BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22775_g2_i1 len=2166 path=[1337:0-640 1978:641-673 2651:674-995
694:996-1024 3001:1025-1728 2004:1729-2165]

Length=2166
                                                                      Score     E

ref|XP_006341140.1|  PREDICTED: cell division protein FtsZ homolo...    696   0.0      
ref|XP_010325922.1|  PREDICTED: cell division protein FtsZ homolo...    696   0.0      
ref|XP_011094340.1|  PREDICTED: cell division protein FtsZ homolo...    684   0.0      
ref|XP_009770004.1|  PREDICTED: cell division protein FtsZ homolo...    678   0.0      
ref|XP_009802019.1|  PREDICTED: cell division protein FtsZ homolo...    676   0.0      
ref|XP_004249449.1|  PREDICTED: cell division protein FtsZ homolo...    676   0.0      
ref|XP_006339123.1|  PREDICTED: cell division protein FtsZ homolo...    675   0.0      
ref|XP_009617397.1|  PREDICTED: cell division protein FtsZ homolo...    674   0.0      
ref|XP_009614454.1|  PREDICTED: cell division protein FtsZ homolo...    674   0.0      
ref|XP_011077930.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    685   0.0      
gb|EYU38631.1|  hypothetical protein MIMGU_mgv1a005592mg                667   0.0      
gb|KDP42743.1|  hypothetical protein JCGZ_23683                         660   0.0      
gb|EPS71348.1|  hypothetical protein M569_03407                         660   0.0      
ref|XP_006430212.1|  hypothetical protein CICLE_v10011609mg             654   0.0      
ref|XP_006481783.1|  PREDICTED: cell division protein FtsZ homolo...    654   0.0      
gb|AAF23771.1|AF205859_1  FtsZ protein                                  652   0.0      Gentiana lutea
ref|XP_006481782.1|  PREDICTED: cell division protein FtsZ homolo...    650   0.0      
ref|XP_002528741.1|  Cell division protein ftsZ, putative               647   0.0      Ricinus communis
ref|XP_002282740.1|  PREDICTED: cell division protein FtsZ homolo...    647   0.0      Vitis vinifera
ref|XP_007027731.1|  Tubulin/FtsZ family protein isoform 1              646   0.0      
ref|XP_008241237.1|  PREDICTED: cell division protein FtsZ homolo...    642   0.0      
gb|AFC37492.1|  FtsZ2 protein                                           641   0.0      
ref|XP_007202025.1|  hypothetical protein PRUPE_ppa005084mg             639   0.0      
gb|AFB70893.1|  FtsZ3 protein                                           638   0.0      
ref|XP_008389555.1|  PREDICTED: cell division protein FtsZ homolo...    634   0.0      
ref|XP_004302993.1|  PREDICTED: cell division protein FtsZ homolo...    634   0.0      
ref|XP_009617400.1|  PREDICTED: cell division protein FtsZ homolo...    632   0.0      
ref|XP_010101572.1|  Cell division protein FtsZ-2-2-like protein        633   0.0      
ref|XP_009374723.1|  PREDICTED: cell division protein FtsZ homolo...    632   0.0      
gb|EYU35483.1|  hypothetical protein MIMGU_mgv1a006376mg                628   0.0      
ref|XP_008787852.1|  PREDICTED: cell division protein FtsZ homolo...    630   0.0      
ref|XP_010036692.1|  PREDICTED: cell division protein FtsZ homolo...    628   0.0      
ref|XP_010683737.1|  PREDICTED: cell division protein FtsZ homolo...    627   0.0      
ref|XP_010931142.1|  PREDICTED: cell division protein FtsZ homolo...    625   0.0      
ref|XP_008369724.1|  PREDICTED: cell division protein FtsZ homolo...    624   0.0      
gb|KHG03680.1|  Cell division FtsZ-1, chloroplastic -like protein       624   0.0      
ref|XP_010244904.1|  PREDICTED: cell division protein FtsZ homolo...    622   0.0      
ref|XP_008343377.1|  PREDICTED: cell division protein FtsZ homolo...    619   0.0      
ref|XP_011019895.1|  PREDICTED: cell division protein FtsZ homolo...    618   0.0      
ref|XP_010271658.1|  PREDICTED: cell division protein FtsZ homolo...    618   0.0      
ref|XP_004149210.1|  PREDICTED: cell division protein FtsZ homolo...    615   0.0      
gb|KHG21600.1|  Cell division FtsZ-1, chloroplastic -like protein       615   0.0      
ref|XP_002308148.1|  hypothetical protein POPTR_0006s08310g             614   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009366668.1|  PREDICTED: cell division protein FtsZ homolo...    614   0.0      
ref|XP_003521462.1|  PREDICTED: cell division protein FtsZ homolo...    613   0.0      
ref|XP_008462572.1|  PREDICTED: cell division protein FtsZ homolo...    613   0.0      
ref|XP_004143321.1|  PREDICTED: cell division protein FtsZ homolo...    613   0.0      
gb|KEH42026.1|  cell division FtsZ-like protein                         610   0.0      
ref|XP_003554434.1|  PREDICTED: cell division protein FtsZ homolo...    608   0.0      
ref|XP_007145302.1|  hypothetical protein PHAVU_007G227600g             608   0.0      
ref|XP_007162898.1|  hypothetical protein PHAVU_001G189700g             606   0.0      
ref|XP_010527321.1|  PREDICTED: cell division protein FtsZ homolo...    603   0.0      
ref|XP_004494033.1|  PREDICTED: cell division protein FtsZ homolo...    601   0.0      
ref|XP_010905974.1|  PREDICTED: cell division protein FtsZ homolo...    601   0.0      
ref|XP_006855018.1|  hypothetical protein AMTR_s00031p00027380          599   0.0      
ref|XP_006594215.1|  PREDICTED: cell division protein FtsZ homolo...    600   0.0      
ref|XP_011007122.1|  PREDICTED: cell division protein FtsZ homolo...    600   0.0      
ref|XP_010059812.1|  PREDICTED: cell division protein FtsZ homolo...    599   0.0      
ref|XP_004494173.1|  PREDICTED: cell division protein FtsZ homolo...    599   0.0      
ref|XP_011007140.1|  PREDICTED: cell division protein FtsZ homolo...    598   0.0      
ref|XP_010527634.1|  PREDICTED: cell division protein FtsZ homolo...    596   0.0      
ref|XP_011007098.1|  PREDICTED: cell division protein FtsZ homolo...    595   0.0      
ref|XP_003625812.1|  Cell division protein ftsZ                         595   0.0      
ref|XP_010426896.1|  PREDICTED: cell division protein FtsZ homolo...    594   0.0      
gb|KHN13512.1|  Cell division protein FtsZ like 2-1, chloroplastic      592   0.0      
ref|XP_011007130.1|  PREDICTED: cell division protein FtsZ homolo...    593   0.0      
ref|XP_006291052.1|  hypothetical protein CARUB_v10017167mg             593   0.0      
ref|XP_002881433.1|  hypothetical protein ARALYDRAFT_902736             593   0.0      
ref|XP_002877882.1|  ftsz2-2                                            593   0.0      
ref|XP_008804829.1|  PREDICTED: cell division protein FtsZ homolo...    592   0.0      
ref|XP_010426897.1|  PREDICTED: cell division protein FtsZ homolo...    592   0.0      
ref|NP_190843.1|  plastidial division protein FtsZ2-2                   592   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504020.1|  PREDICTED: cell division protein FtsZ homolo...    592   0.0      
ref|XP_006384816.1|  FtsZ 3 family protein                              591   0.0      
ref|XP_006410796.1|  hypothetical protein EUTSA_v10016595mg             591   0.0      
ref|XP_011007148.1|  PREDICTED: cell division protein FtsZ homolo...    590   0.0      
ref|XP_010515749.1|  PREDICTED: cell division protein FtsZ homolo...    590   0.0      
ref|XP_010504021.1|  PREDICTED: cell division protein FtsZ homolo...    589   0.0      
gb|AAL07180.1|  putative plastid division protein FtsZ                  588   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_565839.1|  cell division protein FtsZ homolog 2-1                588   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294122.1|  hypothetical protein CARUB_v10023118mg             588   0.0      
ref|XP_010515750.1|  PREDICTED: cell division protein FtsZ homolo...    587   0.0      
ref|XP_006589850.1|  PREDICTED: cell division protein FtsZ homolo...    603   0.0      
ref|XP_006384817.1|  hypothetical protein POPTR_0004s21330g             586   0.0      
ref|XP_002312816.1|  FtsZ 3 family protein                              584   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008784023.1|  PREDICTED: cell division protein FtsZ homolo...    583   0.0      
ref|XP_006403772.1|  hypothetical protein EUTSA_v10010342mg             581   0.0      
ref|XP_010912291.1|  PREDICTED: cell division protein FtsZ homolo...    580   0.0      
ref|XP_011000926.1|  PREDICTED: cell division protein FtsZ homolo...    578   0.0      
emb|CCH47171.1|  similar to cell division protein ftsZ homolog 2-1      579   0.0      
ref|XP_009115972.1|  PREDICTED: cell division protein FtsZ homolo...    575   0.0      
ref|XP_010509497.1|  PREDICTED: cell division protein FtsZ homolo...    576   0.0      
ref|XP_010505156.1|  PREDICTED: cell division protein FtsZ homolo...    575   0.0      
ref|XP_011000925.1|  PREDICTED: cell division protein FtsZ homolo...    573   0.0      
ref|XP_010516836.1|  PREDICTED: cell division protein FtsZ homolo...    572   0.0      
ref|XP_011000927.1|  PREDICTED: cell division protein FtsZ homolo...    570   0.0      
emb|CDX78122.1|  BnaA09g33170D                                          570   0.0      
emb|CDX73607.1|  BnaC08g23960D                                          569   0.0      
ref|XP_009141570.1|  PREDICTED: cell division protein FtsZ homolo...    569   0.0      
emb|CDP15408.1|  unnamed protein product                                563   0.0      
ref|XP_009408276.1|  PREDICTED: cell division protein FtsZ homolo...    568   0.0      
gb|KCW48328.1|  hypothetical protein EUGRSUZ_K02046                     566   0.0      
emb|CDY43739.1|  BnaAnng07540D                                          566   0.0      
ref|XP_011000928.1|  PREDICTED: cell division protein FtsZ homolo...    558   0.0      
dbj|BAA96782.1|  LlFtsZ                                                 558   0.0      Lilium longiflorum [Easter lily]
emb|CBI30290.3|  unnamed protein product                                552   0.0      
ref|XP_007015822.1|  Tubulin/FtsZ family protein isoform 1              555   0.0      
ref|XP_003579697.1|  PREDICTED: cell division protein FtsZ homolo...    551   0.0      
ref|XP_004965609.1|  PREDICTED: cell division protein FtsZ homolo...    550   0.0      
gb|AFW59980.1|  hypothetical protein ZEAMMB73_019582                    550   0.0      
ref|XP_002447361.1|  hypothetical protein SORBIDRAFT_06g033640          549   0.0      Sorghum bicolor [broomcorn]
gb|KCW90554.1|  hypothetical protein EUGRSUZ_A02664                     548   0.0      
ref|XP_008663752.1|  PREDICTED: cell division protein FtsZ homolo...    548   0.0      
gb|EMS54959.1|  Cell division protein ftsZ-like protein 2-1, chlo...    548   0.0      
gb|EEE59586.1|  hypothetical protein OsJ_11892                          543   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050766.1|  Os03g0646100                                       543   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC75829.1|  hypothetical protein OsI_12805                          543   0.0      Oryza sativa Indica Group [Indian rice]
gb|ABR17393.1|  unknown                                                 546   0.0      Picea sitchensis
dbj|BAJ86189.1|  predicted protein                                      540   0.0      
ref|XP_003568351.1|  PREDICTED: cell division protein FtsZ homolo...    540   0.0      
gb|KEH24136.1|  cell division FtsZ-like protein                         540   0.0      
ref|XP_004961927.1|  PREDICTED: cell division protein FtsZ homolo...    538   0.0      
ref|XP_008363816.1|  PREDICTED: cell division protein FtsZ homolo...    536   0.0      
ref|XP_008656239.1|  PREDICTED: cell division protein FtsZ homolo...    537   0.0      
ref|XP_006650344.1|  PREDICTED: cell division protein FtsZ homolo...    537   0.0      
ref|XP_009404365.1|  PREDICTED: cell division protein FtsZ homolo...    536   0.0      
dbj|BAJ99368.1|  predicted protein                                      530   3e-178   
ref|XP_002523799.1|  Cell division protein ftsZ, putative               530   6e-178   Ricinus communis
gb|EMS50261.1|  Cell division protein ftsZ-like protein 2-1, chlo...    528   1e-177   
gb|EMT27316.1|  Cell division protein ftsZ                              526   4e-177   
gb|EEC79304.1|  hypothetical protein OsI_20135                          527   4e-177   Oryza sativa Indica Group [Indian rice]
ref|NP_001055677.1|  Os05g0443800                                       526   7e-177   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011000929.1|  PREDICTED: cell division protein FtsZ homolo...    525   1e-176   
ref|XP_006424245.1|  hypothetical protein CICLE_v10028361mg             525   2e-176   
ref|XP_008784025.1|  PREDICTED: cell division protein FtsZ homolo...    523   5e-176   
ref|XP_007015824.1|  Tubulin/FtsZ family protein isoform 3              523   7e-176   
ref|XP_006487942.1|  PREDICTED: cell division protein FtsZ homolo...    524   7e-176   
ref|XP_010232593.1|  PREDICTED: cell division protein FtsZ homolo...    524   8e-176   
ref|XP_010232594.1|  PREDICTED: cell division protein FtsZ homolo...    521   8e-175   
ref|XP_002441183.1|  hypothetical protein SORBIDRAFT_09g021830          519   4e-174   Sorghum bicolor [broomcorn]
ref|XP_006294123.1|  hypothetical protein CARUB_v10023118mg             517   7e-174   
gb|KCW90556.1|  hypothetical protein EUGRSUZ_A02664                     517   1e-173   
ref|XP_007027732.1|  Tubulin/FtsZ family protein isoform 2              498   1e-166   
gb|EMT25022.1|  Cell division protein ftsZ                              507   2e-166   
dbj|BAC57987.1|  ftsZ2                                                  489   1e-161   Marchantia polymorpha
ref|XP_002966083.1|  hypothetical protein SELMODRAFT_84291              472   3e-157   
ref|XP_010905984.1|  PREDICTED: cell division protein FtsZ homolo...    472   2e-156   
ref|XP_001765953.1|  ftsZ2-1 plastid division protein                   465   4e-153   
ref|XP_008804834.1|  PREDICTED: cell division protein FtsZ homolo...    460   4e-152   
ref|XP_007015825.1|  Tubulin/FtsZ family protein, putative isoform 4    456   5e-150   
gb|KDO70388.1|  hypothetical protein CISIN_1g024548mg                   449   8e-150   
ref|XP_001766775.1|  ftsZ2-2 plastid division protein                   449   7e-147   
gb|AFK36357.1|  unknown                                                 440   4e-146   
gb|KHG08016.1|  Cell division FtsZ-1, chloroplastic -like protein       421   2e-137   
emb|CDY70774.1|  BnaAnng34970D                                          413   9e-136   
emb|CDY72626.1|  BnaAnng41710D                                          412   1e-135   
dbj|BAD12166.1|  plastid division protein FtsZ2                         373   9e-118   Nannochloris bacillaris
ref|WP_015194198.1|  cell division protein FtsZ                         365   3e-115   
ref|XP_007015823.1|  Tubulin/FtsZ family protein, putative isoform 2    360   1e-113   
ref|WP_009785798.1|  cell division protein FtsZ                         360   5e-113   
ref|WP_023065873.1|  cell division protein FtsZ                         360   6e-113   
ref|WP_019504285.1|  hypothetical protein                               359   9e-113   
ref|WP_017303420.1|  hypothetical protein                               357   3e-112   
gb|AEL23173.1|  cell division protein                                   355   3e-112   
gb|AEL23175.1|  cell division protein                                   355   4e-112   
gb|AEL23168.1|  cell division protein                                   354   7e-112   
gb|AFP55289.1|  FtsZ                                                    353   1e-111   
gb|AEL23170.1|  cell division protein                                   353   2e-111   
ref|WP_015186821.1|  cell division protein FtsZ                         356   2e-111   
gb|AEL23169.1|  cell division protein                                   353   2e-111   
ref|WP_008186504.1|  cell division protein FtsZ                         355   2e-111   
emb|CEF98657.1|  Cell division protein FtsZ, C-terminal                 355   3e-111   
ref|XP_001418657.1|  predicted protein                                  354   3e-111   Ostreococcus lucimarinus CCE9901
ref|WP_034935803.1|  cell division protein FtsZ                         353   4e-111   
ref|XP_002499616.1|  predicted protein                                  355   4e-111   Micromonas commoda
ref|WP_015221984.1|  cell division protein FtsZ                         355   5e-111   
ref|XP_003058209.1|  predicted protein                                  355   5e-111   
ref|WP_012161432.1|  cell division protein FtsZ                         353   6e-111   
ref|WP_015117120.1|  cell division protein FtsZ                         355   7e-111   
gb|AEL23167.1|  cell division protein                                   351   9e-111   
gb|ELR98955.1|  cell division protein FtsZ                              354   9e-111   
ref|WP_008050554.1|  cell division protein FtsZ                         354   1e-110   
ref|WP_006669768.1|  cell division protein FtsZ                         354   1e-110   
ref|WP_006625893.1|  cell division protein FtsZ                         354   1e-110   
gb|AFP55293.1|  FtsZ                                                    353   2e-110   
ref|WP_006511475.1|  cell division protein FtsZ                         353   4e-110   
ref|WP_014276905.1|  cell division protein FtsZ                         352   4e-110   
ref|WP_006620261.1|  cell division protein FtsZ                         352   5e-110   
ref|WP_012630079.1|  cell division protein FtsZ                         353   8e-110   
ref|WP_015147980.1|  cell division protein FtsZ                         351   1e-109   
ref|WP_006632966.1|  cell division protein FtsZ                         351   2e-109   
gb|AFP55292.1|  FtsZ                                                    351   2e-109   
ref|WP_009557129.1|  cell division protein FtsZ                         350   2e-109   
ref|XP_003080256.1|  ftsZ2 (ISS)                                        350   3e-109   
ref|WP_015167500.1|  cell division protein FtsZ                         349   6e-109   
ref|WP_039778672.1|  cell division protein FtsZ                         348   6e-109   
ref|WP_015201234.1|  cell division protein FtsZ                         349   7e-109   
ref|WP_015180997.1|  cell division protein FtsZ                         349   7e-109   
ref|WP_015179039.1|  cell division protein FtsZ                         350   8e-109   
ref|WP_017712109.1|  cell division protein FtsZ                         347   9e-109   
ref|WP_023171980.1|  cell division protein FtsZ                         348   9e-109   
ref|WP_006106232.1|  cell division protein FtsZ                         346   1e-108   
ref|WP_035156917.1|  cell division protein FtsZ                         347   4e-108   
ref|WP_015157768.1|  cell division protein FtsZ                         347   4e-108   
ref|WP_037222028.1|  cell division protein FtsZ                         347   4e-108   
ref|WP_015219491.1|  cell division protein FtsZ                         347   5e-108   
ref|WP_010468588.1|  cell division protein FtsZ                         347   8e-108   
ref|WP_017287543.1|  cell division protein FtsZ                         346   9e-108   
ref|WP_009633359.1|  cell division protein FtsZ                         346   1e-107   
dbj|BAP17020.1|  cell division protein                                  343   1e-107   
ref|WP_026099047.1|  cell division protein FtsZ                         345   2e-107   
ref|WP_015225997.1|  cell division protein FtsZ                         345   2e-107   
ref|WP_009628587.1|  cell division protein FtsZ                         345   2e-107   
gb|AAM22891.1|  plastid division protein FtsZ2                          345   2e-107   Chlamydomonas reinhardtii
ref|XP_001700508.1|  plastid division protein FtsZ2                     345   3e-107   Chlamydomonas reinhardtii
ref|WP_035996963.1|  cell division protein FtsZ                         345   3e-107   
ref|WP_006457598.1|  cell division protein FtsZ                         344   3e-107   
ref|WP_008226369.1|  Cell division protein FtsZ                         345   3e-107   
ref|WP_011244037.1|  cell division protein FtsZ                         343   4e-107   
ref|WP_002765213.1|  cell division protein FtsZ                         344   5e-107   
ref|WP_008232986.1|  Cell division protein FtsZ                         344   5e-107   
ref|WP_038027290.1|  cell division protein FtsZ                         342   5e-107   
ref|WP_015164337.1|  cell division protein FtsZ                         344   5e-107   
ref|WP_015785230.1|  MULTISPECIES: cell division protein FtsZ           344   9e-107   
ref|WP_015229558.1|  cell division protein FtsZ                         341   1e-106   
ref|WP_002801422.1|  cell division protein FtsZ                         343   1e-106   
ref|WP_011433691.1|  cell division protein FtsZ                         341   1e-106   
ref|WP_011140302.1|  cell division protein FtsZ                         343   1e-106   
ref|WP_009544135.1|  MULTISPECIES: cell division protein FtsZ           342   2e-106   
ref|WP_008274607.1|  cell division protein FtsZ                         342   2e-106   
ref|WP_024125914.1|  cell division tubulin protein FtsZ                 342   2e-106   
ref|WP_027841036.1|  cell division protein FtsZ                         342   4e-106   
ref|WP_011429031.1|  cell division protein FtsZ                         340   4e-106   
ref|WP_015125672.1|  cell division protein FtsZ                         340   4e-106   
ref|WP_007355195.1|  MULTISPECIES: cell division protein FtsZ           342   5e-106   
ref|WP_019499271.1|  hypothetical protein                               342   6e-106   
ref|WP_015956956.1|  cell division protein FtsZ                         341   7e-106   
gb|AIE75824.1|  Cell division protein FtsZ                              341   9e-106   
ref|WP_011058214.1|  cell division protein FtsZ                         340   1e-105   
gb|EHJ13165.1|  cell division protein                                   338   2e-105   
ref|WP_011613145.1|  cell division protein FtsZ                         340   2e-105   
ref|WP_012265734.1|  cell division protein FtsZ                         340   3e-105   
ref|WP_035826132.1|  cell division protein FtsZ                         340   3e-105   
ref|WP_002756934.1|  cell division protein FtsZ                         339   3e-105   
ref|WP_007305196.1|  cell division protein FtsZ                         339   3e-105   
ref|WP_002781797.1|  Cell division protein ftsZ                         339   4e-105   
ref|WP_008206746.1|  cell division protein FtsZ                         339   4e-105   
ref|WP_021834441.1|  Cell division protein FtsZ                         339   5e-105   
gb|KFM23856.1|  Cell division protein FtsZ-like protein 1, chloro...    338   6e-105   
dbj|BAE20183.1|  FtsZ protein                                           338   8e-105   Microcystis aeruginosa
ref|WP_002742535.1|  cell division protein FtsZ                         338   8e-105   
ref|WP_002778450.1|  cell division protein FtsZ                         338   8e-105   
ref|WP_017296057.1|  hypothetical protein                               338   1e-104   
ref|WP_002738456.1|  cell division protein FtsZ                         338   1e-104   
ref|WP_002789310.1|  cell division protein FtsZ                         338   1e-104   
ref|XP_002952497.1|  plastid division protein FtsZ2                     338   1e-104   
gb|KEI67555.1|  FtsZ                                                    338   1e-104   
dbj|GAL92496.1|  cell division protein FtsZ                             338   1e-104   
ref|WP_015173791.1|  cell division protein FtsZ                         338   1e-104   
ref|WP_015154609.1|  cell division protein FtsZ                         337   2e-104   
ref|WP_013322397.1|  cell division protein FtsZ                         337   4e-104   
ref|WP_026788004.1|  MULTISPECIES: cell division protein FtsZ           337   5e-104   
ref|WP_039716790.1|  cell division protein FtsZ                         336   5e-104   
ref|WP_004161871.1|  cell division protein FtsZ                         336   7e-104   
ref|WP_015142504.1|  cell division protein FtsZ                         335   1e-103   
dbj|BAA82871.1|  plastid division protein FtsZ                          337   3e-103   Cyanidium caldarium
ref|WP_015115266.1|  cell division protein FtsZ                         335   6e-103   
ref|WP_026101371.1|  cell division protein FtsZ                         333   1e-102   
ref|XP_005538694.1|  plastid division protein FtsZ2-1                   335   1e-102   
dbj|BAD12165.1|  plastid division protein FtsZ                          333   2e-102   Nannochloris bacillaris
ref|WP_008307838.1|  cell division protein FtsZ                         330   3e-102   
ref|WP_010872126.1|  cell division protein FtsZ                         332   3e-102   
ref|WP_038330945.1|  cell division protein FtsZ                         332   3e-102   
ref|WP_015127955.1|  cell division protein FtsZ                         332   4e-102   
ref|WP_012411109.1|  cell division protein FtsZ                         332   4e-102   
ref|WP_026085701.1|  cell division protein FtsZ                         332   4e-102   
ref|WP_015139802.1|  cell division protein FtsZ                         332   5e-102   
ref|WP_025701508.1|  cell division protein FtsZ                         329   7e-102   
gb|AHJ27769.1|  Cell division protein FtsZ                              329   8e-102   
ref|WP_037289880.1|  cell division protein FtsZ                         329   1e-101   
ref|WP_015212387.1|  cell division protein FtsZ                         330   1e-101   
ref|WP_013191011.1|  cell division protein FtsZ                         330   1e-101   
ref|WP_027404710.1|  cell division protein FtsZ                         330   1e-101   
ref|WP_015209597.1|  cell division protein FtsZ                         330   1e-101   
gb|AAA85526.1|  FtsZ                                                    328   1e-101   
ref|WP_039204701.1|  cell division protein FtsZ                         330   2e-101   
ref|WP_006516669.1|  cell division protein FtsZ                         330   2e-101   
ref|WP_028549289.1|  cell division protein FtsZ                         328   2e-101   
ref|WP_036598772.1|  cell division protein FtsZ                         328   2e-101   
ref|WP_026082307.1|  cell division protein FtsZ                         330   2e-101   
ref|WP_016949004.1|  cell division protein FtsZ                         330   2e-101   
ref|WP_006197392.1|  cell division protein FtsZ                         330   2e-101   
ref|WP_017656104.1|  cell division protein FtsZ                         330   3e-101   
ref|WP_009456805.1|  MULTISPECIES: cell division protein FtsZ           330   3e-101   
ref|WP_015081472.1|  cell division protein FtsZ                         330   3e-101   
ref|WP_010997999.1|  cell division protein FtsZ                         329   3e-101   
ref|XP_007514862.1|  cell division protein FtsZ                         327   3e-101   
ref|WP_035989948.1|  cell division protein FtsZ                         327   4e-101   
ref|WP_011318639.1|  cell division protein FtsZ                         329   4e-101   
ref|XP_005647947.1|  cell division protein FtsZ                         327   4e-101   
ref|XP_002501749.1|  predicted protein                                  327   5e-101   
ref|WP_028082852.1|  cell division protein FtsZ                         328   7e-101   
ref|WP_028090307.1|  cell division protein FtsZ                         328   8e-101   
ref|WP_015132799.1|  cell division protein FtsZ                         327   8e-101   
ref|WP_031291206.1|  cell division protein FtsZ                         328   8e-101   
ref|WP_025692149.1|  cell division protein FtsZ                         326   8e-101   
ref|WP_038087826.1|  cell division protein FtsZ                         325   1e-100   
gb|ESA39048.1|  cell division protein                                   326   1e-100   
ref|XP_007515227.1|  cell division protein FtsZ                         327   1e-100   
ref|WP_006278715.1|  cell division protein FtsZ                         328   2e-100   
ref|WP_009342894.1|  cell division protein FtsZ                         328   2e-100   
ref|WP_025699186.1|  cell division protein FtsZ                         325   2e-100   
ref|WP_017299096.1|  cell division protein FtsZ                         325   3e-100   
ref|WP_022334019.1|  cell division protein FtsZ                         325   3e-100   
ref|WP_018975671.1|  cell division protein FtsZ                         325   4e-100   
ref|WP_009589569.1|  MULTISPECIES: cell division protein FtsZ           324   5e-100   
ref|WP_026093497.1|  cell division protein FtsZ                         327   5e-100   
ref|WP_036483673.1|  cell division protein FtsZ                         325   8e-100   
ref|WP_026733488.1|  cell division protein FtsZ                         325   9e-100   
ref|WP_017811789.1|  cell division protein FtsZ                         324   1e-99    
gb|AIQ13897.1|  cell division protein FtsZ                              323   1e-99    
ref|WP_036690196.1|  cell division protein FtsZ                         323   1e-99    
ref|WP_036654768.1|  cell division protein FtsZ                         323   2e-99    
ref|WP_038697626.1|  cell division protein FtsZ                         323   2e-99    
ref|WP_036724269.1|  cell division protein FtsZ                         323   2e-99    
gb|AIQ60212.1|  cell division protein FtsZ                              323   2e-99    
gb|AHV98374.1|  cell division protein FtsZ                              322   2e-99    
gb|KDD77168.1|  tubulin/FtsZ GTPase                                     328   2e-99    
ref|WP_039725564.1|  cell division protein FtsZ                         322   2e-99    
dbj|BAA82090.1|  plastid division protein FtsZ                          326   2e-99    
ref|WP_019909324.1|  cell division protein FtsZ                         322   3e-99    
ref|WP_026087296.1|  cell division protein FtsZ                         324   3e-99    
ref|WP_015199344.1|  cell division protein FtsZ                         324   4e-99    
ref|WP_036621409.1|  cell division protein FtsZ                         322   5e-99    
ref|WP_016860511.1|  cell division protein FtsZ                         323   6e-99    
ref|WP_009671787.1|  MULTISPECIES: cell division protein FtsZ           322   6e-99    
ref|WP_024094493.1|  cell division protein FtsZ                         322   6e-99    
ref|WP_038595356.1|  cell division protein FtsZ                         321   6e-99    
ref|WP_006209084.1|  MULTISPECIES: cell division protein FtsZ           321   7e-99    
ref|WP_014758451.1|  MULTISPECIES: cell division protein FtsZ           321   7e-99    
ref|WP_017310208.1|  cell division protein FtsZ                         323   7e-99    
ref|WP_017745628.1|  cell division protein FtsZ                         323   8e-99    
gb|AIQ31689.1|  cell division protein FtsZ                              321   9e-99    
ref|WP_018132753.1|  cell division protein FtsZ                         320   9e-99    
ref|WP_026721750.1|  cell division protein FtsZ                         323   1e-98    
ref|WP_012305666.1|  cell division protein FtsZ                         322   1e-98    
ref|WP_022257925.1|  cell division protein FtsZ                         321   1e-98    
gb|AFP65585.1|  cell division protein                                   322   1e-98    
ref|WP_030006808.1|  cell division protein FtsZ                         322   1e-98    
ref|WP_007505648.1|  cell division protein FtsZ                         320   1e-98    
ref|WP_015263178.1|  cell division protein FtsZ                         320   2e-98    
ref|WP_026485538.1|  cell division protein FtsZ                         320   2e-98    
ref|WP_007129473.1|  MULTISPECIES: cell division protein FtsZ           320   2e-98    
ref|WP_014795201.1|  MULTISPECIES: cell division protein FtsZ           319   2e-98    
ref|WP_019636227.1|  cell division protein FtsZ                         320   2e-98    
ref|WP_029682012.1|  cell division protein FtsZ                         321   2e-98    
ref|WP_028558081.1|  cell division protein FtsZ                         320   2e-98    
ref|WP_014282434.1|  cell division protein FtsZ                         320   2e-98    
gb|KIE11505.1|  cell division protein FtsZ                              322   2e-98    
ref|WP_036646713.1|  cell division protein FtsZ                         320   2e-98    
ref|WP_039748803.1|  cell division protein FtsZ                         322   3e-98    
ref|WP_036645617.1|  cell division protein FtsZ                         320   3e-98    
gb|AIQ48718.1|  cell division protein FtsZ                              320   3e-98    
ref|WP_018886787.1|  MULTISPECIES: cell division protein FtsZ           320   3e-98    
ref|XP_005707174.1|  cell division protein FtsZ                         323   3e-98    
ref|WP_036683633.1|  cell division protein FtsZ                         320   3e-98    
ref|WP_019688024.1|  cell division protein FtsZ                         320   3e-98    
ref|WP_013372084.1|  MULTISPECIES: cell division protein FtsZ           320   3e-98    
ref|WP_039304277.1|  cell division protein FtsZ                         319   4e-98    
ref|WP_025707238.1|  cell division protein FtsZ                         319   4e-98    
ref|WP_022423421.1|  cell division protein FtsZ                         319   4e-98    
ref|WP_013787845.1|  cell division protein FtsZ                         319   4e-98    
ref|WP_021978524.1|  cell division protein FtsZ                         319   5e-98    
ref|WP_018212641.1|  cell division protein FtsZ                         318   5e-98    
ref|WP_015050372.1|  cell division protein FtsZ                         318   6e-98    
gb|EES72495.1|  cell division protein FtsZ                              319   6e-98    
ref|WP_029636425.1|  cell division protein FtsZ [                       320   6e-98    
ref|WP_038074722.1|  cell division protein FtsZ                         321   6e-98    
ref|WP_005811376.1|  cell division protein FtsZ                         318   8e-98    
ref|WP_028991008.1|  cell division protein FtsZ                         318   8e-98    
ref|WP_009709084.1|  cell division protein FtsZ                         318   8e-98    
ref|WP_039837031.1|  cell division protein FtsZ                         318   8e-98    
ref|WP_026097750.1|  cell division protein FtsZ                         320   8e-98    
ref|WP_029196512.1|  cell division protein FtsZ                         318   8e-98    
ref|XP_001712632.1|  ftsZ                                               320   9e-98    
ref|WP_028537941.1|  cell division protein FtsZ                         318   9e-98    
gb|AIQ37250.1|  cell division protein FtsZ                              318   1e-97    
ref|WP_022490056.1|  cell division protein FtsZ                         318   1e-97    
ref|WP_020615575.1|  cell division protein FtsZ                         318   1e-97    
ref|WP_036624324.1|  cell division protein FtsZ                         318   1e-97    
ref|WP_022604249.1|  cell division protein FtsZ                         320   1e-97    
ref|WP_006036353.1|  cell division protein FtsZ                         318   1e-97    
ref|WP_036657855.1|  cell division protein FtsZ                         318   1e-97    
ref|WP_025715634.1|  cell division protein FtsZ                         318   2e-97    
ref|WP_025684642.1|  cell division protein FtsZ                         318   2e-97    
ref|WP_015311907.1|  cell division protein FtsZ                         317   2e-97    
dbj|BAC57986.1|  ftsZ1                                                  320   2e-97    
ref|WP_021882365.1|  Cell division protein FtsZ                         317   2e-97    
ref|WP_022238341.1|  cell division protein FtsZ                         317   2e-97    
gb|AIQ54176.1|  cell division protein FtsZ                              317   3e-97    
ref|XP_003080788.1|  ftsZ1 (ISS)                                        317   3e-97    
ref|WP_017687306.1|  MULTISPECIES: cell division protein FtsZ           317   3e-97    
ref|WP_019533079.1|  cell division protein FtsZ                         317   4e-97    
ref|WP_013311084.1|  MULTISPECIES: cell division protein FtsZ           317   4e-97    
dbj|GAK39701.1|  cell division protein FtsZ                             317   4e-97    
emb|CDN46091.1|  Cell division protein FtsZ                             316   4e-97    
gb|EOS57895.1|  cell division protein ftsZ                              317   5e-97    
ref|WP_021996294.1|  cell division protein FtsZ                         316   5e-97    
ref|WP_024628412.1|  MULTISPECIES: cell division protein FtsZ           316   5e-97    
ref|WP_023989443.1|  cell division protein FtsZ                         316   5e-97    
ref|WP_028611218.1|  cell division protein FtsZ                         316   6e-97    
emb|CAA07676.1|  cell division protein                                  317   7e-97    
ref|WP_022182800.1|  cell division protein FtsZ                         316   7e-97    
ref|WP_018085527.1|  cell division protein FtsZ                         315   8e-97    
ref|WP_007431185.1|  cell division protein FtsZ                         316   8e-97    
gb|KFF42124.1|  cell division protein FtsZ                              318   8e-97    
ref|XP_001713182.1|  cell division protein FtsZ                         317   9e-97    
ref|WP_010345423.1|  cell division protein FtsZ                         316   1e-96    
ref|WP_037994954.1|  cell division protein FtsZ                         316   1e-96    
ref|WP_007100416.1|  cell division protein FtsZ                         316   1e-96    
gb|AIS52701.1|  cell division protein FtsZ                              315   1e-96    
ref|WP_018753246.1|  cell division protein FtsZ                         316   1e-96    
ref|WP_036760508.1|  cell division protein FtsZ                         315   1e-96    
ref|WP_028597011.1|  cell division protein FtsZ                         315   2e-96    
ref|WP_006446859.1|  cell division protein FtsZ                         315   2e-96    
ref|XP_010249043.1|  PREDICTED: cell division protein FtsZ homolo...    317   2e-96    
ref|XP_001419359.1|  predicted protein                                  312   2e-96    
emb|CEG01485.1|  Cell division protein FtsZ, C-terminal                 317   2e-96    
ref|WP_015845455.1|  cell division protein FtsZ                         315   2e-96    
dbj|BAD99307.1|  plastid division protein FtsZ                          318   2e-96    
ref|WP_012810654.1|  cell division protein FtsZ                         315   2e-96    
ref|WP_022113666.1|  cell division protein FtsZ                         315   2e-96    
ref|WP_012063991.1|  cell division protein FtsZ                         314   3e-96    
ref|XP_001769058.1|  ftsZ1-2 plastid division protein                   317   3e-96    
ref|XP_001780238.1|  ftsZ1-1 plastid division protein                   317   3e-96    
ref|WP_013172594.1|  cell division protein FtsZ [                       314   4e-96    
ref|XP_002984848.1|  hypothetical protein SELMODRAFT_156840             313   4e-96    
dbj|GAK04047.1|  cell division protein FtsZ                             314   4e-96    
ref|XP_002985903.1|  hypothetical protein SELMODRAFT_123081             313   4e-96    
gb|KEF38623.1|  cell division protein FtsZ                              314   4e-96    
ref|WP_003333420.1|  cell division protein FtsZ                         314   4e-96    
ref|WP_028561612.1|  cell division protein FtsZ                         314   5e-96    
ref|WP_025027694.1|  cell division protein FtsZ                         314   5e-96    
ref|WP_022736451.1|  cell division protein FtsZ                         314   5e-96    
dbj|GAK14519.1|  cell division protein FtsZ                             314   5e-96    
ref|WP_034106842.1|  cell division protein FtsZ                         313   5e-96    
ref|WP_026696181.1|  cell division protein FtsZ                         314   6e-96    
ref|WP_014521294.1|  cell division protein FtsZ                         313   7e-96    
dbj|GAJ99636.1|  cell division protein FtsZ                             314   7e-96    
ref|WP_011128508.1|  cell division protein FtsZ                         313   8e-96    
ref|WP_011564468.1|  cell division protein FtsZ                         313   8e-96    
ref|WP_022484186.1|  cell division protein FtsZ                         313   8e-96    
ref|WP_008339618.1|  cell division protein FtsZ                         313   1e-95    
ref|WP_027414502.1|  cell division protein FtsZ                         313   1e-95    
ref|WP_026964003.1|  cell division protein FtsZ                         313   1e-95    
ref|WP_021295404.1|  cell division protein FtsZ                         313   1e-95    
ref|WP_035340445.1|  cell division protein FtsZ                         313   2e-95    
gb|AII47419.1|  cell division protein FtsZ                              313   2e-95    
ref|WP_018921335.1|  cell division protein FtsZ                         313   2e-95    
ref|WP_006570252.1|  cell division protein FtsZ                         311   2e-95    
ref|WP_012995467.1|  cell division protein FtsZ                         311   2e-95    
ref|WP_003867934.1|  MULTISPECIES: cell division protein FtsZ           311   2e-95    
ref|WP_013075835.1|  cell division protein FtsZ                         311   2e-95    
ref|WP_022412048.1|  cell division protein FtsZ                         312   3e-95    
ref|WP_009620973.1|  cell division protein FtsZ                         311   3e-95    
ref|WP_012344963.1|  cell division protein FtsZ                         312   3e-95    
ref|WP_003871212.1|  cell division protein FtsZ                         311   3e-95    
ref|WP_011933657.1|  cell division protein FtsZ                         312   3e-95    
ref|WP_027726129.1|  cell division protein FtsZ                         312   3e-95    
ref|WP_028051969.1|  cell division protein FtsZ                         311   3e-95    
ref|WP_003386373.1|  cell division protein FtsZ                         311   3e-95    
ref|WP_017753639.1|  cell division protein FtsZ                         312   3e-95    
dbj|BAQ14204.1|  putative cell division protein FtsZ                    311   3e-95    
dbj|GAK07430.1|  cell division protein FtsZ                             312   3e-95    
ref|WP_011344952.1|  cell division protein FtsZ                         311   3e-95    
ref|WP_015255167.1|  cell division protein FtsZ                         311   3e-95    
ref|WP_017186040.1|  cell division protein FtsZ                         311   4e-95    
ref|WP_004441551.1|  cell division protein FtsZ                         311   4e-95    
ref|WP_022325280.1|  cell division protein FtsZ                         311   4e-95    
ref|WP_028544979.1|  cell division protein FtsZ                         311   5e-95    
ref|WP_014904587.1|  MULTISPECIES: cell division protein FtsZ           310   5e-95    
ref|WP_010270112.1|  cell division protein FtsZ                         311   5e-95    
ref|WP_019005181.1|  cell division protein FtsZ                         311   5e-95    
ref|WP_014063046.1|  cell division protein FtsZ                         310   6e-95    
ref|WP_027091068.1|  cell division protein FtsZ                         311   6e-95    
ref|WP_036581310.1|  cell division protein FtsZ                         311   7e-95    
ref|WP_008516016.1|  cell division protein FtsZ                         310   7e-95    
ref|WP_036902311.1|  cell division protein FtsZ                         310   8e-95    
gb|KHO62804.1|  cell division protein FtsZ                              310   8e-95    
gb|EKD64404.1|  hypothetical protein ACD_51C00004G0002                  311   9e-95    
gb|KGG11975.1|  Cell division protein FtsZ                              310   9e-95    
ref|WP_036911818.1|  MULTISPECIES: cell division protein FtsZ           311   9e-95    
ref|WP_022792698.1|  cell division protein FtsZ                         311   1e-94    
ref|WP_028595816.1|  cell division protein FtsZ                         310   1e-94    
dbj|GAF22208.1|  LOW QUALITY PROTEIN: cell division protein FtsZ        310   1e-94    
ref|WP_011129698.1|  cell division protein FtsZ                         311   1e-94    
ref|WP_013298223.1|  cell division protein FtsZ                         310   1e-94    
dbj|GAF66163.1|  cell division protein FtsZ                             311   1e-94    
ref|WP_013917748.1|  cell division protein FtsZ                         310   1e-94    
ref|WP_038681737.1|  cell division protein FtsZ                         310   1e-94    



