIGASPRFLND E YHGGFEQGEIE+V SAM+ANYEAWV GFAPL
Sbjct  104  MLASIRRPELFSKLILIGASPRFLNDGENYHGGFEQGEIEQVSSAMEANYEAWVNGFAPL  163

Query  179  AVGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            AVGADVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC I+Q+++D++VP
Sbjct  164  AVGADVPTAVREFSRTLFNMRPDISLFVSRTVFNSDLRGILGLVKVPCCIMQTARDMSVP  223

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
              VA Y+  +LGGKS V+ + TEGHLPHLSAP
Sbjct  224  ATVATYMKEHLGGKSTVQWLDTEGHLPHLSAP  255



>ref|XP_008238450.1| PREDICTED: probable esterase KAI2 [Prunus mume]
Length=270

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +AAI RPDLF+KL++IGASPR+LND +Y+GGFEQ ++E++F A+++NY+AW  GFAPLAV
Sbjct  103  IAAITRPDLFTKLVMIGASPRYLNDVDYYGGFEQEDLEQLFDAIRSNYKAWCSGFAPLAV  162

Query  185  GADVPAA-VREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ +  V+EFSRTLFNMRPDIALSV +TIF  D R  L  + VPCHI+QS KDLAVPV
Sbjct  163  GGDLDSVPVQEFSRTLFNMRPDIALSVAQTIFQSDTRQILHLIKVPCHILQSVKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             V EY+H NLGG SIVEV+S++GHLP LS+P++ IPVLLRHI++DI A
Sbjct  223  VVTEYLHQNLGGGSIVEVMSSDGHLPQLSSPDIVIPVLLRHIRYDIAA  270



>ref|XP_004231894.1| PREDICTED: probable esterase KAI2 [Solanum lycopersicum]
Length=272

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A++ RPDLF+KL+ +  SPR+LND +Y+GGFEQ +++++F AM++NY+AW  GFAPLA+
Sbjct  103  IASVARPDLFTKLVTVSGSPRYLNDVDYYGGFEQEDLDQLFEAMRSNYKAWCSGFAPLAI  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPD+ALSV + IF  DLR  L  VTVPCHIIQS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDMALSVLQIIFQSDLRHMLPHVTVPCHIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDAD  508
             V+EY+H NLGG+SIVEV+ST+GHLP LS+P++ IPVLLRHI+ DI  D
Sbjct  223  VVSEYLHQNLGGESIVEVMSTDGHLPQLSSPDVVIPVLLRHIRFDISVD  271



>gb|EYU44459.1| hypothetical protein MIMGU_mgv1a011843mg [Erythranthe guttata]
Length=269

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF K+I I ASPR+LND +Y+GGFE+ E+E++F AM++NY+AW  GFAPLAV
Sbjct  103  IASITRPDLFLKIITISASPRYLNDPDYYGGFEKDELEQLFEAMRSNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R FL  V VPCHIIQS KDLAVPV
Sbjct  163  GGDMESLAVQEFSRTLFNMRPDIALSVAQTIFCSDIRPFLCHVAVPCHIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLGG SIVEV+ST+GHLP LS+P++ +PVLLRHI+ +I
Sbjct  223  VVSEYLHQNLGGDSIVEVMSTDGHLPQLSSPDVVVPVLLRHIRFNI  268



>ref|XP_011008514.1| PREDICTED: probable esterase KAI2 [Populus euphratica]
Length=270

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A++ RPDLFSK++++ ASPR+LND +Y+GGFEQ +++++F AMQ NY+AW  GFAPLA
Sbjct  102  VIASVSRPDLFSKIVMLSASPRYLNDVDYYGGFEQEDLDQLFEAMQNNYKAWCSGFAPLA  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSV +TIF+ D+R  L  VTVPCHI+QS KDLAVP
Sbjct  162  VGGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFHSDMRAILHMVTVPCHILQSMKDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
            V  +E++H NLGG+SIVEV+S++GHLP LS+P++ IPVLL+HI+++I A
Sbjct  222  VVASEHLHQNLGGESIVEVMSSDGHLPQLSSPDIVIPVLLKHIRYNIAA  270



>ref|XP_010938958.1| PREDICTED: probable strigolactone esterase DAD2 [Elaeis guineensis]
Length=283

 Score =   238 bits (606),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILAAIRRPD F KLILIGASPRFLNDE YHGGFE+GEIE VF+AM++NYEAWVRGFAPLA
Sbjct  119  ILAAIRRPDAFLKLILIGASPRFLNDENYHGGFEEGEIETVFAAMESNYEAWVRGFAPLA  178

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI L V RT+FN DLRG L  V VPC I+Q++KD++VP 
Sbjct  179  VGADVPEAVREFSRTLFNMRPDITLFVSRTVFNSDLRGVLGLVRVPCVIVQTAKDVSVPP  238

Query  362  AVAEYIHSNLGGKSIVEVV-STEGHLPHLSAPELTIPVLLRHIQ  490
            +VA Y+ ++LGG++  E++  TEGHLPHLSAP    PV+ R + 
Sbjct  239  SVAGYLKAHLGGRTTTELLHHTEGHLPHLSAPAALAPVIRRSLS  282



>ref|XP_002307293.1| hydrolase family protein [Populus trichocarpa]
 gb|EEE94289.1| hydrolase family protein [Populus trichocarpa]
Length=270

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 144/169 (85%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLFSK++++ ASPR+LND +Y+GGFEQ +++++F AMQ NY+AW  GFAPLA
Sbjct  102  VIASISRPDLFSKIVMLSASPRYLNDVDYYGGFEQEDLDQLFEAMQNNYKAWCSGFAPLA  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSV +TIF+ D+R  L  VTVPCHI+QS KDLAVP
Sbjct  162  VGGDMDSIAVQEFSRTLFNMRPDIALSVAQTIFHSDMRAILHMVTVPCHILQSMKDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
            V  +E++H NLGG+SIVEV+S++GHLP LS+P++ IPVLL+HI+ +I A
Sbjct  222  VVASEHLHQNLGGESIVEVMSSDGHLPQLSSPDIVIPVLLKHIRFNIAA  270



>ref|XP_010531272.1| PREDICTED: probable esterase KAI2 isoform X1 [Tarenaya hassleriana]
 ref|XP_010531273.1| PREDICTED: probable esterase KAI2 isoform X2 [Tarenaya hassleriana]
Length=270

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++ND +Y GGFEQ ++ ++F AM+ NY+AW  GFAPLA
Sbjct  102  VLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQDDLNQLFEAMRNNYKAWCMGFAPLA  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  V+VPCHI+QS KDLAVP
Sbjct  162  VGGDLDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRQILPYVSVPCHILQSVKDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H+NLGG+SIVEV+ ++GHLP LS+P+  +PVLLRHI+HDI
Sbjct  222  VVVSEYLHANLGGESIVEVIPSDGHLPQLSSPDSVVPVLLRHIRHDI  268



>ref|XP_004983951.1| PREDICTED: probable esterase D14L-like [Setaria italica]
Length=271

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+I RPDLF+KL+L+ ASPR+LND +Y+GGFEQ E++++F A+++NY+AW  GFAPL 
Sbjct  103  LLASISRPDLFTKLVLLSASPRYLNDVDYYGGFEQDELDELFEAIRSNYKAWCSGFAPLC  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFN+RPDIALSV +TIF  D+R  L  V+VPCHI+QS+KDLAVP
Sbjct  163  VGGDMESVAVQEFSRTLFNIRPDIALSVAQTIFQSDVRSLLPLVSVPCHIVQSTKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H +LG  SIVEV+ +EGHLP LS+P++ +PVLLRHIQHDI
Sbjct  223  VVVSEYLHKHLGSDSIVEVMPSEGHLPQLSSPDIVVPVLLRHIQHDI  269



>dbj|BAJ95075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=271

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+I RPDLFSKL+L+ ASPR+LND +Y+GGFEQ E++++F AM++NY+AW  GFAPL 
Sbjct  103  VLASISRPDLFSKLVLLSASPRYLNDVDYYGGFEQEELDELFEAMRSNYKAWCSGFAPLC  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + +V+EFSRTLFN+RPDIALSV +TIF  D+R  L  V+VPCHI+QS+KDLAVP
Sbjct  163  VGGDLESVSVQEFSRTLFNIRPDIALSVAQTIFQSDVRTLLPLVSVPCHIVQSTKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H +LG  SIVEV+ +EGHLP LS+P++  PVLLRHIQHDI
Sbjct  223  VVVSEYLHKHLGSDSIVEVMPSEGHLPQLSSPDIVTPVLLRHIQHDI  269



>dbj|BAJ95275.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=271

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+I RPDLFSKL+L+ ASPR+LND +Y+GGFEQ E++++F AM++NY+AW  GFAPL 
Sbjct  103  VLASISRPDLFSKLVLLSASPRYLNDVDYYGGFEQEELDELFEAMRSNYKAWCSGFAPLC  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + +V+EFSRTLFN+RPDIALSV +TIF  D+R  L  V+VPCHI+QS+KDLAVP
Sbjct  163  VGGDLESVSVQEFSRTLFNIRPDIALSVAQTIFQSDVRTLLPLVSVPCHIVQSTKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H +LG  SIVEV+ +EGHLP LS+P++  PVLLRHIQHDI
Sbjct  223  VVVSEYLHKHLGSDSIVEVMPSEGHLPQLSSPDIVTPVLLRHIQHDI  269



>ref|XP_009360639.1| PREDICTED: probable strigolactone esterase DAD2 [Pyrus x bretschneideri]
Length=266

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 134/164 (82%), Gaps = 4/164 (2%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKL+LIGASPRFLND +YHGGFEQ EIEKVFSAM+ANY AWV GFAPLA
Sbjct  103  ILASIRRPELFSKLVLIGASPRFLNDGDYHGGFEQEEIEKVFSAMEANYAAWVSGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP  VREFSRTLFNMRPDI L V R +FN DLRG L  V VPC IIQ+SKD++VP 
Sbjct  163  VGADVPTVVREFSRTLFNMRPDITLFVSRAVFNSDLRGVLGLVRVPCCIIQTSKDVSVPG  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
            +VA Y+  +LGG++ V ++ TEGHLPHLSAP L    L R ++H
Sbjct  223  SVANYLRDHLGGRNTVVMLETEGHLPHLSAPGL----LARKLRH  262



>ref|XP_003524676.1| PREDICTED: probable esterase D14L-like [Glycine max]
 gb|KHN41547.1| Sigma factor sigB regulation protein rsbQ [Glycine soja]
Length=272

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RP+LF+K+I+I ASPR+LND EY GGFEQ +++++F+AM ANY+AW  GFAP+AV
Sbjct  103  IASISRPELFAKIIMISASPRYLNDMEYFGGFEQEDLDQLFNAMAANYKAWCSGFAPMAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L+ V+VPCHIIQS KDLAVPV
Sbjct  163  GGDMESVAVQEFSRTLFNMRPDIALSVLQTIFQSDIRQILNLVSVPCHIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             VAEY+H ++GG SIVEV+STEGHLP LS+P++ +P+LL+HI+ DI
Sbjct  223  VVAEYLHQHIGGDSIVEVMSTEGHLPQLSSPDIVVPMLLKHIRLDI  268



>ref|XP_003517326.1| PREDICTED: probable esterase KAI2-like [Glycine max]
Length=272

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+KLI++ ASPR+LND EY+GGFEQ ++ ++F AM ANY+AW  GFAPLAV
Sbjct  103  IASISRPDLFTKLIMVSASPRYLNDVEYYGGFEQEDLNQLFDAMAANYKAWCYGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIAL V RTIF  D+R  LS V+VPCHIIQ+ KD+AVPV
Sbjct  163  GGDMESVAVQEFSRTLFNMRPDIALIVSRTIFQSDMRQILSLVSVPCHIIQAEKDMAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             ++EY+H ++G +SIVEV++T+GHLP LS+P++ IPVLL+HIQ DI++
Sbjct  223  MISEYLHQHIGAESIVEVMATDGHLPQLSSPDIVIPVLLKHIQLDIES  270



>ref|XP_008444562.1| PREDICTED: probable strigolactone esterase D14 homolog [Cucumis 
melo]
Length=267

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKLILIGASPRFLND +YHGGFEQ EI++VF+AM+ANY++WV GFAPLA
Sbjct  104  ILASIRRPELFSKLILIGASPRFLNDGDYHGGFEQSEIDRVFAAMKANYQSWVNGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V + IF+ DLRG L  V VPC IIQ+++D++VP 
Sbjct  164  VGADVPAAVQEFSRTLFNMRPDISLFVSKVIFSSDLRGVLGLVKVPCCIIQTAQDVSVPT  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+  +LGG++ +E++ TEGHLPHLSAP+L +  L R
Sbjct  224  SVAIYLRDHLGGRNTIEMLDTEGHLPHLSAPQLLVRKLRR  263



>ref|XP_004142890.1| PREDICTED: sigma factor SigB regulation protein RsbQ-like [Cucumis 
sativus]
 ref|XP_004156378.1| PREDICTED: sigma factor SigB regulation protein RsbQ-like [Cucumis 
sativus]
 gb|KGN62452.1| Sigma factor sigb regulation protein rsbq [Cucumis sativus]
Length=267

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKLILIGASPRFLND +YHGGFEQ EI++VF+AM+ANY++WV GFAPLA
Sbjct  104  ILASIRRPELFSKLILIGASPRFLNDGDYHGGFEQNEIDRVFAAMKANYQSWVNGFAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V + IF+ DLRG L  V VPC IIQ+++D++VP 
Sbjct  164  VGADVPAAVQEFSRTLFNMRPDISLFVSKVIFSSDLRGVLGLVKVPCCIIQTAQDVSVPT  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+  +LGG++ +E++ TEGHLPHLSAP+L +  L R
Sbjct  224  SVAIYLRDHLGGRNTIEMLDTEGHLPHLSAPQLLVRKLRR  263



>ref|XP_006650237.1| PREDICTED: probable esterase D14L-like [Oryza brachyantha]
Length=271

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLFSKL+L+ ASPR+LND +Y+GGFEQ E++++F AM +NY+AW  GFAPL V
Sbjct  104  IASISRPDLFSKLVLLSASPRYLNDVDYYGGFEQEELDELFEAMGSNYKAWCSGFAPLCV  163

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFN+RPDIALSV +TIF  D+R  L  VTVPCHI+QS+KDLAVPV
Sbjct  164  GGDMESVAVQEFSRTLFNIRPDIALSVAQTIFQSDVRSLLPLVTVPCHIVQSTKDLAVPV  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+  +LGG SIVEV+ +EGHLP LS+P++ IPVLLRHIQ DI
Sbjct  224  VVSEYLQKHLGGDSIVEVMPSEGHLPQLSSPDIVIPVLLRHIQRDI  269



>ref|XP_008367645.1| PREDICTED: probable strigolactone esterase DAD2 [Malus domestica]
Length=266

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 135/164 (82%), Gaps = 4/164 (2%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKL+LIGASPRFLND +YHGGFEQ EIEKVFSAM+ANY AWV GFAPLA
Sbjct  103  ILASIRRPELFSKLVLIGASPRFLNDGDYHGGFEQEEIEKVFSAMEANYAAWVSGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V R +FN DLRG L  V VPC IIQ+S D++VP 
Sbjct  163  VGADVPTAVREFSRTLFNMRPDISLFVSRAVFNSDLRGVLGLVRVPCCIIQTSXDVSVPG  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
            +VA Y+  +LGG++ V ++ TEGHLPHLSAP L    L R ++H
Sbjct  223  SVANYLRDHLGGRNTVVMLETEGHLPHLSAPGL----LARKLRH  262



>ref|XP_010905263.1| PREDICTED: probable esterase D14L [Elaeis guineensis]
Length=270

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RPDLFSKL+++ ASPR+LND +Y GGFEQ E++++F AM++NY+AWV GFAPL V
Sbjct  103  LASISRPDLFSKLVMLSASPRYLNDVDYFGGFEQEELDQLFDAMRSNYKAWVSGFAPLCV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFN+RPDIALSV +TIF  D+R  L  VTVPCHI+QSSKDLAVPV
Sbjct  163  GGDLDSVAVQEFSRTLFNIRPDIALSVAQTIFQSDVRRLLGLVTVPCHILQSSKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDID  502
             V+EY+H N+ G SIVEV+ +EGHLP LS PE+ IPVLLRHI+ DI+
Sbjct  223  VVSEYLHKNITGISIVEVMPSEGHLPQLSNPEMVIPVLLRHIRFDIE  269



>ref|XP_006426038.1| hypothetical protein CICLE_v10026274mg [Citrus clementina]
 gb|ESR39278.1| hypothetical protein CICLE_v10026274mg [Citrus clementina]
Length=270

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+KL++I  SPR+LND +Y+GGFEQ E++++F AM++NY+AW  GFAPLAV
Sbjct  103  IASISRPDLFTKLVMISGSPRYLNDVDYYGGFEQEELDQLFEAMRSNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  LS V+VPCHIIQS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRQILSLVSVPCHIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             ++EY+H NL   S+VEV+S++GHLP LS+P++ IPVLLRHI+++I
Sbjct  223  VISEYLHQNLLADSVVEVMSSDGHLPQLSSPDIVIPVLLRHIRYNI  268



>ref|XP_010070624.1| PREDICTED: probable esterase KAI2 [Eucalyptus grandis]
Length=270

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+K++++  SPR++ND +Y GGFEQ +++++F AM+ NY+AW  GFAPLAV
Sbjct  103  IASISRPDLFAKIVMLSGSPRYVNDPDYFGGFEQEDLDQLFEAMRENYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIFN D+R  L  VTVPCHIIQS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFNSDMRSILRLVTVPCHIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLGG SIVEV+ ++GHLP LS+P+  IPV+LRHI++DI
Sbjct  223  VVSEYLHQNLGGDSIVEVMQSDGHLPQLSSPDTVIPVILRHIRYDI  268