>ref|XP_006341140.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006341141.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=477

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/483 (85%), Positives = 433/483 (90%), Gaps = 9/483 (2%)
 Frame = +1

Query  283   CTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansn  462
             CT   FM  DT   RGVLTV+GGRV P+K+ +EK G L   VN++G  +    KCSANS+
Sbjct  3     CTSAVFMPPDTRRSRGVLTVLGGRVCPLKIQDEKIGYLG--VNQKGTSSLPQFKCSANSH  60

Query  463   nsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNF  642
             +        QYQ+KDPFLNLHPEISMLRGEGN+TM T RQES   NV+ES  DSSS NNF
Sbjct  61    SVN------QYQNKDPFLNLHPEISMLRGEGNNTMTTSRQESSSGNVSESLMDSSSSNNF  114

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             NEAKIKVVGVGGGGSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPV P+HRL IGQELTR
Sbjct  115   NEAKIKVVGVGGGGSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVNPEHRLPIGQELTR  174

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNPDIG NAA ESK+AIEEAVYG+DMVFVTAGMGGGTGTGAAP+IAGTAKSMGIL
Sbjct  175   GLGAGGNPDIGMNAANESKQAIEEAVYGSDMVFVTAGMGGGTGTGAAPIIAGTAKSMGIL  234

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD
Sbjct  235   TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  294

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             DILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQS
Sbjct  295   DILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQS  354

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             PLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS
Sbjct  355   PLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  414

Query  1543  ITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRY  1719
             ITLIATGFKRQE  D +PLQ NQLA GD S+G NRRPASF++G SVEIPEFL+KKGRSRY
Sbjct  415   ITLIATGFKRQEESDMRPLQGNQLAQGDTSLGTNRRPASFLEGGSVEIPEFLRKKGRSRY  474

Query  1720  PRA  1728
             PRA
Sbjct  475   PRA  477



>ref|XP_010325922.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Solanum lycopersicum]
 ref|XP_010325923.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Solanum lycopersicum]
 ref|XP_010325924.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Solanum lycopersicum]
 ref|XP_010325925.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Solanum lycopersicum]
Length=478

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/486 (85%), Positives = 434/486 (89%), Gaps = 9/486 (2%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA CT   FM  DT   RGVLTV+GGRV P+K+ +EK G L   VN++G  +    KCSA
Sbjct  1     MATCTSAVFMPPDTRRSRGVLTVLGGRVCPLKIQDEKIGYLG--VNQKGTSSLPQFKCSA  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS +        QYQ+KDPFLNLHPEISMLRGEGN+TM T RQES   NV+ES  DSSS 
Sbjct  59    NSQSVN------QYQNKDPFLNLHPEISMLRGEGNNTMTTSRQESSSGNVSESLMDSSSS  112

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             NNFNEAKIKVVGVGGGGSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPV P++RL IGQE
Sbjct  113   NNFNEAKIKVVGVGGGGSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVNPEYRLPIGQE  172

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPDIG NAA ESK+AIEEAVYG+DMVFVTAGMGGGTGTGAAP+IAGTAKSM
Sbjct  173   LTRGLGAGGNPDIGMNAANESKQAIEEAVYGSDMVFVTAGMGGGTGTGAAPIIAGTAKSM  232

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN
Sbjct  233   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  292

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  293   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  352

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG
Sbjct  353   IQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  412

Query  1534  QVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQE  D +PLQ NQLA GDAS+G NRRPASF++G SVEIPEFL+KKGR
Sbjct  413   QVSITLIATGFKRQEESDMRPLQGNQLAQGDASLGTNRRPASFLEGGSVEIPEFLRKKGR  472

Query  1711  SRYPRA  1728
              RYPRA
Sbjct  473   LRYPRA  478



>ref|XP_011094340.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic 
[Sesamum indicum]
 ref|XP_011094341.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic 
[Sesamum indicum]
 ref|XP_011094342.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic 
[Sesamum indicum]
 ref|XP_011094343.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic 
[Sesamum indicum]
Length=478

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/486 (82%), Positives = 430/486 (88%), Gaps = 9/486 (2%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA CT  YF   DT  P GVLTV+G RVSP+KM+ E+NG  S+S  ++ G N+  LKCSA
Sbjct  1     MATCTSPYFTPPDTRRPTGVLTVLGARVSPLKMVEERNGFSSVS--KKCGSNFLQLKCSA  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS++        Q+QSKDPFLNLHPE+S+LRG  NSTM  P+QES   +VTES ++SSS 
Sbjct  59    NSHSFN------QFQSKDPFLNLHPEVSLLRGGTNSTMTNPKQESSSRDVTESLRESSSS  112

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             NN+NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTDIQAMRMSPVFP+HRLQIG E
Sbjct  113   NNYNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDIQAMRMSPVFPEHRLQIGLE  172

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPDIG NAAKESKE+IEEAV GADMVFVTAGMGGGTGTG APVIAG AKSM
Sbjct  173   LTRGLGAGGNPDIGMNAAKESKESIEEAVRGADMVFVTAGMGGGTGTGGAPVIAGVAKSM  232

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRR VQA EGIAALRENVDTLIVIPNDKLL AVS STPVTEAFN
Sbjct  233   GILTVGIVTTPFSFEGRRRIVQAHEGIAALRENVDTLIVIPNDKLLNAVSASTPVTEAFN  292

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  293   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  352

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDPSANLIFGAV+DPSISG
Sbjct  353   IQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPSANLIFGAVVDPSISG  412

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E D + +QANQLA GD ++G NRRP+SF +  SVEIPEFL+KKGR
Sbjct  413   QVSITLIATGFKRQEESDGRAVQANQLAQGDPNLGFNRRPSSFSESGSVEIPEFLRKKGR  472

Query  1711  SRYPRA  1728
             SR+PRA
Sbjct  473   SRFPRA  478



>ref|XP_009770004.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Nicotiana sylvestris]
 ref|XP_009770005.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Nicotiana sylvestris]
 ref|XP_009770006.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Nicotiana sylvestris]
Length=478

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/485 (81%), Positives = 422/485 (87%), Gaps = 9/485 (2%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA CT    M  DT    G+L V G +  P+KM +EKNG L   VN++G  +W   KCSA
Sbjct  1     MASCTSAMCMPPDTRLRNGLLAVFGKKFCPLKMQDEKNGFLG--VNQKGISSWPHFKCSA  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS+          YQSKD FLNLHPEISMLRGEGN T  T +QES    VTESS DSS++
Sbjct  59    NSHRFN------NYQSKDSFLNLHPEISMLRGEGNDTFTTSKQESSGGGVTESSMDSSNL  112

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
              NFNEAKIKVVGVGGGGSNAVNRMIESSM GVEFWIVNTDIQA+RMSP FP+HRL IGQE
Sbjct  113   KNFNEAKIKVVGVGGGGSNAVNRMIESSMNGVEFWIVNTDIQAIRMSPAFPEHRLPIGQE  172

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPDIG NAAKESKEAIE+AV GADMVFVTAGMGGGTGTG AP+IAG AKSM
Sbjct  173   LTRGLGAGGNPDIGMNAAKESKEAIEDAVRGADMVFVTAGMGGGTGTGGAPIIAGIAKSM  232

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVS STPVTEAFN
Sbjct  233   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSASTPVTEAFN  292

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  293   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  352

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             +QSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPS++G
Sbjct  353   VQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSLNG  412

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E D +P+Q NQLA GDA++GINRRP+SF++G SVEIPEFL+KKG 
Sbjct  413   QVSITLIATGFKRQEESDGRPVQGNQLAQGDATLGINRRPSSFLEGGSVEIPEFLRKKGG  472

Query  1711  SRYPR  1725
             SRYPR
Sbjct  473   SRYPR  477



>ref|XP_009802019.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Nicotiana sylvestris]
 ref|XP_009802020.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Nicotiana sylvestris]
 ref|XP_009802021.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Nicotiana sylvestris]
 ref|XP_009802022.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Nicotiana sylvestris]
 emb|CAC44257.1| FtsZ-like protein [Nicotiana tabacum]
Length=468

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/486 (82%), Positives = 421/486 (87%), Gaps = 19/486 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA CT   FM  DT   RG LT++GGR+  +KM +EK G L   VN++G  +    KCSA
Sbjct  1     MATCTSAVFMPPDTRRSRGALTILGGRLCALKMQDEKIGFLG--VNQKGSSSLPQFKCSA  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS++        QYQ+KD FLNLHPEIS+LRGE          ES   NVTES  DSS  
Sbjct  59    NSHSVN------QYQNKDSFLNLHPEISLLRGE----------ESSSGNVTESLMDSSRS  102

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             NNFNEAKIKVVGVGGGGSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPV  + RL IGQE
Sbjct  103   NNFNEAKIKVVGVGGGGSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVAAEQRLPIGQE  162

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPDIG NAA ESK+AIEEAVYGADMVFVTAGMGGGTGTGAAP+IAGTAKSM
Sbjct  163   LTRGLGAGGNPDIGMNAANESKQAIEEAVYGADMVFVTAGMGGGTGTGAAPIIAGTAKSM  222

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN
Sbjct  223   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  282

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  283   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  342

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG
Sbjct  343   IQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  402

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E D +PLQ NQL  GDAS+G NRRPASF++G SVEIPEFL+KKGR
Sbjct  403   QVSITLIATGFKRQEESDGRPLQGNQLTQGDASLGSNRRPASFLEGGSVEIPEFLRKKGR  462

Query  1711  SRYPRA  1728
             SRYPRA
Sbjct  463   SRYPRA  468



>ref|XP_004249449.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Solanum lycopersicum]
Length=478

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/485 (82%), Positives = 422/485 (87%), Gaps = 9/485 (2%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA CT   F+  DT    GVLTV+  RV P+KM +EK G LS  VN++G  +    KCSA
Sbjct  1     MASCTSAVFVPLDTRLRNGVLTVLARRVCPLKMQDEKVGYLS--VNQKGISSCPQFKCSA  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS+          YQSKD FLNLHPEISML+GEGN T  T RQES    V ES  DSSS+
Sbjct  59    NSHRFN------NYQSKDSFLNLHPEISMLQGEGNHTFTTSRQESSSGGVAESLMDSSSL  112

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
              NFNEAKIKVVGVGGGGSNAVNRMIESSM GVEFWIVNTDIQA+RMSPVFP++RL IGQE
Sbjct  113   KNFNEAKIKVVGVGGGGSNAVNRMIESSMNGVEFWIVNTDIQAIRMSPVFPENRLPIGQE  172

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPDIG NAAKESKEAIEEAV GADMVFVTAGMGGGTGTG AP+IAG AKSM
Sbjct  173   LTRGLGAGGNPDIGMNAAKESKEAIEEAVRGADMVFVTAGMGGGTGTGGAPIIAGIAKSM  232

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVS STPVTEAFN
Sbjct  233   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSLSTPVTEAFN  292

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  293   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  352

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             +QSPLLDIGIERATGIVWNITGG DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPS+SG
Sbjct  353   VQSPLLDIGIERATGIVWNITGGNDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSLSG  412

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E D +PLQ NQLA GDA++GINRRP+SF++G SVEIPEFL+KKG 
Sbjct  413   QVSITLIATGFKRQEESDGRPLQGNQLAQGDANLGINRRPSSFLEGGSVEIPEFLRKKGG  472

Query  1711  SRYPR  1725
             SRYPR
Sbjct  473   SRYPR  477



>ref|XP_006339123.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Solanum tuberosum]
Length=478

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/486 (82%), Positives = 422/486 (87%), Gaps = 9/486 (2%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA CT   F+  DT    GVLTV+  RV P+KM +EK G L   VN++G  +    KCSA
Sbjct  1     MASCTSAVFVPLDTRLRNGVLTVLARRVCPLKMQDEKVGFLG--VNQKGISSCPQFKCSA  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS+          YQSKD FLNLHPEISML+GEGN T  T RQES    V ES  DSSS+
Sbjct  59    NSHRFN------NYQSKDSFLNLHPEISMLQGEGNHTFTTSRQESSSGGVAESLMDSSSL  112

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
              NFNEAKIKVVGVGGGGSNAVNRMIESSM GVEFWIVNTDIQA+RMSPVFP++RL IGQE
Sbjct  113   KNFNEAKIKVVGVGGGGSNAVNRMIESSMNGVEFWIVNTDIQAIRMSPVFPENRLPIGQE  172

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPDIG NAAKESKEAIEEAV GADMVFVTAGMGGGTGTG AP+IAG AKSM
Sbjct  173   LTRGLGAGGNPDIGMNAAKESKEAIEEAVRGADMVFVTAGMGGGTGTGGAPIIAGIAKSM  232

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVS STPVTEAFN
Sbjct  233   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSLSTPVTEAFN  292

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  293   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  352

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             +QSPLLDIGIERATGIVWNITGG DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPS+SG
Sbjct  353   VQSPLLDIGIERATGIVWNITGGNDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSLSG  412

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E D +PLQ NQLA GDA++GINRRP+SF++G SVEIPEFL+KKG 
Sbjct  413   QVSITLIATGFKRQEESDGRPLQGNQLAQGDANLGINRRPSSFLEGGSVEIPEFLRKKGG  472

Query  1711  SRYPRA  1728
             SRYPRA
Sbjct  473   SRYPRA  478



>ref|XP_009617397.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009617398.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009617399.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
 emb|CAB89288.1| chloroplast FtsZ-like protein [Nicotiana tabacum]
Length=468

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/486 (82%), Positives = 421/486 (87%), Gaps = 19/486 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA CT   FM  DT   RGVLT++GGR+  +KM +EK G L   VN++G  +    KCS+
Sbjct  1     MATCTSAVFMPPDTRRSRGVLTLLGGRLCALKMQDEKIGFLG--VNQKGSSSLPQFKCSS  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS++        QYQ+KD FLNLHPEIS+LRGE          ES   NVTES  DSS  
Sbjct  59    NSHSVN------QYQNKDSFLNLHPEISLLRGE----------ESSSGNVTESLMDSSRS  102

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             NNFNEAKIKVVGVGGGGSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPV  + RL IGQE
Sbjct  103   NNFNEAKIKVVGVGGGGSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVAAEQRLPIGQE  162

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPDIG NAA ESK+AIEEAVYGADMVFVTAGMGGGTGTGAAP+IAGTAKSM
Sbjct  163   LTRGLGAGGNPDIGMNAANESKQAIEEAVYGADMVFVTAGMGGGTGTGAAPIIAGTAKSM  222

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN
Sbjct  223   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  282

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  283   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  342

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG
Sbjct  343   IQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  402

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E D +PLQ NQL  GD S+G NRRPASF++G SVEIPEFL+KKGR
Sbjct  403   QVSITLIATGFKRQEESDGRPLQGNQLTQGDVSLGNNRRPASFLEGGSVEIPEFLRKKGR  462

Query  1711  SRYPRA  1728
             SRYPRA
Sbjct  463   SRYPRA  468



>ref|XP_009614454.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=478

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/485 (81%), Positives = 420/485 (87%), Gaps = 9/485 (2%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA CT    +  D     G+L V+G R  P+KM +EKNG L   VN++G  +W   KCSA
Sbjct  1     MASCTSAVCIPPDIRLQNGLLAVLGKRFCPLKMHDEKNGFLG--VNQKGISSWPHFKCSA  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS+          YQSKD FLNLHPEISMLRGEGN T  T +QES    VTE S DSSS+
Sbjct  59    NSHRFN------NYQSKDSFLNLHPEISMLRGEGNDTFTTSKQESSGGGVTERSMDSSSL  112

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
              NFNEAKIKVVGVGGGGSNAVNRMIESSM GVEFWIVNTDIQA+RMSP FP+HRL IGQE
Sbjct  113   KNFNEAKIKVVGVGGGGSNAVNRMIESSMNGVEFWIVNTDIQAIRMSPAFPEHRLPIGQE  172

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPDIG NAAKESKEAIE+AV GADMVFVTAGMGGGTGTG AP+IAG AKSM
Sbjct  173   LTRGLGAGGNPDIGMNAAKESKEAIEDAVRGADMVFVTAGMGGGTGTGGAPIIAGIAKSM  232

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVS STPVTEAFN
Sbjct  233   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSASTPVTEAFN  292

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  293   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  352

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             +QSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPS++G
Sbjct  353   VQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSLNG  412

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E D +P+Q NQLA GDA+ GINRRP+SF++G SVEIPEFL+KKG 
Sbjct  413   QVSITLIATGFKRQEESDGRPVQGNQLAQGDATPGINRRPSSFLEGGSVEIPEFLRKKGG  472

Query  1711  SRYPR  1725
             SRYPR
Sbjct  473   SRYPR  477



>ref|XP_011077930.1| PREDICTED: LOW QUALITY PROTEIN: cell division protein FtsZ homolog 
2-2, chloroplastic-like [Sesamum indicum]
Length=892

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/485 (81%), Positives = 429/485 (88%), Gaps = 9/485 (2%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA CT  YF   D   P GVLTV G RVSP+KM+ E+NG  +    ++GG ++   KCSA
Sbjct  415   MATCTSQYFTPLDIRSPLGVLTVHGARVSPLKMVEERNGFPA--AGKKGGSSFPQFKCSA  472

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS++        Q+QSKDPFLNLHPEI++L GE NSTM+ PRQ+S   +VTES +DSS++
Sbjct  473   NSHSVN------QFQSKDPFLNLHPEIALLGGETNSTMINPRQDSSSGSVTESPRDSSTL  526

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             NN+NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTDIQAM+MSPVFP+HRLQIGQE
Sbjct  527   NNYNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDIQAMKMSPVFPKHRLQIGQE  586

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPD+G NAAKESKEAIE AVYGADMVFVTAGMGGGTGTG AP+IA  AKSM
Sbjct  587   LTRGLGAGGNPDVGMNAAKESKEAIEGAVYGADMVFVTAGMGGGTGTGGAPIIAAVAKSM  646

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEG+RR VQA EGIAALRENVDTLIVIPN+KLL AVS STPVTEAFN
Sbjct  647   GILTVGIVTTPFSFEGQRRTVQALEGIAALRENVDTLIVIPNEKLLKAVSSSTPVTEAFN  706

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRA DAALNA
Sbjct  707   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRATDAALNA  766

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDPSANLIFGAV+DPSISG
Sbjct  767   IQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPSANLIFGAVVDPSISG  826

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E D + LQANQL  GD++IG+NRRPASF++G SVEIPEFL+KKGR
Sbjct  827   QVSITLIATGFKRQGESDGRTLQANQLPQGDSNIGLNRRPASFLEGGSVEIPEFLRKKGR  886

Query  1711  SRYPR  1725
             SRYPR
Sbjct  887   SRYPR  891



>gb|EYU38631.1| hypothetical protein MIMGU_mgv1a005592mg [Erythranthe guttata]
Length=478

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/486 (80%), Positives = 433/486 (89%), Gaps = 9/486 (2%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA CT  YFM  DT  P GVL V+G  + P+KM++E+NG  S  + ++ G ++   KCSA
Sbjct  1     MATCTSPYFMPPDTRRPVGVLNVLGVPLPPLKMVDERNGFSS--IGKKIGPSFPHFKCSA  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS++        Q+Q+KDPFLNLHPE+SMLRGE NST++ PRQ+S   +V ES ++S ++
Sbjct  59    NSHSVN------QFQNKDPFLNLHPEVSMLRGETNSTLINPRQDSSSASVAESVRESPTL  112

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             N++NEAKIKV+GVGGGGSNAVNRMIES MKGVEFWIVNTDIQA++MSPVF +HRLQIGQE
Sbjct  113   NSYNEAKIKVIGVGGGGSNAVNRMIESEMKGVEFWIVNTDIQAIKMSPVFSEHRLQIGQE  172

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGG P+IG NAAKESKEAIE+AVYGADMVFVTAGMGGGTGTG APVIAG AKSM
Sbjct  173   LTRGLGAGGKPEIGMNAAKESKEAIEDAVYGADMVFVTAGMGGGTGTGGAPVIAGVAKSM  232

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVS STPVTEAFN
Sbjct  233   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSASTPVTEAFN  292

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  293   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  352

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG DLTLFEVNAAAEVIYDLVDPSANLIFGAV+DPS+SG
Sbjct  353   IQSPLLDIGIERATGIVWNITGGNDLTLFEVNAAAEVIYDLVDPSANLIFGAVVDPSLSG  412

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E D K +QANQ+A GD++IG+NRRP+SF++G SVEIPEFL+KKGR
Sbjct  413   QVSITLIATGFKRQEESDGKTIQANQVAQGDSNIGLNRRPSSFLEGGSVEIPEFLRKKGR  472

Query  1711  SRYPRA  1728
             SRYPRA
Sbjct  473   SRYPRA  478



>gb|KDP42743.1| hypothetical protein JCGZ_23683 [Jatropha curcas]
Length=484

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/486 (80%), Positives = 429/486 (88%), Gaps = 3/486 (1%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA C   Y   SDT  P G++TV+GGRVS    L  K GSL +S ++   L  S     +
Sbjct  1     MAACVSPYCTASDTRNPMGMVTVLGGRVSVENHLG-KVGSLKMSDDKNRYLGASQKSKIS  59

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS   A +HS + Y +KDPFL+LHPEISMLRGEGN+T+ TPR+++    VT+S  D S  
Sbjct  60    NSKCLAKSHSVSPYHNKDPFLDLHPEISMLRGEGNNTVTTPRKDTSSGTVTDSLGDESGP  119

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             +N+NEAKIKV+GVGGGGSNAVNRMIESSMKGVEFWIVNTD+QAM+MSPVFP++RLQIGQE
Sbjct  120   SNYNEAKIKVIGVGGGGSNAVNRMIESSMKGVEFWIVNTDVQAMKMSPVFPENRLQIGQE  179

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNP+IG NAAKESKEAIEEA+YG+DMVFVTAGMGGGTGTG APVIAG AKSM
Sbjct  180   LTRGLGAGGNPEIGMNAAKESKEAIEEALYGSDMVFVTAGMGGGTGTGGAPVIAGVAKSM  239

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIA+LR+NVDTLIVIPNDKLLTAVS STPVTEAFN
Sbjct  240   GILTVGIVTTPFSFEGRRRAVQAQEGIASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFN  299

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  300   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  359

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS+SG
Sbjct  360   IQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSLSG  419

Query  1534  QVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQE ++ +PLQA+QL+PGD + GINRRP SF +GSSVEIPEFLKKKGR
Sbjct  420   QVSITLIATGFKRQEENESRPLQASQLSPGDVTFGINRRP-SFTEGSSVEIPEFLKKKGR  478

Query  1711  SRYPRA  1728
             SRYPRA
Sbjct  479   SRYPRA  484



>gb|EPS71348.1| hypothetical protein M569_03407 [Genlisea aurea]
Length=636

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/486 (77%), Positives = 422/486 (87%), Gaps = 7/486 (1%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA C   YF  +D   P G+LTV+G R+S +KM+ +++G  +   +++   N+ + +CSA
Sbjct  1     MAQCISPYFRPADIRPPVGLLTVLGSRLSSLKMIEDRHGVSNACYDQKNASNFPIFRCSA  60

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS++        Q+  KDPFLNLHPE+S+LRGE +S     + ++  E+ TES ++SSS+
Sbjct  61    NSHSVN------QFHGKDPFLNLHPEVSLLRGETSSAFTNLKPDTVSEDATESLRNSSSL  114

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             N F EAKIKV+GVGGGGSNAVNRMIESSMKGVEFWIVNTD+QAMR+SP+F  HRLQIGQE
Sbjct  115   NGFGEAKIKVIGVGGGGSNAVNRMIESSMKGVEFWIVNTDVQAMRLSPIFQDHRLQIGQE  174

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNP+IG NAA ESKE I+EAVYGADMVFVTAGMGGGTGTG APVIAG AKSM
Sbjct  175   LTRGLGAGGNPEIGKNAANESKETIQEAVYGADMVFVTAGMGGGTGTGGAPVIAGVAKSM  234

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN
Sbjct  235   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  294

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRA+M +AGSSLMGIGTATGKTRARDAALNA
Sbjct  295   LADDILRQGVRGISDIITIPGLVNVDFADVRAVMANAGSSLMGIGTATGKTRARDAALNA  354

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPS+SG
Sbjct  355   IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSLSG  414

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             Q+SITLIATGFKRQ EG+ +PLQ NQL  G+ + G+NRRP SF++G  VEIPEFL+KKGR
Sbjct  415   QISITLIATGFKRQEEGESRPLQGNQLGQGEGNAGMNRRPPSFVEGGGVEIPEFLRKKGR  474

Query  1711  SRYPRA  1728
             SRYPRA
Sbjct  475   SRYPRA  480



>ref|XP_006430212.1| hypothetical protein CICLE_v10011609mg [Citrus clementina]
 ref|XP_006430213.1| hypothetical protein CICLE_v10011609mg [Citrus clementina]
 gb|ESR43452.1| hypothetical protein CICLE_v10011609mg [Citrus clementina]
 gb|ESR43453.1| hypothetical protein CICLE_v10011609mg [Citrus clementina]
Length=484

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/486 (79%), Positives = 425/486 (87%), Gaps = 3/486 (1%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA C    F  SDT    GVLTV GGRVS    L   NG L +S N+ G L         
Sbjct  1     MATCMSPCFTPSDTRA-MGVLTVFGGRVSMENHLGRVNG-LKMSDNKNGYLGTGQKSTFT  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
                 SAN+ S + Y +KDPFLNLHPE+S+LRGEG +T+  PR++S   +VTES +++SS 
Sbjct  59    QFRCSANSQSVSSYHNKDPFLNLHPEVSLLRGEGTNTISNPRKDSPSGSVTESIEEASSP  118

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             +++NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAMRMSPVFP++RLQIGQE
Sbjct  119   SSYNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMRMSPVFPENRLQIGQE  178

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNP+IG NAAKESKE+IEEA++GADMVFVTAGMGGGTGTG APVIAG AKSM
Sbjct  179   LTRGLGAGGNPEIGMNAAKESKESIEEALFGADMVFVTAGMGGGTGTGGAPVIAGVAKSM  238

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIA+LR+NVDTLIVIPNDKLLTAVS STPVTEAFN
Sbjct  239   GILTVGIVTTPFSFEGRRRAVQAQEGIASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFN  298

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  299   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  358

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS+SG
Sbjct  359   IQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSLSG  418

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E + +PLQA+QLA GDA+ GINRRP+SF +G SVEIPEFLKKKGR
Sbjct  419   QVSITLIATGFKRQEESEGRPLQASQLAQGDAAFGINRRPSSFSEGGSVEIPEFLKKKGR  478

Query  1711  SRYPRA  1728
             SR+PRA
Sbjct  479   SRFPRA  484



>ref|XP_006481783.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X2 [Citrus sinensis]
 ref|XP_006481784.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=484

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/486 (79%), Positives = 424/486 (87%), Gaps = 3/486 (1%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA C    F  SDT    GVLTV GGRVS    L   NG L +S N+ G L         
Sbjct  1     MATCMSPCFTPSDTRA-MGVLTVFGGRVSMENHLGRVNG-LKMSDNKNGYLGTGQKSTFT  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
                 SAN+ S + Y +KDPFLNLHPE+S+LRGEG +T+  PR++    +VTES +++SS 
Sbjct  59    QFRCSANSQSVSSYHNKDPFLNLHPEVSLLRGEGTNTISNPRKDGSSGSVTESIEEASSP  118

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             +++NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAMRMSPVFP++RLQIGQE
Sbjct  119   SSYNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMRMSPVFPENRLQIGQE  178

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNP+IG NAAKESKE+IEEA++GADMVFVTAGMGGGTGTG APVIAG AKSM
Sbjct  179   LTRGLGAGGNPEIGMNAAKESKESIEEALFGADMVFVTAGMGGGTGTGGAPVIAGVAKSM  238

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIA+LR+NVDTLIVIPNDKLLTAVS STPVTEAFN
Sbjct  239   GILTVGIVTTPFSFEGRRRAVQAQEGIASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFN  298

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  299   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  358

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS+SG
Sbjct  359   IQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSLSG  418

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E + +PLQA+QLA GDA+ GINRRP+SF +G SVEIPEFLKKKGR
Sbjct  419   QVSITLIATGFKRQEESEGRPLQASQLAQGDAAFGINRRPSSFSEGGSVEIPEFLKKKGR  478

Query  1711  SRYPRA  1728
             SR+PRA
Sbjct  479   SRFPRA  484



>gb|AAF23771.1|AF205859_1 FtsZ protein [Gentiana lutea]
Length=483

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/489 (79%), Positives = 422/489 (86%), Gaps = 10/489 (2%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA  T   F   D   P  V+T  GGR+SP+KM       +    +++G   +   KCS 
Sbjct  1     MATSTSPCFTPYDIQSPSRVMTTFGGRISPMKMNLFHEKKVFWVFDQKGSRIYPHFKCST  60

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGI--ENVTESSKDSS  627
             NS+N        Q+QSKDPFLNLHPEIS+LRG+GN+T++  R ++     +VTES +DSS
Sbjct  61    NSHNVN------QHQSKDPFLNLHPEISLLRGDGNNTLVDSRVDTAGSGRSVTESLRDSS  114

Query  628   SVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIG  807
             S NN++EAKIKVVGVGGGGSNAVNRMIES+MKGVEFWIVNTD+QA++MSPV+ ++RLQIG
Sbjct  115   SSNNYSEAKIKVVGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAIKMSPVYLENRLQIG  174

Query  808   QELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaK  987
             QELTRGLGAGGNPDIG NAAKESKEAIEEAVYGADMVFVTAGMGGGTGTG APVIAG AK
Sbjct  175   QELTRGLGAGGNPDIGMNAAKESKEAIEEAVYGADMVFVTAGMGGGTGTGGAPVIAGIAK  234

Query  988   SMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEA  1167
             SMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR+NVDTLIVIPNDKLLTAVSPSTPVTEA
Sbjct  235   SMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDNVDTLIVIPNDKLLTAVSPSTPVTEA  294

Query  1168  FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAAL  1347
             FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAAL
Sbjct  295   FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAAL  354

Query  1348  NAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSI  1527
             NAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDPSANLIFGAV+DPS+
Sbjct  355   NAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPSANLIFGAVVDPSL  414

Query  1528  SGQVSITLIATGFKRQEGDDK-PLQA-NQLAPGDASIGINRRPASFMDGSSVEIPEFLKK  1701
              GQVSITLIATGFKRQE  DK  +QA  QLAPGDA+ GINRRP+SF +  SVEIPEFL+K
Sbjct  415   CGQVSITLIATGFKRQEESDKRSIQAGGQLAPGDANQGINRRPSSFSESGSVEIPEFLRK  474

Query  1702  KGRSRYPRA  1728
             KGRSRYPRA
Sbjct  475   KGRSRYPRA  483



>ref|XP_006481782.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=484

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/486 (79%), Positives = 423/486 (87%), Gaps = 3/486 (1%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA C    F  SDT    GVLTV GGRVS    L   N SL +S N+ G           
Sbjct  1     MATCMSPCFTPSDTRA-MGVLTVFGGRVSMENHLGRVN-SLKMSDNKNGFSGTGQKSTFT  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
                 SAN+ S + Y +KDPFLNLHPE+S+LRGEG +T+  PR++    +VTES +++SS 
Sbjct  59    QFRCSANSQSVSSYHNKDPFLNLHPEVSLLRGEGTNTISNPRKDGSSGSVTESIEEASSP  118

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             +++NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAMRMSPVFP++RLQIGQE
Sbjct  119   SSYNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMRMSPVFPENRLQIGQE  178

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNP+IG NAAKESKE+IEEA++GADMVFVTAGMGGGTGTG APVIAG AKSM
Sbjct  179   LTRGLGAGGNPEIGMNAAKESKESIEEALFGADMVFVTAGMGGGTGTGGAPVIAGVAKSM  238

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIA+LR+NVDTLIVIPNDKLLTAVS STPVTEAFN
Sbjct  239   GILTVGIVTTPFSFEGRRRAVQAQEGIASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFN  298

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  299   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  358

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS+SG
Sbjct  359   IQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSLSG  418

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E + +PLQA+QLA GDA+ GINRRP+SF +G SVEIPEFLKKKGR
Sbjct  419   QVSITLIATGFKRQEESEGRPLQASQLAQGDAAFGINRRPSSFSEGGSVEIPEFLKKKGR  478

Query  1711  SRYPRA  1728
             SR+PRA
Sbjct  479   SRFPRA  484



>ref|XP_002528741.1| Cell division protein ftsZ, putative [Ricinus communis]
 gb|EEF33653.1| Cell division protein ftsZ, putative [Ricinus communis]
Length=485

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/492 (78%), Positives = 426/492 (87%), Gaps = 14/492 (3%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGL------NWS  435
             MA C   Y   SDT  P G+LTV+GGR++    L  + GSL LS ++   L      N+S
Sbjct  1     MAACVSPYCTPSDTRNPMGMLTVLGGRLAVENHLG-RVGSLKLSDDKNRFLGANQKANFS  59

Query  436   LLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESS  615
               KCSA S++ +       Y +KDPFL+LHPEISMLRGEGN+T+ TP++++    VT+S 
Sbjct  60    HFKCSAKSHSVS------PYPNKDPFLDLHPEISMLRGEGNNTVTTPKKDNLSGTVTDSL  113

Query  616   KDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHR  795
                SS NN+NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAM+MSPVFP++R
Sbjct  114   GHESSPNNYNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMKMSPVFPENR  173

Query  796   LQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapvia  975
             LQIGQELTRGLGAGGNP+IG NAAKESKEAIEEA+YG+DMVFVTAGMGGGTGTG APVIA
Sbjct  174   LQIGQELTRGLGAGGNPEIGMNAAKESKEAIEEALYGSDMVFVTAGMGGGTGTGGAPVIA  233

Query  976   gtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTP  1155
               AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR++VDTLIVIPNDKLLTAVS STP
Sbjct  234   SVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDSVDTLIVIPNDKLLTAVSQSTP  293

Query  1156  VTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRAR  1335
             VTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRAR
Sbjct  294   VTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRAR  353

Query  1336  DAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVI  1515
             DAALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVI
Sbjct  354   DAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVI  413

Query  1516  DPSISGQVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEF  1692
             DPS+SGQVSITLIATGFKRQE ++ +PLQA QL+  D + GI+RRP+SF +  SVEIPEF
Sbjct  414   DPSLSGQVSITLIATGFKRQEENEGRPLQAGQLSGADVTFGISRRPSSFTESGSVEIPEF  473

Query  1693  LKKKGRSRYPRA  1728
             LKKKGRSRYPRA
Sbjct  474   LKKKGRSRYPRA  485



>ref|XP_002282740.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Vitis vinifera]
 emb|CAN80330.1| hypothetical protein VITISV_018274 [Vitis vinifera]
Length=486

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/495 (78%), Positives = 426/495 (86%), Gaps = 19/495 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVS---------PVKMLNEKNGSLSLSVNRRGGL  426
             MA C  +YF  SDT     +L V+G R+S          +KM ++KN  L     +R   
Sbjct  1     MATCMSSYFTPSDTRNQMELLNVLGRRISLGNHQRRVNSLKMFDDKNEMLG--AGQRISS  58

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
                  KCSANS++ +       Y SKDPFL+LHPE+SMLRGEG+S + +PR+++   +VT
Sbjct  59    RLPQFKCSANSHSVS------PYHSKDPFLDLHPEVSMLRGEGSSNVSSPRKDASSGSVT  112

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ES +DSS  +N+NEAKIKV+GVGGGGSNAVNRMIESSM+GVEFWIVNTD+QAMRMSPV+ 
Sbjct  113   ESIRDSSGPSNYNEAKIKVIGVGGGGSNAVNRMIESSMQGVEFWIVNTDVQAMRMSPVYT  172

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             +HRLQIGQELTRGLGAGGNPDIG NAAKESKEAIEEAVYGADMVFVTAGMGGGTGTG AP
Sbjct  173   EHRLQIGQELTRGLGAGGNPDIGMNAAKESKEAIEEAVYGADMVFVTAGMGGGTGTGGAP  232

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             VIAG AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR++VDTLIVIPNDKLLTAVS 
Sbjct  233   VIAGVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDSVDTLIVIPNDKLLTAVSQ  292

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKT  1326
             STPVTEAFNLADDILRQGVRGISDII IPGLVNVDFADVRAIM +AGSSLMGIGTATGKT
Sbjct  293   STPVTEAFNLADDILRQGVRGISDIIMIPGLVNVDFADVRAIMANAGSSLMGIGTATGKT  352

Query  1327  RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  1506
             RARDAALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDPSANLIFG
Sbjct  353   RARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPSANLIFG  412

Query  1507  AVIDPSISGQVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEI  1683
             AVIDPS+SGQVSITLIATGFKRQE ++ +PLQA+QLA GDA+ G++RRP SF +G SVEI
Sbjct  413   AVIDPSLSGQVSITLIATGFKRQEENEGRPLQASQLAQGDANFGMSRRP-SFTEGGSVEI  471

Query  1684  PEFLKKKGRSRYPRA  1728
             PEFLKKKGRSRYPRA
Sbjct  472   PEFLKKKGRSRYPRA  486



>ref|XP_007027731.1| Tubulin/FtsZ family protein isoform 1 [Theobroma cacao]
 gb|EOY08233.1| Tubulin/FtsZ family protein isoform 1 [Theobroma cacao]
Length=483

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/486 (79%), Positives = 421/486 (87%), Gaps = 4/486 (1%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             M      YF  SD   P GVL V+GGRVS   +L  + G L +   + G  +        
Sbjct  1     MVAAISPYFTPSDAR-PMGVLNVLGGRVSMDNLLG-RVGCLKMCDGKIGCSSAGQRSTMP  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             +   SAN+ S + YQ+KDPFLN+HPE+SMLRGEGN+T+  PR++S   +VTES  D SS 
Sbjct  59    HCRCSANSQSVSPYQNKDPFLNMHPEVSMLRGEGNNTVTNPRKDSSSGSVTESLGDMSSS  118

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             +N+NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAM+MSPVFP+HRLQIGQE
Sbjct  119   SNYNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMKMSPVFPEHRLQIGQE  178

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNP+IG NAAKESKE+IEEA+YG+DMVFVTAGMGGGTGTG APVIAG AKS+
Sbjct  179   LTRGLGAGGNPEIGMNAAKESKESIEEALYGSDMVFVTAGMGGGTGTGGAPVIAGVAKSL  238

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVS STPVTEAFN
Sbjct  239   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSQSTPVTEAFN  298

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  299   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  358

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLD+GIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS+SG
Sbjct  359   IQSPLLDLGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSLSG  418

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQ E + +PLQA QLA GD  +GINRRP SF +G SVEIPEFLKKKGR
Sbjct  419   QVSITLIATGFKRQEESEGRPLQAGQLAQGDIGLGINRRP-SFSEGGSVEIPEFLKKKGR  477

Query  1711  SRYPRA  1728
             SRYPRA
Sbjct  478   SRYPRA  483



>ref|XP_008241237.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Prunus mume]
Length=481

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/497 (76%), Positives = 425/497 (86%), Gaps = 30/497 (6%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRV---------SPVKMLNEKNGSLSLSVNRRGGL  426
             MA    TYF  SDT  P G+LT  GGR+         S VKM  +K G +       G +
Sbjct  1     MATYASTYFTISDTRNPVGLLTGRGGRLLTKNQLGNFSCVKMAEDKYGFM-------GAI  53

Query  427   NWSLL---KCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIE  597
             + S L   KCS+NS +         YQ+KDPFLNLHPE+S+LRGEG++T+  PR+++   
Sbjct  54    HKSTLTQVKCSSNSQSVN------SYQNKDPFLNLHPEVSLLRGEGSNTVNNPRKDTSSG  107

Query  598   NVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSP  777
             +VTES  D SS +N++EAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAMRMSP
Sbjct  108   SVTESLSDKSSPSNYSEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMRMSP  167

Query  778   VFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtg  957
             VFP++RLQIGQELTRGLGAGGNPD+G NAAKESKE+IEEA+YG+DMVFVTAGMGGGTGTG
Sbjct  168   VFPENRLQIGQELTRGLGAGGNPDVGMNAAKESKESIEEALYGSDMVFVTAGMGGGTGTG  227

Query  958   aapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTA  1137
              APV+AG AKSMGILTVG+VTTPFSFEGR+RAVQAQEGIAALRENVDTLIVIPNDKLLTA
Sbjct  228   GAPVVAGVAKSMGILTVGVVTTPFSFEGRKRAVQAQEGIAALRENVDTLIVIPNDKLLTA  287

Query  1138  VSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTAT  1317
             VS STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTAT
Sbjct  288   VSQSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTAT  347

Query  1318  GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANL  1497
             GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTL+EVNAAAEVIYDLVDP+ANL
Sbjct  348   GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLYEVNAAAEVIYDLVDPTANL  407

Query  1498  IFGAVIDPSISGQVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSS  1674
             IFGAV DPS+SGQVSITLIATGFKRQE ++ +PLQA     GD ++GINRRP+SFM+GS 
Sbjct  408   IFGAVTDPSLSGQVSITLIATGFKRQEENEGRPLQAQ----GDVTLGINRRPSSFMEGSP  463

Query  1675  VEIPEFLKKKGRSRYPR  1725
             VEIP+FLKKKGRSRYPR
Sbjct  464   VEIPDFLKKKGRSRYPR  480



>gb|AFC37492.1| FtsZ2 protein [Manihot esculenta]
Length=485

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/493 (76%), Positives = 420/493 (85%), Gaps = 18/493 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNE--KNGSLSLSVNRRGGL------N  429
             MA C   Y   SDT  P G+LTV+GGRV   KM N   + GSL +S ++   L      N
Sbjct  1     MAACVSPYCTPSDTINPMGMLTVLGGRV---KMENHLGRIGSLKISDDKNRYLDASQRSN  57

Query  430   WSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTE  609
             +S  KC   S++ +       Y +KD FL+LHPEISMLRGEGN+T  TPR+++    VT+
Sbjct  58    FSYFKCLVKSHSVS------PYHNKDSFLDLHPEISMLRGEGNNTATTPRKDTSSGTVTD  111

Query  610   SSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQ  789
                  SS +N++EAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAM+M PVFP+
Sbjct  112   RFGKESSPSNYSEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMKMFPVFPE  171

Query  790   HRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapv  969
             +RLQIGQELTRGLGAGGNP+IG NAAKESK AIEEA+YG+DMVFVTAGMGGGTGTG APV
Sbjct  172   NRLQIGQELTRGLGAGGNPEIGMNAAKESKVAIEEALYGSDMVFVTAGMGGGTGTGGAPV  231

Query  970   iagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPS  1149
             IA  AKSMGILTVGIVTTPFSFEGRR AVQAQEGIAALR+NVDTLIVIPNDKLLTAVS S
Sbjct  232   IANVAKSMGILTVGIVTTPFSFEGRRGAVQAQEGIAALRDNVDTLIVIPNDKLLTAVSQS  291

Query  1150  TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTR  1329
             TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM SAGSSLMGIGTATGKTR
Sbjct  292   TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMASAGSSLMGIGTATGKTR  351

Query  1330  ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGA  1509
             ARDAALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGA
Sbjct  352   ARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGA  411

Query  1510  VIDPSISGQVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIP  1686
             VIDPS+SGQ+SITLIATGFKRQE ++ +PLQA+QL+PGD + G NR  +SF +GSSVE+P
Sbjct  412   VIDPSLSGQISITLIATGFKRQEENEGRPLQASQLSPGDGTFGTNRPSSSFTEGSSVEVP  471

Query  1687  EFLKKKGRSRYPR  1725
             EFLKKKGRSRYPR
Sbjct  472   EFLKKKGRSRYPR  484



>ref|XP_007202025.1| hypothetical protein PRUPE_ppa005084mg [Prunus persica]
 gb|EMJ03224.1| hypothetical protein PRUPE_ppa005084mg [Prunus persica]
Length=478

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/485 (77%), Positives = 421/485 (87%), Gaps = 9/485 (2%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA    TYF  SDT  P G+LT  GGR+    ++  + G+L ++ ++ G +         
Sbjct  1     MATYASTYFTISDTRNPVGLLTGRGGRL----LMKNQLGNLKMAEDKYGFMGAIHKSTLT  56

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
                 S+N+ S + YQ+KDPFLNLHPE+S+LRGEGN+T+  PR++    +VTES  D SS 
Sbjct  57    QVKCSSNSQSVSSYQNKDPFLNLHPEVSLLRGEGNNTVNNPRKDISSGSVTESLSDKSSP  116

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             +N++EAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAMRMSPVFP++RLQIGQE
Sbjct  117   SNYSEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMRMSPVFPENRLQIGQE  176

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPD+G NAAKESKE+IEEA+YG+DMVFVTAGMGGGTGTG APV+AG AKSM
Sbjct  177   LTRGLGAGGNPDVGMNAAKESKESIEEALYGSDMVFVTAGMGGGTGTGGAPVVAGVAKSM  236

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVG+VTTPFSFEGR+RAVQAQEGIAALRENVDTLIVIPNDKLLTAVS STPVTEAFN
Sbjct  237   GILTVGVVTTPFSFEGRKRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSQSTPVTEAFN  296

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  297   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  356

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGGTDLTL+EVNAAAEVIYDLVDP+ANLIFGAV DPS+SG
Sbjct  357   IQSPLLDIGIERATGIVWNITGGTDLTLYEVNAAAEVIYDLVDPTANLIFGAVTDPSLSG  416

Query  1534  QVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQE ++ + LQA     GD ++GINRRP+SFM+GS VEIP+FLKKKGR
Sbjct  417   QVSITLIATGFKRQEENEGRQLQAQ----GDVTLGINRRPSSFMEGSPVEIPDFLKKKGR  472

Query  1711  SRYPR  1725
             SRYPR
Sbjct  473   SRYPR  477



>gb|AFB70893.1| FtsZ3 protein [Manihot esculenta]
Length=484

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/491 (78%), Positives = 422/491 (86%), Gaps = 13/491 (3%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLS--VNRRGGL---NWSL  438
             MA C   Y  +SDT  P G+LTV+GGRVS V+    + G L +S   NR   +   N S 
Sbjct  1     MAACLSPYCTSSDTRKPMGMLTVLGGRVS-VENHPSRLGCLRMSDDKNRYPCVKKSNISY  59

Query  439   LKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSK  618
              KCS    N +       Y + D FL+LHP+ISMLRGEGN+   T R+++    +T+S  
Sbjct  60    SKCSVRCTNVS------PYYNDDSFLDLHPQISMLRGEGNNMATTSRKDTPSGIITDSLG  113

Query  619   DSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRL  798
             + ++ +N NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTDIQAM+MSPVFP++RL
Sbjct  114   EDATPSNCNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDIQAMKMSPVFPENRL  173

Query  799   QIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviag  978
             QIGQELTRGLGAGGNPDIG NAAKESKEAIEEA+YG+DMVFVTAGMGGGTGTG APVIAG
Sbjct  174   QIGQELTRGLGAGGNPDIGMNAAKESKEAIEEALYGSDMVFVTAGMGGGTGTGGAPVIAG  233

Query  979   taKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPV  1158
              AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVS STPV
Sbjct  234   IAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSQSTPV  293

Query  1159  TEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARD  1338
             TEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM SAGSSLMGIGTATGKTRARD
Sbjct  294   TEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMASAGSSLMGIGTATGKTRARD  353

Query  1339  AALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVID  1518
             AALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVID
Sbjct  354   AALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVID  413

Query  1519  PSISGQVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFL  1695
             PS+SGQVSITLIATGFKRQE ++ +PLQA+QL+ GD + GINRRP+SF +G SVEIPEFL
Sbjct  414   PSLSGQVSITLIATGFKRQEENEGRPLQASQLSQGDVAFGINRRPSSFTEGGSVEIPEFL  473

Query  1696  KKKGRSRYPRA  1728
             KKKGRSRYPRA
Sbjct  474   KKKGRSRYPRA  484



>ref|XP_008389555.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Malus domestica]
 ref|XP_008353971.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Malus domestica]
Length=482

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/486 (77%), Positives = 413/486 (85%), Gaps = 6/486 (1%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA     Y    DT  P GVLT +GGR+     L  +  SL +S  + G +  +      
Sbjct  2     MATYASNYVTLPDTRNPVGVLTRLGGRLGMENHLG-RVSSLKVSEEKYGFMGVTYKSSLP  60

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
                 S N+ S   YQ++DPFLNLHPE+S+LRGEGN  +  PR++     VTES  D SS 
Sbjct  61    QVKCSTNSQSVGSYQNRDPFLNLHPEVSLLRGEGNDRVNNPRKDISGGGVTESLSDKSSP  120

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             +N  EAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAMRMSPVFP++RLQIGQE
Sbjct  121   SNNGEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMRMSPVFPENRLQIGQE  180

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPDIG NAAKESKE+IEEA+YG+DMVFVTAGMGGGTGTG AP++AG AKSM
Sbjct  181   LTRGLGAGGNPDIGMNAAKESKESIEEALYGSDMVFVTAGMGGGTGTGGAPIVAGAAKSM  240

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVG+VTTPFSFEGR+RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN
Sbjct  241   GILTVGVVTTPFSFEGRKRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  300

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  301   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  360

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG DLTL+EVNAAAEVIYDLVDP+ANLIFGAV DPS+SG
Sbjct  361   IQSPLLDIGIERATGIVWNITGGADLTLYEVNAAAEVIYDLVDPTANLIFGAVTDPSLSG  420

Query  1534  QVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQE ++ +PLQA     GD ++GINRRP+SFM+GS+VEIP+FLKKKGR
Sbjct  421   QVSITLIATGFKRQEENEGRPLQAQ----GDVTLGINRRPSSFMEGSAVEIPDFLKKKGR  476

Query  1711  SRYPRA  1728
             SRYPRA
Sbjct  477   SRYPRA  482



>ref|XP_004302993.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=479

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/494 (76%), Positives = 419/494 (85%), Gaps = 26/494 (5%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGR---------VSPVKMLNEKNGSLSLSVNRRGGL  426
             MA    T+F  SDT  P GVLT +GGR         V  V+ML E       +V++   L
Sbjct  1     MATYASTHFTFSDTRNPVGVLTRVGGRLLVGNHFERVRSVRMLPEGKFGFVGAVHK---L  57

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
             N +  K         N+HS   Y +KDPFLNLHPE+SMLRGEGN+T    R+++   +VT
Sbjct  58    NLNQFK---------NSHSVGSYPNKDPFLNLHPEVSMLRGEGNNTSSNLRKDTPGGSVT  108

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ES  D SS NN+NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAMRMSPVFP
Sbjct  109   ESLSDKSSPNNYNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMRMSPVFP  168

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             ++RLQIGQELTRGLGAGGNPD+G NAAKES+E+IEEA++G+DMVFVTAGMGGGTGTG AP
Sbjct  169   ENRLQIGQELTRGLGAGGNPDVGMNAAKESRESIEEALFGSDMVFVTAGMGGGTGTGGAP  228

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             V+AG AKSMGILTVG+VTTPFSFEGR+RAVQAQEGIAALRENVDTLIVIPNDKLLTAVS 
Sbjct  229   VVAGVAKSMGILTVGVVTTPFSFEGRKRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSQ  288

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKT  1326
             STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKT
Sbjct  289   STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKT  348

Query  1327  RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  1506
             RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTL+EVNAAAEVIYDLVDP+ANLIFG
Sbjct  349   RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLYEVNAAAEVIYDLVDPTANLIFG  408

Query  1507  AVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEI  1683
             AV DPS++GQVSITLIATGFKRQ E D +PLQA     GD ++GINRRP+SF +GS+VEI
Sbjct  409   AVTDPSLTGQVSITLIATGFKRQEESDGRPLQAQ----GDVTLGINRRPSSFTEGSAVEI  464

Query  1684  PEFLKKKGRSRYPR  1725
             P+FLKKKGRSRYPR
Sbjct  465   PDFLKKKGRSRYPR  478



>ref|XP_009617400.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=450

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/466 (82%), Positives = 400/466 (86%), Gaps = 19/466 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA CT   FM  DT   RGVLT++GGR+  +KM +EK G L   VN++G  +    KCS+
Sbjct  1     MATCTSAVFMPPDTRRSRGVLTLLGGRLCALKMQDEKIGFLG--VNQKGSSSLPQFKCSS  58

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
             NS++        QYQ+KD FLNLHPEIS+LRGE          ES   NVTES  DSS  
Sbjct  59    NSHSVN------QYQNKDSFLNLHPEISLLRGE----------ESSSGNVTESLMDSSRS  102

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             NNFNEAKIKVVGVGGGGSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPV  + RL IGQE
Sbjct  103   NNFNEAKIKVVGVGGGGSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVAAEQRLPIGQE  162

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPDIG NAA ESK+AIEEAVYGADMVFVTAGMGGGTGTGAAP+IAGTAKSM
Sbjct  163   LTRGLGAGGNPDIGMNAANESKQAIEEAVYGADMVFVTAGMGGGTGTGAAPIIAGTAKSM  222

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN
Sbjct  223   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  282

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  283   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  342

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG
Sbjct  343   IQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  402

Query  1534  QVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDG  1668
             QVSITLIATGFKRQ E D +PLQ NQL  GD S+G N RPASFM G
Sbjct  403   QVSITLIATGFKRQEESDGRPLQGNQLTQGDVSLGNNGRPASFMQG  448



>ref|XP_010101572.1| Cell division protein FtsZ-2-2-like protein [Morus notabilis]
 gb|EXB88711.1| Cell division protein FtsZ-2-2-like protein [Morus notabilis]
Length=480

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/495 (77%), Positives = 416/495 (84%), Gaps = 25/495 (5%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSP---------VKMLNEKNGSLSLSVNRRGGL  426
             MA  T  YF  SDT  P GVLTV+ GR            +K L +K G    S       
Sbjct  1     MATYTSAYFTLSDTRNPAGVLTVLRGRAPAENHFGRSVCMKGLEDKYGLFGGSQKS----  56

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
             +   LKCS+NS++ +       YQ KDPFLNLHPEISMLR EGN+++  PR+ES    VT
Sbjct  57    HLHQLKCSSNSHSVS------PYQRKDPFLNLHPEISMLR-EGNNSVNNPRKESLGGGVT  109

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ES  D S  N +NEAKIKV+GVGGGGSNAVNRMIESSMKGVEFWIVNTD+QAMRMSPVFP
Sbjct  110   ESLGDESGSNKYNEAKIKVIGVGGGGSNAVNRMIESSMKGVEFWIVNTDVQAMRMSPVFP  169

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             ++RLQIGQELTRGLGAGGNP+IG NAAKES+  IEEA++G+DMVFVTAGMGGGTGTG AP
Sbjct  170   ENRLQIGQELTRGLGAGGNPEIGMNAAKESRALIEEALHGSDMVFVTAGMGGGTGTGGAP  229

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             +IAG AKS+GILTVGIVTTPFSFEGR+RAVQAQEGIAALRENVDTLIVIPNDKLLTAVS 
Sbjct  230   IIAGIAKSIGILTVGIVTTPFSFEGRKRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSQ  289

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKT  1326
             STPVTEAFNLADDILRQGVRGISDIIT+PGLVNVDFADVRAIM +AGSSLMGIGTATGKT
Sbjct  290   STPVTEAFNLADDILRQGVRGISDIITVPGLVNVDFADVRAIMANAGSSLMGIGTATGKT  349

Query  1327  RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  1506
             RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFG
Sbjct  350   RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFG  409

Query  1507  AVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEI  1683
             AVIDPS+SGQVSITLIATGFKRQ E + +P+QA     GD  +GINRRP+SF DGSSVEI
Sbjct  410   AVIDPSLSGQVSITLIATGFKRQEESEGRPIQAQ----GDIGLGINRRPSSFTDGSSVEI  465

Query  1684  PEFLKKKGRSRYPRA  1728
             P+FLKKKGRSRYPRA
Sbjct  466   PDFLKKKGRSRYPRA  480



>ref|XP_009374723.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009374724.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=482

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/485 (76%), Positives = 412/485 (85%), Gaps = 6/485 (1%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA     Y    DT  P GVLT +GGR+     L  +  SL +S  + G +  +      
Sbjct  2     MATYASNYVTLPDTRNPVGVLTRLGGRLGMENHLG-RVSSLKVSEEKYGFMGVTYKSSLP  60

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
                 S N+ S   YQ++DPFLNLHPE+S+LRGEGN  +  PR++     VTES  D SS 
Sbjct  61    QVKCSTNSQSVGSYQNRDPFLNLHPEVSLLRGEGNDRVNNPRKDISGGGVTESLSDKSSP  120

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             +N  EAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAMRMSPVFP++RLQIGQE
Sbjct  121   SNNGEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMRMSPVFPENRLQIGQE  180

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNPDIG NAAKESKE+IEEA+YG+DMVFVTAGMGGGTGTG AP++AG AKSM
Sbjct  181   LTRGLGAGGNPDIGMNAAKESKESIEEALYGSDMVFVTAGMGGGTGTGGAPIVAGVAKSM  240

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVG+VTTPFSFEGR+RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN
Sbjct  241   GILTVGVVTTPFSFEGRKRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  300

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA
Sbjct  301   LADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNA  360

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIERATGIVWNITGG DLTL+EVNAAAEVIYDLVDP+ANLIFGAV DPS+SG
Sbjct  361   IQSPLLDIGIERATGIVWNITGGADLTLYEVNAAAEVIYDLVDPTANLIFGAVTDPSLSG  420

Query  1534  QVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGR  1710
             QVSITLIATGFKRQE ++ +PLQA     GD ++GINRRP+SFM+GS+VEIP+FLKKKGR
Sbjct  421   QVSITLIATGFKRQEENEGRPLQAQ----GDVTLGINRRPSSFMEGSAVEIPDFLKKKGR  476

Query  1711  SRYPR  1725
             SRYPR
Sbjct  477   SRYPR  481



>gb|EYU35483.1| hypothetical protein MIMGU_mgv1a006376mg [Erythranthe guttata]
Length=446

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/454 (81%), Positives = 402/454 (89%), Gaps = 9/454 (2%)
 Frame = +1

Query  370   MLNEKNGSLSLSVNRRGGLNWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRG  549
             M++E+NG  S+S   +        KCSANS+ +       ++Q  DPFLNLHPEIS+LRG
Sbjct  1     MVDERNGFSSVS--HKCSSTSPQFKCSANSHGAN------KFQGNDPFLNLHPEISLLRG  52

Query  550   EGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGV  729
             E NSTM   RQ++   NVTE S+DS+S NN+++AKIKV+GVGGGGSNAVNRMIES+M GV
Sbjct  53    ELNSTMTETRQDNSSGNVTEISRDSASSNNYSDAKIKVIGVGGGGSNAVNRMIESAMNGV  112

Query  730   EFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGA  909
             EFWIVNTDIQAMR+SP+FP HRLQIGQELTRGLGAGGNP+IG NAA+ES+E+IE AVYGA
Sbjct  113   EFWIVNTDIQAMRLSPIFPDHRLQIGQELTRGLGAGGNPEIGMNAARESRESIESAVYGA  172

Query  910   DMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRE  1089
             DMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRE
Sbjct  173   DMVFVTAGMGGGTGTGGAPVIAGVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRE  232

Query  1090  NVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRA  1269
             NVDTLIVIPNDKLL AVS +TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRA
Sbjct  233   NVDTLIVIPNDKLLNAVSAATPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRA  292

Query  1270  IMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVN  1449
             IM +AGSSLMGIGTATGKTRARDAALNAIQSPLLD+GIERATGIVWNITGGTDLTLFEVN
Sbjct  293   IMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDLGIERATGIVWNITGGTDLTLFEVN  352

Query  1450  AAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDA  1626
             AAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ E D +  QA+Q+   D 
Sbjct  353   AAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEESDGRQYQASQVGQTDT  412

Query  1627  SIGINRRPASFMDGSSVEIPEFLKKKGRSRYPRA  1728
             +IGINRR +SF++G SVEIPEFLKKKGRSR+PRA
Sbjct  413   NIGINRRSSSFLEGGSVEIPEFLKKKGRSRFPRA  446



>ref|XP_008787852.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Phoenix dactylifera]
 ref|XP_008787860.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Phoenix dactylifera]
Length=486

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/489 (76%), Positives = 416/489 (85%), Gaps = 20/489 (4%)
 Frame = +1

Query  295   YFMTSDTWCPRGVLTVIGGRV---------SPVKMLNEKNGSLSLSVNRRGGLNWSLLKC  447
             YF      C  G L   GGR+         S  KML+++NG L +          S++ C
Sbjct  7     YFTPFSRQCSVGTLRSPGGRILAEGWTGRNSSFKMLSKENGLLEMG--------QSVVSC  58

Query  448   sansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSS  627
             ++    SAN+HS + + SKDPFLNLHPE+S+L+G+ N T++ PR+E+   +V ES + SS
Sbjct  59    ASRVRCSANSHSISSFHSKDPFLNLHPEVSLLQGDKNDTVIDPRKENVGGSVVESLRGSS  118

Query  628   SVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIG  807
               N++NEAKIKV+G+GGGGSNAVNRMIES MKGVEFWIVNTD+QAMRMSPVFP+HRLQIG
Sbjct  119   VPNDYNEAKIKVIGIGGGGSNAVNRMIESDMKGVEFWIVNTDVQAMRMSPVFPEHRLQIG  178

Query  808   QELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaK  987
             QELTRGLGAGGNPDIG NAA+ESKE+I+EAVYGADMVFVTAGMGGGTGTG APVIAG  K
Sbjct  179   QELTRGLGAGGNPDIGMNAAEESKESIQEAVYGADMVFVTAGMGGGTGTGGAPVIAGLTK  238

Query  988   SMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEA  1167
             SMGILTVGIVT PFSFEGRRRAVQAQEGI+ALRENVDTLIVIPNDKLLTAVSP+TPVTEA
Sbjct  239   SMGILTVGIVTIPFSFEGRRRAVQAQEGISALRENVDTLIVIPNDKLLTAVSPNTPVTEA  298

Query  1168  FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAAL  1347
             FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIME+AGSSLMGIGTATGKTRARDAAL
Sbjct  299   FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMENAGSSLMGIGTATGKTRARDAAL  358

Query  1348  NAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSI  1527
             NAIQSPLLDIGIERATGIVWNITGG+DLTL+EVNAAAEVIYDLVDPSANLIFGAVID S+
Sbjct  359   NAIQSPLLDIGIERATGIVWNITGGSDLTLYEVNAAAEVIYDLVDPSANLIFGAVIDQSL  418

Query  1528  SGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFM-DGSSVEIPEFLKK  1701
              GQVSITLIATGFKRQ E + + LQ +QL  GD S+GINRRP S++ +G+ VEIPEFL+K
Sbjct  419   GGQVSITLIATGFKRQDEPEGQTLQGSQLGHGD-SLGINRRPTSYVTEGNMVEIPEFLRK  477

Query  1702  KGRSRYPRA  1728
             KGRSRYPRA
Sbjct  478   KGRSRYPRA  486



>ref|XP_010036692.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Eucalyptus grandis]
 ref|XP_010036693.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Eucalyptus grandis]
 ref|XP_010036694.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Eucalyptus grandis]
 ref|XP_010036695.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW48327.1| hypothetical protein EUGRSUZ_K02046 [Eucalyptus grandis]
Length=485

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/495 (76%), Positives = 418/495 (84%), Gaps = 20/495 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIG---------GRVSPVKMLNEKNGSLSLSVNRRGGL  426
             MA C+      S T  P G+   +G         GRV+ ++M N K+G +    +     
Sbjct  1     MASCSSVRIAPSVTPVPLGMSGNLGDRFALENQLGRVNFLRMSNRKSGLM----DAYQTY  56

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
             + S  KCS NS+N +       Y SKDPFLNLHPE+SMLRGEGNST+  PR++S   +VT
Sbjct  57    SSSQFKCSVNSHNVS------PYPSKDPFLNLHPEVSMLRGEGNSTISNPRKDSSSGSVT  110

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ES +D+ + N +NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAMRMSPVFP
Sbjct  111   ESLRDTPAPNTYNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMRMSPVFP  170

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             ++RLQIGQELTRGLGAGGNP+IG NAAKESKE +EEA+YGADMVFVTAGMGGGTGTG AP
Sbjct  171   ENRLQIGQELTRGLGAGGNPEIGMNAAKESKETVEEALYGADMVFVTAGMGGGTGTGGAP  230

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             +IAG AKSMGILTVGIVTTPFSFEGRRR VQAQEG+A+LR+NVDTLIVIPNDKLLTAVS 
Sbjct  231   IIAGVAKSMGILTVGIVTTPFSFEGRRRTVQAQEGVASLRDNVDTLIVIPNDKLLTAVSQ  290

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKT  1326
             STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  AGSSLMGIGTATGK+
Sbjct  291   STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMADAGSSLMGIGTATGKS  350

Query  1327  RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  1506
             RA+DAALNAIQSPLLDIGIERATGIVWNITGG+DLTL+EVNAAAEVIYDLVDP+ANLIFG
Sbjct  351   RAKDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLYEVNAAAEVIYDLVDPNANLIFG  410

Query  1507  AVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEI  1683
             AVIDPS+SGQVSITLIATGFKRQ E D + LQA QLA G+ +IGINR  +SF +G SVEI
Sbjct  411   AVIDPSLSGQVSITLIATGFKRQEESDSRLLQAGQLAQGEVTIGINRPSSSFSEGGSVEI  470

Query  1684  PEFLKKKGRSRYPRA  1728
             PEFLKKKGRSRYPRA
Sbjct  471   PEFLKKKGRSRYPRA  485



>ref|XP_010683737.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010683738.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010683739.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=483

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/496 (76%), Positives = 418/496 (84%), Gaps = 24/496 (5%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIG---------GRVSPVKMLNEKNGSLSLSVNRRGGL  426
             MA C       SD    RGVLTV+G         GRV+ VK  +E+NG            
Sbjct  1     MAACGSKSLTCSDAGTARGVLTVLGRRLPTESHSGRVTSVKFFDERNG------------  48

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRG-EGNSTMMTPRQESGIENV  603
                 + CSA    S+N+HS ++  + DPFLNLHPEIS+LRG + N+ M +PR +    ++
Sbjct  49    QRMAVSCSAKFKCSSNSHSVSRSNNNDPFLNLHPEISLLRGGDANNMMNSPRNDGPSGSI  108

Query  604   TESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVF  783
             T++ ++SS  NN+NEA IKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTDIQAMRMSPVF
Sbjct  109   TDTLRESSRTNNYNEATIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDIQAMRMSPVF  168

Query  784   PQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaa  963
              ++RLQIGQELTRGLGAGGNP+IG NAAKESKEAIEEA++G+DMVFVTAGMGGGTGTGAA
Sbjct  169   SENRLQIGQELTRGLGAGGNPEIGMNAAKESKEAIEEALHGSDMVFVTAGMGGGTGTGAA  228

Query  964   pviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVS  1143
             P+IAG AKSMGILTVGIVTTPFSFEGRRR VQAQEG AALRENVDTLIVIPNDKLLTAVS
Sbjct  229   PIIAGIAKSMGILTVGIVTTPFSFEGRRRTVQAQEGTAALRENVDTLIVIPNDKLLTAVS  288

Query  1144  PSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGK  1323
             P+TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  AGSSLMGIGTATGK
Sbjct  289   PNTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMADAGSSLMGIGTATGK  348

Query  1324  TRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF  1503
             TRARDAALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIF
Sbjct  349   TRARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIF  408

Query  1504  GAVIDPSISGQVSITLIATGFKRQE-GDDKPLQANQLAPGDASIGINRRPASFMDGSSVE  1680
             GAVIDPS+SGQVSITLIATGFKRQE G+ +PLQA+Q + GD  +G+NRRP SF + SSVE
Sbjct  409   GAVIDPSLSGQVSITLIATGFKRQEDGESRPLQASQPSQGDIGLGMNRRP-SFSESSSVE  467

Query  1681  IPEFLKKKGRSRYPRA  1728
             IPEFL+KKGRSRYPRA
Sbjct  468   IPEFLRKKGRSRYPRA  483



>ref|XP_010931142.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Elaeis guineensis]
Length=486

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/496 (76%), Positives = 422/496 (85%), Gaps = 25/496 (5%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRV---------SPVKMLNEKNGSLSLSVNRRGGL  426
             +A CTP         C  G+L   G R+         S +KM++++NG L +        
Sbjct  5     VAHCTPF-----SRQCSGGILRSPGRRILAENRTSRNSSLKMISKENGLLEMG-------  52

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
               S++ CS+    SAN+HS +   SKDPFLNLHPE+S+L+G+ + T++ PR+E+   NV 
Sbjct  53    -QSVVSCSSRVRCSANSHSVSSLHSKDPFLNLHPEVSLLQGDKHDTVIDPRKENVGGNVV  111

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ES + SS  N++NEAKIKV+GVGGGGSNAVNRMIES MKGVEFWIVNTD+QAMRMSPVFP
Sbjct  112   ESLRGSSVPNDYNEAKIKVIGVGGGGSNAVNRMIESDMKGVEFWIVNTDVQAMRMSPVFP  171

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             +HRLQIGQELTRGLGAGGNPDIG NAAKESKE+I+EAVYGADMVFVTAGMGGGTGTG AP
Sbjct  172   EHRLQIGQELTRGLGAGGNPDIGMNAAKESKESIQEAVYGADMVFVTAGMGGGTGTGGAP  231

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             VIAG AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP
Sbjct  232   VIAGVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  291

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKT  1326
             +TPV EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIME+AGSSLMGIGTATGKT
Sbjct  292   NTPVMEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMENAGSSLMGIGTATGKT  351

Query  1327  RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  1506
             RARDAALNAI SPLLDIGIERATGIVWNITGG+DLTL+EVNAAAEVIYDLVDPSANLIFG
Sbjct  352   RARDAALNAIHSPLLDIGIERATGIVWNITGGSDLTLYEVNAAAEVIYDLVDPSANLIFG  411

Query  1507  AVIDPSISGQVSITLIATGFKRQEG-DDKPLQANQLAPGDASIGINRRPASFM-DGSSVE  1680
             AVID S+SGQVSITLIATGFKRQ+G + + LQ +QL  GD S+GINRRP S++ +G++VE
Sbjct  412   AVIDQSLSGQVSITLIATGFKRQDGPEGQTLQGSQLGHGD-SLGINRRPTSYVTEGNTVE  470

Query  1681  IPEFLKKKGRSRYPRA  1728
             IPEFL+KKGRSRYPRA
Sbjct  471   IPEFLRKKGRSRYPRA  486



>ref|XP_008369724.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Malus domestica]
Length=481

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/488 (77%), Positives = 415/488 (85%), Gaps = 11/488 (2%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA     Y   SDT  P G+LT +GG +     L   +   SL V+   G     LK S 
Sbjct  2     MATYASNYVTLSDTRNPVGILTRLGGHLGTENHLGRVS---SLKVSEEYGFMGVTLKSSL  58

Query  454   -nsnnsanahsanQYQS-KDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSS  627
                  S N+ S   YQ+ +DPFLNLHPE+S+LRGEGN+T+  PR++   E VTES  D S
Sbjct  59    PQVKCSINSKSVGSYQNNRDPFLNLHPEVSLLRGEGNNTLSNPRKDISGEGVTESLSDKS  118

Query  628   SVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIG  807
             S +N  EAKIKV+GVGGGGSNAVNRMIES+MKGVEFWI+NTDIQAM+MSPVFP++R+QIG
Sbjct  119   SPSN-GEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWILNTDIQAMKMSPVFPENRIQIG  177

Query  808   QELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaK  987
             QELTRGLGAGGNPDIG NAAKESKE+IEEA+YG+DMVFVTAGMGGGTGTG AP++AG AK
Sbjct  178   QELTRGLGAGGNPDIGMNAAKESKESIEEALYGSDMVFVTAGMGGGTGTGGAPIVAGVAK  237

Query  988   SMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEA  1167
             SMGILTVG+VTTPFSFEGR+RAVQAQEGIAALRENVDTLIVIPNDKLLTAVS STPVTEA
Sbjct  238   SMGILTVGVVTTPFSFEGRKRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSQSTPVTEA  297

Query  1168  FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAAL  1347
             FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAAL
Sbjct  298   FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAAL  357

Query  1348  NAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSI  1527
             NAIQSPLLDIGIERATGIVWNITGGTDLTL+EVNAAAEVIYDLVDP+ANLIFGAV DPS+
Sbjct  358   NAIQSPLLDIGIERATGIVWNITGGTDLTLYEVNAAAEVIYDLVDPTANLIFGAVTDPSL  417

Query  1528  SGQVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKK  1704
             SGQVSITLIATGFKRQE ++ +PLQA     GD ++GINRRP+SFM+GSSVEIP+FLKKK
Sbjct  418   SGQVSITLIATGFKRQEENEGRPLQAQ----GDVTLGINRRPSSFMEGSSVEIPDFLKKK  473

Query  1705  GRSRYPRA  1728
             G SRYPRA
Sbjct  474   GGSRYPRA  481



>gb|KHG03680.1| Cell division FtsZ-1, chloroplastic -like protein [Gossypium 
arboreum]
Length=483

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/495 (76%), Positives = 416/495 (84%), Gaps = 22/495 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRV---------SPVKMLNEKNGSLSLSVNRRGGL  426
             MA  T  YF  SD+    GVL V+GGRV         S +K+   K+G  S S       
Sbjct  1     MATATFPYFTPSDSRS-MGVLNVLGGRVLMENPLGRFSCLKIYEGKSGFSSASQKS----  55

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
                  +CSA++ + +       YQ+KDPFLNLHPE+SMLRGEGN+T+  PR++S    V 
Sbjct  56    TMPSFRCSADARSIS------HYQNKDPFLNLHPEVSMLRGEGNNTVTNPRKDSSSGTVI  109

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ES  D S  +N+NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAM+MSPVFP
Sbjct  110   ESVGDMSGSSNYNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMKMSPVFP  169

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             +HRLQIG ELTRGLGAGGNP+IG NAAKESKE+IEEA+YG+DMVFVTAGMGGGTGTG AP
Sbjct  170   KHRLQIGLELTRGLGAGGNPEIGMNAAKESKESIEEALYGSDMVFVTAGMGGGTGTGGAP  229

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             VIAG AKSMGILTVGIVTTPFSFEGRRR VQAQEGIAALRENVDTLIVIPNDKLLTAVS 
Sbjct  230   VIAGVAKSMGILTVGIVTTPFSFEGRRRVVQAQEGIAALRENVDTLIVIPNDKLLTAVSS  289

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKT  1326
             STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVR IM +AGSSLMGIGTATGKT
Sbjct  290   STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRTIMANAGSSLMGIGTATGKT  349

Query  1327  RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  1506
             RARDAALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFG
Sbjct  350   RARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPAANLIFG  409

Query  1507  AVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEI  1683
             AVIDPSISGQVSITLIATGFKRQ E +++P QA+Q+A GD  +G NR   SF +GSSV++
Sbjct  410   AVIDPSISGQVSITLIATGFKRQEESEERPPQASQVAQGDTGLGTNRW-LSFGEGSSVDV  468

Query  1684  PEFLKKKGRSRYPRA  1728
             PEFLKKKGRSR+PRA
Sbjct  469   PEFLKKKGRSRHPRA  483



>ref|XP_010244904.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Nelumbo nucifera]
Length=483

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/488 (77%), Positives = 417/488 (85%), Gaps = 23/488 (5%)
 Frame = +1

Query  298   FMTSDTWCPRGVLTVIGGRV---------SPVKMLNEKNGSLSLSVNRRGGLNWSLLKCs  450
             F +SDT    GVL+V+GGRV         S +K+ + KNG    S  +R   N    +C 
Sbjct  8     FPSSDTRNSVGVLSVLGGRVPMKNRVGKISSLKVFDGKNGFFGHS--QRIASNLPHFRCL  65

Query  451   ansnnsanahsanQYQSKDPFLNLHPEISMLRG-EGNSTMMTPRQESGIENVTESSKDSS  627
             ANS+NS+       Y S+DPFL+LHPE+SMLRG EG+  + +PR+ES   NVTES  D  
Sbjct  66    ANSHNSS------PYNSRDPFLSLHPEVSMLRGGEGSDAVTSPRKESAGVNVTESLVDLP  119

Query  628   SVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIG  807
             + NN+NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFW+VNTD+QAMRMSPVFP++RLQIG
Sbjct  120   ASNNYNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWVVNTDVQAMRMSPVFPENRLQIG  179

Query  808   QELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaK  987
             +ELTRGLGAGGNPDIG NAAKESKEAIEEA+YG+DMVFVTAGMGGGTGTG APVIAG AK
Sbjct  180   KELTRGLGAGGNPDIGMNAAKESKEAIEEALYGSDMVFVTAGMGGGTGTGGAPVIAGIAK  239

Query  988   SMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEA  1167
             SMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR+NVDTLIVIPNDKLLTAVS STPVTEA
Sbjct  240   SMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDNVDTLIVIPNDKLLTAVSQSTPVTEA  299

Query  1168  FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAAL  1347
             FNLADDILRQGVRGISDIIT+PGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAAL
Sbjct  300   FNLADDILRQGVRGISDIITVPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAAL  359

Query  1348  NAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSI  1527
             NAIQSPLLDIGIERATGIVWNITGG DLTL+EVNAAAEVIYDLVDP+ANLIFGAVID S+
Sbjct  360   NAIQSPLLDIGIERATGIVWNITGGNDLTLYEVNAAAEVIYDLVDPTANLIFGAVIDQSL  419

Query  1528  SGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKK  1704
             SGQVSITLIATGFKRQ E + +PLQ +QL  GD    + RRP+SF +G SVEIPEFLKKK
Sbjct  420   SGQVSITLIATGFKRQDENEGRPLQGSQLGYGD----VGRRPSSFTEGESVEIPEFLKKK  475

Query  1705  GRSRYPRA  1728
             GRSRYPRA
Sbjct  476   GRSRYPRA  483



>ref|XP_008343377.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Malus domestica]
Length=432

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/413 (85%), Positives = 384/413 (93%), Gaps = 5/413 (1%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             YQ++DPFLNLHPE+S+LRGEGN  +  PR++     VTES  D SS +N  EAKIKV+GV
Sbjct  24    YQNRDPFLNLHPEVSLLRGEGNDRVNNPRKDISGGGVTESLSDKSSPSNNGEAKIKVIGV  83

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIES+MKGVEFWIVNTD+QAMRMSPVFP++RLQIGQELTRGLGAGGNPDI
Sbjct  84    GGGGSNAVNRMIESAMKGVEFWIVNTDVQAMRMSPVFPENRLQIGQELTRGLGAGGNPDI  143

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKESKE+IEEA+YG+DMVFVTAGMGGGTGTG AP++AG AKSMGILTVG+VTTPFS
Sbjct  144   GMNAAKESKESIEEALYGSDMVFVTAGMGGGTGTGGAPIVAGAAKSMGILTVGVVTTPFS  203

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGR+RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI
Sbjct  204   FEGRKRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  263

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA
Sbjct  264   SDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  323

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG DLTL+EVNAAAEVIYDLVDP+ANLIFGAV DPS+SGQVSITLIATGFKR
Sbjct  324   TGIVWNITGGADLTLYEVNAAAEVIYDLVDPTANLIFGAVTDPSLSGQVSITLIATGFKR  383

Query  1573  QEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPRA  1728
             QE ++ +PLQA     GD ++GINRRP+SFM+GS+VEIP+FLKKKGRSRYPRA
Sbjct  384   QEENEGRPLQAQ----GDVTLGINRRPSSFMEGSAVEIPDFLKKKGRSRYPRA  432



>ref|XP_011019895.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic 
[Populus euphratica]
 ref|XP_011019896.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic 
[Populus euphratica]
 ref|XP_011019897.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic 
[Populus euphratica]
Length=475

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/492 (74%), Positives = 409/492 (83%), Gaps = 24/492 (5%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA C   Y    D+  P G+L+V+G R+   ++  E +    L + R G L  +  K  +
Sbjct  1     MAACVSPYCTLGDSRKPTGMLSVVGARM---RVSTENH----LGMGRFGSLKMTESKSKS  53

Query  454   nsnnsanahsanQYQ---SKDPFLNLHPEISMLR---GEGNSTMMTPRQESGIENVTESS  615
             N+          QY    SKDPFLNLHPE+SMLR    EGN+ + T          T  +
Sbjct  54    NNLPQCIGKIPQQYHNSSSKDPFLNLHPEVSMLRVKGEEGNNKVTT----------TAPA  103

Query  616   KDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHR  795
             ++ SS +N NEA IKV+GVGGGGSNAVNRMIESSMKGVEFWIVNTD+QAM MSPVFP++R
Sbjct  104   RNGSSPSNGNEANIKVIGVGGGGSNAVNRMIESSMKGVEFWIVNTDVQAMSMSPVFPENR  163

Query  796   LQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapvia  975
             LQIGQ+LTRGLGAGGNP+IG NAAKESK+AIEEAVYGADMVFVTAGMGGGTGTG AP+I+
Sbjct  164   LQIGQDLTRGLGAGGNPEIGMNAAKESKQAIEEAVYGADMVFVTAGMGGGTGTGGAPIIS  223

Query  976   gtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTP  1155
             G AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR+NVDTLIVIPNDKLLTAVS +TP
Sbjct  224   GVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDNVDTLIVIPNDKLLTAVSQTTP  283

Query  1156  VTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRAR  1335
             VTEAFNLADDILRQGVRGISDIIT+PGLVNVDFADVRAIM +AGSSLMGIG ATGKTRAR
Sbjct  284   VTEAFNLADDILRQGVRGISDIITVPGLVNVDFADVRAIMANAGSSLMGIGIATGKTRAR  343

Query  1336  DAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVI  1515
             DAALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVI
Sbjct  344   DAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVI  403

Query  1516  DPSISGQVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEF  1692
             DPS+SGQVSITLIATGFKRQE ++ +P QA+QLAPG+ + GINRRP++  +G SVEIPEF
Sbjct  404   DPSLSGQVSITLIATGFKRQEENEGRPFQASQLAPGEVTSGINRRPSTVTEGGSVEIPEF  463

Query  1693  LKKKGRSRYPRA  1728
             LKKKGRSRYPRA
Sbjct  464   LKKKGRSRYPRA  475



>ref|XP_010271658.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010271659.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Nelumbo nucifera]
Length=487

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/496 (76%), Positives = 413/496 (83%), Gaps = 20/496 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVS---------PVKMLNEKNGSLSLSVNRRGGL  426
             MA   P  F + DT    GVL ++GGRVS          +KML+EK+G       +R   
Sbjct  1     MATHLPC-FTSVDTRNSVGVLAILGGRVSIENHKCKISSLKMLDEKSGIFGPI--QRIAS  57

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISM-LRGEGNSTMMTPRQESGIENV  603
             N    +C ANS+            SKDPFLNLHPE+S   RG+G+  +  PR+ES   +V
Sbjct  58    NMPHFRCLANSHIVNA------CHSKDPFLNLHPEVSTPRRGQGSDVVTNPRKESSGSSV  111

Query  604   TESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVF  783
             TES  D  + +N+NEAKIKV+GVGGGGSNAVNRMIESSMKGVEFWIVNTD+QAMR+SPVF
Sbjct  112   TESLGDLPASSNYNEAKIKVIGVGGGGSNAVNRMIESSMKGVEFWIVNTDVQAMRISPVF  171

Query  784   PQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaa  963
             P++RLQIGQELTRGLGAGGNPDIG NAAKESK+AIEEA+YGADMVFVTAGMGGGTGTG A
Sbjct  172   PENRLQIGQELTRGLGAGGNPDIGMNAAKESKDAIEEALYGADMVFVTAGMGGGTGTGGA  231

Query  964   pviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVS  1143
             PVIAG AKSMGILTVGIVTTPFSFEGRRR VQAQEGIA LR NVDTLIVIPNDKLLTAVS
Sbjct  232   PVIAGIAKSMGILTVGIVTTPFSFEGRRRTVQAQEGIATLRNNVDTLIVIPNDKLLTAVS  291

Query  1144  PSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGK  1323
             PSTPVTEAFNLADDILRQGVRGISDIIT+PGLVNVDFADV+AIM +AGSSLMGIGTATGK
Sbjct  292   PSTPVTEAFNLADDILRQGVRGISDIITVPGLVNVDFADVQAIMANAGSSLMGIGTATGK  351

Query  1324  TRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF  1503
             TRARDAALNAIQSPLLDIGIERATGIVWNITGG DLTL+EVNAAAEVIYDLVDPSANLIF
Sbjct  352   TRARDAALNAIQSPLLDIGIERATGIVWNITGGNDLTLYEVNAAAEVIYDLVDPSANLIF  411

Query  1504  GAVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVE  1680
             GAVIDPS+SGQVSITLIATGFKRQ E + +PLQ +QL  GD ++GIN RP+SF +G  VE
Sbjct  412   GAVIDPSLSGQVSITLIATGFKRQDEIEGRPLQGSQLGNGDVNLGINGRPSSFTEGGPVE  471

Query  1681  IPEFLKKKGRSRYPRA  1728
             IPEFL+KKGRSRYPRA
Sbjct  472   IPEFLRKKGRSRYPRA  487



>ref|XP_004149210.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004170577.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN59129.1| hypothetical protein Csa_3G776890 [Cucumis sativus]
Length=488

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/497 (74%), Positives = 408/497 (82%), Gaps = 21/497 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVS-----------PVKMLNEKNGSLSLSVNRRG  420
             MA CT  +F  SD   P GVL V+GGR+S            VKM  E +G + +      
Sbjct  1     MASCTSVHFALSDGRNPVGVLNVLGGRLSMSNDNSLGRFGCVKMQEEGSGFVGVGQK---  57

Query  421   GLNWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIEN  600
              L+    KC++ S++ +       Y ++DPFL LHPE+SMLRG+GN    +PRQ+S IE+
Sbjct  58    -LSLRKFKCASASHSHSVN----SYPNRDPFLELHPEVSMLRGDGNIMSGSPRQDSSIES  112

Query  601   VTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPV  780
              TES  D +S +N+ EAKIKV+GVGGGGSNA+NRMIESSMKGVEFW+VNTD+QA++MSPV
Sbjct  113   NTESLGDKTSPSNYGEAKIKVIGVGGGGSNAINRMIESSMKGVEFWVVNTDVQALKMSPV  172

Query  781   FPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtga  960
               ++ LQIG+ELTRGLGAGGNP+IG NAA ESKEAIE A+YGADMVFVTAGMGGGTGTG 
Sbjct  173   QSENCLQIGRELTRGLGAGGNPEIGMNAANESKEAIEGALYGADMVFVTAGMGGGTGTGG  232

Query  961   apviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAV  1140
              PVIA  AKSMGILTVGIVTTPFSFEGRRR VQAQEGIAALR+NVDTLIVIPNDKLLTAV
Sbjct  233   VPVIASIAKSMGILTVGIVTTPFSFEGRRRTVQAQEGIAALRDNVDTLIVIPNDKLLTAV  292

Query  1141  SPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATG  1320
             + ST VTEAFNLADDILRQGVRGISDII IPGLVNVDFADVRAIM +AGSSLMGIGTATG
Sbjct  293   TQSTAVTEAFNLADDILRQGVRGISDIIMIPGLVNVDFADVRAIMANAGSSLMGIGTATG  352

Query  1321  KTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLI  1500
             KTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLI
Sbjct  353   KTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLI  412

Query  1501  FGAVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSV  1677
             FGAVIDPSISGQVSITLIATGFKRQ E + +P Q +Q A G+ + GINR P SF DG  V
Sbjct  413   FGAVIDPSISGQVSITLIATGFKRQEESEGRPFQVSQQARGETTYGINRSP-SFADGGLV  471

Query  1678  EIPEFLKKKGRSRYPRA  1728
             EIPEFLKKKGRSRYPRA
Sbjct  472   EIPEFLKKKGRSRYPRA  488



>gb|KHG21600.1| Cell division FtsZ-1, chloroplastic -like protein [Gossypium 
arboreum]
Length=474

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/472 (79%), Positives = 403/472 (85%), Gaps = 9/472 (2%)
 Frame = +1

Query  322   PRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWS---LLKCsansnnsanahsanQ  492
             P GVL V+GGRV    +L    G LS      G + +S   L     +   S N+HS + 
Sbjct  9     PMGVLNVLGGRV----LLENPTGRLSCLKLCDGKIGFSRAGLRSIMPHLRCSTNSHSVSP  64

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             YQ+KD FLNLH E+ MLRGEGN+ +  PR+ES   +VTE   D +S NN NEAKIKV+GV
Sbjct  65    YQNKDRFLNLHHEVPMLRGEGNNMITNPRKESSSGSVTEFLGDMNSSNNNNEAKIKVIGV  124

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIES M+GVEFWIVNTD+QAM+MSPVFP+HRLQIGQELTRGLGAGGNP+I
Sbjct  125   GGGGSNAVNRMIESEMQGVEFWIVNTDVQAMKMSPVFPKHRLQIGQELTRGLGAGGNPEI  184

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKESKE+IEEA+YGADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGI TTPFS
Sbjct  185   GMNAAKESKESIEEALYGADMVFVTAGMGGGTGTGGAPVIAGLAKSMGILTVGIATTPFS  244

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRR VQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI
Sbjct  245   FEGRRRTVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  304

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIITIPGLVNVDFADVR IM +AGSSLMGIGTATGKTRARDAALNAIQSPLLD+GIERA
Sbjct  305   SDIITIPGLVNVDFADVRTIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDLGIERA  364

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS+SGQVSITLIATGFK 
Sbjct  365   TGIVWNITGGSDLTLFEVNAAAEVIYDLVDPAANLIFGAVIDPSLSGQVSITLIATGFKN  424

Query  1573  QEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPRA  1728
             QE  ++  QA QLA GD  +GINRRP SF +G SV+IPEFLKKKG SRYPRA
Sbjct  425   QEEGERS-QAGQLAQGDTGLGINRRP-SFNEGGSVDIPEFLKKKGHSRYPRA  474



>ref|XP_002308148.1| hypothetical protein POPTR_0006s08310g [Populus trichocarpa]
 gb|EEE91671.1| hypothetical protein POPTR_0006s08310g [Populus trichocarpa]
Length=479

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/504 (72%), Positives = 411/504 (82%), Gaps = 44/504 (9%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWS------  435
             MA C   Y    D+  P G+L+V+G R+   ++  E +    L + R G L  +      
Sbjct  1     MAACVSPYCTLGDSRKPMGMLSVVGARM---RVSTENH----LGMGRFGSLKMTESKSKS  53

Query  436   ------LLKCsansnnsanahsanQYQ---SKDPFLNLHPEISMLR---GEGNSTMMTPR  579
                   L +C +            QYQ   SKDPFLNLHPE+SMLR    EGN+ + T  
Sbjct  54    KSKSNNLPQCISKIPE--------QYQNSSSKDPFLNLHPEVSMLRVRGEEGNNKVTT--  103

Query  580   QESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQ  759
                     T  +++ SS +N NEA IKV+GVGGGGSNAVNRMIESSMKGVEFW+VNTD+Q
Sbjct  104   --------TAPARNGSSPSNHNEANIKVIGVGGGGSNAVNRMIESSMKGVEFWVVNTDVQ  155

Query  760   AMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmg  939
             +M MSPVFP++RLQIGQ+LTRGLGAGGNP+IG NAAKESK+AIEEAVYGADMVFVTAGMG
Sbjct  156   SMSMSPVFPENRLQIGQDLTRGLGAGGNPEIGMNAAKESKQAIEEAVYGADMVFVTAGMG  215

Query  940   ggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPN  1119
             GGTGTG AP+I+G AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR+NVDTLIVIPN
Sbjct  216   GGTGTGGAPIISGVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDNVDTLIVIPN  275

Query  1120  DKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLM  1299
             DKLLTAVS +TPVTEAFNLADDILRQGVRGISDIIT+PGLVNVDFADVRAIM +AGSSLM
Sbjct  276   DKLLTAVSQTTPVTEAFNLADDILRQGVRGISDIITVPGLVNVDFADVRAIMANAGSSLM  335

Query  1300  GIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLV  1479
             GIG ATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLV
Sbjct  336   GIGIATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLV  395

Query  1480  DPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPAS  1656
             DP+ANLIFGAVIDPS+SGQVSITLIATGFKRQE ++ +P QA+QLAPG+ + GINRRP++
Sbjct  396   DPTANLIFGAVIDPSLSGQVSITLIATGFKRQEENEGRPFQASQLAPGEVTSGINRRPST  455

Query  1657  FMDGSSVEIPEFLKKKGRSRYPRA  1728
             F +G SVEIPEFLKKKGRSRYPRA
Sbjct  456   FTEGGSVEIPEFLKKKGRSRYPRA  479



>ref|XP_009366668.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009366669.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=480

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/498 (76%), Positives = 418/498 (84%), Gaps = 32/498 (6%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGG---------RVSPVKMLNEKNGSLSLSVNRRGGL  426
             MA     Y   SDT  P GVLT +GG         RVS +K+  E      + VN    L
Sbjct  2     MATYASNYVTLSDTRNPVGVLTRLGGHFGTENHLGRVSSLKVPEEYG---FMGVN----L  54

Query  427   NWSLL--KCsansnnsanahsanQYQS-KDPFLNLHPEISMLRGEGNSTMMTPRQESGIE  597
               SLL  KCS NS +         YQ+ +DPFLNLHPE+S+LR EGN+T+  PR++   E
Sbjct  55    KSSLLHVKCSINSKSVG------SYQNNRDPFLNLHPEVSLLR-EGNNTLSNPRKDISGE  107

Query  598   NVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSP  777
              VTES  D SS +N  EAKIKV+GVGGGGSNAVNRMIES+MKGVEFWI+NTDIQAM+MSP
Sbjct  108   GVTESLSDKSSPSN-GEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWILNTDIQAMKMSP  166

Query  778   VFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtg  957
             VFP++RLQIGQELTRGLGAGGNPDIG NAAKESKE+IEEA+YG+DMVFVTAGMGGGTGTG
Sbjct  167   VFPENRLQIGQELTRGLGAGGNPDIGMNAAKESKESIEEALYGSDMVFVTAGMGGGTGTG  226