>gb|EYU31294.1| hypothetical protein MIMGU_mgv1a027102mg [Erythranthe guttata]
 gb|EYU36379.1| hypothetical protein MIMGU_mgv1a011920mg [Erythranthe guttata]
Length=266

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KLILIGASPRFLND+ YHGGFEQ EIEK FSAM+ NY+AW  GFAPLA
Sbjct  103  ILASIRRPELFTKLILIGASPRFLNDKNYHGGFEQAEIEKFFSAMEENYKAWASGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  V VPC IIQ++KD++VP 
Sbjct  163  VGADVPDAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVKVPCSIIQTAKDVSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPEL  460
            +VA Y+ ++LGG+S + +++ EGHLPHLSAP L
Sbjct  223  SVAVYLKNHLGGRSTIHMLNIEGHLPHLSAPNL  255



>ref|XP_008441109.1| PREDICTED: probable esterase D14L [Cucumis melo]
Length=270

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLF KLIL+ ASPR+LND +Y+GGFE+ +I ++  AMQ+NY+AW  GFAPLA
Sbjct  102  VVASIIRPDLFFKLILLSASPRYLNDVDYYGGFEEDDISQILEAMQSNYKAWCSGFAPLA  161

Query  182  VGADVP-AAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+   AV+EFSRT FNMRPDIALS+ +TIF  D R  L  VTVPCHI+QS+KD+AVP
Sbjct  162  VGGDMKTGAVQEFSRTCFNMRPDIALSIMQTIFEIDTRPILGLVTVPCHILQSAKDMAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            + V+EY+H N+ G SIVEV+ TEGHLP LS+P+L +PV+LRHI HDI
Sbjct  222  LVVSEYLHQNIAGHSIVEVMETEGHLPQLSSPDLVVPVVLRHIHHDI  268



>ref|XP_010688104.1| PREDICTED: probable strigolactone esterase DAD2 [Beta vulgaris 
subsp. vulgaris]
Length=276

 Score =   235 bits (599),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+IRR +LFSKLILIGASPRFLND +YHGGFE+GEIE VFSAM+ANY AWV GFAPLA
Sbjct  103  LLASIRRRELFSKLILIGASPRFLNDHDYHGGFEEGEIETVFSAMEANYAAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVP AVREFSRTLFNMRPDI+L V RT+F+ D RG L  V VPC+IIQ++KD++VP 
Sbjct  163  VGADVPTAVREFSRTLFNMRPDISLFVCRTVFSSDFRGVLGLVRVPCYIIQTAKDMSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGGK  V +++TEGHLPHLSAP      L R
Sbjct  223  SVATYMKNHLGGKGTVIMLNTEGHLPHLSAPAQLAQALRR  262



>ref|XP_004290965.1| PREDICTED: sigma factor SigB regulation protein RsbQ-like [Fragaria 
vesca subsp. vesca]
Length=269

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LFSKLIL+GASPRFLND +YHGGFEQ EIEK+FSAM+ANY AWV GFAPLA
Sbjct  105  ILASIRRPELFSKLILLGASPRFLNDRDYHGGFEQEEIEKLFSAMEANYSAWVNGFAPLA  164

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V R +FN DLR FL  V VPC IIQ+++D +VP 
Sbjct  165  VGADVPAAVREFSRTLFNMRPDISLFVSRAVFNSDLREFLGFVRVPCFIIQTARDHSVPA  224

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPEL  460
            +VA Y+  +LGG++ +  + TEGHLPHLSAP L
Sbjct  225  SVANYLKDHLGGRNTIVTLETEGHLPHLSAPGL  257



>ref|XP_007155860.1| hypothetical protein PHAVU_003G237900g [Phaseolus vulgaris]
 gb|ESW27854.1| hypothetical protein PHAVU_003G237900g [Phaseolus vulgaris]
Length=278

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RPDLF+K+I++ A+PR++ND EY GGFEQ +++++F+AM ANY+AW  GFAP+AV
Sbjct  103  LASISRPDLFAKIIMLSANPRYVNDMEYFGGFEQEDLDQLFNAMAANYKAWCSGFAPMAV  162

Query  185  GADVPAAV-REFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + V +EFSRTLFNMRPDIA SV +TIF  D+R  L+ VTVPCHIIQS KDLAVP+
Sbjct  163  GGDMDSVVVQEFSRTLFNMRPDIAFSVLQTIFQSDMRQILNLVTVPCHIIQSKKDLAVPI  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             VAEY+H  +GG S+VEV+STEGHLP LS+P++ IPV+L+HI  DI
Sbjct  223  VVAEYLHQRIGGDSVVEVLSTEGHLPQLSSPDIVIPVILKHIGLDI  268



>gb|EPS65751.1| hypothetical protein M569_09023, partial [Genlisea aurea]
Length=266

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP LF+KLILIGASPRFLND+ YHGGFEQ E+EKVF+AM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPHLFNKLILIGASPRFLNDKNYHGGFEQAEVEKVFAAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VG DVP AVREFSRTLFNMRPDI L V RT+F+ DLRG L  V VPC IIQ++KD +VP 
Sbjct  163  VGGDVPEAVREFSRTLFNMRPDITLFVSRTVFHSDLRGILGLVKVPCSIIQTTKDPSVPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPEL  460
             +A Y+ S+LGG++ V +++ EGHLPHLSAP L
Sbjct  223  TMAMYLKSHLGGRNTVHMLNIEGHLPHLSAPNL  255



>gb|KFK30366.1| hypothetical protein AALP_AA7G251900 [Arabis alpina]
Length=271

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A++ RPDLFSK+++I ASPR++ND +Y GGFEQ E+ ++F AM++NY+AW  GFAPLA
Sbjct  103  VIASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQDELNQLFEAMRSNYKAWCLGFAPLA  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  V VPCHI+QS KDLAVP
Sbjct  163  VGGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRQILPFVAVPCHILQSVKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H+NLG +S+VEV+ ++GHLP LS+P+  IPVLLRHI++DI
Sbjct  223  VVVSEYLHTNLGSESVVEVIPSDGHLPQLSSPDCVIPVLLRHIRNDI  269



>ref|XP_003550985.1| PREDICTED: probable esterase D14L-like [Glycine max]
 gb|KHN44009.1| Sigma factor sigB regulation protein rsbQ [Glycine soja]
Length=271

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RP+LF+K+I+I ASPR++ND EY GGFEQ +++++F+AM ANY+AW  GFAP+A+
Sbjct  103  VASISRPELFAKIIMISASPRYVNDMEYFGGFEQEDLDQLFNAMAANYKAWCSGFAPMAI  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L+ VTVPCHIIQS KDLAVPV
Sbjct  163  GGDMESVAVQEFSRTLFNMRPDIALSVLQTIFRSDMRQILNLVTVPCHIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             VAEY+H ++GG SIVEV+STEGHLP LS+P++ IPVLL+HI  +I
Sbjct  223  VVAEYLHQHIGGASIVEVMSTEGHLPQLSSPDIFIPVLLKHIPLNI  268



>ref|XP_009138495.1| PREDICTED: probable esterase KAI2 [Brassica rapa]
Length=272

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++ND +Y GGFE+ ++ ++F AM++NY+AW  GFAPLA
Sbjct  104  VLASLNRPDLFSKIVMISASPRYVNDADYQGGFEEEDLNQLFEAMRSNYKAWCLGFAPLA  163

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALS+ +TIF+ D+R  L  V+VPCHI+QS KDLAVP
Sbjct  164  VGGDLDSVAVQEFSRTLFNMRPDIALSLAQTIFHSDMRQILPFVSVPCHIVQSVKDLAVP  223

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            VAV+EY+H+NLG +S+VEV+S++GHLP LS+P+  IPVLLRHI++DI
Sbjct  224  VAVSEYLHNNLGSESVVEVMSSDGHLPQLSSPDSVIPVLLRHIRNDI  270



>ref|XP_009142941.1| PREDICTED: probable esterase KAI2 [Brassica rapa]
Length=271

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK++++ ASPRF+ND +Y GGFEQ ++ ++F A+++NY+AW  GFAPL 
Sbjct  103  VLASLNRPDLFSKIVMVSASPRFVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLV  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALS+ +TIF+ D+R  L  V+VPCHI+QS+KDLAVP
Sbjct  163  VGGDLDSVAVQEFSRTLFNMRPDIALSMAQTIFSSDMRQILPFVSVPCHIVQSAKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            VAV+EY+H+NLG +S+VEV+S+EGHLP LS+P   IPVLLRHI+ DI
Sbjct  223  VAVSEYLHTNLGSESVVEVMSSEGHLPQLSSPASVIPVLLRHIRQDI  269



>emb|CDX79820.1| BnaA05g03360D [Brassica napus]
Length=271

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK++++ ASPRF+ND +Y GGFEQ ++ ++F A+++NY+AW  GFAPL 
Sbjct  103  VLASLNRPDLFSKIVMVSASPRFVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLV  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALS+ +TIF+ D+R  L  V+VPCHI+QS+KDLAVP
Sbjct  163  VGGDLDSVAVQEFSRTLFNMRPDIALSMAQTIFSSDMRQILPFVSVPCHIVQSAKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            VAV+EY+H+NLG +S+VEV+S+EGHLP LS+P   IPVLLRHI+ DI
Sbjct  223  VAVSEYLHTNLGSESVVEVMSSEGHLPQLSSPASVIPVLLRHIRQDI  269



>ref|XP_009342786.1| PREDICTED: probable esterase KAI2 [Pyrus x bretschneideri]
Length=270

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +AA+ RPDLF+KLI+I ASPRFLND +Y+GGFEQ ++E++F A+Q+NY+AW  GFA L V
Sbjct  103  IAAVTRPDLFTKLIMIAASPRFLNDVDYYGGFEQEDVEQLFEAIQSNYKAWCSGFASLVV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + A++EFSRTLFNMRPDI++SV +TIF  D+R  L  +TVPCHI+QS KDLAVP+
Sbjct  163  GGDMDSVAIQEFSRTLFNMRPDISVSVAQTIFQSDIRQILRLITVPCHILQSVKDLAVPM  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             V EY+H NLGGKSIVEV+S++G+LP LS+P+   PVLL+HI++DI A
Sbjct  223  VVTEYLHQNLGGKSIVEVMSSDGYLPQLSSPDFVNPVLLKHIRYDIAA  270



>ref|XP_003550024.1| PREDICTED: probable esterase KAI2-like [Glycine max]
 gb|KHN44008.1| Sigma factor sigB regulation protein rsbQ [Glycine soja]
Length=272

 Score =   233 bits (593),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 138/170 (81%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+I  P LF+KLIL+ ASPRFLND EY GGF+Q ++ +++  +++NY+AW  GFAPL 
Sbjct  102  LLASISHPHLFTKLILVSASPRFLNDSEYFGGFQQEDLTQLYDGIRSNYKAWCSGFAPLV  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            +G D+ + AV+EFSRTLFNMRPDIALS+ +TIF FD+R  L  VTVPCHIIQS+KDLA P
Sbjct  162  IGGDMDSVAVQEFSRTLFNMRPDIALSLAQTIFQFDMRPILCHVTVPCHIIQSTKDLAAP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDAD  508
            V VAEY+  NLGGK+IVEV+ TEGHLP LS+P++ +PVLL HI+H++  D
Sbjct  222  VVVAEYLQQNLGGKTIVEVMPTEGHLPQLSSPDIVVPVLLNHIRHNLAED  271



>ref|XP_010061678.1| PREDICTED: probable strigolactone esterase D14 homolog [Eucalyptus 
grandis]
 gb|KCW68654.1| hypothetical protein EUGRSUZ_F02254 [Eucalyptus grandis]
Length=266

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILAAIRRP LF+KL+LIGASPRFLNDE+YH GFEQ +IE+VF+AMQ+NYEAWV G APLA
Sbjct  103  ILAAIRRPHLFTKLVLIGASPRFLNDEDYHCGFEQEQIEQVFTAMQSNYEAWVNGHAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VG+DVP AVREFSRTLFNMRPDI+L V RT+FN DLRG L  VTVPC IIQ++ D+ +P 
Sbjct  163  VGSDVPTAVREFSRTLFNMRPDISLFVLRTVFNSDLRGVLGLVTVPCCIIQTAHDVLLPA  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
            + A Y+ ++LGG + +EVV TEGHLPHL+AP
Sbjct  223  SAATYLMNHLGGPTTMEVVDTEGHLPHLTAP  253



>ref|XP_006466507.1| PREDICTED: probable esterase KAI2-like [Citrus sinensis]
Length=270

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+KL++I  SPR+LND +Y+GGFEQ E++++F AM++NY+AW  GFAPLAV
Sbjct  103  IASISRPDLFTKLVMISGSPRYLNDVDYYGGFEQEELDQLFEAMRSNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  V+VPCHIIQS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRQILGLVSVPCHIIQSVKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             ++EY+H NL   S+VEV+S++GHLP LS+P++ IPVLLRHI+++I
Sbjct  223  VISEYLHQNLLVDSVVEVMSSDGHLPQLSSPDIVIPVLLRHIRYNI  268



>ref|XP_004511872.1| PREDICTED: probable esterase D14L-like [Cicer arietinum]
Length=305

 Score =   233 bits (595),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF KLI++ +SPR+LND  Y+GGFEQ ++ ++F+AM  NY+AW  GFAPLAV
Sbjct  103  IASISRPDLFVKLIMVSSSPRYLNDVNYYGGFEQEDLNQLFNAMAENYKAWCFGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIAL V RTIF  D+R  L+ VTVPCHIIQ+ KD+AVPV
Sbjct  163  GGDMESVAVQEFSRTLFNMRPDIALIVSRTIFQSDMRQILNLVTVPCHIIQAEKDMAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDID  502
             V+EY+H +LGG+SIVEV++T+GHLP LS+P++ IPVLL+HIQ DI+
Sbjct  223  MVSEYLHQHLGGESIVEVMATDGHLPQLSSPDIVIPVLLKHIQLDIE  269



>ref|XP_009403750.1| PREDICTED: probable strigolactone esterase DAD2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403751.1| PREDICTED: probable strigolactone esterase DAD2 [Musa acuminata 
subsp. malaccensis]
Length=290

 Score =   233 bits (594),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            I+AAIRRP+LF KLIL+GASPRFLND +YHGGFE+ E EKVF+AM+ANYEAWV+GFAPLA
Sbjct  125  IIAAIRRPELFLKLILVGASPRFLNDGDYHGGFEREEFEKVFAAMEANYEAWVQGFAPLA  184

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+ N DLRG L  V  PC ++Q++KD++VP 
Sbjct  185  VGADVPAAVREFSRTLFNMRPDISLFVSRTVVNSDLRGVLGLVRTPCVVVQTAKDVSVPA  244

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHI  487
            +VA Y+ ++LGG++ +E++  EGHLPHLS+P + + VL R I
Sbjct  245  SVAAYLKAHLGGRTTIELLPIEGHLPHLSSPAVLVQVLRRAI  286



>ref|XP_006411882.1| hypothetical protein EUTSA_v10025969mg [Eutrema salsugineum]
 gb|ESQ53335.1| hypothetical protein EUTSA_v10025969mg [Eutrema salsugineum]
Length=271

 Score =   232 bits (592),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++ND +Y GGFEQ ++ ++F AM++NY+AW  GFAPLA
Sbjct  103  VLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQDDLNQLFEAMRSNYKAWCLGFAPLA  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  V VPCHI+QS KDLAVP
Sbjct  163  VGGDLDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRQILPFVAVPCHILQSVKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H+NLG +S+VEV+ ++GHLP LS+P+  IPVLLRHI++DI
Sbjct  223  VVVSEYLHTNLGSESVVEVIPSDGHLPQLSSPDSVIPVLLRHIRNDI  269



>emb|CDY44038.1| BnaA08g15680D [Brassica napus]
Length=271

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++ND +Y GGFEQ ++ ++F AM +NY+AW  GFAPLA
Sbjct  103  LLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQDDLNQLFEAMGSNYKAWCLGFAPLA  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  V VPCHI+QS KDLAVP
Sbjct  163  VGGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRQILPFVAVPCHILQSVKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            VAV+EY+H+NLG +S+VEV+ ++GHLP LS+P+  IPVLLRHI++DI
Sbjct  223  VAVSEYLHTNLGCESVVEVIPSDGHLPQLSSPDSVIPVLLRHIRNDI  269



>emb|CDY29553.1| BnaA03g53980D [Brassica napus]
Length=303

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++ND +Y GGFE+ ++ ++F AM++NY+AW  GFAPLA
Sbjct  135  VLASLNRPDLFSKIVMISASPRYVNDADYQGGFEEEDLNQLFEAMRSNYKAWCLGFAPLA  194

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALS+ +TIF+ D+R  L  V+VPCHI+QS KDLAVP
Sbjct  195  VGGDLDSVAVQEFSRTLFNMRPDIALSLAQTIFHSDMRQILPFVSVPCHIVQSVKDLAVP  254

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            VAV+EY+H+NLG +S+VEV+S++GHLP LS+P+  IPVLLRHI++DI
Sbjct  255  VAVSEYLHNNLGSESVVEVMSSDGHLPQLSSPDSVIPVLLRHIRNDI  301



>ref|XP_009109374.1| PREDICTED: probable esterase KAI2 [Brassica rapa]
Length=271

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++ND +Y GGFEQ ++ ++F AM +NY+AW  GFAPLA
Sbjct  103  LLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQDDLNQLFEAMGSNYKAWCLGFAPLA  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  V VPCHI+QS KDLAVP
Sbjct  163  VGGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRQILPFVAVPCHILQSVKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            VAV+EY+H+NLG +S+VEV+ ++GHLP LS+P+  IPVLLRHI++DI
Sbjct  223  VAVSEYLHTNLGCESVVEVIPSDGHLPQLSSPDSVIPVLLRHIRNDI  269



>ref|XP_003597120.1| Sigma factor sigB regulation protein rsbQ [Medicago truncatula]
 ref|XP_003611634.1| Sigma factor sigB regulation protein rsbQ [Medicago truncatula]
 gb|AES94592.1| sigma factor sigb regulation rsbq-like protein [Medicago truncatula]
Length=305