Query  958   aapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTA  1137
              AP++AG AKSMGILTVG+VTTPFSFEGR+RAVQAQEGIAALRENVDTLIVIPNDKLLTA
Sbjct  227   GAPIVAGVAKSMGILTVGVVTTPFSFEGRKRAVQAQEGIAALRENVDTLIVIPNDKLLTA  286

Query  1138  VSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTAT  1317
             VS STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTAT
Sbjct  287   VSQSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTAT  346

Query  1318  GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANL  1497
             GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTL+EVNAAAEVIYDLVDP+ANL
Sbjct  347   GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLYEVNAAAEVIYDLVDPTANL  406

Query  1498  IFGAVIDPSISGQVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSS  1674
             IFGAV DPS+SGQVSITLIATGFKRQE ++ + LQA     GD ++GINRRP+SFM+GS+
Sbjct  407   IFGAVTDPSLSGQVSITLIATGFKRQEENEGRTLQAQ----GDVTLGINRRPSSFMEGSA  462

Query  1675  VEIPEFLKKKGRSRYPRA  1728
             VEIP+FLKKKG SRYPRA
Sbjct  463   VEIPDFLKKKGGSRYPRA  480



>ref|XP_003521462.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Glycine max]
 gb|KHN18768.1| Cell division protein FtsZ like 2-1, chloroplastic [Glycine soja]
Length=475

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/488 (75%), Positives = 405/488 (83%), Gaps = 16/488 (3%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA C    +  S+     GVL V+GGR   +   +  N S  L +     +  S  KC +
Sbjct  1     MATC----YTPSNVRNSPGVLAVVGGRT--ISENHVGNRSCFLRIQESKTVFGSNRKCGS  54

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIE--NVTESSKDSS  627
                  +          KDPFL+LHPE+SMLRGEG S + +PR    +   NV ES + ++
Sbjct  55    FQVKCSA------ISRKDPFLDLHPEVSMLRGEGGSALNSPRPRKDVSGGNVAESLEATT  108

Query  628   SVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIG  807
             + +N+NEAKIKV+GVGGGGSNAVNRMIESSM GVEFWIVNTD+QAMRMSPV P +RLQIG
Sbjct  109   TPSNYNEAKIKVIGVGGGGSNAVNRMIESSMNGVEFWIVNTDVQAMRMSPVIPHNRLQIG  168

Query  808   QELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaK  987
             QELTRGLGAGGNP+IG NAAKESKE+I+EAVYGADMVFVTAGMGGGTGTG APVIAG  K
Sbjct  169   QELTRGLGAGGNPEIGMNAAKESKESIQEAVYGADMVFVTAGMGGGTGTGGAPVIAGITK  228

Query  988   SMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEA  1167
             SMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR+NVDTLIVIPNDKLLTAVS STPVTEA
Sbjct  229   SMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDNVDTLIVIPNDKLLTAVSQSTPVTEA  288

Query  1168  FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAAL  1347
             FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAAL
Sbjct  289   FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAAL  348

Query  1348  NAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSI  1527
             NAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS+
Sbjct  349   NAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSL  408

Query  1528  SGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKK  1704
             SGQVSITLIATGFKRQ E + +P+QA+Q   GD ++GINRR +SF DGS VEIPEFLKKK
Sbjct  409   SGQVSITLIATGFKRQEESEGRPIQASQFTQGD-TVGINRRSSSFTDGSFVEIPEFLKKK  467

Query  1705  GRSRYPRA  1728
             GRSRYPRA
Sbjct  468   GRSRYPRA  475



>ref|XP_008462572.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Cucumis melo]
Length=479

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/481 (75%), Positives = 420/481 (87%), Gaps = 22/481 (5%)
 Frame = +1

Query  313   TWCPRGVLTVIGGRVSP--------VKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnns  468
             T  P G+L+ +GGRVS         +KM  ++NG +   +N++  L          + +S
Sbjct  12    TRNPVGMLSALGGRVSMEHHSGKSFMKMPEDRNGFVG--INQKSNL----------AKSS  59

Query  469   anahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNE  648
             +N+HS + YQ++D F++LHPEIS+LRGEG++++ +PR+E+ +  +T  + + +S +N+NE
Sbjct  60    SNSHSVSPYQNRDSFMDLHPEISLLRGEGSNSVNSPRKEN-LGGITSENLEDASSSNYNE  118

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A+IKV+GVGGGGSNAVNRMIESSM+GVEFWIVNTD+QAM+MSPV+P++RLQIG+ELTRGL
Sbjct  119   ARIKVIGVGGGGSNAVNRMIESSMQGVEFWIVNTDVQAMKMSPVYPENRLQIGRELTRGL  178

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP+IG +AA ESKEAIEEA+YG+DMVFVT+GMGGGTGTG APVIAG AKSMGILTV
Sbjct  179   GAGGNPEIGMSAANESKEAIEEALYGSDMVFVTSGMGGGTGTGGAPVIAGIAKSMGILTV  238

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             GIVTTPFSFEGRRRAVQAQEGIA LR+ VDTLIVIPNDKLLTAVS STPVTEAFNLADDI
Sbjct  239   GIVTTPFSFEGRRRAVQAQEGIANLRDKVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDI  298

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPL
Sbjct  299   LRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPL  358

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             LDIGIERATGIVWNITGG+DLTL+EVNAAAEVIYDLVDP+ANLIFGAVIDPS+SGQVSIT
Sbjct  359   LDIGIERATGIVWNITGGSDLTLYEVNAAAEVIYDLVDPTANLIFGAVIDPSLSGQVSIT  418

Query  1549  LIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             LIATGFKRQ E + +PLQA+QL+ GD + GINRRP+S  +GSS EIPEFLKKKGRSRYPR
Sbjct  419   LIATGFKRQEESEGRPLQASQLSQGDNNFGINRRPSSLTEGSSFEIPEFLKKKGRSRYPR  478

Query  1726  A  1728
             A
Sbjct  479   A  479



>ref|XP_004143321.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004163312.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48262.1| hypothetical protein Csa_6G452630 [Cucumis sativus]
Length=479

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/481 (75%), Positives = 419/481 (87%), Gaps = 22/481 (5%)
 Frame = +1

Query  313   TWCPRGVLTVIGGRVS--------PVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnns  468
             T  P G+L+ +GGRVS         +KM  ++NG +   +N++  L          + +S
Sbjct  12    TRNPVGMLSALGGRVSMEHHSGKSYMKMPEDRNGFVG--INQKSNL----------AKSS  59

Query  469   anahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNE  648
             +N+HS + YQ++D FL+LHPEISMLRGEG++++ +PR+E+ +  +T  + + +S +N+NE
Sbjct  60    SNSHSVSPYQNRDSFLDLHPEISMLRGEGSNSVNSPRKEN-LGGITSENLEDASSSNYNE  118

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A+IKV+GVGGGGSNAVNRMIESSM+GVEFWIVNTD+QAM+MSPV+P++RLQIGQELTRGL
Sbjct  119   ARIKVIGVGGGGSNAVNRMIESSMQGVEFWIVNTDVQAMKMSPVYPENRLQIGQELTRGL  178

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP+IG +AA ESKEAIEEA+YG+DMVFVT+GMGGGTGTG APVIAG AKSMGILTV
Sbjct  179   GAGGNPEIGMSAANESKEAIEEALYGSDMVFVTSGMGGGTGTGGAPVIAGIAKSMGILTV  238

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             GIVTTPFSFEGRRRAVQAQEGIA LR+ VDTLIVIPNDKLLTAVS STPVTEAFNLADDI
Sbjct  239   GIVTTPFSFEGRRRAVQAQEGIANLRDKVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDI  298

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPL
Sbjct  299   LRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPL  358

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             LDIGIERATGIVWNITGG+DLTL+EVNAAAEVIYDLVDP+ANLIFGAVIDPS+SGQVSIT
Sbjct  359   LDIGIERATGIVWNITGGSDLTLYEVNAAAEVIYDLVDPTANLIFGAVIDPSLSGQVSIT  418

Query  1549  LIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             LIATGFKRQ E + +PLQA+QL+ GD + GINRRP+S  + SS EIPEFLKKKGRSRYPR
Sbjct  419   LIATGFKRQEESEGRPLQASQLSQGDNNFGINRRPSSLNEVSSFEIPEFLKKKGRSRYPR  478

Query  1726  A  1728
             A
Sbjct  479   A  479



>gb|KEH42026.1| cell division FtsZ-like protein [Medicago truncatula]
Length=484

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/493 (75%), Positives = 414/493 (84%), Gaps = 19/493 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSP-----VKMLNEKNGSLSLSVNRRGGLNWSL  438
             M  C  T F  S+     GV  V+ GR  P     +K+ + K G L     R+  L+   
Sbjct  1     MVTCVSTNFAHSNAINSAGVFNVVRGREFPRRVNFMKIFDRKIGFLG--SERK--LSLVQ  56

Query  439   LKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGI--ENVTES  612
             +KCS+NSNN +       Y S DPFL+LHPE+SMLRGE +ST+  PR+ S    E+++ES
Sbjct  57    VKCSSNSNNGS------SYHSHDPFLHLHPEVSMLRGEVSSTVNIPRKGSSSLGEDLSES  110

Query  613   SKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQH  792
               D SS +N+N+AKIKV+GVGGGGSNAVNRMIESSM GVEFWIVNTD+QAMRMSPVFP++
Sbjct  111   LGDISSESNYNQAKIKVIGVGGGGSNAVNRMIESSMHGVEFWIVNTDVQAMRMSPVFPEN  170

Query  793   RLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapvi  972
             RLQIG ELTRGLGAGGNP+ G NAAKES+E+IEEAVYGADMVFVTAGMGGGTGTG AP+I
Sbjct  171   RLQIGLELTRGLGAGGNPETGMNAAKESRESIEEAVYGADMVFVTAGMGGGTGTGGAPII  230

Query  973   agtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPST  1152
             AG AKSMGILTVGIVTTPFSFEGR+R++QAQEGI ALR+NVDTLIVIPNDKLLTAVS ST
Sbjct  231   AGVAKSMGILTVGIVTTPFSFEGRKRSIQAQEGITALRDNVDTLIVIPNDKLLTAVSQST  290

Query  1153  PVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRA  1332
             PVTEAFNLADDILRQGVRGISDIITIPG+VNVDFADVRAIM +AGSSLMGIGTATGKTRA
Sbjct  291   PVTEAFNLADDILRQGVRGISDIITIPGMVNVDFADVRAIMANAGSSLMGIGTATGKTRA  350

Query  1333  RDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAV  1512
             RDAALNAIQSPLLDIGIERATGIVWNITGG+DLTL+EVNAAAEVIYDLVDPSANLIFGAV
Sbjct  351   RDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLYEVNAAAEVIYDLVDPSANLIFGAV  410

Query  1513  IDPSISGQVSITLIATGFKRQEGD-DKPLQANQLAPGDASIGINRRPASFM-DGSSVEIP  1686
             IDPS++GQVSITLIATGFKRQE D +KPLQ +QL  GD +I  NRRP+SF  DGS  EIP
Sbjct  411   IDPSLTGQVSITLIATGFKRQEEDEEKPLQTSQLTQGDTTINFNRRPSSFSDDGSLFEIP  470

Query  1687  EFLKKKGRSRYPR  1725
             +FLKKKGRSRYPR
Sbjct  471   DFLKKKGRSRYPR  483



>ref|XP_003554434.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Glycine max]
 gb|KHN02227.1| Cell division protein FtsZ like 2-1, chloroplastic [Glycine soja]
Length=478

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/489 (75%), Positives = 406/489 (83%), Gaps = 17/489 (3%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNG--SLSLSVNRRGGLNWSLLKC  447
             MA C    +  S+     GVL V+GGR      ++E +G  S  L +     +  S  KC
Sbjct  1     MATC----YTPSNVRNSAGVLAVVGGRT-----ISENHGIRSCFLRIQESKTVFGSNRKC  51

Query  448   sansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIE--NVTESSKD  621
              +     +          KDPFL+LHPE+SMLRGEG S + +PR    +   NV ES + 
Sbjct  52    GSFPVKCSANSH--SISRKDPFLDLHPEVSMLRGEGGSALNSPRPRKDVSGGNVAESLEA  109

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             +++ +N++EAKIKV+GVGGGGSNAVNRMIESSM GVEFWIVNTD+QAMRMSPV P +RLQ
Sbjct  110   TTAPSNYSEAKIKVIGVGGGGSNAVNRMIESSMNGVEFWIVNTDVQAMRMSPVIPPNRLQ  169

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             IGQELTRGLGAGGNP+IG NAAKESKE+I+EAVYGADMVFVTAGMGGGTGTG APVIAG 
Sbjct  170   IGQELTRGLGAGGNPEIGMNAAKESKESIQEAVYGADMVFVTAGMGGGTGTGGAPVIAGI  229

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
              KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR+NVDTLIVIPNDKLLTAVS STPVT
Sbjct  230   TKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDNVDTLIVIPNDKLLTAVSQSTPVT  289

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDA
Sbjct  290   EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDA  349

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             ALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVN AAEVIYDLVDP+ANLIFGAVIDP
Sbjct  350   ALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNVAAEVIYDLVDPTANLIFGAVIDP  409

Query  1522  SISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLK  1698
             S+SGQVSITLIATGFKRQ E + +P+QA+QL  GD ++GINRR ++F DGS VEIPEFLK
Sbjct  410   SLSGQVSITLIATGFKRQEESEGRPMQASQLTQGD-TVGINRRSSTFTDGSFVEIPEFLK  468

Query  1699  KKGRSRYPR  1725
             KKGRSRYPR
Sbjct  469   KKGRSRYPR  477



>ref|XP_007145302.1| hypothetical protein PHAVU_007G227600g [Phaseolus vulgaris]
 gb|ESW17296.1| hypothetical protein PHAVU_007G227600g [Phaseolus vulgaris]
Length=484

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/497 (73%), Positives = 413/497 (83%), Gaps = 25/497 (5%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIG--------GRVSPVKMLNEKNGSLSLSVNRRGGLN  429
             MA C  T    S+T     V TV G        GR   +KM + +NG         GG+ 
Sbjct  1     MATCVSTIVAPSNTRNSARVFTVGGRNLRGNYPGRARYLKMYDRRNGF-------SGGIQ  53

Query  430   WSLL---KCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIEN  600
              S L   KCSANS+  +       Y S+ PFL+LHPE+SMLRGEG+ST+ +PR++S  E+
Sbjct  54    MSGLLEVKCSANSHGVS------PYNSQGPFLDLHPEVSMLRGEGSSTLNSPRKDSSRED  107

Query  601   VTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPV  780
             ++ES    S  +++NEAKIKV+GVGGGGSNAVNRMI+SSM GVEFWIVNTD+QA+RMSPV
Sbjct  108   LSESLGPVSIQSDYNEAKIKVIGVGGGGSNAVNRMIQSSMHGVEFWIVNTDVQAIRMSPV  167

Query  781   FPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtga  960
             +P++RLQIGQELTRGLGAGGNP+ G NAAKES+E+IEEAVYGADMVFVTAGMGGGTGTG 
Sbjct  168   YPENRLQIGQELTRGLGAGGNPETGMNAAKESRESIEEAVYGADMVFVTAGMGGGTGTGG  227

Query  961   apviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAV  1140
             AP+IAG AKSMG+LTVGIVTTPFSFEGR+RA+QAQEGI ALR+NVDTLIVIPNDKLLTAV
Sbjct  228   APIIAGIAKSMGVLTVGIVTTPFSFEGRKRAIQAQEGITALRDNVDTLIVIPNDKLLTAV  287

Query  1141  SPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATG  1320
             S STPV+EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATG
Sbjct  288   SQSTPVSEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATG  347

Query  1321  KTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLI  1500
             K+RARDAALNA+QSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLI
Sbjct  348   KSRARDAALNAVQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPTANLI  407

Query  1501  FGAVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSV  1677
             FGAVIDPS++GQVSITLIATGFKRQ E + +PLQA QL   D++ GINRR +SF DG   
Sbjct  408   FGAVIDPSLTGQVSITLIATGFKRQEESEGRPLQATQLNQADSNFGINRRSSSFSDGGLF  467

Query  1678  EIPEFLKKKGRSRYPRA  1728
             EIPEFLKKKG SRYPRA
Sbjct  468   EIPEFLKKKGGSRYPRA  484



>ref|XP_007162898.1| hypothetical protein PHAVU_001G189700g [Phaseolus vulgaris]
 gb|ESW34892.1| hypothetical protein PHAVU_001G189700g [Phaseolus vulgaris]
Length=478

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/484 (75%), Positives = 402/484 (83%), Gaps = 13/484 (3%)
 Frame = +1

Query  292   TYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNG--SLSLSVNRRGGLNWSLLKCsansnn  465
             T +  S+     GVL V+GGR      ++E +G  S SL +     +  S  KC +    
Sbjct  3     TCYAPSNARNSAGVLAVVGGRT-----ISENHGGRSCSLKIQESKYVFGSSRKCGSIQVK  57

Query  466   sanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIEN--VTESSKDSSSVNN  639
              +          KDPFL+LHPE+SMLRGEG S +  PR    + +  V ES + + + +N
Sbjct  58    CSTNSH--SISRKDPFLDLHPEVSMLRGEGGSALNNPRPRKDVSSGKVAESFEATMNPSN  115

Query  640   FNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELT  819
             +NEAKIKV+GVGGGGSNAVNRMIESSM GVEFWIVNTD+QAMRMSPV PQ+RLQIG+ELT
Sbjct  116   YNEAKIKVIGVGGGGSNAVNRMIESSMNGVEFWIVNTDVQAMRMSPVIPQNRLQIGEELT  175

Query  820   RGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGI  999
             RGLGAGGNP+IG NAAKES+E+I+EAVYG+DMVFVTAGMGGGTGTG APVIAG  KSMGI
Sbjct  176   RGLGAGGNPEIGMNAAKESEESIQEAVYGSDMVFVTAGMGGGTGTGGAPVIAGITKSMGI  235

Query  1000  LTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLA  1179
             LTVGIVTTPFSFEGRRRAVQAQEGIAALR+NVDTLIVIPNDKLLTAVS STPVTEAFNLA
Sbjct  236   LTVGIVTTPFSFEGRRRAVQAQEGIAALRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLA  295

Query  1180  DDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQ  1359
             DDILR GVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQ
Sbjct  296   DDILRHGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQ  355

Query  1360  SPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQV  1539
             SPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS+SGQV
Sbjct  356   SPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSLSGQV  415

Query  1540  SITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSR  1716
             SITLIATGFKRQ E + +P Q +QL  G+ +IGINRR +SF DG  VEIPEFLKKKGRSR
Sbjct  416   SITLIATGFKRQEESEGRPTQGSQLMQGE-TIGINRRSSSFTDGGFVEIPEFLKKKGRSR  474

Query  1717  YPRA  1728
             YPRA
Sbjct  475   YPRA  478



>ref|XP_010527321.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=484

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/415 (83%), Positives = 382/415 (92%), Gaps = 4/415 (1%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRG-EGNS-TMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvv  666
             +QS+DPFLNLHPEISMLRG EGN+  ++ PR+E+    +TE+  +SS+ ++ NEA+IKV+
Sbjct  69    FQSQDPFLNLHPEISMLRGGEGNNDVVINPRKETSTGPITENFGESSTTSSNNEARIKVI  128

Query  667   gvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNP  846
             G+GGGGSNAVNRMIES MKGVEFWIVNTDIQAMRMSPVFP++RL IG+ELTRGLGAGGNP
Sbjct  129   GIGGGGSNAVNRMIESEMKGVEFWIVNTDIQAMRMSPVFPENRLPIGKELTRGLGAGGNP  188

Query  847   DIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTP  1026
             +IG NAAKESKE+IEEA+ G+DMVF+TAGMGGGTGTG AP+IA  AK MGILTVGIVTTP
Sbjct  189   EIGMNAAKESKESIEEALCGSDMVFITAGMGGGTGTGGAPIIAEIAKEMGILTVGIVTTP  248

Query  1027  FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVR  1206
             FSFEGRRRA+QAQEGIA+LR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVR
Sbjct  249   FSFEGRRRALQAQEGIASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVR  308

Query  1207  GISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  1386
             GISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK RARDAALNAIQSPLLDIGIE
Sbjct  309   GISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKARARDAALNAIQSPLLDIGIE  368

Query  1387  RATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF  1566
             RATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS++GQVSITLIATGF
Sbjct  369   RATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSLTGQVSITLIATGF  428

Query  1567  KRQEGDD-KPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             KRQE  + +PLQ NQLA G+ S G+ RRP +SF +GSSVEIPEFLKKKGRSRYPR
Sbjct  429   KRQEQTEGRPLQGNQLAQGEVSRGVTRRPSSSFTEGSSVEIPEFLKKKGRSRYPR  483



>ref|XP_004494033.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Cicer arietinum]
Length=484

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/496 (74%), Positives = 412/496 (83%), Gaps = 25/496 (5%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGR---------VSPVKMLNEKNGSLSLSVNRRGGL  426
             M  C  T F  S+     GVL V+ GR         VS +K  +  NG L   V + G +
Sbjct  1     MVTCVSTNFAHSNAL---GVLNVVRGRTLIESFPKRVSFMKKFDSNNGFLG-GVRKLGLV  56

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
              +   KC A+SNN +       Y S+D FL+LHPEISMLRGE +  +  PR +S  E+++
Sbjct  57    QF---KCLASSNNVS------SYHSQDSFLHLHPEISMLRGESSGIVNIPRNDSLGEDLS  107

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ES   +SS +++N+AKIKV+GVGGGGSNAVNRMIESSM GVEFWIVNTD+QAMRMSPVFP
Sbjct  108   ESLGVTSSESSYNQAKIKVIGVGGGGSNAVNRMIESSMNGVEFWIVNTDVQAMRMSPVFP  167

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             ++RLQIG ELTRGLGAGGNP  G NAAKES+E+IEEAVYGADMVFVTAGMGGGTGTG AP
Sbjct  168   ENRLQIGLELTRGLGAGGNPKTGMNAAKESRESIEEAVYGADMVFVTAGMGGGTGTGGAP  227

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             +IAG AKSMGILTVGIVTTPFSFEGR+RA+QAQEGI ALR+NVDTLIVIPNDKLLTAVS 
Sbjct  228   IIAGVAKSMGILTVGIVTTPFSFEGRKRAIQAQEGITALRDNVDTLIVIPNDKLLTAVSQ  287

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKT  1326
             STPVTEAFNLADDILRQGVRGISDI+TIPGLVNVDFADVRAIM +AGSSLMGIGTATGKT
Sbjct  288   STPVTEAFNLADDILRQGVRGISDIVTIPGLVNVDFADVRAIMANAGSSLMGIGTATGKT  347

Query  1327  RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  1506
             RARDAALNAIQSPLLD GIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDPSANLIFG
Sbjct  348   RARDAALNAIQSPLLDTGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPSANLIFG  407

Query  1507  AVIDPSISGQVSITLIATGFKRQEGDDK--PLQANQLAPGDASIGINRRPASFMDGSSV-  1677
             AVIDPS++ QVSITLIATGFK QE +++  PLQANQLA GD ++G N RP+SF+D +S+ 
Sbjct  408   AVIDPSLTDQVSITLIATGFKCQEENEERSPLQANQLAQGDTAVGFNGRPSSFLDDASLF  467

Query  1678  EIPEFLKKKGRSRYPR  1725
             EIPEFLKKKGRSRYPR
Sbjct  468   EIPEFLKKKGRSRYPR  483



>ref|XP_010905974.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010905975.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010905976.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010905977.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010905978.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010905979.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010905980.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010905981.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010905982.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010905983.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=487

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/484 (75%), Positives = 406/484 (84%), Gaps = 19/484 (4%)
 Frame = +1

Query  310   DTWCPRGVLTVIG---------GRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansn  462
             D  CP GV  ++G         GR S   + NE+NG     V+ +  ++ S ++CSA SN
Sbjct  12    DGRCPGGVSAILGRRSLTVDWSGRCSSFNIWNERNG---FYVSGQRAVSCSRVRCSAKSN  68

Query  463   nsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNF  642
             + +       Y +KDPFL+LHPE+SMLRGE    +M  +++    NVTES ++SS  +N+
Sbjct  69    SHSIG----SYHNKDPFLHLHPEVSMLRGEATDMIMDSKKDKLGSNVTESLRESSLPDNY  124

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             NEAKIKV+GVGGGGSNAVNRMIESSMKGVEFWIVNTD+QAMRMSPV+P++RLQIGQELTR
Sbjct  125   NEAKIKVIGVGGGGSNAVNRMIESSMKGVEFWIVNTDVQAMRMSPVYPENRLQIGQELTR  184

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNPDIG NAA+ESKE+IEEAV GADMVFVTAGMGGGTGTG APVIAG AKSMGIL
Sbjct  185   GLGAGGNPDIGMNAARESKESIEEAVSGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGIL  244

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVGIVTTPFSFEGR+RAVQAQEGIAALR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLAD
Sbjct  245   TVGIVTTPFSFEGRKRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVSPNTPVTEAFNLAD  304

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             DILRQGVRGISDII +PGLVNVDFADVRAIM  AGSSLMGIGTATGKTRARDAALNAIQS
Sbjct  305   DILRQGVRGISDIIMVPGLVNVDFADVRAIMADAGSSLMGIGTATGKTRARDAALNAIQS  364

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             PLLDIGIERATGIVWNITGG DLTL+EVNAAAEVIYDLVDP ANLIFGAVID S+SGQVS
Sbjct  365   PLLDIGIERATGIVWNITGGNDLTLYEVNAAAEVIYDLVDPGANLIFGAVIDQSLSGQVS  424

Query  1543  ITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFM-DGSSVEIPEFLKKKGRSR  1716
             ITLIATGFKRQ E + +  Q   L  GD  IGINRRP+S + +GS VEIPEFL+KKGRSR
Sbjct  425   ITLIATGFKRQEETEGRSFQGAHLG-GDNLIGINRRPSSSLSEGSMVEIPEFLRKKGRSR  483

Query  1717  YPRA  1728
             YP+A
Sbjct  484   YPKA  487



>ref|XP_006855018.1| hypothetical protein AMTR_s00031p00027380 [Amborella trichopoda]
 gb|ERN16485.1| hypothetical protein AMTR_s00031p00027380 [Amborella trichopoda]
Length=449

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/415 (84%), Positives = 377/415 (91%), Gaps = 4/415 (1%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             Y SKDPFLNLHPE+SMLRGE    ++ P++E+    + E  +D S  NN+NEAKIKV+GV
Sbjct  36    YHSKDPFLNLHPEVSMLRGETGDKVINPKKENSTV-LNEPLRDGSRSNNYNEAKIKVIGV  94

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIESSMKGVEFWIVNTD+QAM+MSPV+P++RLQIGQELTRGLGAGGNPDI
Sbjct  95    GGGGSNAVNRMIESSMKGVEFWIVNTDVQAMKMSPVYPENRLQIGQELTRGLGAGGNPDI  154

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKESKE+IEEAVYG+DMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFS
Sbjct  155   GMNAAKESKESIEEAVYGSDMVFVTAGMGGGTGTGGAPVIAGVAKSMGILTVGIVTTPFS  214

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRAVQAQEGIAALR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGI
Sbjct  215   FEGRRRAVQAQEGIAALRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRGI  274

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA
Sbjct  275   SDIITVPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  334

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG DLTL+EVNAAAEVIYDLVDPSANLIFGAVID S+SGQVSITLIATGFKR
Sbjct  335   TGIVWNITGGNDLTLYEVNAAAEVIYDLVDPSANLIFGAVIDQSLSGQVSITLIATGFKR  394

Query  1573  Q-EGDDKPLQAN-QLAPGDASIGINRRPASFM-DGSSVEIPEFLKKKGRSRYPRA  1728
             Q E + +P+QA      GD ++GINRRP+S + D  S EIPEFLKKKGRSRYPRA
Sbjct  395   QDEAEGRPMQATLPQTHGDVNLGINRRPSSTLSDTGSFEIPEFLKKKGRSRYPRA  449



>ref|XP_006594215.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X2 [Glycine max]
 ref|XP_003541462.2| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN14997.1| Cell division protein FtsZ like 2-1, chloroplastic [Glycine soja]
Length=486

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/495 (74%), Positives = 409/495 (83%), Gaps = 19/495 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIG--------GRVSPVKMLNEKNGSLSLSVNRRGGLN  429
             MA C  T F  S+T     VL+V G        GR    KM + +NG  S  +   G L 
Sbjct  1     MATCVSTIFAPSNTRNSARVLSVGGTNLTWNYPGRACFTKMYDRRNG-FSGGIQMSGLLQ  59

Query  430   WSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTE  609
                +KCSANS++ +  +      S+ PFL+LHPE+SMLRGE +ST+ +PR++S   +++E
Sbjct  60    ---VKCSANSHSVSPYN-----NSQGPFLDLHPEVSMLRGEASSTVNSPRKDSSGGDLSE  111

Query  610   SSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQ  789
             S   +SS +++NEAKIKV+GVGGGGSNAVNRMIES M GVEFWIVNTD+QAMRMSPV+P+
Sbjct  112   SLGTTSSQSDYNEAKIKVIGVGGGGSNAVNRMIESEMHGVEFWIVNTDVQAMRMSPVYPE  171

Query  790   HRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapv  969
             +RLQIGQELTRGLGAGGNP+ G NAAKESKE+IEEAVYGADMVFVTAGMGGGTGTG AP+
Sbjct  172   NRLQIGQELTRGLGAGGNPETGMNAAKESKESIEEAVYGADMVFVTAGMGGGTGTGGAPI  231

Query  970   iagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPS  1149
             IA  AKSMGILTVGIVTTPFSFEGR+RA+QAQEGI ALR+NVDTLIVIPNDKLLTAVS S
Sbjct  232   IASIAKSMGILTVGIVTTPFSFEGRKRAIQAQEGITALRDNVDTLIVIPNDKLLTAVSQS  291

Query  1150  TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTR  1329
             TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK+R
Sbjct  292   TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSR  351

Query  1330  ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGA  1509
             ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVN AAEVIYDLVDP+ANLIFGA
Sbjct  352   ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPTANLIFGA  411

Query  1510  VIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIP  1686
             VIDPS+SGQVSITLIATGFKRQ E   +PLQ +QL   D + G NRR +SF DG   EIP
Sbjct  412   VIDPSLSGQVSITLIATGFKRQEESQGRPLQVSQLTQADTTYGTNRRSSSFADGGLFEIP  471

Query  1687  EFLKKK-GRSRYPRA  1728
             EFLKKK G SRYPRA
Sbjct  472   EFLKKKGGGSRYPRA  486



>ref|XP_011007122.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=480

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/489 (74%), Positives = 403/489 (82%), Gaps = 15/489 (3%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIG---GRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLK  444
             MA C    F  S T    G         GR+  V+  ++K GS      RR   + S ++
Sbjct  1     MATCVSPPFTPSGTQISVGRRISTENRFGRIVTVQRFDKKKGSWGAC--RRNVFSISQIR  58

Query  445   CsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDS  624
             CS NS+N +          KD FL+LHPE+SMLR + N T  T R+E+  +NVTESS D+
Sbjct  59    CSVNSHNISP-------NHKDSFLDLHPEVSMLRSDANDTYSTLRKETSGKNVTESSGDT  111

Query  625   SSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQI  804
             S ++N+NEAKIKVVGVGGGGSNAVNRMIESS+ GVEFWIVNTDIQAM+MSPV P++RLQ+
Sbjct  112   SFMSNYNEAKIKVVGVGGGGSNAVNRMIESSLTGVEFWIVNTDIQAMKMSPVLPENRLQV  171

Query  805   GQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagta  984
             G+ELTRGLGAGGNPDIG NAA ESK AIEEA+YGADMVF+TAGMGGGTGTGAAPVIAG A
Sbjct  172   GKELTRGLGAGGNPDIGMNAANESKAAIEEALYGADMVFITAGMGGGTGTGAAPVIAGVA  231

Query  985   KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTE  1164
             KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR NVDTLIVIPNDKLLTAVS STPVTE
Sbjct  232   KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVSQSTPVTE  291

Query  1165  AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAA  1344
             AFNLADDILRQGVRGISDII +PGLVNVDFADVRAIM+ AGSSL+GIGTATGKTRARDAA
Sbjct  292   AFNLADDILRQGVRGISDIIMVPGLVNVDFADVRAIMKDAGSSLLGIGTATGKTRARDAA  351

Query  1345  LNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPS  1524
             LNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS
Sbjct  352   LNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPS  411

Query  1525  ISGQVSITLIATGF-KRQEGDDK-PLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLK  1698
             +SGQVSITLIATGF +R EG+ +  +Q  Q A GD S+G NRRP  + DG SVEIPEFL+
Sbjct  412   LSGQVSITLIATGFNRRDEGEGQAKMQGTQRAHGDVSLGTNRRPP-YTDGGSVEIPEFLR  470

Query  1699  KKGRSRYPR  1725
             KKGRS +PR
Sbjct  471   KKGRSLFPR  479



>ref|XP_010059812.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW90555.1| hypothetical protein EUGRSUZ_A02664 [Eucalyptus grandis]
Length=483

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/491 (75%), Positives = 414/491 (84%), Gaps = 14/491 (3%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRV-SPVKMLNEKNGSLSLSVNRRGGLNWSLLKCs  450
             M+ C  T    S     +GVL + GGRV    +    K+G +  + N   G N  +    
Sbjct  1     MSTCLSTNLAPSVGGNRKGVLNLRGGRVLVENRWFEVKSGKMIGTKNNFLGAN--MRSVL  58

Query  451   ansnnsanahsanQYQSKDPFLNLHPEISMLRG---EGNSTMMTPRQESGIE-NVTESSK  618
                  S N+HS + YQSKDPFLN HPE++MLRG   EGN+T    +Q  G+  NV ES +
Sbjct  59    PQIMCSTNSHSVSTYQSKDPFLNSHPEVAMLRGNKGEGNNT--ANKQNDGLGGNVVESLR  116

Query  619   DSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRL  798
             D+S+ +N +EAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTDIQAMRMSPVFP +RL
Sbjct  117   DTSNQSNHSEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDIQAMRMSPVFPDNRL  176

Query  799   QIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviag  978
             QIGQELTRGLGAGGNP+IG NAAKESKEAIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG
Sbjct  177   QIGQELTRGLGAGGNPEIGMNAAKESKEAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAG  236