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF KLI++ +SPR+LND  Y GGFEQ ++ ++F+AM  NY+AW  GFAPLAV
Sbjct  103  IASITRPDLFLKLIMVSSSPRYLNDVNYFGGFEQEDLNQLFNAMAENYKAWCYGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIAL V RTIF  D+R  L+ VTVPCHIIQ+ KD+AVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALIVSRTIFQSDMRQILNLVTVPCHIIQAEKDMAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDID  502
             V+EY+H +LGG+SIVEV++T+GHLP LS+P++ IPVLLRHIQ +I+
Sbjct  223  MVSEYLHQHLGGQSIVEVMTTDGHLPQLSSPDIVIPVLLRHIQLNIE  269



>ref|XP_008787141.1| PREDICTED: LOW QUALITY PROTEIN: probable esterase D14L [Phoenix 
dactylifera]
Length=271

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A++ RPDLFSK++++ ASPR+LND +Y GGFEQ E++++F AM++NY+AWV GFAPLAV
Sbjct  104  IASVSRPDLFSKIVMLSASPRYLNDVDYFGGFEQEELDELFDAMRSNYKAWVSGFAPLAV  163

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFN+RPDIA SV +TIF  D+R  L  VTVPCHI+QSSKDLAVPV
Sbjct  164  GGDLESVAVQEFSRTLFNIRPDIAFSVAQTIFQSDVRHLLGHVTVPCHILQSSKDLAVPV  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDID  502
             V+EY+H NL   SIVEV+ +EGHLP LS PE+ IPVLLRHI+ DI+
Sbjct  224  VVSEYLHKNLRANSIVEVMPSEGHLPQLSNPEIVIPVLLRHIRFDIE  270



>gb|ACJ85126.1| unknown [Medicago truncatula]
 gb|AFK46148.1| unknown [Medicago truncatula]
Length=305

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF KLI++ +SPR+LND  Y GGFEQ ++ ++F+AM  NY+AW  GFAPLAV
Sbjct  103  IASITRPDLFLKLIMVSSSPRYLNDVNYFGGFEQEDLNQLFNAMAENYKAWCYGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIAL V RTIF  D+R  L+ VTVPCHIIQ+ KD+AVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALIVSRTIFQSDMRQILNLVTVPCHIIQAEKDMAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDID  502
             V+EY+H +LGG+SIVEV++T+GHLP LS+P++ IPVLLRHIQ +I+
Sbjct  223  MVSEYLHQHLGGQSIVEVMTTDGHLPQLSSPDIVIPVLLRHIQLNIE  269



>emb|CDY22426.1| BnaC03g61390D [Brassica napus]
Length=271

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++ND +Y GGFEQ ++ ++F AM++NY+AW  GFAPLA
Sbjct  103  LLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQDDLNQLFEAMRSNYKAWCLGFAPLA  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIAL V +TIF  D+R  L  V VPCHI+QS KDLAVP
Sbjct  163  VGGDMDSVAVQEFSRTLFNMRPDIALCVAQTIFQSDMRQILPFVAVPCHILQSVKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            VAV+EY+H+NLG +S+VEV+ ++GHLP LS+P+  IPVLLRHI++DI
Sbjct  223  VAVSEYLHTNLGCESVVEVIPSDGHLPQLSSPDSVIPVLLRHIRNDI  269



>ref|XP_009761984.1| PREDICTED: probable esterase KAI2 [Nicotiana sylvestris]
Length=271

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 138/170 (81%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A++ RPDLF+KL+ +  SPR+LND +Y+GGFEQ +++++F  M++NY+AW  GFA LA
Sbjct  102  VIASVARPDLFTKLVTVSGSPRYLNDVDYYGGFEQEDLDQLFETMRSNYKAWCSGFALLA  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+E SRTLFNMRPDIALSV + IF  DLR  L  VTVPCHIIQS KDL VP
Sbjct  162  VGGDMDSVAVQELSRTLFNMRPDIALSVLQIIFLSDLRHLLPHVTVPCHIIQSMKDLVVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDAD  508
            V V+EY+H NLGG SIVEV+ST+GHLP LS+P++ IPVLLRHI++DI  D
Sbjct  222  VVVSEYLHQNLGGGSIVEVMSTDGHLPQLSSPDVVIPVLLRHIRYDIAVD  271



>ref|XP_004141889.1| PREDICTED: sigma factor SigB regulation protein RsbQ-like [Cucumis 
sativus]
 ref|XP_004167381.1| PREDICTED: sigma factor SigB regulation protein RsbQ-like [Cucumis 
sativus]
 gb|KGN48581.1| hypothetical protein Csa_6G493890 [Cucumis sativus]
Length=270

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLF KLIL+ ASPR+LN  +Y+GGFE+ +I ++  AMQ+NY+AW  GFAPLA
Sbjct  102  VIASIIRPDLFFKLILLSASPRYLNGVDYYGGFEEEDITQILEAMQSNYKAWCSGFAPLA  161

Query  182  VGADVP-AAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+   AV+EFSRT FNMRPDIALS+ +TIF  D R  L  VTVPCHI+QS+KD+AVP
Sbjct  162  VGGDMKTGAVQEFSRTCFNMRPDIALSIMQTIFEIDTRPMLGLVTVPCHILQSAKDMAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H N+ G SIVEV+ TEGHLP LS+P++ IPV+LRHI HDI
Sbjct  222  VVVSEYLHQNIAGHSIVEVMETEGHLPQLSSPDVFIPVVLRHIHHDI  268



>gb|EPS64213.1| hydrolase, alpha/beta fold family protein, partial [Genlisea 
aurea]
Length=267

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A++ R DLF+KL+ I ASPR+LN E+Y+GGFE+ ++E V  AM++NY  W  GFAPLA
Sbjct  101  MIASVFRRDLFTKLVCISASPRYLNGEDYYGGFERDDLEGVLKAMESNYRDWFEGFAPLA  160

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLF+MRPDIA SV RTIF  DLR +L  VTVPCHIIQS+KDLAVP
Sbjct  161  VGGDMASIAVQEFSRTLFSMRPDIAASVARTIFFSDLRAYLGSVTVPCHIIQSAKDLAVP  220

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+  NLGGKS+VEV+STEGHLP LS+PE+ IPV+LRHI+ DI
Sbjct  221  VVVSEYLRRNLGGKSVVEVMSTEGHLPQLSSPEVAIPVILRHIRFDI  267



>ref|XP_007156746.1| hypothetical protein PHAVU_002G013800g [Phaseolus vulgaris]
 gb|ESW28740.1| hypothetical protein PHAVU_002G013800g [Phaseolus vulgaris]
Length=272

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+KL+++GASPR+LND +Y+GGFEQ E+ ++F AM ANY+AW  GFAPLAV
Sbjct  103  IASIARPDLFTKLVMVGASPRYLNDVDYYGGFEQEELNQLFDAMSANYKAWCYGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDI L V RTIF  D+R  LS V+VPCHIIQ+ KD+AVPV
Sbjct  163  GGDLESVAVQEFSRTLFNMRPDIGLMVSRTIFQSDMRHILSLVSVPCHIIQAEKDMAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             ++E++H N+   SIVEV++T+GHLP LS+P++ IPVLL HI  +I+A
Sbjct  223  VISEFLHQNIAANSIVEVIATDGHLPQLSSPDIVIPVLLEHIHLEIEA  270



>emb|CDY17923.1| BnaC04g02960D [Brassica napus]
Length=271

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLF K+++I ASPRF+ND +Y GGFEQ ++ ++F A+++NY+AW  GFAPL 
Sbjct  103  VLASLNRPDLFYKIVMISASPRFVNDVDYEGGFEQEDLNQLFEAIRSNYKAWCLGFAPLV  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALS+ +TIF+ D+R  L  V+VPCHI+QS+KDLAVP
Sbjct  163  VGGDLDSVAVQEFSRTLFNMRPDIALSMAQTIFSSDMRQILPFVSVPCHIVQSAKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            VAV+EY+H+NLG +S+VEV+S+EGHLP LS+P   IPVLLRHI++DI
Sbjct  223  VAVSEYLHTNLGSESVVEVMSSEGHLPQLSSPASVIPVLLRHIRNDI  269



>ref|XP_006284314.1| hypothetical protein CARUB_v10005485mg [Capsella rubella]
 gb|EOA17212.1| hypothetical protein CARUB_v10005485mg [Capsella rubella]
Length=271

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++ND +Y GGFEQ ++ ++F AM +NY+AW  GFAPLA
Sbjct  103  VLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAMGSNYKAWCSGFAPLA  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALS+ +TIF  D+R  L  V+VPCHI+QS KDLAVP
Sbjct  163  VGGDMDSIAVQEFSRTLFNMRPDIALSLGQTIFQSDMRQILPFVSVPCHILQSVKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDID  502
            V V+EY+H+NLG +S+VEV+ ++GHLP LS+P+  IPV+LRHI++DID
Sbjct  223  VTVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVVLRHIRNDID  270



>ref|XP_002866945.1| hypothetical protein ARALYDRAFT_912591 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43204.1| hypothetical protein ARALYDRAFT_912591 [Arabidopsis lyrata subsp. 
lyrata]
Length=271

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA++ RPDLFSK+++I ASPR+LND +Y GGFEQ ++ ++F A+++NY+AW  GFAPLA
Sbjct  103  ILASLNRPDLFSKIVMISASPRYLNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLA  162

Query  182  VGADVP-AAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+   AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  V+VPCHI+QS KDLAVP
Sbjct  163  VGGDLDLIAVQEFSRTLFNMRPDIALSVAQTIFQSDMRQILPYVSVPCHILQSIKDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H+NLG +S+VEV+ ++GHLP LS+P+  IPV+LRHI++DI
Sbjct  223  VVVSEYLHANLGSESVVEVIPSDGHLPQLSSPDTVIPVILRHIRNDI  269



>ref|XP_008340844.1| PREDICTED: probable esterase KAI2 [Malus domestica]
Length=270

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +AA+ RPDLF+KLI+I ASPRFLND +Y+GGFEQ ++E++F A+Q+NY+AW  GFA L V
Sbjct  103  IAAVTRPDLFTKLIMIAASPRFLNDVDYYGGFEQEDVEQLFEAIQSNYKAWCSGFASLVV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + A++EFSRTLFNMRPDI+LSV +TIF  D+R  L  +TVPCHI+QS KDLAVP+
Sbjct  163  GRDMDSVAIQEFSRTLFNMRPDISLSVAQTIFQSDIRQILRLITVPCHILQSVKDLAVPM  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             V EY+H NLGGKSIVEV+S++G+LP LS+P++   VLL+HI++DI A
Sbjct  223  VVTEYLHQNLGGKSIVEVMSSDGYLPQLSSPDIVNLVLLKHIRYDIMA  270



>gb|EYU44463.1| hypothetical protein MIMGU_mgv1a011794mg [Erythranthe guttata]
Length=270

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A++ RP+LFSK+I + ASPR+LND +Y+GGFE+ +I ++F AM +NY++W  G+APLA
Sbjct  102  VIASVTRPELFSKIITVSASPRYLNDPDYYGGFEEEDIVQLFDAMGSNYKSWCAGWAPLA  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  VTVPCH+IQS KDLAVP
Sbjct  162  VGGDMESLAVQEFSRTLFNMRPDIALSVAQTIFYSDVRPLLGHVTVPCHVIQSVKDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
            V V+EY+H NLGG SIVEV+ST+GHLP LS+P++ +PVLLRHI+ +I A
Sbjct  222  VVVSEYLHQNLGGDSIVEVMSTDGHLPQLSSPDVVVPVLLRHIRFNIAA  270



>emb|CDP02566.1| unnamed protein product [Coffea canephora]
Length=270

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+KL+++  SPR+LND +Y+GGFEQ +++++F AM++NY AW  GFAPLAV
Sbjct  103  VASIARPDLFTKLVMVSGSPRYLNDVDYYGGFEQEDLDQLFEAMKSNYRAWCDGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV RTIF  D R  L+ V VPC IIQS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVARTIFCSDTRHLLAHVRVPCRIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLG +S+VEV+ST+GHLP LS+P++ +PVLLRHI+ +I
Sbjct  223  VVSEYLHQNLGCESVVEVMSTDGHLPQLSSPDVVVPVLLRHIRDNI  268



>ref|XP_007155857.1| hypothetical protein PHAVU_003G237600g [Phaseolus vulgaris]
 gb|ESW27851.1| hypothetical protein PHAVU_003G237600g [Phaseolus vulgaris]
Length=272

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA+I  P LF+KLIL+ ASPRFLND EY GGF+Q ++ +++  +++NY+AW  GFAPL 
Sbjct  102  LLASISHPHLFTKLILVSASPRFLNDSEYFGGFQQEDLTQLYDGIRSNYKAWCSGFAPLV  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            +G D+ + +V+EFSRTLFNMRPDIALS+ +TIF FD+R  L  V+VPCHIIQS+KDLA P
Sbjct  162  IGGDMDSVSVQEFSRTLFNMRPDIALSLAQTIFQFDMRPVLGLVSVPCHIIQSTKDLAAP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V VAEY+  NLGGK+IVEV+ TEGHLP LSAP++ IPVLL HI+HD+
Sbjct  222  VVVAEYLQLNLGGKTIVEVMPTEGHLPQLSAPDVVIPVLLNHIRHDL  268



>ref|XP_008660429.1| PREDICTED: probable strigolactone esterase D14 [Zea mays]
 gb|AFW89301.1| hypothetical protein ZEAMMB73_960698 [Zea mays]
Length=292

 Score =   231 bits (588),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KL+LIGASPRFLND +YHGGFE  EI++VF AM ANY AW  G+APLA
Sbjct  128  ILASIRRPELFAKLVLIGASPRFLNDHDYHGGFELPEIQQVFDAMAANYSAWATGYAPLA  187

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V RT+FN DLRG L  V  PC ++Q+++D++VP 
Sbjct  188  VGADVPAAVQEFSRTLFNMRPDISLHVCRTVFNTDLRGVLGMVRAPCVVVQTTRDVSVPA  247

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ VE + TEGHLPHLSAP L   VL R
Sbjct  248  SVAAYLKAHLGGRTAVEFLQTEGHLPHLSAPGLLAQVLRR  287



>ref|NP_195463.1| probable esterase KAI2 [Arabidopsis thaliana]
 sp|Q9SZU7.1|KAI2_ARATH RecName: Full=Probable esterase KAI2; AltName: Full=Protein DWARF-14-like; 
Short=Protein D14-like; AltName: Full=Protein 
HYPOSENSITIVE TO LIGHT; AltName: Full=Protein KARRIKIN INSENSITIVE 
2 [Arabidopsis thaliana]
 pdb|4IH1|A Chain A, Crystal Structure Of Karrikin Insensitive 2 (kai2) From 
Arabidopsis Thaliana
 pdb|4JYM|A Chain A, Crystal Structure Of Kai2 In Complex With 3-methyl-2h-furo[2,3- 
C]pyran-2-one
 pdb|4JYM|B Chain B, Crystal Structure Of Kai2 In Complex With 3-methyl-2h-furo[2,3- 
C]pyran-2-one
 pdb|4JYP|A Chain A, Crystal Structure Of Kai2 Apo Form
 pdb|4JYP|B Chain B, Crystal Structure Of Kai2 Apo Form
 emb|CAB38214.1| putative protein [Arabidopsis thaliana]
 emb|CAB80412.1| putative protein [Arabidopsis thaliana]
 gb|AAL07039.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14286.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86798.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
Length=270

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++ND +Y GGFEQ ++ ++F A+++NY+AW  GFAPLA
Sbjct  102  VLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLA  161

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  VTVPCHI+QS KDLAVP
Sbjct  162  VGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H+NLG +S+VEV+ ++GHLP LS+P+  IPV+LRHI++DI
Sbjct  222  VVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI  268



>ref|XP_009386270.1| PREDICTED: probable strigolactone esterase DAD2 [Musa acuminata 
subsp. malaccensis]
Length=279

 Score =   230 bits (586),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILAAIRRP LF KLIL+GASPRFLND +YHGGFE+ E E+VF+AM+ANYEAWVRGFAPLA
Sbjct  114  ILAAIRRPLLFLKLILVGASPRFLNDGDYHGGFEREETEEVFAAMEANYEAWVRGFAPLA  173

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAVREFSRTLFNMRPDI+L V RT+FN DLRG L  V  PC +IQ++ D++VP 
Sbjct  174  VGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVQAPCVVIQTANDVSVPP  233

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ +E++  EGHLPHLSAP   + VL R
Sbjct  234  SVAAYLKAHLGGRTTLELLHDEGHLPHLSAPASFVHVLHR  273



>ref|XP_004985292.1| PREDICTED: probable strigolactone esterase D14-like [Setaria 
italica]
Length=308

 Score =   231 bits (588),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KLILIGASPRFLND +YHGGFE  EI++VF+AM ANY AW  G+APLA
Sbjct  144  ILASIRRPELFAKLILIGASPRFLNDNDYHGGFELPEIQQVFAAMAANYSAWATGYAPLA  203

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V RT+FN DLRG L  V  PC ++Q+++D++VP 
Sbjct  204  VGADVPAAVQEFSRTLFNMRPDISLHVCRTVFNTDLRGVLGMVRSPCVVVQTTRDVSVPA  263

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ VE + TEGHLPHLSAP L   VL R
Sbjct  264  SVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPGLLAQVLRR  303



>pdb|3W06|A Chain A, Crystal Structure Of Arabidopsis Thaliana Dwarf14 Like 
(atd14l)
Length=272

 Score =   229 bits (585),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++ND +Y GGFEQ ++ ++F A+++NY+AW  GFAPLA
Sbjct  104  VLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLA  163

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  VTVPCHI+QS KDLAVP
Sbjct  164  VGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVP  223

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H+NLG +S+VEV+ ++GHLP LS+P+  IPV+LRHI++DI
Sbjct  224  VVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI  270



>pdb|4IHA|A Chain A, Crystal Structure Of Rice Dwarf14 (d14) In Complex With 
A Gr24 Hydrolysis Intermediate
 pdb|4IHA|B Chain B, Crystal Structure Of Rice Dwarf14 (d14) In Complex With 
A Gr24 Hydrolysis Intermediate
 pdb|4IH9|A Chain A, Crystal Structure Of Rice Dwarf14 (d14)
 pdb|4IH9|B Chain B, Crystal Structure Of Rice Dwarf14 (d14)
Length=268

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRPDLF+KL+LIGASPRFLND +YHGGFE  EI++VF AM ANY AW  G+APLA
Sbjct  104  ILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLA  163

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V +T+F  DLRG L  V  PC ++Q+++D++VP 
Sbjct  164  VGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPA  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ VE + TEGHLPHLSAP L   VL R
Sbjct  224  SVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRR  263



>pdb|4HRX|A Chain A, Crystal Structure Of Kai2
 pdb|4HRY|A Chain A, The Structure Of Arabidopsis Thaliana Kai2
 pdb|4HTA|A Chain A, The Structure Of The Karrikin Insensitive (kai2) Protein 
In Arabidopsis Thaliana
Length=288

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++ND +Y GGFEQ ++ ++F A+++NY+AW  GFAPLA
Sbjct  120  VLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLA  179

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  VTVPCHI+QS KDLAVP
Sbjct  180  VGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVP  239

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V V+EY+H+NLG +S+VEV+ ++GHLP LS+P+  IPV+LRHI++DI
Sbjct  240  VVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI  286



>pdb|3W04|A Chain A, Crystal Structure Of Oryza Sativa Dwarf14 (d14)
 pdb|3W04|B Chain B, Crystal Structure Of Oryza Sativa Dwarf14 (d14)
 pdb|3W05|A Chain A, Crystal Structure Of Oryza Sativa Dwarf14 (d14) In Complex 
With Pmsf
 pdb|3W05|B Chain B, Crystal Structure Of Oryza Sativa Dwarf14 (d14) In Complex 
With Pmsf
Length=266

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRPDLF+KL+LIGASPRFLND +YHGGFE  EI++VF AM ANY AW  G+APLA
Sbjct  102  ILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLA  161

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V +T+F  DLRG L  V  PC ++Q+++D++VP 
Sbjct  162  VGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPA  221

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ VE + TEGHLPHLSAP L   VL R
Sbjct  222  SVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRR  261



>gb|EMT06220.1| hypothetical protein F775_07019 [Aegilops tauschii]
Length=273

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRPDLF+KL+LIGASPRFLND +YHGGFE  EI++VF AM ANYEAW +G+APLA
Sbjct  109  ILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFQAMSANYEAWAKGYAPLA  168

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V +++F  DLRG L  V  PC ++Q+++D++VP 
Sbjct  169  VGADVPAAVQEFSRTLFNMRPDISLHVCQSVFKTDLRGVLGMVQAPCVVVQTTRDVSVPA  228

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
             VA Y+ ++LGG++ +E + TEGHLPHLSAP L   VL R
Sbjct  229  NVAAYLKAHLGGRTTIEPLPTEGHLPHLSAPSLLAQVLRR  268



>pdb|3VXK|A Chain A, Crystal Structure Of Osd14
 pdb|3VXK|B Chain B, Crystal Structure Of Osd14
 pdb|3WIO|A Chain A, Crystal Structure Of Osd14 In Complex With Hydroxy D-ring
 pdb|3WIO|B Chain B, Crystal Structure Of Osd14 In Complex With Hydroxy D-ring
Length=274

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRPDLF+KL+LIGASPRFLND +YHGGFE  EI++VF AM ANY AW  G+APLA
Sbjct  110  ILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLA  169

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V +T+F  DLRG L  V  PC ++Q+++D++VP 
Sbjct  170  VGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPA  229

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ VE + TEGHLPHLSAP L   VL R
Sbjct  230  SVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRR  269



>ref|XP_003558555.1| PREDICTED: probable strigolactone esterase D14 [Brachypodium 
distachyon]
Length=301

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRPDLF+KL+LIGASPRFLND +YHGGFE  EI++VF AM ANYEAW  G+APLA
Sbjct  137  ILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFEVAEIQQVFDAMSANYEAWATGYAPLA  196

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V +++F  DLRG L  V  PC ++Q+++D++VP 
Sbjct  197  VGADVPAAVQEFSRTLFNMRPDISLYVCQSVFKTDLRGVLGMVQAPCVVVQTTRDVSVPA  256

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ +E + TEGHLPHLSAP L   VL R
Sbjct  257  SVAAYLKAHLGGRTTIEPLPTEGHLPHLSAPSLLAQVLRR  296



>ref|XP_001769317.1| predicted protein [Physcomitrella patens]
 gb|EDQ65871.1| predicted protein [Physcomitrella patens]
Length=271

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA++ RP++FSK+I I ASPR+LND +Y GGFEQ ++ ++F AMQ+N+EAWV GFAPLAV
Sbjct  106  LASLERPEIFSKIITISASPRYLNDMDYFGGFEQDDLNQLFEAMQSNFEAWVSGFAPLAV  165

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            GAD+ + AV+EF RTLFN+RPDIA SV +TIF  DLR  L  VTVPCHI+QSSKDLAVP+
Sbjct  166  GADIDSMAVQEFGRTLFNIRPDIAFSVAKTIFQSDLRIVLPNVTVPCHILQSSKDLAVPI  225

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHI  487
             VA+Y+H  LGG +IVEV+ TEGHLP LS+PE+ IPVL RH+
Sbjct  226  VVADYLHHTLGGPTIVEVLQTEGHLPQLSSPEIVIPVLKRHL  267



>ref|XP_006649588.1| PREDICTED: probable strigolactone esterase D14-like [Oryza brachyantha]
Length=317

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KLILIGASPRFLND +YHGGFE  EI++VF AM ANY AW  G+APLA
Sbjct  153  ILASIRRPELFAKLILIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLA  212

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V +T+F  DLRG L  V  PC ++Q+++D++VP 
Sbjct  213  VGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRSPCVVVQTTRDVSVPA  272

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ +NLGG++ VE + TEGHLPHLSAP L   VL R
Sbjct  273  SVAAYLKANLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRR  312



>ref|NP_001150635.1| LOC100284268 [Zea mays]
 gb|ACG39850.1| sigma factor sigB regulation protein rsbQ [Zea mays]
 gb|ACG41051.1| sigma factor sigB regulation protein rsbQ [Zea mays]
 tpg|DAA43920.1| TPA: sigma factor sigB regulation protein rsbQ [Zea mays]
Length=307

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KL+LIGASPRFLND +YHGGFE  EI++VF AM ANY AW  G+APLA
Sbjct  143  ILASIRRPELFAKLVLIGASPRFLNDHDYHGGFELPEIQQVFDAMAANYSAWATGYAPLA  202

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V RT+FN DLRG L  V  PC ++Q+++D++VP 
Sbjct  203  VGADVPAAVQEFSRTLFNMRPDISLHVCRTVFNTDLRGVLGMVRSPCVVVQTTRDVSVPA  262

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ VE + TEGHLPHLSAP L   VL R
Sbjct  263  SVAAYLKAHLGGRTAVEFLQTEGHLPHLSAPGLLAQVLRR  302



>ref|NP_001049306.1| Os03g0203200 [Oryza sativa Japonica Group]
 sp|Q10QA5.1|D14_ORYSJ RecName: Full=Probable strigolactone esterase D14; AltName: Full=Protein 
DWARF-14; AltName: Full=Protein DWARF-88; AltName: 
Full=Protein HIGH-TILLERING DWARF 2 [Oryza sativa Japonica 
Group]
 gb|ABF94525.1| hydrolase, alpha/beta fold family protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94526.1| hydrolase, alpha/beta fold family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11220.1| Os03g0203200 [Oryza sativa Japonica Group]
 dbj|BAG92161.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACV30015.1| dwarf 88 esterase [Oryza sativa Japonica Group]
Length=318

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRPDLF+KL+LIGASPRFLND +YHGGFE  EI++VF AM ANY AW  G+APLA
Sbjct  154  ILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLA  213

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V +T+F  DLRG L  V  PC ++Q+++D++VP 
Sbjct  214  VGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPA  273

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ VE + TEGHLPHLSAP L   VL R
Sbjct  274  SVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRR  313



>ref|XP_001766839.1| predicted protein [Physcomitrella patens]
 gb|EDQ68241.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA++ RP++FSK+I I ASPR+LND +Y GGFEQ ++ ++F AMQ+N++AWV GFAPLAV
Sbjct  106  LASLYRPEIFSKIITISASPRYLNDMDYFGGFEQEDLNQLFEAMQSNFKAWVSGFAPLAV  165

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            GAD+ + AV+EF RTLFN+RPDIA SV +TIF  DLR  L +VTVPCHI+QSSKDLAVPV
Sbjct  166  GADIDSMAVQEFGRTLFNIRPDIAFSVAKTIFQSDLRSILPKVTVPCHILQSSKDLAVPV  225

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             VA+Y+H  LGG +IVEV+ TEGHLP LS+P++ IPVL RH+  ++++
Sbjct  226  VVADYLHLTLGGPTIVEVLPTEGHLPQLSSPDIVIPVLKRHVAGNLES  273



>ref|XP_010432057.1| PREDICTED: probable esterase KAI2 [Camelina sativa]
Length=271

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++N  +Y GGFEQ ++ ++F AM++NY+AW  GFAPLA
Sbjct  103  VLASLNRPDLFSKIVMISASPRYVNAVDYQGGFEQDDLNQLFEAMRSNYKAWCSGFAPLA  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALS+ +TIF  D+R  L  V+VPCHI+QS +DLAVP
Sbjct  163  VGGDLDSIAVQEFSRTLFNMRPDIALSLGQTIFQSDMRHILPFVSVPCHILQSVRDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDID  502
            V+V+EY+H+NLG +S+VEV+ ++GHLP LS+P+  +PV+LRHI++DID
Sbjct  223  VSVSEYLHTNLGSESVVEVIPSDGHLPQLSSPDSVVPVVLRHIRNDID  270



>ref|XP_010437222.1| PREDICTED: probable esterase KAI2 [Camelina sativa]
 ref|XP_010437224.1| PREDICTED: probable esterase KAI2 isoform X1 [Camelina sativa]
 ref|XP_010437225.1| PREDICTED: probable esterase KAI2 isoform X2 [Camelina sativa]
 ref|XP_010437226.1| PREDICTED: probable esterase KAI2 isoform X3 [Camelina sativa]
Length=271

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++N  +Y GGFEQ ++ ++F AM++NY+AW  GFAPLA
Sbjct  103  VLASLNRPDLFSKIVMISASPRYVNAVDYQGGFEQDDLNQLFEAMRSNYKAWCSGFAPLA  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALS+ +TIF  D+R  L  V+VPCHI+QS +DLAVP
Sbjct  163  VGGDLDSIAVQEFSRTLFNMRPDIALSLGQTIFQSDMRHILPFVSVPCHILQSVRDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDID  502
            V+V+EY+H+NLG +S+VEV+ ++GHLP LS+P+  +PV+LRHI++DID
Sbjct  223  VSVSEYLHTNLGSESVVEVIPSDGHLPQLSSPDSVVPVVLRHIRNDID  270



>gb|KDP32038.1| hypothetical protein JCGZ_12499 [Jatropha curcas]
Length=268

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A++ RPDLFSKLIL+ A+PR LNDE+Y+GGFEQ +IE++F  +++NY+AW  GFAP+ V
Sbjct  103  IASVSRPDLFSKLILLSATPRLLNDEDYYGGFEQEDIEQIFEGVKSNYKAWCSGFAPMVV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALS+ + IF  D+R  L  VTVPCHI+QS+KD+AVP+
Sbjct  163  GGDMESVAVQEFSRTLFNMRPDIALSLAQVIFLTDMRHVLPSVTVPCHILQSTKDMAVPI  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            AV+EY+H N GG SIVE++ST GHLP LS+P++ IPV+++HI + I
Sbjct  223  AVSEYLHQNFGGPSIVELISTCGHLPQLSSPDIVIPVIVKHISYVI  268



>ref|XP_010446656.1| PREDICTED: probable esterase KAI2 [Camelina sativa]
Length=271

 Score =   228 bits (580),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLFSK+++I ASPR++N  +Y GGFEQ ++ ++F AM++NY+AW  GFAPLA
Sbjct  103  VLASLNRPDLFSKIVMISASPRYVNAVDYQGGFEQDDLNQLFEAMRSNYKAWCSGFAPLA  162

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSRTLFNMRPDIALS+ +TIF  D+R  L  V+VPCHI+QS +DLAVP
Sbjct  163  VGGDLDSIAVQEFSRTLFNMRPDIALSLGQTIFQSDMRHILPFVSVPCHILQSVRDLAVP  222

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDID  502
            V+V+EY+H+NLG +S+VEV+ ++GHLP LS+P+  +PV+LRHI++DID
Sbjct  223  VSVSEYLHTNLGSESVVEVIPSDGHLPQLSSPDSVVPVVLRHIRNDID  270



>ref|XP_002468316.1| hypothetical protein SORBIDRAFT_01g043630 [Sorghum bicolor]
 gb|EER95314.1| hypothetical protein SORBIDRAFT_01g043630 [Sorghum bicolor]
Length=314

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRP+LF+KL+LIGASPRFLND +YHGGFE  EI++VF AM ANY AW  G+APLA
Sbjct  150  ILASIRRPELFAKLVLIGASPRFLNDNDYHGGFELPEIQQVFVAMAANYSAWAVGYAPLA  209

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V RT+FN DLRG L  V  PC ++Q+++D++VP 
Sbjct  210  VGADVPAAVQEFSRTLFNMRPDISLHVCRTVFNTDLRGVLGMVRSPCVVVQTTRDVSVPA  269

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+  +LGG++ VE + TEGHLPHLSAP L   VL R
Sbjct  270  SVAAYLRDHLGGRTTVEFLQTEGHLPHLSAPGLLAQVLRR  309



>ref|XP_006364425.1| PREDICTED: probable esterase KAI2-like [Solanum tuberosum]
Length=270

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+K++ + ASPR+LND EY+GGFE+ E++++F A++ NY++W  GFAPL V
Sbjct  103  IASIARPDLFTKIVTVSASPRYLNDSEYYGGFEREELDQLFEAVKTNYKSWCSGFAPLVV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + A++EFSRTLFNMRPDIALSV + IF  DLR  L  V+VP HIIQS KDLAVPV
Sbjct  163  GGDMDSVAIQEFSRTLFNMRPDIALSVIQIIFLSDLRHLLPHVSVPFHIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+  NLG +SIVEV+STEGHLP LS+P++ IPVLLRHI+HDI
Sbjct  223  VVSEYLSQNLGSESIVEVMSTEGHLPQLSSPDVVIPVLLRHIRHDI  268



>ref|XP_011099337.1| PREDICTED: LOW QUALITY PROTEIN: probable esterase KAI2 [Sesamum 
indicum]
Length=265

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 136/168 (81%), Gaps = 4/168 (2%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A+I RPDLFSKL+ I ASPR+LND +Y GGFEQ ++ ++F AM++NY+AW  GFAPLA
Sbjct  102  VIASITRPDLFSKLVAISASPRYLNDPDYFGGFEQDDLVQLFEAMRSNYKAWCSGFAPLA  161

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VG D+ +      RTLFNMRPDIALSV +TIF  D+R  L  V VPCHIIQS KDLAVPV
Sbjct  162  VGGDMESV----XRTLFNMRPDIALSVAQTIFYSDMRPLLPHVKVPCHIIQSMKDLAVPV  217

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             V+EY+H NLGG+SIVEV+ST+GHLP LS+P++ +PVLLRHI+++I A
Sbjct  218  VVSEYLHQNLGGESIVEVMSTDGHLPQLSSPDVVVPVLLRHIRYNIAA  265



>ref|XP_004233449.1| PREDICTED: probable esterase KAI2 [Solanum lycopersicum]
Length=270

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+K++ + ASPR+LND EY+GGFE+ E++++F A++ NY++W  GFAPL V
Sbjct  103  IASIARPDLFTKIVTVSASPRYLNDSEYYGGFEREELDQLFEAVKTNYKSWCSGFAPLVV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + A++EFSRTLFNMRPDIALSV + IF  DLR  L  V+VP HIIQS KDLAVPV
Sbjct  163  GGDMDSVAIQEFSRTLFNMRPDIALSVIQIIFLSDLRHLLPHVSVPFHIIQSMKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+  NLG +SIVEV+STEGHLP LS+P++ IPVLLRHI+HDI
Sbjct  223  VVSEYLSQNLGSESIVEVMSTEGHLPQLSSPDVVIPVLLRHIRHDI  268



>ref|XP_008344337.1| PREDICTED: probable esterase KAI2 [Malus domestica]
Length=270

 Score =   224 bits (572),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +AAI RPDLF+KL++I ASPR+LND +Y+GGFEQ E+E++F A+++NY+AW  GFAPLAV
Sbjct  103  IAAITRPDLFTKLVMIAASPRYLNDVDYYGGFEQEELEQLFEAIRSNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRT+FNMRPDIALSV +TIF  DLR  L  +TVPCHI+QS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTVFNMRPDIALSVAQTIFQSDLRQMLGLITVPCHILQSVKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLGG+SIVEV+S++GHLP LS+PE+  PVLLRHI++DI
Sbjct  223  VVSEYLHQNLGGQSIVEVMSSDGHLPQLSSPEIVNPVLLRHIRYDI  268



>dbj|BAJ94658.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00093.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=303

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRPDLF+KL+LIGASPRFLND +YHGGFE  +I++VF AM ANY AW  G+APLA
Sbjct  139  ILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEQIQQVFDAMSANYAAWATGYAPLA  198

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V +++F  DLRG L  V  PC ++Q+++D++VP 
Sbjct  199  VGADVPAAVQEFSRTLFNMRPDISLHVCQSVFKTDLRGVLGMVQAPCVVVQTTRDVSVPA  258