Query  979   taKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPV  1158
              AKSMGILTVGIVTTPFSFEGR+R VQAQEGIA+LR+NVDTLIVIPNDKLLTAVSPSTPV
Sbjct  237   VAKSMGILTVGIVTTPFSFEGRKRTVQAQEGIASLRDNVDTLIVIPNDKLLTAVSPSTPV  296

Query  1159  TEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARD  1338
             TEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARD
Sbjct  297   TEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARD  356

Query  1339  AALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVID  1518
             AALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVID
Sbjct  357   AALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVID  416

Query  1519  PSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFL  1695
             PS+SGQVSITLIATGFKRQ E + + LQ+ Q+  GD   G+NRRP+S+ +G+SVEIPEFL
Sbjct  417   PSLSGQVSITLIATGFKRQEESEGRSLQSGQIQ-GD---GLNRRPSSYGEGTSVEIPEFL  472

Query  1696  KKKGRSRYPRA  1728
             KKKGRSR+PRA
Sbjct  473   KKKGRSRFPRA  483



>ref|XP_004494173.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Cicer arietinum]
Length=495

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/499 (74%), Positives = 411/499 (82%), Gaps = 25/499 (5%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRV----------SPVKMLNEKNGSLSLSVNRRGG  423
             MA C    F+ S++    GVL V GGR             +K+ + KNG L  + NR+ G
Sbjct  8     MATC----FVHSNSRNSVGVLAVNGGRTLLENNHINKPCFLKIHDNKNGFLGGNGNRKCG  63

Query  424   LNWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTM---MTPRQESGI  594
                       ++ +  N   +  + SKDPFL+LHPEISMLRGEG+S++     PR+++  
Sbjct  64    F-----INVKSTGSPNNHSVSPYHHSKDPFLDLHPEISMLRGEGSSSLNNTTRPRKDTSG  118

Query  595   ENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMS  774
              +V E  +D+S  +N+NEAKIKV+GVGGGGSNAVNRMIESSM GVEFWIVNTD+QAMRMS
Sbjct  119   GDVDERLEDNSIPSNYNEAKIKVIGVGGGGSNAVNRMIESSMNGVEFWIVNTDVQAMRMS  178

Query  775   PVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgt  954
             PV  ++RL IGQELTRGLGAGGNP+IG NAAKESKE+I+EAVYGADMVFVTAGMGGGTGT
Sbjct  179   PVVSENRLPIGQELTRGLGAGGNPEIGMNAAKESKESIQEAVYGADMVFVTAGMGGGTGT  238

Query  955   gaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLT  1134
             GAAPVIAG  KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR+NVDTLIVIPNDKLLT
Sbjct  239   GAAPVIAGITKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDNVDTLIVIPNDKLLT  298

Query  1135  AVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTA  1314
             AVS STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTA
Sbjct  299   AVSQSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTA  358

Query  1315  TGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSAN  1494
             TGKTRARDAALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+AN
Sbjct  359   TGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTAN  418

Query  1495  LIFGAVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGS  1671
             LIFGAVIDPS+SGQVSITLIATGFKRQ E + +P Q +QL  GD    I+RR ++F DGS
Sbjct  419   LIFGAVIDPSLSGQVSITLIATGFKRQEESEGRPAQVSQLTQGDTV--ISRRSSTFTDGS  476

Query  1672  SVEIPEFLKKKGRSRYPRA  1728
              VEIPEFLKKKGR RYPRA
Sbjct  477   LVEIPEFLKKKGRLRYPRA  495



>ref|XP_011007140.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X4 [Populus euphratica]
Length=476

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/487 (74%), Positives = 400/487 (82%), Gaps = 15/487 (3%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIG---GRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLK  444
             MA C    F  S T    G         GR+  V+  ++K GS      RR   + S ++
Sbjct  1     MATCVSPPFTPSGTQISVGRRISTENRFGRIVTVQRFDKKKGSWGAC--RRNVFSISQIR  58

Query  445   CsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDS  624
             CS NS+N +          KD FL+LHPE+SMLR + N T  T R+E+  +NVTESS D+
Sbjct  59    CSVNSHNISP-------NHKDSFLDLHPEVSMLRSDANDTYSTLRKETSGKNVTESSGDT  111

Query  625   SSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQI  804
             S ++N+NEAKIKVVGVGGGGSNAVNRMIESS+ GVEFWIVNTDIQAM+MSPV P++RLQ+
Sbjct  112   SFMSNYNEAKIKVVGVGGGGSNAVNRMIESSLTGVEFWIVNTDIQAMKMSPVLPENRLQV  171

Query  805   GQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagta  984
             G+ELTRGLGAGGNPDIG NAA ESK AIEEA+YGADMVF+TAGMGGGTGTGAAPVIAG A
Sbjct  172   GKELTRGLGAGGNPDIGMNAANESKAAIEEALYGADMVFITAGMGGGTGTGAAPVIAGVA  231

Query  985   KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTE  1164
             KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR NVDTLIVIPNDKLLTAVS STPVTE
Sbjct  232   KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVSQSTPVTE  291

Query  1165  AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAA  1344
             AFNLADDILRQGVRGISDII +PGLVNVDFADVRAIM+ AGSSL+GIGTATGKTRARDAA
Sbjct  292   AFNLADDILRQGVRGISDIIMVPGLVNVDFADVRAIMKDAGSSLLGIGTATGKTRARDAA  351

Query  1345  LNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPS  1524
             LNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS
Sbjct  352   LNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPS  411

Query  1525  ISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKK  1704
             +SGQVSITLIATGF R+  D+   Q  Q A GD S+G NRRP  + DG SVEIPEFL+KK
Sbjct  412   LSGQVSITLIATGFNRR--DEGEGQGTQRAHGDVSLGTNRRPP-YTDGGSVEIPEFLRKK  468

Query  1705  GRSRYPR  1725
             GRS +PR
Sbjct  469   GRSLFPR  475



>ref|XP_010527634.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Tarenaya hassleriana]
Length=479

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/412 (83%), Positives = 381/412 (92%), Gaps = 7/412 (2%)
 Frame = +1

Query  496   QSKDPFLNLHPEISMLRG-EGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             QS+DPFLNLHPEISML+G EGN+ +  PR+E+    +TE  ++SS+ ++FNEA+IKV+GV
Sbjct  70    QSQDPFLNLHPEISMLKGGEGNNMVTDPRKETYGGPITEDFRESSTPSSFNEARIKVIGV  129

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIES MKGVEFWIVNTDIQAMRMSPVFP++RLQIG+ELTRGLGAGGNP+I
Sbjct  130   GGGGSNAVNRMIESEMKGVEFWIVNTDIQAMRMSPVFPENRLQIGKELTRGLGAGGNPEI  189

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKESKE+IEEA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTPFS
Sbjct  190   GMNAAKESKESIEEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTPFS  249

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRA+QAQEGIA+LR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGI
Sbjct  250   FEGRRRALQAQEGIASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRGI  309

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA
Sbjct  310   SDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  369

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS+SGQVSITLIATGFKR
Sbjct  370   TGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSLSGQVSITLIATGFKR  429

Query  1573  QEGDD-KPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYP  1722
             QE  + + +Q NQ A G+    I RRP +SF +GS+VEIPEFLKKKGRSRYP
Sbjct  430   QEETEGRTVQGNQPAQGE----ITRRPSSSFREGSAVEIPEFLKKKGRSRYP  477



>ref|XP_011007098.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X1 [Populus euphratica]
 ref|XP_011007106.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X1 [Populus euphratica]
 ref|XP_011007113.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=481

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/490 (74%), Positives = 403/490 (82%), Gaps = 16/490 (3%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIG---GRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLK  444
             MA C    F  S T    G         GR+  V+  ++K GS      RR   + S ++
Sbjct  1     MATCVSPPFTPSGTQISVGRRISTENRFGRIVTVQRFDKKKGSWGAC--RRNVFSISQIR  58

Query  445   CsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDS  624
             CS NS+N +          KD FL+LHPE+SMLR + N T  T R+E+  +NVTESS D+
Sbjct  59    CSVNSHNISP-------NHKDSFLDLHPEVSMLRSDANDTYSTLRKETSGKNVTESSGDT  111

Query  625   SSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQI  804
             S ++N+NEAKIKVVGVGGGGSNAVNRMIESS+ GVEFWIVNTDIQAM+MSPV P++RLQ+
Sbjct  112   SFMSNYNEAKIKVVGVGGGGSNAVNRMIESSLTGVEFWIVNTDIQAMKMSPVLPENRLQV  171

Query  805   GQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagta  984
             G+ELTRGLGAGGNPDIG NAA ESK AIEEA+YGADMVF+TAGMGGGTGTGAAPVIAG A
Sbjct  172   GKELTRGLGAGGNPDIGMNAANESKAAIEEALYGADMVFITAGMGGGTGTGAAPVIAGVA  231

Query  985   KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTE  1164
             KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR NVDTLIVIPNDKLLTAVS STPVTE
Sbjct  232   KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVSQSTPVTE  291

Query  1165  AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTAT-GKTRARDA  1341
             AFNLADDILRQGVRGISDII +PGLVNVDFADVRAIM+ AGSSL+GIGTAT GKTRARDA
Sbjct  292   AFNLADDILRQGVRGISDIIMVPGLVNVDFADVRAIMKDAGSSLLGIGTATAGKTRARDA  351

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDP
Sbjct  352   ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDP  411

Query  1522  SISGQVSITLIATGF-KRQEGDDKP-LQANQLAPGDASIGINRRPASFMDGSSVEIPEFL  1695
             S+SGQVSITLIATGF +R EG+ +  +Q  Q A GD S+G NRRP  + DG SVEIPEFL
Sbjct  412   SLSGQVSITLIATGFNRRDEGEGQAKMQGTQRAHGDVSLGTNRRPP-YTDGGSVEIPEFL  470

Query  1696  KKKGRSRYPR  1725
             +KKGRS +PR
Sbjct  471   RKKGRSLFPR  480



>ref|XP_003625812.1| Cell division protein ftsZ [Medicago truncatula]
 gb|AES82030.1| cell division FtsZ-like protein [Medicago truncatula]
Length=494

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/498 (73%), Positives = 408/498 (82%), Gaps = 24/498 (5%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRV---------SPVKMLNEKNGSLSLSVNRRGGL  426
             MA C    F  +++    GVL V GGR          S    ++E   + S   NR+ GL
Sbjct  8     MASC----FAPTNSRNSAGVLAVNGGRKLLENHHINKSCFVKIHENKFAFSSVNNRKCGL  63

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTM---MTPRQESGIE  597
                      ++    +   +  + SKDPFL+LHPEISMLRGEG+S +     PR+++   
Sbjct  64    FQ-----VKSTGLPNSHSVSPYHHSKDPFLDLHPEISMLRGEGSSGLNNSTRPRKDTSGG  118

Query  598   NVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSP  777
             +V E  +D+ + +N+NEAKIKV+GVGGGGSNAVNRMIESSM GVEFWIVNTD+QAMRMSP
Sbjct  119   DVMEGLEDNLTPSNYNEAKIKVIGVGGGGSNAVNRMIESSMNGVEFWIVNTDVQAMRMSP  178

Query  778   VFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtg  957
             V  ++RL IGQELTRGLGAGGNP+IG NAAKESK++I+EAVYGADMVFVTAGMGGGTGTG
Sbjct  179   VNSENRLPIGQELTRGLGAGGNPEIGMNAAKESKDSIQEAVYGADMVFVTAGMGGGTGTG  238

Query  958   aapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTA  1137
             AAPVIAG  KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR+NVDTLIVIPNDKLLTA
Sbjct  239   AAPVIAGITKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDNVDTLIVIPNDKLLTA  298

Query  1138  VSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTAT  1317
             VS STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTAT
Sbjct  299   VSQSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTAT  358

Query  1318  GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANL  1497
             GKTRARDAALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANL
Sbjct  359   GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANL  418

Query  1498  IFGAVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSS  1674
             IFGAVIDPS+SGQVSITLIATGFKRQ E + +P+QANQL  GD    ++RR ++F DGS 
Sbjct  419   IFGAVIDPSLSGQVSITLIATGFKRQEESEARPVQANQLTQGDTV--VSRRSSTFTDGSL  476

Query  1675  VEIPEFLKKKGRSRYPRA  1728
             VEIPEFLKKKGR RYPRA
Sbjct  477   VEIPEFLKKKGRLRYPRA  494



>ref|XP_010426896.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=475

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/414 (82%), Positives = 368/414 (89%), Gaps = 14/414 (3%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIEN-VTESSKDSSSVNNFNEAKIKvv  666
              +QS+D FLNLHPEISML          PR+E+     +TE S + S  N +NEA+IKV+
Sbjct  73    HFQSQDSFLNLHPEISML---------NPRKEATTSGPITEDSDELSPPNTYNEARIKVI  123

Query  667   gvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNP  846
             GVGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPVFP +RLQIG+ELTRGLGAGGNP
Sbjct  124   GVGGGGSNAVNRMIESEMVGVEFWIVNTDIQAMRMSPVFPDNRLQIGKELTRGLGAGGNP  183

Query  847   DIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTP  1026
             +IG NAA ESK AIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTP
Sbjct  184   EIGMNAATESKTAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTP  243

Query  1027  FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVR  1206
             FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLL AVS STPVTEAFNLADDILRQGVR
Sbjct  244   FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLAAVSQSTPVTEAFNLADDILRQGVR  303

Query  1207  GISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  1386
             GISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE
Sbjct  304   GISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  363

Query  1387  RATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF  1566
             RATGIVWNITGG+DLTLFEVNAA EVIYDLVDP+ANLIFGAV+DPS SGQ+SITLIATGF
Sbjct  364   RATGIVWNITGGSDLTLFEVNAATEVIYDLVDPTANLIFGAVVDPSYSGQISITLIATGF  423

Query  1567  KRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             KRQ EG+ +PLQ  Q    DAS+G+ RRP+SF +GSS+EIPEFLKKKGRSRYPR
Sbjct  424   KRQEEGEGRPLQKTQ---ADASMGVTRRPSSFAEGSSIEIPEFLKKKGRSRYPR  474



>gb|KHN13512.1| Cell division protein FtsZ like 2-1, chloroplastic [Glycine soja]
Length=431

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/413 (81%), Positives = 374/413 (91%), Gaps = 1/413 (0%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             Y S+ PFL+LHPE+SMLRGEG+ST+ +PR++S   +++ES   +S  +++NEAKIKV+GV
Sbjct  19    YNSQGPFLDLHPEVSMLRGEGSSTVNSPRKDSSGGDLSESLGTTSIQSDYNEAKIKVIGV  78

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRM ES M GVEFWIVNTD+QAMRMSPV+P++RLQIGQELTRGLGAGGNP+ 
Sbjct  79    GGGGSNAVNRMTESEMHGVEFWIVNTDVQAMRMSPVYPENRLQIGQELTRGLGAGGNPET  138

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKESKE+IEEAVYGADMVFVTAGMGGGTGTG AP+IA  AKSMGILTVGIVTTPFS
Sbjct  139   GMNAAKESKESIEEAVYGADMVFVTAGMGGGTGTGGAPIIASIAKSMGILTVGIVTTPFS  198

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGR+R++QAQEGI ALR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGI
Sbjct  199   FEGRKRSIQAQEGITALRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRGI  258

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERA
Sbjct  259   SDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERA  318

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVW+ITGGTDLTLFEVN AAEVIYDLVDP+ANLIFGAVIDPS+SGQVSITLIATGFKR
Sbjct  319   TGIVWDITGGTDLTLFEVNTAAEVIYDLVDPTANLIFGAVIDPSLSGQVSITLIATGFKR  378

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPRA  1728
             Q E + +PLQA+QL   D + G N R +SF DG   EIPEFLKK+G SRYPRA
Sbjct  379   QEESEGRPLQASQLTQADTTFGTNWRSSSFTDGGLFEIPEFLKKRGGSRYPRA  431



>ref|XP_011007130.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X3 [Populus euphratica]
Length=477

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/460 (77%), Positives = 393/460 (85%), Gaps = 13/460 (3%)
 Frame = +1

Query  349   GRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnnsanahsanQYQSKDPFLNLHP  528
             GR+  V+  ++K GS      RR   + S ++CS NS+N +          KD FL+LHP
Sbjct  29    GRIVTVQRFDKKKGSWGAC--RRNVFSISQIRCSVNSHNISP-------NHKDSFLDLHP  79

Query  529   EISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMI  708
             E+SMLR + N T  T R+E+  +NVTESS D+S ++N+NEAKIKVVGVGGGGSNAVNRMI
Sbjct  80    EVSMLRSDANDTYSTLRKETSGKNVTESSGDTSFMSNYNEAKIKVVGVGGGGSNAVNRMI  139

Query  709   ESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeai  888
             ESS+ GVEFWIVNTDIQAM+MSPV P++RLQ+G+ELTRGLGAGGNPDIG NAA ESK AI
Sbjct  140   ESSLTGVEFWIVNTDIQAMKMSPVLPENRLQVGKELTRGLGAGGNPDIGMNAANESKAAI  199

Query  889   eeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQE  1068
             EEA+YGADMVF+TAGMGGGTGTGAAPVIAG AKSMGILTVGIVTTPFSFEGRRRAVQAQE
Sbjct  200   EEALYGADMVFITAGMGGGTGTGAAPVIAGVAKSMGILTVGIVTTPFSFEGRRRAVQAQE  259

Query  1069  GIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNV  1248
             GIAALR NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGISDII +PGLVNV
Sbjct  260   GIAALRNNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRGISDIIMVPGLVNV  319

Query  1249  DFADVRAIMESAGSSLMGIGTAT-GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGT  1425
             DFADVRAIM+ AGSSL+GIGTAT GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGT
Sbjct  320   DFADVRAIMKDAGSSLLGIGTATAGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGT  379

Query  1426  DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQAN  1605
             DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS+SGQVSITLIATGF R+  D+   Q  
Sbjct  380   DLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSLSGQVSITLIATGFNRR--DEGEGQGT  437

Query  1606  QLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q A GD S+G NRRP  + DG SVEIPEFL+KKGRS +PR
Sbjct  438   QRAHGDVSLGTNRRPP-YTDGGSVEIPEFLRKKGRSLFPR  476



>ref|XP_006291052.1| hypothetical protein CARUB_v10017167mg [Capsella rubella]
 gb|EOA23950.1| hypothetical protein CARUB_v10017167mg [Capsella rubella]
Length=472

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/468 (75%), Positives = 394/468 (84%), Gaps = 15/468 (3%)
 Frame = +1

Query  331   VLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnnsanahsa-nQYQSKD  507
             VLT++   V P   L  + G L +  ++R     +  K  ++S  ++    + + +QS+D
Sbjct  16    VLTLLRKSVLPENHLGARAGCLRMIESKRNRFVVAAHKSESSSIRNSLNSHSPSHFQSQD  75

Query  508   PFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggS  687
              FLNLHPEISML          PR+E     +TE   + S+   +NEA+IKV+GVGGGGS
Sbjct  76    SFLNLHPEISML---------NPRKEITSGPITEDLDELSTPTTYNEARIKVIGVGGGGS  126

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMIES M GVEFWIVNTDIQAMRMSPVFP +RLQIG+ELTRGLGAGGNP+IG NAA
Sbjct  127   NAVNRMIESEMVGVEFWIVNTDIQAMRMSPVFPDNRLQIGKELTRGLGAGGNPEIGMNAA  186

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
              ESKEAIE+A+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTPFSFEGRR
Sbjct  187   TESKEAIEQALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTPFSFEGRR  246

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             R VQAQEGIAALRENVDTLIVIPNDKLL+AVS STPVTEAFNLADDILRQGVRGISDIIT
Sbjct  247   RTVQAQEGIAALRENVDTLIVIPNDKLLSAVSQSTPVTEAFNLADDILRQGVRGISDIIT  306

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  1407
             IPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW
Sbjct  307   IPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  366

Query  1408  NITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ-EGD  1584
             NITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS SGQ+SITLIATGFKRQ EG+
Sbjct  367   NITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSYSGQISITLIATGFKRQEEGE  426

Query  1585  DKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
              KPLQA Q    DAS+GI+RRP +SF +GSS+EIPEFLKKKGRSRYPR
Sbjct  427   GKPLQATQ---ADASMGISRRPSSSFTEGSSIEIPEFLKKKGRSRYPR  471



>ref|XP_002881433.1| hypothetical protein ARALYDRAFT_902736 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57692.1| hypothetical protein ARALYDRAFT_902736 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/414 (82%), Positives = 376/414 (91%), Gaps = 4/414 (1%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvg  669
             Q Q++DPFLNLHPEISMLRGEG ST++ PR+E+    VTE  ++ S+ +N+NEA+IKV+G
Sbjct  67    QSQAQDPFLNLHPEISMLRGEGTSTIVNPRKETSSGPVTEDFEEPSAPSNYNEARIKVIG  126

Query  670   vggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPD  849
             VGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPV P +RLQIG+ELTRGLGAGGNP+
Sbjct  127   VGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIGKELTRGLGAGGNPE  186

Query  850   IGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPF  1029
             IG NAA+ESKE IEEA+YG+DMVFVTAGMGGGTGTGAAPVIAG AK+MGILTVGI TTPF
Sbjct  187   IGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKAMGILTVGIATTPF  246

Query  1030  SFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRG  1209
             SFEGRRR VQAQEG+A+LR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRG
Sbjct  247   SFEGRRRTVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRG  306

Query  1210  ISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIER  1389
             ISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIER
Sbjct  307   ISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIER  366

Query  1390  ATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFK  1569
             ATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DP++SGQVSITLIATGFK
Sbjct  367   ATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPALSGQVSITLIATGFK  426

Query  1570  RQEGDDKPLQANQLAPGD-ASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             RQE  +   +A Q+A  D AS+G  RRP +SF +  SVEIPEFLKKKG SRYPR
Sbjct  427   RQEEGEG--RAVQMAQADAASVGATRRPSSSFRESGSVEIPEFLKKKGSSRYPR  478



>ref|XP_002877882.1| ftsz2-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54141.1| ftsz2-2 [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/468 (76%), Positives = 397/468 (85%), Gaps = 15/468 (3%)
 Frame = +1

Query  331   VLTVIGGRVSPVKMLNEKNGSLSLSV-NRRGGLNWSLLKCsansnnsanahsanQYQSKD  507
             VLTV+   V P   L  + G L +S   +R  +  +    S++  NS N+HS + +QS+D
Sbjct  16    VLTVLRKSVLPENHLGTRVGCLRMSDGTKRYRVVAAHKSESSSIRNSLNSHSPSHFQSQD  75

Query  508   PFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggS  687
              FLNLHPEISML          PR+E+    +TE   + S+ N +NEA+IKV+GVGGGGS
Sbjct  76    SFLNLHPEISML---------NPRKETSSVPITEDLDELSTPNTYNEARIKVIGVGGGGS  126

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMIES M GVEFWIVNTDIQAMRMSPVFP +RLQIG+ELTRGLGAGGNP+IG NAA
Sbjct  127   NAVNRMIESEMIGVEFWIVNTDIQAMRMSPVFPDNRLQIGKELTRGLGAGGNPEIGMNAA  186

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
              ESKEAI+EA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTPFSFEGRR
Sbjct  187   TESKEAIQEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTPFSFEGRR  246

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             RAVQAQEGIAALR+NVDTLIVIPNDKLL AVS STPVTEAFNLADDILRQGVRGISDIIT
Sbjct  247   RAVQAQEGIAALRDNVDTLIVIPNDKLLAAVSQSTPVTEAFNLADDILRQGVRGISDIIT  306

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  1407
             IPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW
Sbjct  307   IPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  366

Query  1408  NITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ-EGD  1584
             NITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS SGQ+SITLIATGFKRQ EG+
Sbjct  367   NITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSYSGQISITLIATGFKRQEEGE  426

Query  1585  DKPLQANQLAPGDASIGINRRPA-SFMDGSSVEIPEFLKKKGRSRYPR  1725
              +PLQA Q    DAS+G  RRP+ SF +GSS+EIPEFLKKKGRSRYPR
Sbjct  427   GRPLQATQ---ADASVGATRRPSPSFTEGSSIEIPEFLKKKGRSRYPR  471



>ref|XP_008804829.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Phoenix dactylifera]
 ref|XP_008804830.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Phoenix dactylifera]
 ref|XP_008804831.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Phoenix dactylifera]
 ref|XP_008804832.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=487

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/485 (75%), Positives = 407/485 (84%), Gaps = 21/485 (4%)
 Frame = +1

Query  310   DTWCPRGVLTVIG---------GRVSPVKM-LNEKNGSLSLSVNRRGGLNWSLLKCsans  459
             D  CP GV  ++G         GR S   + LNE+NG     V+ +  ++ S ++CSANS
Sbjct  12    DGRCPVGVSAILGRRSLTVDGSGRCSSFNIFLNERNG---FYVSGQRAVSCSWVRCSANS  68

Query  460   nnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNN  639
             N+         Y +KDPFL+LHPE+SMLRGE    ++  +++    NVTES ++SS  +N
Sbjct  69    NSHNIG----SYHNKDPFLHLHPEVSMLRGETTDKIIDSKKDKLGSNVTESLRESSLPDN  124

Query  640   FNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELT  819
             + EAKIKV+GVGGGGSNAVNRMIESSMKGVEFWIVNTD+QAMRMSPV+P++RLQIG ELT
Sbjct  125   YKEAKIKVIGVGGGGSNAVNRMIESSMKGVEFWIVNTDVQAMRMSPVYPENRLQIGHELT  184

Query  820   RGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGI  999
             RGLGAGGNPDIG NAAKESKE+IEEAV  ADMVF+TAGMGGGTGTG APVIAG AKSMGI
Sbjct  185   RGLGAGGNPDIGMNAAKESKESIEEAVSSADMVFITAGMGGGTGTGGAPVIAGIAKSMGI  244

Query  1000  LTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLA  1179
             LTVGIVTTPFSFEGR+RAVQAQEGIA+LR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLA
Sbjct  245   LTVGIVTTPFSFEGRKRAVQAQEGIASLRNNVDTLIVIPNDKLLTAVSPNTPVTEAFNLA  304

Query  1180  DDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQ  1359
             DDILRQGVRGISDIIT+PGLVNVDFADVRAIM  AGSSLMGIGTATGKTRARDAALNAI 
Sbjct  305   DDILRQGVRGISDIITVPGLVNVDFADVRAIMADAGSSLMGIGTATGKTRARDAALNAIH  364

Query  1360  SPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQV  1539
             SPLLDIGIERATGIVWNITGG DLTL+EVNAAAEVIYDLVDP+ANLIFGAVID S+SGQV
Sbjct  365   SPLLDIGIERATGIVWNITGGNDLTLYEVNAAAEVIYDLVDPAANLIFGAVIDQSLSGQV  424

Query  1540  SITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRS  1713
             SITLIATGFKRQE  + +  Q  QL+ GD S+GINRRP +S  +GS VEIPEFL+KKGRS
Sbjct  425   SITLIATGFKRQEETEGRSFQGAQLS-GD-SLGINRRPSSSLTEGSMVEIPEFLRKKGRS  482

Query  1714  RYPRA  1728
             RYPRA
Sbjct  483   RYPRA  487



>ref|XP_010426897.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=474

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/414 (82%), Positives = 367/414 (89%), Gaps = 15/414 (4%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIEN-VTESSKDSSSVNNFNEAKIKvv  666
              +QS+D FLNLHPEISML          PR+E+     +TE S + S  N +NEA+IKV+
Sbjct  73    HFQSQDSFLNLHPEISML---------NPRKEATTSGPITEDSDELSPPNTYNEARIKVI  123

Query  667   gvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNP  846
             GVGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPVFP +RLQIG+ELTRGLGAGGNP
Sbjct  124   GVGGGGSNAVNRMIESEMVGVEFWIVNTDIQAMRMSPVFPDNRLQIGKELTRGLGAGGNP  183

Query  847   DIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTP  1026
             +IG NAA ESK AIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTP
Sbjct  184   EIGMNAATESKTAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTP  243

Query  1027  FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVR  1206
             FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLL AVS STPVTEAFNLADDILRQGVR
Sbjct  244   FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLAAVSQSTPVTEAFNLADDILRQGVR  303

Query  1207  GISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  1386
             GISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE
Sbjct  304   GISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  363

Query  1387  RATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF  1566
             RATGIVWNITGG+DLTLFEVNAA EVIYDLVDP+ANLIFGAV+DPS SGQ+SITLIATGF
Sbjct  364   RATGIVWNITGGSDLTLFEVNAATEVIYDLVDPTANLIFGAVVDPSYSGQISITLIATGF  423

Query  1567  KRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             KRQ EG+ +PLQ       DAS+G+ RRP+SF +GSS+EIPEFLKKKGRSRYPR
Sbjct  424   KRQEEGEGRPLQTQ----ADASMGVTRRPSSFAEGSSIEIPEFLKKKGRSRYPR  473



>ref|NP_190843.1| plastidial division protein FtsZ2-2 [Arabidopsis thaliana]
 sp|Q9LXJ0.1|FTZ22_ARATH RecName: Full=Cell division protein FtsZ homolog 2-2, chloroplastic; 
Short=AtFtsZ2-2; AltName: Full=Plastid division protein 
FTSZ2-2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK63846.1|AF384167_1 plastid division protein FtsZ2-2 [Arabidopsis thaliana]
 emb|CAB89236.1| plastid division protein FtsZ-like [Arabidopsis thaliana]
 gb|AAN13020.1| putative plastid division protein FtsZ [Arabidopsis thaliana]
 gb|AEE78989.1| Tubulin/FtsZ family protein [Arabidopsis thaliana]
Length=473

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/469 (76%), Positives = 397/469 (85%), Gaps = 16/469 (3%)
 Frame = +1

Query  331   VLTVIGGRVSPVKMLNEKNGSLSLS--VNRRGGLNWSLLKCsansnnsanahsanQYQSK  504
             VLTV+   V P   L  + G L +S    +R  +  S    S++  NS N+HS + +QS+
Sbjct  16    VLTVLRKSVLPDHHLGTRVGCLRMSEGTTKRYRVVASHKYESSSIRNSLNSHSTSHFQSQ  75

Query  505   DPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvgggg  684
             D FLNLHPEISML          PR+E+    +TE   + S+ N +NEA+IKV+GVGGGG
Sbjct  76    DSFLNLHPEISML---------NPRKETSSVPITEDLDELSTPNTYNEARIKVIGVGGGG  126

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
             SNAVNRMIES M GVEFWIVNTDIQAMR+SPVFP +RLQIG+ELTRGLGAGGNP+IG NA
Sbjct  127   SNAVNRMIESEMIGVEFWIVNTDIQAMRISPVFPDNRLQIGKELTRGLGAGGNPEIGMNA  186

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A ESKEAI+EA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTPFSFEGR
Sbjct  187   ATESKEAIQEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTPFSFEGR  246

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RRA+QAQEGIAALR+NVDTLIVIPNDKLL AVS STPVTEAFNLADDILRQGVRGISDII
Sbjct  247   RRALQAQEGIAALRDNVDTLIVIPNDKLLAAVSQSTPVTEAFNLADDILRQGVRGISDII  306

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
             TIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV
Sbjct  307   TIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  366

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ-EG  1581
             WNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS SGQ+SITLIATGFKRQ EG
Sbjct  367   WNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSYSGQISITLIATGFKRQEEG  426

Query  1582  DDKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             + +PLQA Q    DAS+G  RRP +SF +GSS+EIPEFLKKKGRSRYPR
Sbjct  427   EGRPLQATQ---ADASMGATRRPSSSFTEGSSIEIPEFLKKKGRSRYPR  472



>ref|XP_010504020.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic 
isoform X1 [Camelina sativa]
Length=475

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/415 (82%), Positives = 369/415 (89%), Gaps = 15/415 (4%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIEN-VTESSKDSSSVNNFNEAKIKvv  666
              +QS+D FLNLHPEISML          PR+E      +TE S + S+ N +NEA+IKV+
Sbjct  72    HFQSQDSFLNLHPEISML---------NPRKEVTTSGPITEDSDELSTPNTYNEARIKVI  122

Query  667   gvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNP  846
             GVGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPVFP +RLQIG+ELTRGLGAGGNP
Sbjct  123   GVGGGGSNAVNRMIESEMVGVEFWIVNTDIQAMRMSPVFPDNRLQIGKELTRGLGAGGNP  182

Query  847   DIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTP  1026
             +IG NAA ESK AIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTP
Sbjct  183   EIGMNAATESKTAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTP  242

Query  1027  FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVR  1206
             FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLL AVS STPVTEAFNLADDILRQGVR
Sbjct  243   FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLAAVSQSTPVTEAFNLADDILRQGVR  302

Query  1207  GISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  1386
             GISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE
Sbjct  303   GISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  362

Query  1387  RATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF  1566
             RATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS SGQ+SITLIATGF
Sbjct  363   RATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSYSGQISITLIATGF  422

Query  1567  KRQ-EGDDKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             KRQ EG+ +PLQ  Q    DAS+G+ RRP +SF +GSS+EIPEFLKKKGRSRYPR
Sbjct  423   KRQEEGEGRPLQKTQ---ADASMGVTRRPSSSFAEGSSIEIPEFLKKKGRSRYPR  474



>ref|XP_006384816.1| FtsZ 3 family protein [Populus trichocarpa]
 gb|ERP62613.1| FtsZ 3 family protein [Populus trichocarpa]
Length=476

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/459 (76%), Positives = 390/459 (85%), Gaps = 12/459 (3%)
 Frame = +1

Query  349   GRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnnsanahsanQYQSKDPFLNLHP  528
             GR+   +  ++K GS       R  ++ S ++CS NS+N +          KD FL+LHP
Sbjct  29    GRIVTAQRFDKKKGSWGAC--GRNAVSISQIRCSVNSHNISP-------NHKDSFLDLHP  79

Query  529   EISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMI  708
             E+SMLR + N T  + R+E+   NVTESS D+S ++N+NEAKIKVVGVGGGGSNAVNRMI
Sbjct  80    EVSMLRSDANDTYSSVRKETSGRNVTESSGDTSFMSNYNEAKIKVVGVGGGGSNAVNRMI  139