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ +E + TEGHLPHLSAP L   VL R
Sbjct  259  SVAAYLKAHLGGRTTIEPLPTEGHLPHLSAPSLLAQVLRR  298



>ref|XP_008340833.1| PREDICTED: probable esterase KAI2 [Malus domestica]
 ref|XP_008354712.1| PREDICTED: probable esterase KAI2 [Malus domestica]
Length=297

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +AAI RPDLF+KL++I ASPR+LND +Y+GGFEQ E+E++F A+++NY+AW  GFAPLAV
Sbjct  130  IAAITRPDLFTKLVMIAASPRYLNDVDYYGGFEQEELEQLFEAIRSNYKAWCSGFAPLAV  189

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRT FNMRPDIALSV +TIF  DLR  L  +TVPCHI+QS KDLAVPV
Sbjct  190  GGDMDSVAVQEFSRTXFNMRPDIALSVAQTIFQSDLRQMLGLITVPCHILQSVKDLAVPV  249

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+H NLGG+SIVEV+S++GHLP LS+PE+  PVLLRHI++DI
Sbjct  250  VVSEYLHQNLGGQSIVEVMSSDGHLPQLSSPEIVNPVLLRHIRYDI  295



>gb|AHW84477.1| alpha-beta hydrolase KAI2a [Marchantia polymorpha]
Length=267

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RP LFSK+I+I ASPR+LND  Y GGF+Q ++ ++F AMQ+N++AWV GFAPLAV
Sbjct  102  LASIERPYLFSKIIMISASPRYLNDANYFGGFDQEDLNQLFEAMQSNFKAWVSGFAPLAV  161

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            GAD+ + AV+EFSRTLFN+RPDIA SV +TIF  DLR  L +V VPCHI+QS+KDLAVPV
Sbjct  162  GADIESDAVQEFSRTLFNIRPDIAFSVAKTIFQSDLRRILPQVIVPCHILQSNKDLAVPV  221

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+  + GGK+IVE++ T+GHLP LS+P++ +PVL+RHI   I
Sbjct  222  VVSEYLKHSFGGKTIVEILPTDGHLPQLSSPDVVVPVLMRHIMGSI  267



>dbj|BAJ96506.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=303

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRPDLF+KL+LIGASPRFLND +YHGGFE  +I++VF AM ANY AW  G+APLA
Sbjct  139  ILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEQIQQVFDAMSANYAAWATGYAPLA  198

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPAAV+EFSRTLFNMRPDI+L V +++F  DLRG L  V  PC ++Q+++D++VP 
Sbjct  199  VGADVPAAVQEFSRTLFNMRPDISLHVCQSVFKTDLRGVLGMVQAPCVVVQTTRDVSVPA  258

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            +VA Y+ ++LGG++ +E + TEGHLPHLSAP L   V  R
Sbjct  259  SVAAYLKAHLGGRTTIEPLPTEGHLPHLSAPSLLAQVFRR  298



>ref|XP_001772484.1| predicted protein [Physcomitrella patens]
 gb|EDQ62766.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   223 bits (567),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 135/166 (81%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA++ RP+ F+K+I I ASPR+LND +Y GGFEQ ++ ++F AMQ+N++AWV GFAPLAV
Sbjct  106  LASLARPNFFTKIITISASPRYLNDADYFGGFEQDDLNQLFQAMQSNFKAWVSGFAPLAV  165

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            GAD+ + AV+EF RTLFN+RPDIA SV +TIF  DLR  L +VTVPCHI+QSS+DLAVPV
Sbjct  166  GADIESMAVQEFGRTLFNIRPDIAFSVAKTIFQSDLRSILPQVTVPCHILQSSRDLAVPV  225

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V++YIH  + G SIVEV+ TEGHLP LS+P++ IPVL RH+  D+
Sbjct  226  IVSDYIHQRISGASIVEVLHTEGHLPQLSSPDVVIPVLKRHLVGDL  271



>ref|XP_001769564.1| predicted protein [Physcomitrella patens]
 gb|EDQ65557.1| predicted protein [Physcomitrella patens]
Length=270

 Score =   222 bits (566),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 135/162 (83%), Gaps = 1/162 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA++ RP++F+K+I + ASPR+LND +Y GGFEQ ++ ++F AMQ+N++AWV GFAPLAV
Sbjct  105  LASLERPEIFTKIITLSASPRYLNDRDYFGGFEQDDLNQLFEAMQSNFKAWVSGFAPLAV  164

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G+D+ + AV+EF RTLFN+RPDIA SV +TIF  DLR  L +VTVPCHI+QSSKDLAVP+
Sbjct  165  GSDIDSMAVQEFGRTLFNIRPDIAFSVAKTIFQSDLRIMLPKVTVPCHILQSSKDLAVPL  224

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHI  487
             VA+Y+H  LGG +IVEV+ TEGHLP LS+P++ IPVL RH+
Sbjct  225  VVADYLHHALGGPTIVEVLPTEGHLPQLSSPDIIIPVLKRHL  266



>ref|XP_002984394.1| hypothetical protein SELMODRAFT_445910 [Selaginella moellendorffii]
 gb|EFJ14444.1| hypothetical protein SELMODRAFT_445910 [Selaginella moellendorffii]
Length=267

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LAA  RP++FSK+IL+ ASPR+LNDE Y GGFEQ ++ ++F AMQ+N++AWV GFAPL V
Sbjct  102  LAAAARPEIFSKIILLSASPRYLNDENYFGGFEQQDLNELFDAMQSNFKAWVSGFAPLVV  161

Query  185  GADVPAA-VREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ +A V+EFSRTLFN+RPDIAL+V ++IF  D R  L  V  PCHI+QS+KDLAVPV
Sbjct  162  GDDMESATVQEFSRTLFNVRPDIALAVAKSIFQSDFRHILPGVFPPCHILQSNKDLAVPV  221

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V++Y+ +NLGGK++VEV++ EGHLP LSAP++ IPVLLRH+Q +I
Sbjct  222  VVSDYLAANLGGKTVVEVLAAEGHLPQLSAPDVVIPVLLRHLQMEI  267



>gb|EAZ27449.1| hypothetical protein OsJ_11398 [Oryza sativa Japonica Group]
Length=288

 Score =   220 bits (561),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 141/208 (68%), Gaps = 43/208 (21%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPR---------------------------------------  67
            +A+I RPDLFSKL+L+ ASPR                                       
Sbjct  79   IASISRPDLFSKLVLLSASPRHLQLVLTLDLTMDGWGVGCIEPPNLKLDSCIVKTDNLQG  138

Query  68   ---FLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVGADVPA-AVREFSRTLFN  235
               +LND +Y+GGFEQ +++++F AM +NY+AW  GFAPL VG D+ + AV+EFSRTLFN
Sbjct  139  VLLYLNDVDYYGGFEQEDLDELFEAMGSNYKAWCSGFAPLCVGGDMESVAVQEFSRTLFN  198

Query  236  MRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAVAEYIHSNLGGKSIVEV  415
            +RPDIALSV +TIF  D+R  L  VTVPCHI+QS+KDLAVPV V+EY+H +LGG SIVEV
Sbjct  199  IRPDIALSVAQTIFQSDVRSLLPLVTVPCHIVQSTKDLAVPVVVSEYLHKHLGGDSIVEV  258

Query  416  VSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            + +EGHLP LS+P++ IPVLLRHIQHDI
Sbjct  259  MPSEGHLPQLSSPDIVIPVLLRHIQHDI  286



>ref|XP_009774997.1| PREDICTED: probable esterase D14L, partial [Nicotiana sylvestris]
Length=149

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = +2

Query  65   RFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVGADVPA-AVREFSRTLFNMR  241
            R+LND +Y+GGFEQ +++++F AM++NY+AW  GFAPL VG D+ + A++EFSRTLFNMR
Sbjct  2    RYLNDSDYYGGFEQEDLDQLFEAMRSNYKAWCSGFAPLVVGGDMDSVAIQEFSRTLFNMR  61

Query  242  PDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAVAEYIHSNLGGKSIVEVVS  421
            PDIALSV + IF  DLR  L+ VTVPCHIIQS KDLAVPV V+EY+H +LGG+SIVEV+S
Sbjct  62   PDIALSVLQIIFLSDLRHLLAHVTVPCHIIQSMKDLAVPVVVSEYLHQHLGGESIVEVMS  121

Query  422  TEGHLPHLSAPELTIPVLLRHIQHDI  499
            TEGHLP LS+P++ IPVLLRHI+HDI
Sbjct  122  TEGHLPQLSSPDVVIPVLLRHIRHDI  147



>gb|KDO79007.1| hypothetical protein CISIN_1g046596mg, partial [Citrus sinensis]
Length=258

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+KL++I  SPR+LND +Y+GGFEQ E++++F AM++NY+AW  GFAPLAV
Sbjct  103  IASISRPDLFTKLVMISGSPRYLNDVDYYGGFEQEELDQLFEAMRSNYKAWCSGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  V+VPCHIIQS KDLAVPV
Sbjct  163  GGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRQILGLVSVPCHIIQSVKDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIP  469
             ++EY+H NL   S+VEV+S++GHLP LS+P++ IP
Sbjct  223  VISEYLHQNLLVDSVVEVMSSDGHLPQLSSPDIVIP  258



>gb|AAR89004.1| putative hydrolases [Oryza sativa Japonica Group]
 gb|EAY90591.1| hypothetical protein OsI_12193 [Oryza sativa Indica Group]
Length=313

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 141/208 (68%), Gaps = 43/208 (21%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPR---------------------------------------  67
            +A+I RPDLFSKL+L+ ASPR                                       
Sbjct  104  IASISRPDLFSKLVLLSASPRHLQLVLTLDLTMDGWGVGCIEPPNLKLDSCIVKTDNLQG  163

Query  68   ---FLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVGADVPA-AVREFSRTLFN  235
               +LND +Y+GGFEQ +++++F AM +NY+AW  GFAPL VG D+ + AV+EFSRTLFN
Sbjct  164  VLLYLNDVDYYGGFEQEDLDELFEAMGSNYKAWCSGFAPLCVGGDMESVAVQEFSRTLFN  223

Query  236  MRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAVAEYIHSNLGGKSIVEV  415
            +RPDIALSV +TIF  D+R  L  VTVPCHI+QS+KDLAVPV V+EY+H +LGG SIVEV
Sbjct  224  IRPDIALSVAQTIFQSDVRSLLPLVTVPCHIVQSTKDLAVPVVVSEYLHKHLGGDSIVEV  283

Query  416  VSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            + +EGHLP LS+P++ IPVLLRHIQHDI
Sbjct  284  MPSEGHLPQLSSPDIVIPVLLRHIQHDI  311



>gb|AHW84478.1| alpha-beta hydrolase KAI2b [Marchantia polymorpha]
Length=274

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA++ RPD FSK++L+ ASPR+LN+  Y GGFEQ ++ ++F AMQ+N++AWV GFAPLAV
Sbjct  102  LASLERPDAFSKIVLVSASPRYLNEPFYFGGFEQEDLNQLFEAMQSNFKAWVTGFAPLAV  161

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            GAD+ A  V+EF+RTLFN+RPDIALSV +TIF  D+R  L  VTVPCHI+QS+KDLAVPV
Sbjct  162  GADIEAPVVQEFARTLFNIRPDIALSVVKTIFQSDVRKILPLVTVPCHILQSTKDLAVPV  221

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHI  487
             VA Y+  +LGG++ +E+  TEGHLP LS+PE+ IPV+LRHI
Sbjct  222  VVAHYLERSLGGETHMEIFPTEGHLPQLSSPEVVIPVILRHI  263



>ref|XP_002972818.1| hypothetical protein SELMODRAFT_441991 [Selaginella moellendorffii]
 gb|EFJ26039.1| hypothetical protein SELMODRAFT_441991 [Selaginella moellendorffii]
Length=267

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LAA  RP++FSK+IL+ ASPR+LNDE Y GGFEQ ++ ++F AMQ+N++AWV GFAPL V
Sbjct  102  LAAAARPEIFSKIILLSASPRYLNDENYFGGFEQQDLNELFDAMQSNFKAWVSGFAPLVV  161

Query  185  GADVPAA-VREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ +A V+EFSRTLFN+RPDIAL+V ++IF  D R  L  V  PCHI+QS+KDLAVPV
Sbjct  162  GDDMESATVQEFSRTLFNVRPDIALAVAKSIFQSDFRHILPGVFPPCHILQSNKDLAVPV  221

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V++Y+ ++LGGK++VEV++ EGHLP LSAP++ IPVLLRH++ +I
Sbjct  222  VVSDYLAAHLGGKTVVEVLAAEGHLPQLSAPDVVIPVLLRHLEMEI  267



>ref|XP_002524972.1| sigma factor sigb regulation protein rsbq, putative [Ricinus 
communis]
 gb|EEF37469.1| sigma factor sigb regulation protein rsbq, putative [Ricinus 
communis]
Length=269

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A++ RPDLF K+I+I A+PR LN E+Y+GGF Q +++++F  +++NY+AW  GFAPL V
Sbjct  103  IASVSRPDLFLKIIMISATPRLLNAEDYYGGFNQEDVDQIFEGVKSNYKAWCSGFAPLVV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
              D+ + AV+EF+RTLFNMRPDIALS+ + IF  D+R  L  VTVPCHI+QS KD+AVP+
Sbjct  163  SGDLESLAVQEFTRTLFNMRPDIALSLAQVIFLTDMRDVLPSVTVPCHILQSMKDMAVPM  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDID  502
             V+EY+H NLG +SI+EV+ T GHLP LS+P++ IPV+L+H+  D++
Sbjct  223  MVSEYLHQNLGSRSIIEVMPTSGHLPQLSSPDIVIPVILKHLTDDVN  269



>ref|XP_008656620.1| PREDICTED: probable esterase D14L isoform X1 [Zea mays]
Length=177

 Score =   209 bits (531),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +2

Query  68   FLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVGADVPA-AVREFSRTLFNMRP  244
            +LND +Y+GGFEQ E++++F AMQ+NY+AW  GFAPL VG D+ + AV+EFSRTLFN+RP
Sbjct  31   YLNDVDYYGGFEQDELDELFEAMQSNYKAWCLGFAPLCVGGDMESVAVQEFSRTLFNIRP  90

Query  245  DIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAVAEYIHSNLGGKSIVEVVST  424
            DIAL+V +TIF  D+R  L  V+VPCHI+QS+KDLAVPV V+EY+H +LGG SIVEV+ +
Sbjct  91   DIALNVAQTIFQSDVRSLLRHVSVPCHIVQSTKDLAVPVVVSEYLHRHLGGDSIVEVMPS  150

Query  425  EGHLPHLSAPELTIPVLLRHIQHDI  499
            EGHLP LS+P++  PVLLRHIQHDI
Sbjct  151  EGHLPQLSSPDIVTPVLLRHIQHDI  175



>ref|XP_002524969.1| sigma factor sigb regulation protein rsbq, putative [Ricinus 
communis]
 gb|EEF37466.1| sigma factor sigb regulation protein rsbq, putative [Ricinus 
communis]
Length=269

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLFSKLI++ A+PR L+D+ Y GGF Q +++++F  M +NYEAW  GFAP  V
Sbjct  102  IASIYRPDLFSKLIMLCATPRLLHDKNYIGGFNQEDLDQMFEGMCSNYEAWCSGFAPTVV  161

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV++FSRTLFNMRPDI+LS+ + +F FD+R  L  VT+PCHI+QS  D AVPV
Sbjct  162  GGDMDSVAVQDFSRTLFNMRPDISLSIAKMMFLFDMRHILPMVTIPCHILQSFNDAAVPV  221

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            AV++Y+H NLGG SI+EV+ TEGHLP L +P + +PV+L+HI 
Sbjct  222  AVSDYLHQNLGGPSIIEVMPTEGHLPQLKSPGIVVPVILKHIH  264



>gb|EMT26461.1| hypothetical protein F775_28903 [Aegilops tauschii]
Length=215

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +2

Query  68   FLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVGADVPA-AVREFSRTLFNMRP  244
            +LND +Y+GGFEQ E++++F AM++NY+AW  GFAPL VG D+ + +V+EFSRTLFN+RP
Sbjct  69   YLNDVDYYGGFEQEELDELFEAMRSNYKAWCSGFAPLCVGGDLESVSVQEFSRTLFNIRP  128

Query  245  DIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAVAEYIHSNLGGKSIVEVVST  424
            DIALSV +TIF  D+R  L  V+VPCHI+QS+KDLAVPV V+EY+H +LGG SIVEV+ +
Sbjct  129  DIALSVAQTIFQSDVRTLLPLVSVPCHIVQSTKDLAVPVVVSEYLHKHLGGDSIVEVMPS  188

Query  425  EGHLPHLSAPELTIPVLLRHIQHDI  499
            EGHLP LS+P++  PVLLRHIQHDI
Sbjct  189  EGHLPQLSSPDIVTPVLLRHIQHDI  213



>ref|XP_001765232.1| predicted protein [Physcomitrella patens]
 gb|EDQ69960.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 124/164 (76%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LA++ RPDLF KLIL+ ASPR+LND  Y+GGFEQ +++++FS+M++N+ AWV GFA  A
Sbjct  105  VLASLERPDLFRKLILLSASPRYLNDSSYYGGFEQEDLDQLFSSMRSNFSAWVSGFATAA  164

Query  182  VGADV-PAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+   AV+EFS T  +MRPD+AL   + +F  D R  LS VTVPCHI+QS KD+AVP
Sbjct  165  VGTDIHDEAVQEFSSTFISMRPDVALRTSQFVFQSDFRSILSEVTVPCHIVQSRKDIAVP  224

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            + VAEY+  NLGG + V+++ T+GHLP LS PEL +PVLL  I 
Sbjct  225  IEVAEYLRCNLGGWTSVDILQTDGHLPQLSCPELVVPVLLHCID  268



>gb|ABD98032.1| catalytic hydrolase [Striga asiatica]
Length=270

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF KLI+I  SPR  N E+Y+GG EQ EI++V  +M+ NY++   G APL +
Sbjct  103  VASIFRPDLFHKLIMISPSPRLANTEDYYGGLEQKEIDEVVGSMEENYKSMALGSAPLIL  162

Query  185  GADV-PAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
              D+  AAV+E+ RTLFNMRPDI+  + R IF  DLR ++  + VPCHII S+KD  VPV
Sbjct  163  ACDLESAAVQEYVRTLFNMRPDISCCIARMIFGLDLRPYIGHIKVPCHIIHSAKDFMVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDID  502
            AV EY+  +LGG S+VEV+ TEGHLPHLSAPE+TIPV+LRH++ DI+
Sbjct  223  AVGEYLCKHLGGPSVVEVMPTEGHLPHLSAPEVTIPVVLRHVRQDIE  269



>gb|KHN07666.1| Sigma factor sigB regulation protein rsbQ [Glycine soja]
Length=198

 Score =   202 bits (513),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 116/134 (87%), Gaps = 3/134 (2%)
 Frame = +2

Query  11   AIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVGA  190
            +IRRPDLFSKLILIGASPRFLND++YHGGFEQGEIE+VFSAM+ANYEAWV GFAPL+VGA
Sbjct  68   SIRRPDLFSKLILIGASPRFLNDKDYHGGFEQGEIEQVFSAMEANYEAWVNGFAPLSVGA  127

Query  191  DVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAVA  370
               AAVREFSRTLFNMRPDI+L V RT+F+ DLRG L  V VPC I+Q+++D++VP +VA
Sbjct  128  ---AAVREFSRTLFNMRPDISLFVSRTVFHSDLRGILGLVNVPCCIMQTARDMSVPASVA  184

Query  371  EYIHSNLGGKSIVE  412
             Y+  ++ GKS ++
Sbjct  185  TYMRDHIAGKSTIQ  198



>ref|XP_002531937.1| sigma factor sigb regulation protein rsbq, putative [Ricinus 
communis]
 gb|EEF30451.1| sigma factor sigb regulation protein rsbq, putative [Ricinus 
communis]
Length=270

 Score =   204 bits (518),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLFSKL+++ A+PR LND +Y+GGF++ +++++F  M +NY+AW  GFAP+ V
Sbjct  103  IASIYRPDLFSKLVMLSATPRLLNDIDYNGGFQKEDLDQMFEGMSSNYKAWCSGFAPMIV  162

Query  185  GADVPAA-VREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ +  V+EFSRTLFNMRPDIAL++ + IF  D R  LS VT P HIIQ + DLAVPV
Sbjct  163  GGDMESIYVQEFSRTLFNMRPDIALNLAKVIFQSDARHILSMVTKPVHIIQGTMDLAVPV  222

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             V+EY+  NLGG S VE++ T GHLP LS P++ IPV+L+HI  DI
Sbjct  223  KVSEYLRQNLGGPSTVELMPTSGHLPQLSYPDIVIPVVLKHIYLDI  268



>emb|CAJ91149.1| hydrolase [Platanus x acerifolia]
Length=226

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ILA+IRRPDLF+KL+LIGASPRFLND +YHGGFE+ EIEK+FSAM+ANYEAWV GFAPLA
Sbjct  103  ILASIRRPDLFTKLVLIGASPRFLNDRDYHGGFEREEIEKLFSAMEANYEAWVNGFAPLA  162

Query  182  VGADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            VGADVPA VREFSRTLFNMRPDI+L V RT+FN D RG L  V VPC IIQS +D++VPV
Sbjct  163  VGADVPAVVREFSRTLFNMRPDISLFVSRTVFNSDFRGVLGLVKVPCCIIQSVRDVSVPV  222

Query  362  AVA  370
            +VA
Sbjct  223  SVA  225



>ref|XP_010030510.1| PREDICTED: LOW QUALITY PROTEIN: probable esterase KAI2 [Eucalyptus 
grandis]
Length=301

 Score =   202 bits (515),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 125/163 (77%), Gaps = 2/163 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LAAI  PDLFSK+ ++ A PR+LND EY+GGFEQ +++++F AMQ NY+ W  GFAPL +
Sbjct  133  LAAIACPDLFSKINMLAALPRYLNDSEYYGGFEQADLDQLFKAMQENYKVWCFGFAPLVI  192

Query  185  GADVPAA-VREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ +  V+EFSRTLFNMRPDIAL +  TIF  D+R +L  V +PCHII S KDL V V
Sbjct  193  GGDMDSVYVQEFSRTLFNMRPDIALCIAXTIFQSDMRPYLGLVNMPCHIIXSMKDLVVLV  252

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSA-PELTIPVLLRHI  487
             V+ Y+H +LGGK I+E++S+EGHL  LS+ PE+ IP+LLRHI
Sbjct  253  GVSGYLHQHLGGKLIIEMMSSEGHLLQLSSPPEMVIPMLLRHI  295



>ref|XP_008680178.1| PREDICTED: probable esterase D14L [Zea mays]
Length=171

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +2

Query  68   FLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVGADVPA-AVREFSRTLFNMRP  244
            +LND +Y+GGFEQ E++++F AMQ+NY+ W  GFAPL VG D+ + AV+EFSRTLFN+RP
Sbjct  31   YLNDVDYYGGFEQDELDELFEAMQSNYKVWCLGFAPLCVGGDMESVAVQEFSRTLFNIRP  90

Query  245  DIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAVAEYIHSNLGGKSIVEVVST  424
            DIAL+V +TIF  D+R  L  V+VPCHI+QS+KDL VPV V+EY+H +LGG SIVEV+ +
Sbjct  91   DIALNVAQTIFQSDVRSLLPHVSVPCHIVQSTKDLVVPVVVSEYLHRHLGGDSIVEVMPS  150

Query  425  EGHLPHLSAPELTIPVLLRHI  487
            EGHLP LS+P++  PVLL+HI
Sbjct  151  EGHLPQLSSPDIVTPVLLQHI  171



>ref|XP_001760483.1| predicted protein [Physcomitrella patens]
 gb|EDQ74558.1| predicted protein [Physcomitrella patens]
Length=270

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RP++F+KLIL+ +SPR+LND  Y+GGF+Q ++++++  M++N+ +WV GF PLA+
Sbjct  107  LASIERPEVFTKLILLASSPRYLNDVGYYGGFDQKDLDQLYGDMKSNFRSWVTGFGPLAI  166

Query  185  GADV-PAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            GAD+  +AV+EFSRTL+++RPDIAL+V +TIF  DLR  L  VTVP +++Q+ KD+AVP+
Sbjct  167  GADLESSAVQEFSRTLYSIRPDIALNVCKTIFQSDLRSILPLVTVPVYVVQTRKDMAVPL  226

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
             VA Y+  NLGG +++EV++T GHLPHLS P + +PVLLR
Sbjct  227  QVANYMVRNLGGWTMMEVLNTGGHLPHLSDPNVVLPVLLR  266



>gb|ABK26781.1| unknown [Picea sitchensis]
Length=281

 Score =   196 bits (499),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 124/163 (76%), Gaps = 1/163 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RP+LF KLIL+ ASPR+LNDE YHGGFE+GEI++++ AM+++Y AWV GFAPLAV
Sbjct  106  LASIERPELFEKLILLCASPRYLNDESYHGGFERGEIDRLYCAMKSDYAAWVSGFAPLAV  165

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G D P+ V+EFSRT+ NMRP+IAL V RTIF  D+R  LS V  PC IIQ++KD+ VP+A
Sbjct  166  GVDEPSVVKEFSRTMMNMRPEIALLVARTIFESDMRSILSDVKTPCSIIQTAKDIVVPMA  225

Query  365  VAEYIHSNLGGK-SIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            V  ++  +LGGK + V+++  +GHLP L+ P L +    R ++
Sbjct  226  VPYHMQGSLGGKMNSVDILDEDGHLPQLTNPGLLLHAFKRVLE  268



>gb|KHN36273.1| Sigma factor sigB regulation protein rsbQ [Glycine soja]
Length=263

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF+KLI++ ASPR+LND EY+GGFEQ ++ ++F AM ANY+AW  GFAPLAV
Sbjct  103  IASISRPDLFTKLIMVSASPRYLNDVEYYGGFEQEDLNQLFDAMAANYKAWCYGFAPLAV  162

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G D+ + AV+EFSRTLFNMRPDIAL V RTIF  D+R  LS V+VPCHIIQ+ KD+AVPV
Sbjct  163  GGDMESVAVQEFSRTLFNMRPDIALIVSRTIFQSDMRQILSLVSVPCHIIQAEKDMAVPV  222

Query  362  AVAEYIHSNLGGKSIVEV  415
             ++EY+H ++G +SIVEV
Sbjct  223  MISEYLHQHIGAESIVEV  240



>gb|ABK21599.1| unknown [Picea sitchensis]
Length=281

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 125/163 (77%), Gaps = 1/163 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RP+LF +LIL+ ASPR+LNDE YHGGFE+GEI++++ AM+++Y AWV GFAPLAV
Sbjct  106  LASIERPELFERLILLCASPRYLNDESYHGGFERGEIDRLYCAMKSDYAAWVSGFAPLAV  165

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G D P+ V+EFSRT+ NMRP+IAL+V RTIF  D+R  LS V  PC IIQ++KD+ VP+A
Sbjct  166  GVDEPSVVKEFSRTMMNMRPEIALAVARTIFESDMRSILSDVKTPCSIIQTAKDIVVPMA  225

Query  365  VAEYIHSNLGGK-SIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            V  ++  +LGGK + V+++  +GHLP L+ P L +    R ++
Sbjct  226  VPYHMQGSLGGKMNSVDLLDEDGHLPQLTHPGLLLQAFKRVLE  268



>ref|XP_010087288.1| hypothetical protein L484_009421 [Morus notabilis]
 gb|EXB28735.1| hypothetical protein L484_009421 [Morus notabilis]
Length=258

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 126/169 (75%), Gaps = 20/169 (12%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            ++A++ RPDLFSKL++I ASPR+LND +Y GGFEQ +++++F AM  NY+AW  GFAPLA
Sbjct  109  VIASVTRPDLFSKLVMIAASPRYLNDVDYFGGFEQEDLDQLFDAMGKNYKAWCSGFAPLA  168

Query  182  VGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            VG D+ + AV+EFSR                    D+R  L  V+VPCHI+QS KDLAVP
Sbjct  169  VGGDMDSVAVQEFSRG-------------------DMRQILGLVSVPCHILQSFKDLAVP  209

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
            + ++EY+H +LGG+SIVEV+S+EGHLP LS+P++ IPVLLRHI++DI A
Sbjct  210  IVISEYLHQHLGGESIVEVMSSEGHLPQLSSPDVVIPVLLRHIRYDIAA  258



>ref|XP_001767298.1| predicted protein [Physcomitrella patens]
 gb|EDQ67979.1| predicted protein [Physcomitrella patens]
Length=282

 Score =   194 bits (493),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 126/174 (72%), Gaps = 13/174 (7%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I+RP++F KLIL+  SPR+LND  Y+GGFEQ +++++F+ ++ ++++WV  FAP AV
Sbjct  107  LASIQRPEIFRKLILLATSPRYLNDRNYYGGFEQHDLDQLFANIKFDFKSWVSVFAPGAV  166

Query  185  GADVP-AAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSR------------VTVPCH  325
            G D+   AV+EF RTL +MRPDI LS  +TIF  DLR  L              VTVPCH
Sbjct  167  GGDIDDKAVQEFFRTLLSMRPDIVLSTSKTIFQSDLRSILPEARKLQSCKSVYIVTVPCH  226

Query  326  IIQSSKDLAVPVAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHI  487
            IIQS KDLAVPV VAEY+  NLGG + +E++ TEGH+P LS+PEL IPVLLR I
Sbjct  227  IIQSRKDLAVPVEVAEYLSRNLGGWTSMEILQTEGHIPQLSSPELVIPVLLRCI  280



>ref|XP_001767650.1| predicted protein [Physcomitrella patens]
 gb|EDQ67609.1| predicted protein [Physcomitrella patens]
Length=262

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RP++F KLIL+G+SPR+LND  Y GGFEQ ++E+++  M++N+ +WV GF  L V
Sbjct  99   LASIERPEVFKKLILLGSSPRYLNDVNYFGGFEQQDLEQIYGDMKSNFRSWVTGFGELLV  158

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
             AD+ + AV+EF RT +++RPDIALS+ RTIF  DLR  L  V VP H++Q+ KD+AVP+
Sbjct  159  AADLQSRAVQEFCRTFYSIRPDIALSITRTIFQSDLRSTLPLVKVPVHLLQTMKDMAVPL  218

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
             VA Y+  NLGG + +E++ TEGHLPHLS P + I  LLR
Sbjct  219  QVAHYLQQNLGGWTTMEILDTEGHLPHLSDPGVVIAALLR  258



>ref|XP_001782872.1| predicted protein [Physcomitrella patens]
 gb|EDQ52327.1| predicted protein [Physcomitrella patens]
Length=266

 Score =   191 bits (485),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 124/166 (75%), Gaps = 8/166 (5%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA++ RP    ++ L     R+LN  EY GG ++  + ++F AMQ+N++AWV GFAPLA+
Sbjct  106  LASMERP---HRIYLC----RYLNASEYFGGLDEEVLNQLFYAMQSNFKAWVSGFAPLAL  158

Query  185  GADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            GAD+ + AV+EFSRTLFN+RPDIA +V +TIF  DLR  L +V VPCHI+QSSKDLAVPV
Sbjct  159  GADIDSMAVQEFSRTLFNIRPDIAFTVAKTIFQSDLRSVLHQVQVPCHILQSSKDLAVPV  218

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
             VA Y+H  LGG S VE++ TEGHLP LSAP++ IPVL RH+  D+
Sbjct  219  VVASYLHHALGGPSAVEILQTEGHLPQLSAPDVVIPVLKRHLVCDV  264



>gb|KDP32036.1| hypothetical protein JCGZ_12497 [Jatropha curcas]
Length=232

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 123/164 (75%), Gaps = 10/164 (6%)
 Frame = +2

Query  8    AAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVG  187
            A+I RPDLFSK+I++ A+PR LND+ Y+GGFE          +++NY+AW  GFAP+ +G
Sbjct  75   ASIARPDLFSKIIMLSATPRLLNDKNYNGGFE---------GLRSNYKAWCSGFAPMVLG  125

Query  188  ADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
             D+ + AV+EFS+TLFNMRPDIA S+    F  +LR  L  VT+PCHI+QS  D+AVP A
Sbjct  126  GDMDSVAVQEFSQTLFNMRPDIAFSLVHLKFLTELRHILPMVTLPCHILQSEMDMAVPAA  185

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHD  496
            V+EY++ +LG  SIVEV+ T GHLPHLSAP++ IPV+L+H++ D
Sbjct  186  VSEYLNQHLGDPSIVEVMPTSGHLPHLSAPDIVIPVILKHLRLD  229



>gb|KCW59519.1| hypothetical protein EUGRSUZ_H02271, partial [Eucalyptus grandis]
Length=302

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 123/165 (75%), Gaps = 3/165 (2%)
 Frame = +2

Query  14   IRRPDLF--SKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVG  187
            IRRP      +L  +   PR L  + +     Q +++++F AM+ NY+AW  GFAPLAVG
Sbjct  136  IRRPLRLRHGRLHRLHQPPRPLRQDRHAFRLPQEDLDQLFEAMRENYKAWCSGFAPLAVG  195

Query  188  ADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
             D+ + AV+EFSRTLFNMRPDIALSV +TIFN D+R  L  VTVPCHIIQS KDLAVPV 
Sbjct  196  GDMDSVAVQEFSRTLFNMRPDIALSVAQTIFNSDMRSILRLVTVPCHIIQSMKDLAVPVV  255

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V+EY+H NLGG SIVEV+ ++GHLP LS+P+  IPV+LRHI++DI
Sbjct  256  VSEYLHQNLGGDSIVEVMQSDGHLPQLSSPDTVIPVILRHIRYDI  300



>tpg|DAA45887.1| TPA: hypothetical protein ZEAMMB73_234551 [Zea mays]
Length=125

 Score =   181 bits (459),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = +2

Query  134  MQANYEAWVRGFAPLAVGADVPA-AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRV  310
            M++NY+AW  GFAPL VG D+ + AV+EFSRTLFN+RPDIALSV +TIF  D+R  L  V
Sbjct  1    MRSNYKAWCSGFAPLCVGGDMESVAVQEFSRTLFNIRPDIALSVAQTIFQSDVRSLLPHV  60

Query  311  TVPCHIIQSSKDLAVPVAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            TVPCHI+QS+KDLAVPV V+EY+H +LGG SIVEV+ +EGHLP LS+P++ IPVLLRHIQ
Sbjct  61   TVPCHIVQSTKDLAVPVVVSEYLHRHLGGDSIVEVMPSEGHLPQLSSPDIVIPVLLRHIQ  120

Query  491  HDI  499
            HDI
Sbjct  121  HDI  123



>ref|XP_006425426.1| hypothetical protein CICLE_v10026257mg [Citrus clementina]
 gb|ESR38666.1| hypothetical protein CICLE_v10026257mg [Citrus clementina]
Length=275

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LAAI RP+LFS+LILIG SPRF ND  Y GG +   +E+VF  M++NYE+WV GF P+A
Sbjct  109  LLAAIHRPNLFSRLILIGGSPRFTNDGNYIGGIDPAHMEEVFRRMESNYESWVAGFVPMA  168

Query  182  VGADVP-AAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            +GADVP  A++EFSRTLF+MRPDIAL V RT F  DLR  L  V VP  IIQSS DL+VP
Sbjct  169  LGADVPDMALQEFSRTLFSMRPDIALHVARTAFAADLRHVLGLVRVPVCIIQSSVDLSVP  228

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
             AVAEY+  +LGG +++E + T GHLPH+S+P
Sbjct  229  PAVAEYMRRHLGGPTVLEFLPTHGHLPHVSSP  260