Query  709   ESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeai  888
             ESS+ GVEFWIVNTDIQAM+MSPV P++RLQ+G+ELTRGLGAGGNPDIG NAA ESK AI
Sbjct  140   ESSLTGVEFWIVNTDIQAMKMSPVLPENRLQVGKELTRGLGAGGNPDIGMNAANESKAAI  199

Query  889   eeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQE  1068
             EEA+YGADMVF+TAGMGGGTGTG APVIAG AKSMGILTVGIVT+PFSFEGRRRAVQAQE
Sbjct  200   EEALYGADMVFITAGMGGGTGTGGAPVIAGVAKSMGILTVGIVTSPFSFEGRRRAVQAQE  259

Query  1069  GIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNV  1248
             GIAALR NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGISDII +PGLVNV
Sbjct  260   GIAALRNNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRGISDIIMVPGLVNV  319

Query  1249  DFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTD  1428
             DFADVRAIM+ AGSSL+GIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTD
Sbjct  320   DFADVRAIMKDAGSSLLGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTD  379

Query  1429  LTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQ  1608
             LTLFEVNAAAEVIYDLVDP+ANLIFGAVIDP++SGQVSITLIATGF R+  D+   Q  Q
Sbjct  380   LTLFEVNAAAEVIYDLVDPTANLIFGAVIDPALSGQVSITLIATGFNRR--DEGEGQGTQ  437

Query  1609  LAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
              A GD S+G NRRP  + DG SVEIPEFL+KKGRS +PR
Sbjct  438   RAHGDVSLGTNRRPP-YADGGSVEIPEFLRKKGRSLFPR  475



>ref|XP_006410796.1| hypothetical protein EUTSA_v10016595mg [Eutrema salsugineum]
 gb|ESQ52249.1| hypothetical protein EUTSA_v10016595mg [Eutrema salsugineum]
Length=476

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/414 (82%), Positives = 377/414 (91%), Gaps = 4/414 (1%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvg  669
              +QS+DPFLNLHPEISMLRGEG +T+  PR+E+    VTE  ++ S  +N+NEA+IKV+G
Sbjct  64    HFQSQDPFLNLHPEISMLRGEGANTIANPRKETSAGPVTEDFEEPSVPSNYNEARIKVIG  123

Query  670   vggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPD  849
             VGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPV  ++RLQIG+ELTRGLGAGGNP+
Sbjct  124   VGGGGSNAVNRMIESEMLGVEFWIVNTDIQAMRMSPVLSENRLQIGKELTRGLGAGGNPE  183

Query  850   IGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPF  1029
             IG NAA+ESKEAIEEA+YG+DMVFVTAGMGGGTGTGAAPVIAG AK+MGILTVGI TTPF
Sbjct  184   IGMNAARESKEAIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKAMGILTVGIATTPF  243

Query  1030  SFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRG  1209
             SFEGRRRAVQAQEG+A+LR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRG
Sbjct  244   SFEGRRRAVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRG  303

Query  1210  ISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIER  1389
             ISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIER
Sbjct  304   ISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIER  363

Query  1390  ATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFK  1569
             ATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS+SGQVSITLIATGFK
Sbjct  364   ATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSLSGQVSITLIATGFK  423

Query  1570  RQ-EGDDKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             RQ EG+ + +Q  Q+    +S+G  RRP +SF +G SVEIPEFLKKKG SRYPR
Sbjct  424   RQEEGEGRAVQMAQV--DTSSMGATRRPSSSFREGGSVEIPEFLKKKGSSRYPR  475



>ref|XP_011007148.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X5 [Populus euphratica]
Length=474

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/461 (77%), Positives = 393/461 (85%), Gaps = 18/461 (4%)
 Frame = +1

Query  349   GRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnnsanahsanQYQSKDPFLNLHP  528
             GR+  V+  ++K GS      RR   + S ++CS NS+N +          KD FL+LHP
Sbjct  29    GRIVTVQRFDKKKGSWGAC--RRNVFSISQIRCSVNSHNISP-------NHKDSFLDLHP  79

Query  529   EISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMI  708
             E+SMLR + N T  T R+E+  +NVTESS D+S ++N+NEAKIKVVGVGGGGSNAVNRMI
Sbjct  80    EVSMLRSDANDTYSTLRKETSGKNVTESSGDTSFMSNYNEAKIKVVGVGGGGSNAVNRMI  139

Query  709   ESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeai  888
             ESS+ GVEFWIVNTDIQAM+MSPV P++RLQ+G+ELTRGLGAGGNPDIG NAA ESK AI
Sbjct  140   ESSLTGVEFWIVNTDIQAMKMSPVLPENRLQVGKELTRGLGAGGNPDIGMNAANESKAAI  199

Query  889   eeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQE  1068
             EEA+YGADMVF+TAGMGGGTGTGAAPVIAG AKSMGILTVGIVTTPFSFEGRRRAVQAQE
Sbjct  200   EEALYGADMVFITAGMGGGTGTGAAPVIAGVAKSMGILTVGIVTTPFSFEGRRRAVQAQE  259

Query  1069  GIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNV  1248
             GIAALR NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGISDII +PGLVNV
Sbjct  260   GIAALRNNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRGISDIIMVPGLVNV  319

Query  1249  DFADVRAIMESAGSSLMGIGTAT-GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGT  1425
             DFADVRAIM+ AGSSL+GIGTAT GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGT
Sbjct  320   DFADVRAIMKDAGSSLLGIGTATAGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGT  379

Query  1426  DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF-KRQEGDDKPLQA  1602
             DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS+SGQVSITLIATGF +R EG+      
Sbjct  380   DLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSLSGQVSITLIATGFNRRDEGE------  433

Query  1603  NQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
              Q A GD S+G NRRP  + DG SVEIPEFL+KKGRS +PR
Sbjct  434   GQRAHGDVSLGTNRRPP-YTDGGSVEIPEFLRKKGRSLFPR  473



>ref|XP_010515749.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=476

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/415 (82%), Positives = 368/415 (89%), Gaps = 15/415 (4%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIEN-VTESSKDSSSVNNFNEAKIKvv  666
              +QS+D FLNLHPEISML          PR+E      +TE S + S+ N +NEA+IKV+
Sbjct  73    HFQSQDSFLNLHPEISML---------NPRKEVTTSGPITEDSDELSTPNTYNEARIKVI  123

Query  667   gvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNP  846
             GVGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPVFP +RLQIG+ELTRGLGAGGNP
Sbjct  124   GVGGGGSNAVNRMIESEMVGVEFWIVNTDIQAMRMSPVFPDNRLQIGKELTRGLGAGGNP  183

Query  847   DIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTP  1026
             +IG NAA ESK AIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTP
Sbjct  184   EIGMNAATESKTAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTP  243

Query  1027  FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVR  1206
             FSFEGRRRAVQAQEGI+ALRENVDTLIVIPNDKLL AVS STPVTEAFNLADDILRQGVR
Sbjct  244   FSFEGRRRAVQAQEGISALRENVDTLIVIPNDKLLAAVSQSTPVTEAFNLADDILRQGVR  303

Query  1207  GISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  1386
             GISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE
Sbjct  304   GISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  363

Query  1387  RATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF  1566
             RATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS SGQ+SITLIATGF
Sbjct  364   RATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSYSGQISITLIATGF  423

Query  1567  KRQ-EGDDKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             KRQ EG+ +PLQ  Q    DAS+G+ RRP +SF +GSS+EIPEFLKKKGR RYPR
Sbjct  424   KRQEEGEGRPLQKTQ---ADASMGVTRRPSSSFTEGSSIEIPEFLKKKGRCRYPR  475



>ref|XP_010504021.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic 
isoform X2 [Camelina sativa]
Length=474

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/415 (82%), Positives = 368/415 (89%), Gaps = 16/415 (4%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIEN-VTESSKDSSSVNNFNEAKIKvv  666
              +QS+D FLNLHPEISML          PR+E      +TE S + S+ N +NEA+IKV+
Sbjct  72    HFQSQDSFLNLHPEISML---------NPRKEVTTSGPITEDSDELSTPNTYNEARIKVI  122

Query  667   gvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNP  846
             GVGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPVFP +RLQIG+ELTRGLGAGGNP
Sbjct  123   GVGGGGSNAVNRMIESEMVGVEFWIVNTDIQAMRMSPVFPDNRLQIGKELTRGLGAGGNP  182

Query  847   DIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTP  1026
             +IG NAA ESK AIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTP
Sbjct  183   EIGMNAATESKTAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTP  242

Query  1027  FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVR  1206
             FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLL AVS STPVTEAFNLADDILRQGVR
Sbjct  243   FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLAAVSQSTPVTEAFNLADDILRQGVR  302

Query  1207  GISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  1386
             GISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE
Sbjct  303   GISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  362

Query  1387  RATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF  1566
             RATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS SGQ+SITLIATGF
Sbjct  363   RATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSYSGQISITLIATGF  422

Query  1567  KRQ-EGDDKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             KRQ EG+ +PLQ       DAS+G+ RRP +SF +GSS+EIPEFLKKKGRSRYPR
Sbjct  423   KRQEEGEGRPLQTQ----ADASMGVTRRPSSSFAEGSSIEIPEFLKKKGRSRYPR  473



>gb|AAL07180.1| putative plastid division protein FtsZ [Arabidopsis thaliana]
Length=473

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/469 (76%), Positives = 396/469 (84%), Gaps = 16/469 (3%)
 Frame = +1

Query  331   VLTVIGGRVSPVKMLNEKNGSLSLS--VNRRGGLNWSLLKCsansnnsanahsanQYQSK  504
             VLTV+   V P   L  + G L +S    +R  +  S    S++  NS N+HS + +QS+
Sbjct  16    VLTVLRKSVLPDHHLGTRVGCLRMSEGTTKRYRVVASHKYESSSIRNSLNSHSTSHFQSQ  75

Query  505   DPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvgggg  684
             D FLNLHPEISML          PR+E+    +TE   + S+ N +NEA+IKV+GVGGGG
Sbjct  76    DSFLNLHPEISML---------NPRKETSSVPITEDLDELSTPNTYNEARIKVIGVGGGG  126

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
             SNAVNRMIES M GVEFWIVNTDIQAMR+SPVFP +RLQIG+ELTRGLGAGGNP+IG NA
Sbjct  127   SNAVNRMIESEMIGVEFWIVNTDIQAMRISPVFPDNRLQIGKELTRGLGAGGNPEIGMNA  186

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A ESKEAI+EA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTPFSFEGR
Sbjct  187   ATESKEAIQEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTPFSFEGR  246

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RRA+QAQEGIAALR+NVDTLIV PNDKLL AVS STPVTEAFNLADDILRQGVRGISDII
Sbjct  247   RRALQAQEGIAALRDNVDTLIVNPNDKLLAAVSQSTPVTEAFNLADDILRQGVRGISDII  306

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
             TIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV
Sbjct  307   TIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  366

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ-EG  1581
             WNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS SGQ+SITLIATGFKRQ EG
Sbjct  367   WNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSYSGQISITLIATGFKRQEEG  426

Query  1582  DDKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             + +PLQA Q    DAS+G  RRP +SF +GSS+EIPEFLKKKGRSRYPR
Sbjct  427   EGRPLQATQ---ADASMGATRRPSSSFTEGSSIEIPEFLKKKGRSRYPR  472



>ref|NP_565839.1| cell division protein FtsZ homolog 2-1 [Arabidopsis thaliana]
 ref|NP_973612.1| cell division protein FtsZ homolog 2-1 [Arabidopsis thaliana]
 sp|O82533.2|FTZ21_ARATH RecName: Full=Cell division protein FtsZ homolog 2-1, chloroplastic; 
Short=AtFtsZ2-1; AltName: Full=Plastid division protein 
FTSZ2-1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC35987.2| plastid division protein FtsZ [Arabidopsis thaliana]
 gb|AAK92779.1| putative plastid division protein FtsZ [Arabidopsis thaliana]
 dbj|BAB68127.1| chloroplast division protein AtFtsZ2-1 [Arabidopsis thaliana]
 gb|AAD21440.2| plastid division protein (FtsZ) [Arabidopsis thaliana]
 gb|AAM14122.1| putative plastid division FtsZ protein [Arabidopsis thaliana]
 gb|AEC09221.1| cell division protein FtsZ homolog 2-1 [Arabidopsis thaliana]
 gb|AEC09222.1| cell division protein FtsZ homolog 2-1 [Arabidopsis thaliana]
Length=478

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/414 (82%), Positives = 374/414 (90%), Gaps = 4/414 (1%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvg  669
             Q Q++DPFLNLHPEISMLRGEG ST++ PR+E+    V E  ++ S+ +N+NEA+IKV+G
Sbjct  66    QSQAQDPFLNLHPEISMLRGEGTSTIVNPRKETSSGPVVEDFEEPSAPSNYNEARIKVIG  125

Query  670   vggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPD  849
             VGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPV P +RLQIG+ELTRGLGAGGNP+
Sbjct  126   VGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIGKELTRGLGAGGNPE  185

Query  850   IGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPF  1029
             IG NAA+ESKE IEEA+YG+DMVFVTAGMGGGTGTGAAPVIAG AK+MGILTVGI TTPF
Sbjct  186   IGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKAMGILTVGIATTPF  245

Query  1030  SFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRG  1209
             SFEGRRR VQAQEG+A+LR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRG
Sbjct  246   SFEGRRRTVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRG  305

Query  1210  ISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIER  1389
             ISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIER
Sbjct  306   ISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIER  365

Query  1390  ATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFK  1569
             ATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DP++SGQVSITLIATGFK
Sbjct  366   ATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPALSGQVSITLIATGFK  425

Query  1570  RQ-EGDDKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             RQ EG+ + +Q  Q     AS+G  RRP +SF +  SVEIPEFLKKKG SRYPR
Sbjct  426   RQEEGEGRTVQMVQA--DAASVGATRRPSSSFRESGSVEIPEFLKKKGSSRYPR  477



>ref|XP_006294122.1| hypothetical protein CARUB_v10023118mg [Capsella rubella]
 gb|EOA27020.1| hypothetical protein CARUB_v10023118mg [Capsella rubella]
Length=477

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/414 (82%), Positives = 373/414 (90%), Gaps = 4/414 (1%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvg  669
             Q  ++DPFLNLHPEISMLRGEG +T+  PR+E+    VTE  ++ S+  N+NEA+IKV+G
Sbjct  65    QTHAQDPFLNLHPEISMLRGEGVNTIANPRKETSAGPVTEDFEEPSAPTNYNEARIKVIG  124

Query  670   vggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPD  849
             VGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPV P +RLQIG+ELTRGLGAGGNP+
Sbjct  125   VGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIGKELTRGLGAGGNPE  184

Query  850   IGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPF  1029
             IG NAA+ESKE IEEA+YG+DMVFVTAGMGGGTGTGAAPVIAG AK+MGILTVGI TTPF
Sbjct  185   IGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKAMGILTVGIATTPF  244

Query  1030  SFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRG  1209
             SFEGRRR VQAQEG+A+LR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRG
Sbjct  245   SFEGRRRTVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRG  304

Query  1210  ISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIER  1389
             ISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIER
Sbjct  305   ISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIER  364

Query  1390  ATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFK  1569
             ATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS++GQVSITLIATGFK
Sbjct  365   ATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSLTGQVSITLIATGFK  424

Query  1570  RQEGDDKPLQANQLAPGDA-SIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             RQE  +   +A Q+A  DA S+G  RRP +SF +  SVEIPEFLKKKG SRYPR
Sbjct  425   RQEEGEG--RAAQMAQADAVSVGATRRPSSSFRESGSVEIPEFLKKKGSSRYPR  476



>ref|XP_010515750.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=475

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/415 (81%), Positives = 367/415 (88%), Gaps = 16/415 (4%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIEN-VTESSKDSSSVNNFNEAKIKvv  666
              +QS+D FLNLHPEISML          PR+E      +TE S + S+ N +NEA+IKV+
Sbjct  73    HFQSQDSFLNLHPEISML---------NPRKEVTTSGPITEDSDELSTPNTYNEARIKVI  123

Query  667   gvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNP  846
             GVGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPVFP +RLQIG+ELTRGLGAGGNP
Sbjct  124   GVGGGGSNAVNRMIESEMVGVEFWIVNTDIQAMRMSPVFPDNRLQIGKELTRGLGAGGNP  183

Query  847   DIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTP  1026
             +IG NAA ESK AIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTP
Sbjct  184   EIGMNAATESKTAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTP  243

Query  1027  FSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVR  1206
             FSFEGRRRAVQAQEGI+ALRENVDTLIVIPNDKLL AVS STPVTEAFNLADDILRQGVR
Sbjct  244   FSFEGRRRAVQAQEGISALRENVDTLIVIPNDKLLAAVSQSTPVTEAFNLADDILRQGVR  303

Query  1207  GISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  1386
             GISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE
Sbjct  304   GISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE  363

Query  1387  RATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF  1566
             RATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS SGQ+SITLIATGF
Sbjct  364   RATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSYSGQISITLIATGF  423

Query  1567  KRQ-EGDDKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             KRQ EG+ +PLQ       DAS+G+ RRP +SF +GSS+EIPEFLKKKGR RYPR
Sbjct  424   KRQEEGEGRPLQTQ----ADASMGVTRRPSSSFTEGSSIEIPEFLKKKGRCRYPR  474



>ref|XP_006589850.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Glycine max]
Length=939

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/497 (73%), Positives = 408/497 (82%), Gaps = 25/497 (5%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIG--------GRVSPVKMLNEKNGSLSLSVNRRGGLN  429
             MA C  T F  S+T     V TV G        GR    KM + +NG         GG+ 
Sbjct  456   MASCVSTIFAPSNTRNTPRVFTVGGRNLTCNYPGRACFTKMYDRRNGF-------SGGIQ  508

Query  430   WSLL---KCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIEN  600
              S L   KCSANS++ +       Y S+ PFL+LHPE+SMLRGEG+ST+ +PR++S   +
Sbjct  509   MSGLLQVKCSANSHSVSP------YNSQGPFLDLHPEVSMLRGEGSSTVNSPRKDSSGGD  562

Query  601   VTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPV  780
             ++ES   +S  +++NEAKIKV+GVGGGGSNAVNRM ES M GVEFWIVNTD+QAMRMSPV
Sbjct  563   LSESLGTTSIQSDYNEAKIKVIGVGGGGSNAVNRMTESEMHGVEFWIVNTDVQAMRMSPV  622

Query  781   FPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtga  960
             +P++RLQIGQELTRGLGAGGNP+ G NAAKESKE+IEEAVYGADMVFVTAGMGGGTGTG 
Sbjct  623   YPENRLQIGQELTRGLGAGGNPETGMNAAKESKESIEEAVYGADMVFVTAGMGGGTGTGG  682

Query  961   apviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAV  1140
             AP+IA  AKSMGILTVGIVTTPFSFEGR+R++QAQEGI ALR+NVDTLIVIPNDKLLTAV
Sbjct  683   APIIASIAKSMGILTVGIVTTPFSFEGRKRSIQAQEGITALRDNVDTLIVIPNDKLLTAV  742

Query  1141  SPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATG  1320
             S STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATG
Sbjct  743   SQSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATG  802

Query  1321  KTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLI  1500
             K+RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVN AAEVIYDLVDP+ANLI
Sbjct  803   KSRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPTANLI  862

Query  1501  FGAVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSV  1677
             FGAVIDPS+SGQVSITLIATGFKRQ E + +PLQA+QL   D + G N R +SF DG   
Sbjct  863   FGAVIDPSLSGQVSITLIATGFKRQEESEGRPLQASQLTQADTTFGTNWRSSSFTDGGLF  922

Query  1678  EIPEFLKKKGRSRYPRA  1728
             EIPEFLKK+G SRYPRA
Sbjct  923   EIPEFLKKRGGSRYPRA  939



>ref|XP_006384817.1| hypothetical protein POPTR_0004s21330g [Populus trichocarpa]
 gb|ERP62614.1| hypothetical protein POPTR_0004s21330g [Populus trichocarpa]
Length=477

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/460 (76%), Positives = 390/460 (85%), Gaps = 13/460 (3%)
 Frame = +1

Query  349   GRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnnsanahsanQYQSKDPFLNLHP  528
             GR+   +  ++K GS       R  ++ S ++CS NS+N +          KD FL+LHP
Sbjct  29    GRIVTAQRFDKKKGSWGAC--GRNAVSISQIRCSVNSHNISP-------NHKDSFLDLHP  79

Query  529   EISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMI  708
             E+SMLR + N T  + R+E+   NVTESS D+S ++N+NEAKIKVVGVGGGGSNAVNRMI
Sbjct  80    EVSMLRSDANDTYSSVRKETSGRNVTESSGDTSFMSNYNEAKIKVVGVGGGGSNAVNRMI  139

Query  709   ESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeai  888
             ESS+ GVEFWIVNTDIQAM+MSPV P++RLQ+G+ELTRGLGAGGNPDIG NAA ESK AI
Sbjct  140   ESSLTGVEFWIVNTDIQAMKMSPVLPENRLQVGKELTRGLGAGGNPDIGMNAANESKAAI  199

Query  889   eeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQE  1068
             EEA+YGADMVF+TAGMGGGTGTG APVIAG AKSMGILTVGIVT+PFSFEGRRRAVQAQE
Sbjct  200   EEALYGADMVFITAGMGGGTGTGGAPVIAGVAKSMGILTVGIVTSPFSFEGRRRAVQAQE  259

Query  1069  GIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNV  1248
             GIAALR NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGISDII +PGLVNV
Sbjct  260   GIAALRNNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRGISDIIMVPGLVNV  319

Query  1249  DFADVRAIMESAGSSLMGIGTAT-GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGT  1425
             DFADVRAIM+ AGSSL+GIGTAT GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGT
Sbjct  320   DFADVRAIMKDAGSSLLGIGTATAGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGT  379

Query  1426  DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQAN  1605
             DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDP++SGQVSITLIATGF R+  D+   Q  
Sbjct  380   DLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPALSGQVSITLIATGFNRR--DEGEGQGT  437

Query  1606  QLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q A GD S+G NRRP  + DG SVEIPEFL+KKGRS +PR
Sbjct  438   QRAHGDVSLGTNRRPP-YADGGSVEIPEFLRKKGRSLFPR  476



>ref|XP_002312816.1| FtsZ 3 family protein [Populus trichocarpa]
 gb|EEE86771.1| FtsZ 3 family protein [Populus trichocarpa]
Length=477

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/460 (76%), Positives = 389/460 (85%), Gaps = 13/460 (3%)
 Frame = +1

Query  349   GRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnnsanahsanQYQSKDPFLNLHP  528
             G+    K  ++KNGS       R   +   ++CS NS+N +         SKD FL+LHP
Sbjct  29    GKTVTFKRFDKKNGSCG--AYERNVFSIPQIRCSVNSHNISPN------HSKDSFLDLHP  80

Query  529   EISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMI  708
             E+SMLR + N T    R+E+   NVTESS DSS ++N+NEAKIKV+GVGGGGSNAVNRMI
Sbjct  81    EVSMLRSDANDTYSCLRKETSGVNVTESSGDSSFMSNYNEAKIKVIGVGGGGSNAVNRMI  140

Query  709   ESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeai  888
             ESS+ GV+FWIVNTDIQAM+MSPV P++RLQ+G+ELTRGLGAGGNPD+G NAA ESK AI
Sbjct  141   ESSLTGVDFWIVNTDIQAMKMSPVLPENRLQVGKELTRGLGAGGNPDVGMNAANESKAAI  200

Query  889   eeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQE  1068
             EEA+YGADMVF+TAGMGGGTGTG APVIA  AKSMGILTVGIVTTPFSFEGRRRAVQAQE
Sbjct  201   EEALYGADMVFITAGMGGGTGTGGAPVIASVAKSMGILTVGIVTTPFSFEGRRRAVQAQE  260

Query  1069  GIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNV  1248
             GIAALR NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGISDII +PGLVNV
Sbjct  261   GIAALRNNVDTLIVIPNDKLLTAVSLSTPVTEAFNLADDILRQGVRGISDIIMVPGLVNV  320

Query  1249  DFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTD  1428
             DFADVRAIM+ AGSSL+GIGTATGK RARDAALNAIQSPLLDIGIERATGIVWNITGGTD
Sbjct  321   DFADVRAIMKDAGSSLLGIGTATGKARARDAALNAIQSPLLDIGIERATGIVWNITGGTD  380

Query  1429  LTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF-KRQEGDDKPLQAN  1605
             LTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS++GQVSITLIATGF +R EG+ K     
Sbjct  381   LTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSLTGQVSITLIATGFNRRNEGEGK---GT  437

Query  1606  QLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q A GD S+GINRRP S+ +G SVEIPEFL+KKGRS +PR
Sbjct  438   QRAHGDVSLGINRRP-SYAEGGSVEIPEFLRKKGRSLFPR  476



>ref|XP_008784023.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008784024.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=477

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/495 (72%), Positives = 402/495 (81%), Gaps = 28/495 (6%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRV---------SPVKMLNEKNGSLSLSVNRRGGL  426
             MA   P  F      C  G L + GGRV         S ++ML + +G L        G+
Sbjct  1     MATQMPC-FTPFSRQCSVGALQIPGGRVLAENWTSRNSSLEMLGKGHGLL--------GM  51

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
               S+  CS+    SAN+HS + Y +KD FLNLHPE+S+LRGE N T++  R++   +++ 
Sbjct  52    VQSVASCSSRVQCSANSHSISSYHNKDRFLNLHPEVSLLRGEKNDTVIDSRRDYVGDDIA  111

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             E+   SS  +++NEAKIKV+GVGGGGSNAVNRMIES MKGVEFW+VNTD+QAMRMSPVFP
Sbjct  112   ETLGGSSVQDDYNEAKIKVIGVGGGGSNAVNRMIESDMKGVEFWVVNTDVQAMRMSPVFP  171

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             +H LQIGQELTRGLGAGGNPDIG NAA+ESKE+I+EAVYGADM+FVTAGMGGGTGTG AP
Sbjct  172   EHCLQIGQELTRGLGAGGNPDIGMNAAEESKESIQEAVYGADMIFVTAGMGGGTGTGGAP  231

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             VI+G AKSMGILTVGIVTTPF+FEGRRR VQAQEGIAALRENVDTLIVIPNDKLLTAVSP
Sbjct  232   VISGIAKSMGILTVGIVTTPFAFEGRRRVVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  291

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKT  1326
             +TPVTEAFNLADDILRQGVRGISDIIT+PGLVNVDFADVRAIM +AGSSLMGIGTATGK+
Sbjct  292   NTPVTEAFNLADDILRQGVRGISDIITVPGLVNVDFADVRAIMVNAGSSLMGIGTATGKS  351

Query  1327  RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  1506
             RARDAALNAIQSPLLDIGIERATGIVWNITGG DLTL+EVNAAAEVIYDLVDPSANLIFG
Sbjct  352   RARDAALNAIQSPLLDIGIERATGIVWNITGGNDLTLYEVNAAAEVIYDLVDPSANLIFG  411

Query  1507  AVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEI  1683
             AVID S+SGQVSITLIATGFKRQ E   + LQ +Q           R  +S  +G+ VEI
Sbjct  412   AVIDQSLSGQVSITLIATGFKRQDEPARRTLQGSQFG---------RPTSSLTEGNMVEI  462

Query  1684  PEFLKKKGRSRYPRA  1728
             PEFL+KKGRSRYPRA
Sbjct  463   PEFLRKKGRSRYPRA  477



>ref|XP_006403772.1| hypothetical protein EUTSA_v10010342mg [Eutrema salsugineum]
 gb|ESQ45225.1| hypothetical protein EUTSA_v10010342mg [Eutrema salsugineum]
Length=469

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/409 (83%), Positives = 368/409 (90%), Gaps = 16/409 (4%)
 Frame = +1

Query  505   DPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvgggg  684
             D FLNLHPEISML          PR+ES    +TE   +SS+ +++NEA+IKV+GVGGGG
Sbjct  74    DSFLNLHPEISML---------NPRKESA--PITEDLGESSTPSSYNEARIKVIGVGGGG  122

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
             SNAVNRMIES M GVEFWIVNTDIQAMRMSPVFP +RLQIG+ELTRGLGAGGNP+IG NA
Sbjct  123   SNAVNRMIESEMVGVEFWIVNTDIQAMRMSPVFPDNRLQIGKELTRGLGAGGNPEIGMNA  182

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A+ESKEAIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTPFSFEGR
Sbjct  183   ARESKEAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTPFSFEGR  242

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RR VQAQEGIAALR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGISDII
Sbjct  243   RRTVQAQEGIAALRDNVDTLIVIPNDKLLTAVSMSTPVTEAFNLADDILRQGVRGISDII  302

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
             TIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV
Sbjct  303   TIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  362

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ-EG  1581
             WNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS +GQVSITLIATGFKRQ EG
Sbjct  363   WNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSFTGQVSITLIATGFKRQEEG  422

Query  1582  DDKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             + +PLQA Q    D S+GI RRP +S  +GSS+EIPEFLKKKGRSRYPR
Sbjct  423   EGRPLQATQ---ADTSMGIARRPSSSLAEGSSIEIPEFLKKKGRSRYPR  468



>ref|XP_010912291.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Elaeis guineensis]
 ref|XP_010912292.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Elaeis guineensis]
 ref|XP_010912293.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Elaeis guineensis]
Length=486

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/496 (73%), Positives = 405/496 (82%), Gaps = 21/496 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRV---------SPVKMLNEKNGSLSLSVNRRGGL  426
             MA   P  F      C  GVL   GGRV         S  +ML++ NG L        G 
Sbjct  1     MATPMPC-FTPFSRQCSVGVLRSPGGRVLAEKWTSRNSSFEMLSKGNGLL--------GT  51

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
               S+  CS+    SAN+HS + + +KD F NLHPE+S+LRGE N  ++  R+E   ++V 
Sbjct  52    AQSVASCSSRVQCSANSHSMSSFPNKDRFSNLHPEVSLLRGEKNDRVIDSRREYVGDDVA  111

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             E+    S  N+ N AKIKV+GVGGGGSNAVNRMI+S M+GVEFWIVNTD+QAMRMSPVFP
Sbjct  112   ETLGCLSVQNDHNGAKIKVIGVGGGGSNAVNRMIKSDMRGVEFWIVNTDVQAMRMSPVFP  171

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             +H LQIGQELT+GLGAGGNPDIG NAAKES+ +I+EAV GADMVFVTAGMGGGTGTG AP
Sbjct  172   EHCLQIGQELTKGLGAGGNPDIGMNAAKESEGSIQEAVNGADMVFVTAGMGGGTGTGGAP  231

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             VIAG AKS+GILTVGIVTTPF+FEGRRRAV AQEGIAALRENVDTLIVIPNDKLLTAVSP
Sbjct  232   VIAGIAKSVGILTVGIVTTPFTFEGRRRAVHAQEGIAALRENVDTLIVIPNDKLLTAVSP  291

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKT  1326
             +TPVTEAF+LADDILRQGVRGISDIIT+PGLVNVDFADVRAIME+AGSSLMGIGTATGK+
Sbjct  292   NTPVTEAFDLADDILRQGVRGISDIITVPGLVNVDFADVRAIMENAGSSLMGIGTATGKS  351

Query  1327  RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  1506
             RARDAALNA+QSPLLDIGIERATGIVWNITGG DLTL+EVNAAAEVIYDLVDPSANLIFG
Sbjct  352   RARDAALNAVQSPLLDIGIERATGIVWNITGGNDLTLYEVNAAAEVIYDLVDPSANLIFG  411

Query  1507  AVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRP-ASFMDGSSVE  1680
             AVID S+SGQVSITLIATGFKRQ E   + LQ +QL  GD S+GINRRP +S  +G+ VE
Sbjct  412   AVIDQSLSGQVSITLIATGFKRQDEPAGRTLQDSQLGRGD-SLGINRRPTSSLSEGNVVE  470

Query  1681  IPEFLKKKGRSRYPRA  1728
             IPEFL+KKGRSRYPRA
Sbjct  471   IPEFLRKKGRSRYPRA  486



>ref|XP_011000926.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=477

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/494 (72%), Positives = 398/494 (81%), Gaps = 28/494 (6%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSP---------VKMLNEKNGSLSLSVNRRGGL  426
             MA C       S  + P G    +G R+S           K  ++KNGS       R   
Sbjct  1     MATCL------SPPFTPSGTQISVGRRISTENRIGKTVTFKRFDKKNGSCG--AYERNVF  52

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
             +   ++CS NS+N +         SKD FL+LHPE+SMLR + N T    R+E+   NVT
Sbjct  53    SIPQIRCSVNSHNISPN------HSKDSFLDLHPEVSMLRSDANDTYYCLRKETSGVNVT  106

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ESS DSS ++N+NEAKIKV+GVGGGGSNAVNRMIESS+ GV+FWI+NTDIQAM+MSPV  
Sbjct  107   ESSGDSSFMSNYNEAKIKVIGVGGGGSNAVNRMIESSLTGVDFWIMNTDIQAMKMSPVLL  166

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             ++RLQ+G+ELTRGLGAGGNPD+G NAA ESK AIEEA+YGADMVF+TAGMGGGTGTG AP
Sbjct  167   KNRLQVGKELTRGLGAGGNPDVGMNAANESKAAIEEALYGADMVFITAGMGGGTGTGGAP  226

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             VIA  AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR NVDTLIVIPNDKLLTAVS 
Sbjct  227   VIASVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVSL  286

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKT  1326
             STPVTEAFNLADDIL QGVRGISDIIT+PGLVNVDFADVRAIM+ AGSSL+GIGTATGK 
Sbjct  287   STPVTEAFNLADDILWQGVRGISDIITVPGLVNVDFADVRAIMKDAGSSLLGIGTATGKA  346

Query  1327  RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  1506
             RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG
Sbjct  347   RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  406

Query  1507  AVIDPSISGQVSITLIATGF-KRQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEI  1683
             AVIDPS++GQV+ITLIATGF +R EG+ K     Q A GD S+GINRRP S+ +G SVEI
Sbjct  407   AVIDPSLTGQVNITLIATGFSRRDEGEGK---GTQRAHGDVSLGINRRP-SYAEGGSVEI  462

Query  1684  PEFLKKKGRSRYPR  1725
             PEFL+KKGRS +PR
Sbjct  463   PEFLRKKGRSLFPR  476



>emb|CCH47171.1| similar to cell division protein ftsZ homolog 2-1 [Lupinus angustifolius]
Length=519