>ref|XP_006466978.1| PREDICTED: probable strigolactone esterase D14-like [Citrus sinensis]
 gb|KDO71265.1| hypothetical protein CISIN_1g045774mg [Citrus sinensis]
Length=275

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LAAI RP+LFS+LILIG SPRF ND  Y GG +   +E+VF  M++NYE+WV GF P+A
Sbjct  109  LLAAIHRPNLFSRLILIGGSPRFTNDGNYIGGIDPAHMEEVFRRMESNYESWVAGFVPMA  168

Query  182  VGADVP-AAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            +GADVP  A++EFSRTLF+MRPDIAL V RT F  DLR  L  V VP  IIQSS DL+VP
Sbjct  169  LGADVPDMALQEFSRTLFSMRPDIALHVARTAFAADLRHVLGLVRVPVCIIQSSVDLSVP  228

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
             AVAEY+  +LGG +++E + T GHLPH+S+P
Sbjct  229  PAVAEYMRRHLGGPTVLEFLPTHGHLPHVSSP  260



>ref|XP_006425422.1| hypothetical protein CICLE_v10026256mg [Citrus clementina]
 gb|ESR38662.1| hypothetical protein CICLE_v10026256mg [Citrus clementina]
Length=275

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    ILAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLA  181
            +LAAI RP+LFS+LILIG SPRF ND  Y GG +   +E+VF  M++NYE+WV GF P+A
Sbjct  109  LLAAIHRPNLFSRLILIGGSPRFTNDGNYIGGIDPAHMEEVFRRMESNYESWVAGFVPMA  168

Query  182  VGADVP-AAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
            +GADVP  A++EFSRTLF+MRPDIAL V RT F  DLR  L  + VP  IIQSS DL+VP
Sbjct  169  LGADVPDMALQEFSRTLFSMRPDIALHVARTAFAADLRHVLGLIRVPVCIIQSSVDLSVP  228

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAP  454
             AVAEY+  +LGG +++E + T GHLPH+S+P
Sbjct  229  PAVAEYMRRHLGGPTVLEFLPTHGHLPHVSSP  260



>gb|ABK22456.1| unknown [Picea sitchensis]
Length=283

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 117/155 (75%), Gaps = 1/155 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RP+LF +LIL+ ASPR+LN+E YHGGFE+GE++ ++ A++++Y AW  GFAPLAV
Sbjct  106  LASIERPELFERLILLCASPRYLNEESYHGGFERGEVDSLYYALKSHYAAWASGFAPLAV  165

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G D P+ V EF RT+ NM+P+IAL+V +TIF  D+R  L  V  PC IIQ++KD+ VP+A
Sbjct  166  GVDEPSVVEEFRRTMMNMKPEIALAVAKTIFESDMRSILCDVKTPCSIIQTAKDIVVPMA  225

Query  365  VAEYIHSNLGGK-SIVEVVSTEGHLPHLSAPELTI  466
            V  ++  NLGGK + V ++  EGHLP L+A +L +
Sbjct  226  VPYHMQGNLGGKMNSVIILDAEGHLPQLTAQDLLL  260



>gb|ABK22436.1| unknown [Picea sitchensis]
Length=273

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 118/160 (74%), Gaps = 1/160 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I+RP LF +LIL+ ASPR+LN+E Y GGFE+G+I+ +FSA+++NY AWV GF PL +
Sbjct  109  LASIKRPGLFERLILLCASPRYLNNESYEGGFERGDIDGIFSAIKSNYSAWVSGFVPLLI  168

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G D P+ V+EFS+ L NM+P+IAL V + IF  D+R  L  V  PC IIQ+ KD+AVP++
Sbjct  169  GVDEPSLVKEFSKKLMNMKPEIALVVAKAIFQSDVRNILCDVKTPCSIIQTRKDIAVPLS  228

Query  365  VAEYIHSNLGG-KSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            V  Y+  NLGG K+ V ++ T+GH+P L++P +   +L +
Sbjct  229  VPYYMQRNLGGEKNSVHILDTDGHIPQLTSPSMFAKLLTQ  268



>gb|ABR17129.1| unknown [Picea sitchensis]
Length=269

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 118/155 (76%), Gaps = 1/155 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I+RP+LF +LIL+ ASPR+LNDE YHGGFE+G+++ ++ AM+++Y  WV GFAPLAV
Sbjct  106  LASIKRPELFERLILLCASPRYLNDESYHGGFERGQVDILYCAMKSDYAEWVSGFAPLAV  165

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G D P+ V+EFSRT+ NM+P+IA++V  TIF  D+R  L  V  P  IIQ+++D+ VP+ 
Sbjct  166  GVDAPSVVQEFSRTMMNMKPEIAVAVASTIFESDMRSILCDVMTPVSIIQTARDIVVPMT  225

Query  365  VAEYIHSNLGGKS-IVEVVSTEGHLPHLSAPELTI  466
            V  ++   LGGK+  V+++  +GHLPHL++P L +
Sbjct  226  VPYHMQGILGGKTNSVDILDVDGHLPHLTSPGLLL  260



>gb|ACN40675.1| unknown [Picea sitchensis]
Length=273

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 117/160 (73%), Gaps = 1/160 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I+RP LF + IL+ ASPR+LN+E Y GGFE+G+I+ +FSA+++NY AWV GF PL +
Sbjct  109  LASIKRPGLFERFILLCASPRYLNNESYEGGFERGDIDGIFSAIKSNYSAWVSGFVPLLI  168

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G D P+ V+EFS+ L NM+P+IAL V + IF  D+R  L  V  PC IIQ+ KD+AVP++
Sbjct  169  GVDEPSLVKEFSKKLMNMKPEIALVVAKAIFQSDVRNILCDVKTPCSIIQTRKDIAVPLS  228

Query  365  VAEYIHSNLGG-KSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            V  Y+  NLGG K+ V ++ T+GH+P L++P +   +L +
Sbjct  229  VPYYMQRNLGGEKNSVHILDTDGHIPQLTSPSMFAKLLTQ  268



>emb|CBI33729.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 114/165 (69%), Gaps = 29/165 (18%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLFSKLI I  SPR+LND +Y+GGFEQ +++++F AM +NY+AW  GFAPLAV
Sbjct  103  IASITRPDLFSKLISINGSPRYLNDVDYYGGFEQEDLDQLFEAMGSNYKAWCSGFAPLAV  162

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G D+                             D    L  VTVPCHI+QS KDLAVPV 
Sbjct  163  GGDM-----------------------------DSVAILCHVTVPCHILQSIKDLAVPVV  193

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V+EY+H NLGG+SIVEV++++GHLP LS+P++ +PVLLRHI+++I
Sbjct  194  VSEYLHQNLGGESIVEVMTSDGHLPQLSSPDIVVPVLLRHIRYNI  238



>ref|XP_008775243.1| PREDICTED: probable strigolactone esterase D14 homolog [Phoenix 
dactylifera]
Length=285

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+++RPDLFS L+LIGASPR+LN E Y GGFE+ E+EK+F A+++N+++W + F  LA+
Sbjct  101  IASVKRPDLFSHLVLIGASPRYLNSEGYEGGFERMEVEKMFVAIESNFQSWAQSFVTLAI  160

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G + P ++  F R+   MRPDIALSV + IF  DLR  L +V VPC IIQ + D+ VP +
Sbjct  161  GVNDPISIETFKRSFLQMRPDIALSVAKMIFLSDLRDVLGKVEVPCTIIQGTNDIVVPTS  220

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            VA YI   + GK++VE++  +GH P L+A ++ +  L R
Sbjct  221  VARYIQHKMKGKAMVEIIRFDGHFPQLTAHQMVMEALDR  259



>ref|XP_001780905.1| predicted protein [Physcomitrella patens]
 gb|EDQ54311.1| predicted protein [Physcomitrella patens]
Length=286

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RP +F KLIL+ ASPR++ND+ Y GGFE  ++ +VF+AMQ+N+ AW  GF P A+
Sbjct  120  IASIERPSVFKKLILMAASPRYINDDNYIGGFELEDLLEVFAAMQSNFRAWATGFVPKAM  179

Query  185  GADVPAA-VREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            GAD+ +  VREF+RTLFNMRPDIAL V +T F  DLR  L +VTVPC+++Q+  D++V +
Sbjct  180  GADIQSWPVREFTRTLFNMRPDIALGVSKTCFESDLRPILPQVTVPCYLMQTGMDISVSI  239

Query  362  AVAEYIHSNLGGKSIVEVV-STEGHLPHLSAPELTIPVLLR  481
             V +Y+ ++LGGK+ VE++   EGHLPHL+ P     +L R
Sbjct  240  EVVKYMAAHLGGKTEVEILHDLEGHLPHLTHPAEVTAMLQR  280



>ref|WP_019184503.1| hypothetical protein [Stenotrophomonas maltophilia]
Length=268

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 118/156 (76%), Gaps = 1/156 (1%)
 Frame = +2

Query  8    AAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVG  187
            AA+ RP+LF +L++IGASPR+L+D+ Y GGF+  ++E++F +M+ANY+AW+ GFAP+ VG
Sbjct  105  AAVARPELFERLVIIGASPRYLDDDGYTGGFKPQDLEQLFESMRANYQAWIAGFAPMVVG  164

Query  188  ADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAV  367
             +  A V +FS TLF MRPDIAL+  RTIF  DLR   +RV+ P H+IQ++ D+AVPVAV
Sbjct  165  VEDSAVVADFSNTLFQMRPDIALNTSRTIFTSDLRSLAARVSTPVHLIQTAHDVAVPVAV  224

Query  368  AEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVL  475
             +++ + + G ++ +V+   GHLPH++AP+  + +L
Sbjct  225  GQWLANAIDGATL-DVIDASGHLPHMTAPDDVMRIL  259



>gb|AFI78790.1| putative D14 protein [Klebsormidium flaccidum]
Length=267

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 114/165 (69%), Gaps = 4/165 (2%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I RP +F K++   ASPR+LNDE Y GG E  ++E +F AM +NY+ WV GFAPLAV
Sbjct  103  LASIERPQVFEKIVCFSASPRYLNDENYFGGNEVADLEALFEAMSSNYKTWVAGFAPLAV  162

Query  185  --GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVP  358
               AD P  V+EFSRTLF++RPDIALSV RTI+  D R  L +V+VP H++QS  DLAVP
Sbjct  163  LGPADSP-GVQEFSRTLFSLRPDIALSVSRTIYFSDYRAILPQVSVPVHLLQSRNDLAVP  221

Query  359  VAVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQH  493
              V  Y+ S+L    +VE +  EGHLPHL+ PEL    + RHI+ 
Sbjct  222  EFVTNYVASHL-HNCVVEYLPIEGHLPHLAQPELMTEAIRRHIEQ  265



>ref|XP_010904531.1| PREDICTED: probable strigolactone esterase D14 homolog [Elaeis 
guineensis]
Length=284

 Score =   173 bits (439),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+++RPDLF+ L+LIGASPR+LN E+Y GGFE+ E+EK+F+ +++N+++W + F PLA+
Sbjct  100  VASVKRPDLFTHLVLIGASPRYLNSEDYEGGFERMEVEKMFTDIESNFQSWAQSFVPLAI  159

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G D P ++ +F  +   MRPDIALS  R I   DLR  L +V V C IIQ + D  VP +
Sbjct  160  GVDDPISIEKFKGSFLQMRPDIALSAARLILLSDLRDVLEKVEVRCTIIQGTNDFLVPTS  219

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            VA Y+   + GK++VE +  +GH P L+A ++ I VL R
Sbjct  220  VAHYMQHKMKGKAMVETIGCDGHFPQLTAHQMLIEVLDR  258



>ref|XP_006844369.1| hypothetical protein AMTR_s00142p00063260 [Amborella trichopoda]
 gb|ERN06044.1| hypothetical protein AMTR_s00142p00063260 [Amborella trichopoda]
Length=279

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = +2

Query  8    AAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVG  187
            AAI+RP++F  LIL+GASPR+LN E Y GGFE+ E+E +F +M+++Y AW   FAP  +G
Sbjct  108  AAIKRPEIFQSLILLGASPRYLNSEGYEGGFERSELESLFKSMESDYTAWTETFAPYVLG  167

Query  188  ADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAV  367
            ++ P  VR F+ +L +M+P+IA+S+ +T+F  D R  L ++ VPC +IQ+ +D AVP+ V
Sbjct  168  SEDPILVRGFNDSLKSMKPEIAVSILKTVFLSDYRDILPKLKVPCVLIQTREDRAVPMFV  227

Query  368  AEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVL  475
            AEY+   LGGK+ +EV+  EGH+PH++AP L I  L
Sbjct  228  AEYLKRELGGKASLEVLDVEGHVPHVTAPSLLISAL  263



>ref|XP_001775211.1| predicted protein [Physcomitrella patens]
 gb|EDQ59947.1| predicted protein [Physcomitrella patens]
Length=280

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RP +F KL+LI  SPR+ ND +Y GGFE  E+ ++F+AM++N+ AW+ GF+P AV
Sbjct  114  IASIERPSVFKKLVLIATSPRYSNDGDYIGGFEMEELHELFAAMRSNFIAWITGFSPKAV  173

Query  185  GADVPAA-VREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G+D+ +  V+EFSRT FNMRPDIALS+ +T F  DLR  + +V +PC+++QS  D ++ +
Sbjct  174  GSDIQSWPVQEFSRTFFNMRPDIALSICKTCFASDLRPLIPQVMIPCYLVQSGVDASLSI  233

Query  362  AVAEYIHSNLGGKSIVEVVST-EGHLPHLSAPELTIPVLLRHIQ  490
             V +Y+ +NLGG S V+++   +GHLPHL+ PE  I +L R  Q
Sbjct  234  KVVKYMAANLGGMSHVDILQDIQGHLPHLAHPEAVIAMLQRAFQ  277



>ref|WP_036504924.1| alpha/beta hydrolase [Novosphingobium sp. AP12]
Length=260

 Score =   170 bits (431),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    AAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVG  187
            AA  RPDLF++L++IGASPR+LND  Y GGFEQ  ++++F++M AN++AWV GFAP+ VG
Sbjct  97   AACARPDLFARLVMIGASPRYLNDGGYVGGFEQEGLDQLFASMAANFQAWVAGFAPMVVG  156

Query  188  ADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAV  367
             D   AV +FSRTLF MRPD+AL+  RTIF  D+R    RV  P H++Q++ D+AVP  V
Sbjct  157  VDDSEAVADFSRTLFQMRPDVALNTSRTIFGSDMRATARRVPTPVHLVQAASDVAVPREV  216

Query  368  AEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHI  487
             +++ + +   + ++V+S  GHLPH++AP   + ++ R +
Sbjct  217  GDWLAAAI-PNATLDVISASGHLPHMTAPAEVLAIVERRL  255



>gb|EJL22584.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Novosphingobium sp. AP12]
Length=266

 Score =   170 bits (430),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    AAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVG  187
            AA  RPDLF++L++IGASPR+LND  Y GGFEQ  ++++F++M AN++AWV GFAP+ VG
Sbjct  103  AACARPDLFARLVMIGASPRYLNDGGYVGGFEQEGLDQLFASMAANFQAWVAGFAPMVVG  162

Query  188  ADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAV  367
             D   AV +FSRTLF MRPD+AL+  RTIF  D+R    RV  P H++Q++ D+AVP  V
Sbjct  163  VDDSEAVADFSRTLFQMRPDVALNTSRTIFGSDMRATARRVPTPVHLVQAASDVAVPREV  222

Query  368  AEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHI  487
             +++ + +   + ++V+S  GHLPH++AP   + ++ R +
Sbjct  223  GDWLAAAI-PNATLDVISASGHLPHMTAPAEVLAIVERRL  261



>ref|WP_021232077.1| hypothetical protein [Novosphingobium lindaniclasticum]
 gb|EQB19775.1| hypothetical protein L284_00370 [Novosphingobium lindaniclasticum 
LE124]
Length=265

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 114/165 (69%), Gaps = 1/165 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A++ RPDLFS++++IGASPR+LN+  Y GGF+  +++ +F +M ANY+AW  GFAPL V
Sbjct  101  IASVGRPDLFSRIVMIGASPRYLNEPGYVGGFDATDLDALFDSMAANYQAWAAGFAPLVV  160

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G D   AV EFSR LF MRPDIAL   RTIF  D+R    RV VP  +IQ++ D+AVP  
Sbjct  161  GVDDAHAVSEFSRGLFQMRPDIALHTSRTIFTSDVRNAARRVPVPVTLIQTANDVAVPRE  220

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDI  499
            V  ++   +   + ++++   GHLPHL+AP+  + +L +H+Q D+
Sbjct  221  VGAWLAREM-KDATLDIIDASGHLPHLTAPDAVMRILDKHLQGDV  264



>ref|WP_037527489.1| alpha/beta hydrolase [Sphingomonas wittichii]
Length=266

 Score =   167 bits (424),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 113/160 (71%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    AAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVG  187
            AA  RP+ F KL++IGASPR+LND+ Y GGF+Q +++ +F +M AN++AW  GFAP  VG
Sbjct  102  AASIRPEPFHKLVMIGASPRYLNDDHYMGGFDQPDLDGLFESMAANFQAWAAGFAPAVVG  161

Query  188  ADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAV  367
                 A+ EFSRTLF MRPDIAL++ RTIF  D+RG   +V  P HIIQ+S D+AVP  V
Sbjct  162  VPDNVAIDEFSRTLFQMRPDIALNMSRTIFQSDMRGVARQVERPTHIIQTSHDMAVPAEV  221

Query  368  AEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHI  487
            A++++  + G S ++++   GHLPH++AP   + +L R +
Sbjct  222  AKWLNRAIDG-STLDMIEAAGHLPHMTAPSEILGILERRL  260



>ref|XP_010257604.1| PREDICTED: probable strigolactone esterase D14 [Nelumbo nucifera]
Length=274

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +AA +RPDLF +LIL+GASPR+LN E Y+GGFE+ ++E VF A++ N+  WV  FAP A+
Sbjct  109  IAATQRPDLFKQLILLGASPRYLNAEGYYGGFERSDVETVFQAIRQNFSGWVSNFAPKAI  168

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G +  AA++EF R+L  M+PDIAL V +T+F  D R  L +V VPC IIQ+ +D  VP +
Sbjct  169  GVNDMAAIKEFERSLRRMKPDIALDVAKTVFLSDYREVLKQVRVPCIIIQAERDFVVPKS  228

Query  365  VAEYIHSNL-GGKSIVEVVSTEGHLPHLSA  451
            VA Y+ + + GG + VE++ T+GH PHL+A
Sbjct  229  VAFYLETMIVGGYTKVEILETQGHFPHLTA  258



>gb|ABK23563.1| unknown [Picea sitchensis]
Length=273

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 107/150 (71%), Gaps = 1/150 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LA+I+RP+LF +LIL+GASPR+LNDE Y GG E+GEI+ + S +++NY AWV GF PL +
Sbjct  109  LASIKRPELFERLILLGASPRYLNDESYEGGSERGEIDGILSTIKSNYSAWVSGFVPLLI  168

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G D P+ V + SR   +++P+IA  V ++IF  DLR  L+ V  PC IIQ+ KD+ VP +
Sbjct  169  GVDQPSIVDDLSRKWLSIKPEIAFPVAKSIFECDLRSILTDVKTPCSIIQTRKDVVVPSS  228

Query  365  VAEYIHSNLGGK-SIVEVVSTEGHLPHLSA  451
            V  Y+  NLGG+ + V ++  +GHLP L++
Sbjct  229  VPYYMQRNLGGENNSVHILDIDGHLPQLTS  258



>ref|WP_038689659.1| alpha/beta hydrolase [Stenotrophomonas rhizophila]
 gb|AHY59805.1| alpha/beta hydrolase [Stenotrophomonas rhizophila]
Length=266

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    AAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVG  187
            AA+ RP+LF +++ IGASPR+L+D+ Y GGF+  +++ +F +MQANY+AWV GFAP+ VG
Sbjct  103  AAVARPELFERVVTIGASPRYLDDDGYTGGFKPQDLDNLFESMQANYQAWVAGFAPMVVG  162

Query  188  ADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAV  367
             +    + +FSRTLF M+PDIAL+  RTIF  D+R    ++++P H+IQ++ D+AVPV V
Sbjct  163  VEDNRVLADFSRTLFQMQPDIALNTSRTIFTSDMRTLAPQLSMPVHVIQTAVDMAVPVEV  222

Query  368  AEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHI  487
            A+++   + G ++ +++   GHLPH++A +    +L R +
Sbjct  223  AQWLADTIDGATL-DIIDASGHLPHMTAADEVTRILERRL  261



>ref|XP_002969138.1| hypothetical protein SELMODRAFT_267235 [Selaginella moellendorffii]
 ref|XP_002973924.1| hypothetical protein SELMODRAFT_149517 [Selaginella moellendorffii]
 gb|EFJ24879.1| hypothetical protein SELMODRAFT_149517 [Selaginella moellendorffii]
 gb|EFJ30254.1| hypothetical protein SELMODRAFT_267235 [Selaginella moellendorffii]
Length=266

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            LAA  RPDLFSKL+L+GASPR++ND  Y GGFEQ +++++ +A++ ++ +W++GFAP A+
Sbjct  104  LAAAARPDLFSKLVLLGASPRYINDAGYEGGFEQQDVDELLAAIKRDHASWLQGFAPAAL  163

Query  185  GADVP-AAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPV  361
            G +     ++ +   L  ++PD  L +  TIF  DLR  LS VTVPCH+IQ+ +D AVP 
Sbjct  164  GPEASEECIQRYMAFLSVVKPDFMLLIAETIFKSDLRKVLSLVTVPCHVIQTKEDFAVPQ  223

Query  362  AVAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            AVA+Y+H  LGG+  +E++   GHLPH++ P++  PVL R
Sbjct  224  AVAKYLHQQLGGE--LEILDARGHLPHVTHPQILAPVLTR  261



>ref|XP_002531585.1| sigma factor sigb regulation protein rsbq, putative [Ricinus 
communis]
 gb|EEF30788.1| sigma factor sigb regulation protein rsbq, putative [Ricinus 
communis]
Length=279

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 112/161 (70%), Gaps = 4/161 (2%)
 Frame = +2

Query  8    AAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAVG  187
            AA++RP LF  L+L+G SPR+LN E YHGGFE+ +++ +  +M  N+ +WV+GFAP+AVG
Sbjct  111  AALQRPHLFQHLVLLGGSPRYLNAEGYHGGFERSDVKAILRSMNHNFSSWVQGFAPVAVG  170

Query  188  ADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAV  367
             +   A+  F+ +L  M+P IA SV +T+F  DLR  L +V+VPC IIQS KD+ VP  V
Sbjct  171  MNNTEAITIFANSLGRMKPSIAHSVAKTVFLSDLRRILPQVSVPCTIIQSKKDIIVPEFV  230

Query  368  AEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQ  490
            A Y+   LGG + V+++ TEGH PHL+A     P+LL+ ++
Sbjct  231  AHYMKKKLGGYAKVKILKTEGHFPHLTA----YPLLLKALK  267



>emb|CAN72706.1| hypothetical protein VITISV_043785 [Vitis vinifera]
Length=250

 Score =   163 bits (412),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 105/149 (70%), Gaps = 0/149 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I+RP+LF +LILIG+SPR+ ND+ Y GGFE   IE++FS M++N++ W   FA L  
Sbjct  79   IASIKRPELFKRLILIGSSPRYFNDDNYEGGFESSVIEQMFSNMESNFDQWASYFASLVA  138

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
             A  P +V ++ ++L  MRP++ALSV +T+F+ D R  L +V  PC IIQ++ D AVP +
Sbjct  139  NAKNPLSVEKYEKSLRAMRPEVALSVAKTVFHCDERDILDKVMTPCTIIQTTNDAAVPNS  198

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSA  451
            VAEY+   + G++ VE +  +GH PHL+A
Sbjct  199  VAEYMQKKIKGETTVEKIDMDGHFPHLNA  227



>ref|XP_010254192.1| PREDICTED: probable strigolactone esterase D14 homolog [Nelumbo 
nucifera]
Length=285

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 114/161 (71%), Gaps = 0/161 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+ +RPDLF +LIL+GASPR+LN ++Y GGFE+  +E++F  +++N+ +WV  FA L +
Sbjct  103  VASTKRPDLFKRLILLGASPRYLNAQDYEGGFERSAVEQMFMTIESNFSSWVPKFACLLI  162

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G + P A+  + + L  MRP+IALS+ +TIF  D+R  L RV VPC I+Q+S D  +P++
Sbjct  163  GEEHPLALEMYEKCLGRMRPEIALSLAKTIFLSDVRDVLERVQVPCTIVQTSHDAVIPIS  222

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHI  487
            VA Y+ S + G+S +E++  + H P L+AP+L + V+ R I
Sbjct  223  VARYMQSKIKGESTLEIIENDNHYPQLTAPQLLLNVVGRVI  263



>ref|XP_002308316.2| hydrolase family protein [Populus trichocarpa]
 gb|EEE91839.2| hydrolase family protein [Populus trichocarpa]
Length=278

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 109/158 (69%), Gaps = 0/158 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I+RPDLF KLIL+GASPR++N ++Y GGF   E+E + S +++NY  W + FA + V
Sbjct  108  IASIKRPDLFKKLILVGASPRYINADDYEGGFSNSEVEDIISNIESNYYNWAQAFASVVV  167

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
             A+ P +V  FS+ L  MRP+ A+ V +T+F  D R  L +V  PC I+Q+++D+ VP +
Sbjct  168  DANDPPSVDMFSKCLQRMRPEFAVPVAKTVFYCDERDILEKVLTPCIIVQTTRDIVVPNS  227

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLL  478
            VA Y+   + GKS VE++ T+GH PHL+A +  + VL+
Sbjct  228  VAYYMQEKIKGKSTVEIIETDGHFPHLTAHQQLLDVLI  265



>ref|XP_010915037.1| PREDICTED: probable strigolactone esterase D14 [Elaeis guineensis]
Length=260

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 111/159 (70%), Gaps = 1/159 (1%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +AAI RPDLFS L+L+GASPR+LN+E Y GG ++ E++++ SAM++N++ W + FAP  +
Sbjct  97   IAAIERPDLFSHLVLVGASPRYLNEEGYEGGMKRSEVDEILSAMESNFQTWAQSFAPPLI  156

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G D P ++ +F +    MRP+IALSV   +F  D R  L +V +PC I+Q + D+ VP++
Sbjct  157  GVDHPDSIEKFMQDFLRMRPEIALSVGEMVFMSDFRDVLEKVELPCTIVQCTDDIVVPMS  216

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            VA Y+ S + G+  +E++ + GH P L+AP+L I +L R
Sbjct  217  VAHYMQSKIKGRVSLEIIKS-GHCPPLTAPQLLIDILDR  254



>emb|CAN75737.1| hypothetical protein VITISV_025902 [Vitis vinifera]
Length=270

 Score =   162 bits (411),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +AA +RPDLF  LIL+G SPR+LN E Y+GGFE+  I+K+F A+  N+  WV+ FAP+AV
Sbjct  107  IAATKRPDLFEHLILLGGSPRYLNAEGYYGGFERSAIDKIFEAINENFPVWVQNFAPMAV  166

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G +  AA+ EF  +L  M+ +IALSV +T+F  DLR  L +V VPC IIQS +D+  P  
Sbjct  167  GINNSAAIAEFENSLGRMKQEIALSVAKTVFLSDLRLVLPQVKVPCTIIQSREDIVAPTF  226

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVL  475
            +A Y+  NLGG + V+++ T GH P L+A  L +  L
Sbjct  227  IACYMKENLGGDATVKILETRGHFPQLTAFPLLLDAL  263



>gb|ABK95696.1| unknown [Populus trichocarpa]
Length=278

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 108/158 (68%), Gaps = 0/158 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I+RPDLF KLIL+GASPR++N ++Y GGF   E+E + S +++NY  W + FA   V
Sbjct  108  IASIKRPDLFKKLILVGASPRYINADDYEGGFSNSEVEDIISNIESNYYNWAQAFASAVV  167

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
             A+ P +V  FS+ L  MRP+ A+ V +T+F  D R  L +V  PC I+Q+++D+ VP +
Sbjct  168  DANDPPSVDMFSKCLQRMRPEFAVPVAKTVFYCDERDILEKVLTPCIIVQTTRDIVVPNS  227

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLL  478
            VA Y+   + GKS VE++ T+GH PHL+A +  + VL+
Sbjct  228  VAYYMQEKIKGKSTVEIIETDGHFPHLTAHQQLLDVLI  265



>ref|XP_002281367.2| PREDICTED: probable strigolactone esterase DAD2 [Vitis vinifera]
Length=295

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 105/149 (70%), Gaps = 0/149 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I+RP+LF +LILIG+SPR+ ND+ Y GGFE   IE++FS M++N++ W   FA L  
Sbjct  124  IASIKRPELFKRLILIGSSPRYFNDDNYEGGFESSVIEQMFSNMESNFDEWASYFASLVA  183

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
             A  P +V ++ ++L  MRP++ALSV +T+F+ D R  L +V  PC IIQ++ D AVP +
Sbjct  184  NAKNPLSVEKYEKSLRAMRPEVALSVAKTVFHCDERDILDKVMTPCTIIQTTNDAAVPNS  243

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSA  451
            VAEY+   + G++ VE +  +GH PHL+A
Sbjct  244  VAEYMQKKIKGETTVEKIDMDGHFPHLNA  272



>gb|AFK48687.1| unknown [Medicago truncatula]
Length=105

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +2

Query  203  AVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVAVAEYIH  382
            AV+EFSRTLFNMRPDIALSV +TIF  D+R  L  VTVPCHIIQS KDLAVPV VAEY+H
Sbjct  5    AVQEFSRTLFNMRPDIALSVLQTIFKSDMRQILCMVTVPCHIIQSMKDLAVPVVVAEYLH  64

Query  383  SNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDIDA  505
             ++G +SIVEV+STEGHLP LS+P++ IPV+L+HI+HDI A
Sbjct  65   QHVGSESIVEVMSTEGHLPQLSSPDVVIPVILKHIRHDIAA  105



>ref|XP_002276657.1| PREDICTED: probable strigolactone esterase D14 homolog [Vitis 
vinifera]
 emb|CBI29965.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +AA +RPDLF  LIL+G SPR+LN E Y+GGFE+ +I+K+F A+  N+  WV+ F P+AV
Sbjct  107  IAATKRPDLFEHLILLGGSPRYLNAEGYYGGFERSDIDKIFEAINENFPVWVQNFVPMAV  166

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            G +  AA+ EF  +L  M+P+I LSV +T+F  DLR  L +V VPC IIQS +D+  P  
Sbjct  167  GINNSAAIAEFEYSLGRMKPEIVLSVAKTVFLSDLRLVLPQVKVPCTIIQSREDIVAPTF  226

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVL  475
            +A Y+  NLG  + V+++ T+GH P L+A  L +  L
Sbjct  227  IACYMKENLGDDATVKILETQGHFPQLTAFPLLLDAL  263



>emb|CBI28105.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 105/149 (70%), Gaps = 0/149 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I+RP+LF +LILIG+SPR+ ND+ Y GGFE   IE++FS M++N++ W   FA L  
Sbjct  97   IASIKRPELFKRLILIGSSPRYFNDDNYEGGFESSVIEQMFSNMESNFDEWASYFASLVA  156

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
             A  P +V ++ ++L  MRP++ALSV +T+F+ D R  L +V  PC IIQ++ D AVP +
Sbjct  157  NAKNPLSVEKYEKSLRAMRPEVALSVAKTVFHCDERDILDKVMTPCTIIQTTNDAAVPNS  216

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSA  451
            VAEY+   + G++ VE +  +GH PHL+A
Sbjct  217  VAEYMQKKIKGETTVEKIDMDGHFPHLNA  245



>ref|XP_008810138.1| PREDICTED: probable strigolactone esterase D14 [Phoenix dactylifera]
Length=266

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 105/159 (66%), Gaps = 0/159 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+++RPDLFS L+LIGASPR+LN E+Y GGFE+ E+E +F+ +++N+++W   F  L +
Sbjct  100  IASVKRPDLFSHLVLIGASPRYLNSEDYEGGFERTEVENMFTNIESNFQSWAESFVRLVI  159

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
            GA+    + +F R+   MRPDIAL   R IF  DLR  L  V V C IIQ + D+ VP +
Sbjct  160  GANDHIFIEKFRRSFLKMRPDIALCAARMIFLSDLRDVLEEVEVACTIIQGTNDVVVPTS  219

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLR  481
            VA ++   + GK+ VE + + GH P L+A  + + VL R
Sbjct  220  VAHFMQQEMKGKATVETIDSAGHFPQLTAHRMLLEVLDR  258



>ref|XP_010249846.1| PREDICTED: probable strigolactone esterase D14 homolog [Nelumbo 
nucifera]
Length=345

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 112/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I+RPDLF +LIL+ ASPRFLN E+Y GGFE   IE++   +++N+  W + FA L V
Sbjct  163  IASIKRPDLFKRLILVAASPRFLNAEDYEGGFEISHIEQMLFNIESNFHEWAQNFAGLVV  222

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
                P +V +F ++L  MRP++ALS+ +TIF  D+R  L +V  PC IIQ+S D+ VPV+
Sbjct  223  DGRHPPSVDKFRKSLGAMRPEVALSLAKTIFLSDVRDVLEKVQTPCTIIQTSNDIVVPVS  282

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLLRHIQHDID  502
            VA Y+H+ + GKS VE++  +GH P L+A    + VL R +  D D
Sbjct  283  VAHYMHNKIKGKSTVEIIEGDGHFPQLTAHSSLLDVLGRVMGIDFD  328



>ref|XP_011016315.1| PREDICTED: probable strigolactone esterase D14 [Populus euphratica]
Length=278

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 109/158 (69%), Gaps = 0/158 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I+RPDLF +LILIGASPR++N ++Y GGF   E+E + S +++N+  W + FA + V
Sbjct  108  IASIKRPDLFKRLILIGASPRYINADDYEGGFNNSEVEDIISNIESNFYNWAQAFASVVV  167

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
             A+ P +V  FS+ L  MRP+ A+ V +T+F  D R  L +V  PC I+Q+++D+ VP +
Sbjct  168  DANDPPSVDMFSKCLQRMRPEFAVHVAKTVFYCDERDILEKVLTPCIIVQTTRDIVVPNS  227

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSAPELTIPVLL  478
            VA Y+   + GKS VE++ T+GH PHL+A +  + VL+
Sbjct  228  VAYYMLEKIKGKSTVEIIETDGHFPHLTAHQQLLDVLI  265



>ref|XP_008242593.1| PREDICTED: probable strigolactone esterase D14 homolog [Prunus 
mume]
Length=284

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +2

Query  5    LAAIRRPDLFSKLILIGASPRFLNDEEYHGGFEQGEIEKVFSAMQANYEAWVRGFAPLAV  184
            +A+I RPDLF  LILIGASPR++N E+Y GG E  +I ++ SA+++NY  W   FA LAV
Sbjct  109  IASINRPDLFKTLILIGASPRYINTEDYEGGLEMSDITQIISAIESNYHNWAANFASLAV  168

Query  185  GADVPAAVREFSRTLFNMRPDIALSVFRTIFNFDLRGFLSRVTVPCHIIQSSKDLAVPVA  364
             A+ P +V +F + L  MRP++AL++ +T+F  D R  L RV+ PC II +S D+  P +
Sbjct  169  DANDPLSVDKFVKCLRRMRPEVALALAKTVFYSDQRDVLDRVSTPCTIINTSSDIVAPNS  228

Query  365  VAEYIHSNLGGKSIVEVVSTEGHLPHLSA  451
            VA Y+   + GKS VE+++T GH P L+A
Sbjct  229  VAFYMQKKIKGKSTVEIINTNGHFPQLTA  257



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1272215339102