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/532 (66%), Positives = 392/532 (74%), Gaps = 60/532 (11%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRV---------SPVKMLNEKNGSLSLSVNRRGGL  426
             MA C  T F  S++     VL V GGR            +KM   K G      NR+ GL
Sbjct  1     MATCMSTSFAPSNSRHLARVLAVPGGRTLTENHNGRSCFMKMYENKYGFSG--GNRKSGL  58

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
                 +KCSANSN+         Y  KDPFL+LHPE+SMLRG G+  +    ++    NV 
Sbjct  59    LQ--VKCSANSNSV--------YHGKDPFLDLHPEVSMLRGTGSGGVNNLIKDIPNGNVA  108

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ES +  SS +N+NEAKIKV+GVGGGGSNAVNRMI+SSM GVEFWIVNTD+QAMR+SPVFP
Sbjct  109   ESLEPISSSSNYNEAKIKVIGVGGGGSNAVNRMIQSSMNGVEFWIVNTDVQAMRVSPVFP  168

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
              +RLQIGQELTRGLGAGGNP+IG NAAKES+E+IEEAV+GADMVFVT      T      
Sbjct  169   DNRLQIGQELTRGLGAGGNPEIGMNAAKESRESIEEAVHGADMVFVTVEYYSITEETLVI  228

Query  967   viagtaKSM-------------------------------------GILTVGIVTTPFSF  1035
                   + +                                     GILTVGIVTTPFSF
Sbjct  229   EKRIANEKLQETLKLSLNGLFGNLAGMGGGTGTGGAPIIAAVAKSMGILTVGIVTTPFSF  288

Query  1036  EGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGIS  1215
             EGRRRAVQAQEGIAALR++VDTLIVIPNDKLLTAV+PSTPVTEAFNLADDILRQGVRGIS
Sbjct  289   EGRRRAVQAQEGIAALRDSVDTLIVIPNDKLLTAVAPSTPVTEAFNLADDILRQGVRGIS  348

Query  1216  DIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  1395
             DIITIPGLVNVDFADVRAIM  AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT
Sbjct  349   DIITIPGLVNVDFADVRAIMADAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  408

Query  1396  GIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ  1575
             GIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFG+VIDPS++GQVSITLIATGFKRQ
Sbjct  409   GIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGSVIDPSLNGQVSITLIATGFKRQ  468

Query  1576  EGDD-KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPRA  1728
             E ++ +P QA QL  G+  I INRR +SF DGS VEIPEFLKKKGRSRYPRA
Sbjct  469   EENEVRPTQATQLTQGEP-IVINRRSSSFTDGSFVEIPEFLKKKGRSRYPRA  519



>ref|XP_009115972.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic 
[Brassica rapa]
Length=463

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/470 (76%), Positives = 396/470 (84%), Gaps = 31/470 (7%)
 Frame = +1

Query  325   RGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnnsanahsanQYQSK  504
             R  +T  G RVS  +M+  K   L   V+ +    WS          ++++H+ N  QS+
Sbjct  21    RKSVTPEGSRVSCFRMVQGKRNRL---VSAQRSEPWS----------TSSSHTPNHLQSQ  67

Query  505   DPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvgggg  684
             DPFLNLHPEISML          PR++S   + TE   DSS  +N+NEA+IKV+GVGGGG
Sbjct  68    DPFLNLHPEISML---------NPRKDS---SSTEDLGDSSPPSNYNEARIKVIGVGGGG  115

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
             SNAVNRMI+S M GVEFWIVNTDIQAMRMSPVFP  RLQIG+ELTRGLGAGGNP+IG NA
Sbjct  116   SNAVNRMIQSEMIGVEFWIVNTDIQAMRMSPVFPDKRLQIGKELTRGLGAGGNPEIGMNA  175

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A+ESKEAIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTPFSFEGR
Sbjct  176   ARESKEAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTPFSFEGR  235

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RR VQAQEGIAALR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGISDII
Sbjct  236   RRTVQAQEGIAALRDNVDTLIVIPNDKLLTAVSMSTPVTEAFNLADDILRQGVRGISDII  295

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
             TIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV
Sbjct  296   TIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  355

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ-EG  1581
             WNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS SGQVSITLIATGFKRQ EG
Sbjct  356   WNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSFSGQVSITLIATGFKRQEEG  415

Query  1582  DDKPLQANQLAPGDASIGIN-RRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             + +PLQA Q    DAS+G+  RRP +SF +GSS+EIPEFLKKKGRSRYPR
Sbjct  416   EGRPLQATQ---ADASMGVTARRPSSSFSEGSSIEIPEFLKKKGRSRYPR  462



>ref|XP_010509497.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Camelina sativa]
Length=482

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/415 (81%), Positives = 372/415 (90%), Gaps = 4/415 (1%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEG-NSTMMTPRQESGIEN-VTESSKDSSSVNNFNEAKIKv  663
             Q Q++DPFLNLHPEISMLRGEG N+T+  PR+E+     VTE  ++ S+ +N+NEA+IKV
Sbjct  68    QSQAQDPFLNLHPEISMLRGEGVNNTIANPRKETSTTGPVTEDFEEPSAPSNYNEARIKV  127

Query  664   vgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGN  843
             +GVGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPV P +RLQIG+ELTRGLGAGGN
Sbjct  128   IGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIGKELTRGLGAGGN  187

Query  844   PDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTT  1023
             P+IG NAA+ESKE IEEA+YG+DMVFVTAGMGGGTGTGAAPVIAG AK+MGILTVGI TT
Sbjct  188   PEIGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKAMGILTVGIATT  247

Query  1024  PFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGV  1203
             PFSFEGRRR VQAQEG+A+LR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGV
Sbjct  248   PFSFEGRRRTVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGV  307

Query  1204  RGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGI  1383
             RGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGI
Sbjct  308   RGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGI  367

Query  1384  ERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATG  1563
             ERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DP+++GQVSITLIATG
Sbjct  368   ERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPALTGQVSITLIATG  427

Query  1564  FKRQEGDDKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             FKRQE + +   A       AS+G  RRP +SF +  SVEIPEFLKKKG SRYPR
Sbjct  428   FKRQE-EGEGRAAQMAQADAASVGATRRPSSSFRESGSVEIPEFLKKKGSSRYPR  481



>ref|XP_010505156.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Camelina sativa]
 ref|XP_010505157.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Camelina sativa]
Length=480

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/415 (81%), Positives = 372/415 (90%), Gaps = 4/415 (1%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEG-NSTMMTPRQESGIEN-VTESSKDSSSVNNFNEAKIKv  663
             Q Q++DPFLNLHPEISMLRGEG N+T+  PR+E+     VTE  ++ S+ +N+NEA+IKV
Sbjct  66    QSQAQDPFLNLHPEISMLRGEGVNNTIANPRKETSTTGPVTEDFEEPSAPSNYNEARIKV  125

Query  664   vgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGN  843
             +GVGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPV P +RLQIG+ELTRGLGAGGN
Sbjct  126   IGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIGKELTRGLGAGGN  185

Query  844   PDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTT  1023
             P+IG NAA+ESKE IEEA+YG+DMVFVTAGMGGGTGTGAAPVIAG AK+MGILTVGI TT
Sbjct  186   PEIGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKAMGILTVGIATT  245

Query  1024  PFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGV  1203
             PFSFEGRRR VQAQEG+A+LR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGV
Sbjct  246   PFSFEGRRRTVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGV  305

Query  1204  RGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGI  1383
             RGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGI
Sbjct  306   RGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGI  365

Query  1384  ERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATG  1563
             ERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DP+++GQVSITLIATG
Sbjct  366   ERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPALTGQVSITLIATG  425

Query  1564  FKRQEGDDKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             FKRQE + +   A       AS+G  RRP +SF +  SVEIPEFLKKKG SRYPR
Sbjct  426   FKRQE-EGEGRAAQMAQADAASVGATRRPSSSFRESGSVEIPEFLKKKGSSRYPR  479



>ref|XP_011000925.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=478

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/495 (72%), Positives = 398/495 (80%), Gaps = 29/495 (6%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSP---------VKMLNEKNGSLSLSVNRRGGL  426
             MA C       S  + P G    +G R+S           K  ++KNGS       R   
Sbjct  1     MATCL------SPPFTPSGTQISVGRRISTENRIGKTVTFKRFDKKNGSCG--AYERNVF  52

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
             +   ++CS NS+N +         SKD FL+LHPE+SMLR + N T    R+E+   NVT
Sbjct  53    SIPQIRCSVNSHNISPN------HSKDSFLDLHPEVSMLRSDANDTYYCLRKETSGVNVT  106

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ESS DSS ++N+NEAKIKV+GVGGGGSNAVNRMIESS+ GV+FWI+NTDIQAM+MSPV  
Sbjct  107   ESSGDSSFMSNYNEAKIKVIGVGGGGSNAVNRMIESSLTGVDFWIMNTDIQAMKMSPVLL  166

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             ++RLQ+G+ELTRGLGAGGNPD+G NAA ESK AIEEA+YGADMVF+TAGMGGGTGTG AP
Sbjct  167   KNRLQVGKELTRGLGAGGNPDVGMNAANESKAAIEEALYGADMVFITAGMGGGTGTGGAP  226

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             VIA  AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR NVDTLIVIPNDKLLTAVS 
Sbjct  227   VIASVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVSL  286

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTAT-GK  1323
             STPVTEAFNLADDIL QGVRGISDIIT+PGLVNVDFADVRAIM+ AGSSL+GIGTAT GK
Sbjct  287   STPVTEAFNLADDILWQGVRGISDIITVPGLVNVDFADVRAIMKDAGSSLLGIGTATAGK  346

Query  1324  TRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF  1503
              RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF
Sbjct  347   ARARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF  406

Query  1504  GAVIDPSISGQVSITLIATGF-KRQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVE  1680
             GAVIDPS++GQV+ITLIATGF +R EG+ K     Q A GD S+GINRRP S+ +G SVE
Sbjct  407   GAVIDPSLTGQVNITLIATGFSRRDEGEGK---GTQRAHGDVSLGINRRP-SYAEGGSVE  462

Query  1681  IPEFLKKKGRSRYPR  1725
             IPEFL+KKGRS +PR
Sbjct  463   IPEFLRKKGRSLFPR  477



>ref|XP_010516836.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Camelina sativa]
Length=480

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/415 (81%), Positives = 371/415 (89%), Gaps = 4/415 (1%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEG-NSTMMTPRQESGIEN-VTESSKDSSSVNNFNEAKIKv  663
             Q Q++DPFLNLHPEISMLRGE  N+T+  PR+E+     VTE  ++ S+ +N+NEA+IKV
Sbjct  66    QSQAQDPFLNLHPEISMLRGEVVNNTIANPRKETSTTGPVTEDFEEPSAPSNYNEARIKV  125

Query  664   vgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGN  843
             +GVGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPV P +RLQIG+ELTRGLGAGGN
Sbjct  126   IGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIGKELTRGLGAGGN  185

Query  844   PDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTT  1023
             P+IG NAA+ESKE IEEA+YG+DMVFVTAGMGGGTGTGAAPVIAG AK+MGILTVGI TT
Sbjct  186   PEIGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKAMGILTVGIATT  245

Query  1024  PFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGV  1203
             PFSFEGRRR VQAQEG+A+LR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGV
Sbjct  246   PFSFEGRRRTVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGV  305

Query  1204  RGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGI  1383
             RGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGI
Sbjct  306   RGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGI  365

Query  1384  ERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATG  1563
             ERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DP+++GQVSITLIATG
Sbjct  366   ERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPALTGQVSITLIATG  425

Query  1564  FKRQEGDDKPLQANQLAPGDASIGINRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             FKRQE + +   A       AS+G  RRP +SF +  SVEIPEFLKKKG SRYPR
Sbjct  426   FKRQE-EGEGRAAQMAQADAASVGATRRPSSSFRESGSVEIPEFLKKKGSSRYPR  479



>ref|XP_011000927.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X3 [Populus euphratica]
Length=475

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/495 (72%), Positives = 397/495 (80%), Gaps = 32/495 (6%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSP---------VKMLNEKNGSLSLSVNRRGGL  426
             MA C       S  + P G    +G R+S           K  ++KNGS       R   
Sbjct  1     MATCL------SPPFTPSGTQISVGRRISTENRIGKTVTFKRFDKKNGSCG--AYERNVF  52

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
             +   ++CS NS+N +         SKD FL+LHPE+SMLR + N T    R+E+   NVT
Sbjct  53    SIPQIRCSVNSHNISPN------HSKDSFLDLHPEVSMLRSDANDTYYCLRKETSGVNVT  106

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ESS DSS ++N+NEAKIKV+GVGGGGSNAVNRMIESS+ GV+FWI+NTDIQAM+MSPV  
Sbjct  107   ESSGDSSFMSNYNEAKIKVIGVGGGGSNAVNRMIESSLTGVDFWIMNTDIQAMKMSPVLL  166

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             ++RLQ+G+ELTRGLGAGGNPD+G NAA ESK AIEEA+YGADMVF+TAGMGGGTGTG AP
Sbjct  167   KNRLQVGKELTRGLGAGGNPDVGMNAANESKAAIEEALYGADMVFITAGMGGGTGTGGAP  226

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             VIA  AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR NVDTLIVIPNDKLLTAVS 
Sbjct  227   VIASVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVSL  286

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTAT-GK  1323
             STPVTEAFNLADDIL QGVRGISDIIT+PGLVNVDFADVRAIM+ AGSSL+GIGTAT GK
Sbjct  287   STPVTEAFNLADDILWQGVRGISDIITVPGLVNVDFADVRAIMKDAGSSLLGIGTATAGK  346

Query  1324  TRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF  1503
              RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF
Sbjct  347   ARARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF  406

Query  1504  GAVIDPSISGQVSITLIATGF-KRQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVE  1680
             GAVIDPS++GQV+ITLIATGF +R EG+ K       A GD S+GINRRP S+ +G SVE
Sbjct  407   GAVIDPSLTGQVNITLIATGFSRRDEGEGK------RAHGDVSLGINRRP-SYAEGGSVE  459

Query  1681  IPEFLKKKGRSRYPR  1725
             IPEFL+KKGRS +PR
Sbjct  460   IPEFLRKKGRSLFPR  474



>emb|CDX78122.1| BnaA09g33170D [Brassica napus]
Length=464

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/471 (76%), Positives = 395/471 (84%), Gaps = 32/471 (7%)
 Frame = +1

Query  325   RGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnnsanahsanQYQSK  504
             R  +T  G RVS  +M+  K   L   V+ +    WS          ++++H+ N  QS+
Sbjct  21    RKSVTPEGSRVSCFRMVQGKRNRL---VSAQRSEPWS----------TSSSHTPNHLQSQ  67

Query  505   DPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvgggg  684
             DPFLNLHPEISML          PR++S   +  E   DSS  +N+NEA+IKV+GVGGGG
Sbjct  68    DPFLNLHPEISML---------NPRKDS---SSAEDLGDSSPPSNYNEARIKVIGVGGGG  115

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
             SNAVNRMI+S M GVEFWIVNTDIQAMRMSPVFP  RLQIG+ELTRGLGAGGNP+IG NA
Sbjct  116   SNAVNRMIQSEMIGVEFWIVNTDIQAMRMSPVFPDKRLQIGKELTRGLGAGGNPEIGMNA  175

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A+ESKEAIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTPFSFEGR
Sbjct  176   ARESKEAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTPFSFEGR  235

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RR VQAQEGIAALR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGISDII
Sbjct  236   RRTVQAQEGIAALRDNVDTLIVIPNDKLLTAVSMSTPVTEAFNLADDILRQGVRGISDII  295

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTAT-GKTRARDAALNAIQSPLLDIGIERATGI  1401
             TIPGLVNVDFADVRAIM +AGSSLMGIGTAT GKTRARDAALNAIQSPLLDIGIERATGI
Sbjct  296   TIPGLVNVDFADVRAIMANAGSSLMGIGTATAGKTRARDAALNAIQSPLLDIGIERATGI  355

Query  1402  VWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ-E  1578
             VWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS SGQVSITLIATGFKRQ E
Sbjct  356   VWNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSFSGQVSITLIATGFKRQEE  415

Query  1579  GDDKPLQANQLAPGDASIGI-NRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             G+ +PLQA Q    DAS+G+  RRP +SF +GSS+EIPEFLKKKGRSRYPR
Sbjct  416   GEGRPLQATQ---ADASMGVTTRRPSSSFSEGSSIEIPEFLKKKGRSRYPR  463



>emb|CDX73607.1| BnaC08g23960D [Brassica napus]
Length=464

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/471 (76%), Positives = 395/471 (84%), Gaps = 32/471 (7%)
 Frame = +1

Query  325   RGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnnsanahsanQYQSK  504
             R  +T  G RVS  +M+  K   L   V+ +    WS          ++++H+ N  QS+
Sbjct  21    RKSVTPEGSRVSCFRMVQGKRNRL---VSAQRSEPWS----------TSSSHTPNHLQSQ  67

Query  505   DPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvgggg  684
             DPFLNLHPEISML          PR++S   + TE   DSS  +N+NEA+IKV+GVGGGG
Sbjct  68    DPFLNLHPEISML---------NPRKDS---SSTEDLGDSSPPSNYNEARIKVIGVGGGG  115

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
             SNAVNRMI+S M GVEFWIVNTDIQAMRMSPVFP  RLQIG+ELTRGLGAGGNP+IG NA
Sbjct  116   SNAVNRMIQSEMIGVEFWIVNTDIQAMRMSPVFPDKRLQIGKELTRGLGAGGNPEIGMNA  175

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A+ESKEAIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG AK+MGILTVGIVTTPFSFEGR
Sbjct  176   ARESKEAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTPFSFEGR  235

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RR VQAQEGIAALR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGISDII
Sbjct  236   RRTVQAQEGIAALRDNVDTLIVIPNDKLLTAVSMSTPVTEAFNLADDILRQGVRGISDII  295

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTAT-GKTRARDAALNAIQSPLLDIGIERATGI  1401
             TIPGLVNVDFADVRAIM +AGSSLMGIGTAT GKTRARDAALNAIQSPLLDIGIERATGI
Sbjct  296   TIPGLVNVDFADVRAIMANAGSSLMGIGTATAGKTRARDAALNAIQSPLLDIGIERATGI  355

Query  1402  VWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ-E  1578
             VWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS SGQVSITLIATGFKRQ E
Sbjct  356   VWNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSFSGQVSITLIATGFKRQEE  415

Query  1579  GDDKPLQANQLAPGDASIG-INRRP-ASFMDGSSVEIPEFLKKKGRSRYPR  1725
             G+ +PLQA Q    DA++G   RRP +SF +GSS+EIPEFLKKKGRSRYPR
Sbjct  416   GEGRPLQATQ---ADATMGATTRRPSSSFSEGSSIEIPEFLKKKGRSRYPR  463



>ref|XP_009141570.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Brassica rapa]
Length=477

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/494 (72%), Positives = 399/494 (81%), Gaps = 28/494 (6%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA      F  SDT     +LTV+   VSP+     +  SL ++  ++ G          
Sbjct  1     MASYVSPCFTPSDTR----LLTVLRKNVSPLG----RAHSLKMTETKKNGF--------F  44

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGN-------STMMTPRQE-SGIENVTE  609
              +       S     S+DPFLNLHPEIS+LRGEG        +T+  PR+E S +  +TE
Sbjct  45    VAAAQRPESSPRHSHSQDPFLNLHPEISLLRGEGGGGGGGGANTVSNPRKEASSMVPLTE  104

Query  610   SSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQ  789
                + S+ + +NEA+IKV+GVGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPV  +
Sbjct  105   DFDEPSAPSGYNEARIKVIGVGGGGSNAVNRMIESEMMGVEFWIVNTDIQAMRMSPVLSE  164

Query  790   HRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapv  969
             +RLQIG+ELTRGLGAGGNP+IG NAAKESKEAIEEA+YG+DMVFVTAGMGGGTGTGAAPV
Sbjct  165   NRLQIGKELTRGLGAGGNPEIGMNAAKESKEAIEEALYGSDMVFVTAGMGGGTGTGAAPV  224

Query  970   iagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPS  1149
             IAG AK+MGILTVGI TTPFSFEGRRRAVQAQEG+A+LR+NVDTLIVIPNDKLLTAVS S
Sbjct  225   IAGIAKAMGILTVGIATTPFSFEGRRRAVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQS  284

Query  1150  TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTR  1329
             TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK+R
Sbjct  285   TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSR  344

Query  1330  ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGA  1509
             ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGA
Sbjct  345   ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFGA  404

Query  1510  VIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGD-ASIGINRRP-ASFMDGSSVEI  1683
             V+DPS++GQVSITLIATGFKRQE  +   +A Q+A  D AS G  RRP +SF +G SVEI
Sbjct  405   VVDPSLTGQVSITLIATGFKRQEEGEG--RAAQMAQADTASTGATRRPSSSFREGGSVEI  462

Query  1684  PEFLKKKGRSRYPR  1725
             PEFLKKKG SRYPR
Sbjct  463   PEFLKKKGSSRYPR  476



>emb|CDP15408.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/343 (91%), Positives = 330/343 (96%), Gaps = 1/343 (0%)
 Frame = +1

Query  703   MIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeske  882
             MIESSMKGVEFWIVNTD+QAMRMSPVFP+ RLQIGQELTRGLGAGGNPDIG NAAKESKE
Sbjct  1     MIESSMKGVEFWIVNTDVQAMRMSPVFPEQRLQIGQELTRGLGAGGNPDIGMNAAKESKE  60

Query  883   aieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQA  1062
             AIE+AVYG+DMVFVTAGMGGGTGTG APVIAG AK+MGILTVGIVTTPFSFEGRRRAVQA
Sbjct  61    AIEDAVYGSDMVFVTAGMGGGTGTGGAPVIAGIAKAMGILTVGIVTTPFSFEGRRRAVQA  120

Query  1063  QEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLV  1242
             QEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLV
Sbjct  121   QEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLV  180

Query  1243  NVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGG  1422
             NVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGG
Sbjct  181   NVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGG  240

Query  1423  TDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ-EGDDKPLQ  1599
             +DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPS+ GQVSITLIATGFKRQ E + +PLQ
Sbjct  241   SDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSLGGQVSITLIATGFKRQEESEGRPLQ  300

Query  1600  ANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPRA  1728
             A Q+A GDA +G+NRRP+SF++G SVEIPEFL+KKGRSRYPRA
Sbjct  301   AGQMAQGDAGLGMNRRPSSFLEGGSVEIPEFLRKKGRSRYPRA  343



>ref|XP_009408276.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009408277.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009408280.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009408281.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=476

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/414 (79%), Positives = 364/414 (88%), Gaps = 4/414 (1%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             Y  KDPFL+LHPE+S+LRGE    +   R +    ++ E+ +DS++ +N+NEAKIKV+GV
Sbjct  65    YHDKDPFLHLHPEVSLLRGERKDAVSDARNDKTGASIVENLRDSAAQDNYNEAKIKVIGV  124

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNA+NRMIESSMKGVEFWIVNTD+QAMRMSPVFP++RLQIG+ELTRGLGAGGNPDI
Sbjct  125   GGGGSNAINRMIESSMKGVEFWIVNTDVQAMRMSPVFPENRLQIGRELTRGLGAGGNPDI  184

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAA ESKE+IE A+  ADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFS
Sbjct  185   GMNAANESKESIEMALASADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFS  244

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGR+R VQAQEGIAALR NVDTLIVIPNDKLLTAVSP+TPV EAFNLADDILRQGVRGI
Sbjct  245   FEGRKRTVQAQEGIAALRNNVDTLIVIPNDKLLTAVSPNTPVAEAFNLADDILRQGVRGI  304

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA
Sbjct  305   SDIITVPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  364

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG DLTL+EVNAAAEVIYDLVDP ANLIFGAVID S+ GQVSITLIATGF+R
Sbjct  365   TGIVWNITGGNDLTLYEVNAAAEVIYDLVDPGANLIFGAVIDQSLCGQVSITLIATGFRR  424

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPAS-FMDGSSVEIPEFLKKKGRSRYPRA  1728
             Q E   +PLQ  Q+  G  ++G NR  +S   +GS +EIPEFL+KKGRS YPRA
Sbjct  425   QDESGSRPLQGAQI--GGDNLGKNRHTSSPLTEGSMIEIPEFLRKKGRSHYPRA  476



>gb|KCW48328.1| hypothetical protein EUGRSUZ_K02046 [Eucalyptus grandis]
 gb|KCW48329.1| hypothetical protein EUGRSUZ_K02046 [Eucalyptus grandis]
 gb|KCW48330.1| hypothetical protein EUGRSUZ_K02046 [Eucalyptus grandis]
Length=450

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/457 (75%), Positives = 385/457 (84%), Gaps = 20/457 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIG---------GRVSPVKMLNEKNGSLSLSVNRRGGL  426
             MA C+      S T  P G+   +G         GRV+ ++M N K+G +    +     
Sbjct  1     MASCSSVRIAPSVTPVPLGMSGNLGDRFALENQLGRVNFLRMSNRKSGLM----DAYQTY  56

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
             + S  KCS NS+N +       Y SKDPFLNLHPE+SMLRGEGNST+  PR++S   +VT
Sbjct  57    SSSQFKCSVNSHNVS------PYPSKDPFLNLHPEVSMLRGEGNSTISNPRKDSSSGSVT  110

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ES +D+ + N +NEAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAMRMSPVFP
Sbjct  111   ESLRDTPAPNTYNEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMRMSPVFP  170

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             ++RLQIGQELTRGLGAGGNP+IG NAAKESKE +EEA+YGADMVFVTAGMGGGTGTG AP
Sbjct  171   ENRLQIGQELTRGLGAGGNPEIGMNAAKESKETVEEALYGADMVFVTAGMGGGTGTGGAP  230

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             +IAG AKSMGILTVGIVTTPFSFEGRRR VQAQEG+A+LR+NVDTLIVIPNDKLLTAVS 
Sbjct  231   IIAGVAKSMGILTVGIVTTPFSFEGRRRTVQAQEGVASLRDNVDTLIVIPNDKLLTAVSQ  290

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKT  1326
             STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  AGSSLMGIGTATGK+
Sbjct  291   STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMADAGSSLMGIGTATGKS  350

Query  1327  RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  1506
             RA+DAALNAIQSPLLDIGIERATGIVWNITGG+DLTL+EVNAAAEVIYDLVDP+ANLIFG
Sbjct  351   RAKDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLYEVNAAAEVIYDLVDPNANLIFG  410

Query  1507  AVIDPSISGQVSITLIATGFKRQ-EGDDKPLQANQLA  1614
             AVIDPS+SGQVSITLIATGFKRQ E D + LQA + A
Sbjct  411   AVIDPSLSGQVSITLIATGFKRQEESDSRLLQAGRSA  447



>emb|CDY43739.1| BnaAnng07540D [Brassica napus]
Length=477

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/494 (72%), Positives = 400/494 (81%), Gaps = 28/494 (6%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA      F  SDT     +LTV+   VSP+     +  SL ++ +++ G          
Sbjct  1     MATYVSPCFTPSDTR----LLTVLRKNVSPLG----RAHSLKMTESKKNGF--------F  44

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGN-----STMMTPRQE-SGIENVTESS  615
              +       S     S+DPFLNLHPEIS+LRGEG      +T+  PR+E S +  +TE  
Sbjct  45    VAAAQRPESSPRHSHSQDPFLNLHPEISLLRGEGGVGGGANTVSNPRKEASSMVPLTEDF  104

Query  616   KDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHR  795
              + S+ + +NEA+IKV+GVGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPV  ++R
Sbjct  105   DEPSAPSGYNEARIKVIGVGGGGSNAVNRMIESEMMGVEFWIVNTDIQAMRMSPVLSENR  164

Query  796   LQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapvia  975
             LQIG+ELTRGLGAGGNP+IG NAAKESKEAIEEA+YG+DMVFVTAGMGGGTGTGAAPVIA
Sbjct  165   LQIGKELTRGLGAGGNPEIGMNAAKESKEAIEEALYGSDMVFVTAGMGGGTGTGAAPVIA  224

Query  976   gtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTP  1155
             G AK+MGILTVGI TTPFSFEGRRRAVQAQEG+A+LR+NVDTLIVIPNDKLLTAVS STP
Sbjct  225   GIAKAMGILTVGIATTPFSFEGRRRAVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTP  284

Query  1156  VTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTAT-GKTRA  1332
             VTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTAT GK+RA
Sbjct  285   VTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATAGKSRA  344

Query  1333  RDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAV  1512
             RDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGAV
Sbjct  345   RDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFGAV  404

Query  1513  IDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGD-ASIGINRRP--ASFMDGSSVEI  1683
             +DPS++GQVSITLIATGFKRQE  +   +A Q+A  D AS G  RRP  +SF +G SVEI
Sbjct  405   VDPSLTGQVSITLIATGFKRQEEGEG--RAAQMAQADTASTGATRRPSSSSFREGGSVEI  462

Query  1684  PEFLKKKGRSRYPR  1725
             PEFLKKKG SRYPR
Sbjct  463   PEFLKKKGSSRYPR  476



>ref|XP_011000928.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X4 [Populus euphratica]
Length=464

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/495 (71%), Positives = 392/495 (79%), Gaps = 43/495 (9%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSP---------VKMLNEKNGSLSLSVNRRGGL  426
             MA C       S  + P G    +G R+S           K  ++KNGS       R   
Sbjct  1     MATCL------SPPFTPSGTQISVGRRISTENRIGKTVTFKRFDKKNGSCG--AYERNVF  52

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
             +   ++CS NS+N +         SKD FL+LHPE+SMLR + N              VT
Sbjct  53    SIPQIRCSVNSHNISPN------HSKDSFLDLHPEVSMLRSDAN--------------VT  92

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ESS DSS ++N+NEAKIKV+GVGGGGSNAVNRMIESS+ GV+FWI+NTDIQAM+MSPV  
Sbjct  93    ESSGDSSFMSNYNEAKIKVIGVGGGGSNAVNRMIESSLTGVDFWIMNTDIQAMKMSPVLL  152

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             ++RLQ+G+ELTRGLGAGGNPD+G NAA ESK AIEEA+YGADMVF+TAGMGGGTGTG AP
Sbjct  153   KNRLQVGKELTRGLGAGGNPDVGMNAANESKAAIEEALYGADMVFITAGMGGGTGTGGAP  212

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             VIA  AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR NVDTLIVIPNDKLLTAVS 
Sbjct  213   VIASVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVSL  272

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTAT-GK  1323
             STPVTEAFNLADDIL QGVRGISDIIT+PGLVNVDFADVRAIM+ AGSSL+GIGTAT GK
Sbjct  273   STPVTEAFNLADDILWQGVRGISDIITVPGLVNVDFADVRAIMKDAGSSLLGIGTATAGK  332

Query  1324  TRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF  1503
              RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF
Sbjct  333   ARARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF  392

Query  1504  GAVIDPSISGQVSITLIATGF-KRQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVE  1680
             GAVIDPS++GQV+ITLIATGF +R EG+ K     Q A GD S+GINRRP S+ +G SVE
Sbjct  393   GAVIDPSLTGQVNITLIATGFSRRDEGEGK---GTQRAHGDVSLGINRRP-SYAEGGSVE  448

Query  1681  IPEFLKKKGRSRYPR  1725
             IPEFL+KKGRS +PR
Sbjct  449   IPEFLRKKGRSLFPR  463



>dbj|BAA96782.1| LlFtsZ [Lilium longiflorum]
Length=468

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/420 (80%), Positives = 366/420 (87%), Gaps = 11/420 (3%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEGNSTMMTPRQES-----GIENVTESSKDSSSVNNFNEAK  654
             ++ + D FL+LHPEISMLRG  N  ++ PR++       I+++ ESS  SS   ++N AK
Sbjct  53    KFNNSDQFLHLHPEISMLRGPTNDAIVDPRKKEKSGGDAIDSLQESSVTSS---DYNGAK  109

Query  655   IKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGA  834
             IKV+GVGGGGSNAVNRMI SSM GVEFWIVNTD+QAMRMSPV+P++RLQIGQELTRGLGA
Sbjct  110   IKVIGVGGGGSNAVNRMIASSMDGVEFWIVNTDVQAMRMSPVYPENRLQIGQELTRGLGA  169

Query  835   GGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGI  1014
             GGNPDIG NAAKESK +IEE+V GADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGI
Sbjct  170   GGNPDIGMNAAKESKVSIEESVSGADMVFVTAGMGGGTGTGGAPVIAGVAKSMGILTVGI  229

Query  1015  VTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILR  1194
             VTTPF FEGRRR VQAQEGIAALR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLADDILR
Sbjct  230   VTTPFMFEGRRRTVQAQEGIAALRNNVDTLIVIPNDKLLTAVSPNTPVTEAFNLADDILR  289

Query  1195  QGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLD  1374
             QGVRGISDIIT+PGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNA+QSPLLD
Sbjct  290   QGVRGISDIITVPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAVQSPLLD  349

Query  1375  IGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLI  1554
             IGIERATGIVWNITGG DLTL+EVNAAAEVIYDLVDP+ANLIFGAVIDPSISGQVSITLI
Sbjct  350   IGIERATGIVWNITGGNDLTLYEVNAAAEVIYDLVDPAANLIFGAVIDPSISGQVSITLI  409

Query  1555  ATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMD-GSSVEIPEFLKKKGRSRYPRA  1728
             ATGFKRQ E + +  Q  QL  G  ++GINRRP+S M  G  VEIP FL+KK  SR PRA
Sbjct  410   ATGFKRQDETEGQKSQGTQLGLG-GNLGINRRPSSSMTMGGIVEIPHFLRKKAGSRNPRA  468



>emb|CBI30290.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/343 (91%), Positives = 329/343 (96%), Gaps = 2/343 (1%)
 Frame = +1

Query  703   MIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeske  882
             MIESSM+GVEFWIVNTD+QAMRMSPV+ +HRLQIGQELTRGLGAGGNPDIG NAAKESKE
Sbjct  1     MIESSMQGVEFWIVNTDVQAMRMSPVYTEHRLQIGQELTRGLGAGGNPDIGMNAAKESKE  60

Query  883   aieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQA  1062
             AIEEAVYGADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFSFEGRRRAVQA
Sbjct  61    AIEEAVYGADMVFVTAGMGGGTGTGGAPVIAGVAKSMGILTVGIVTTPFSFEGRRRAVQA  120

Query  1063  QEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLV  1242
             QEGIAALR++VDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRGISDII IPGLV
Sbjct  121   QEGIAALRDSVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRGISDIIMIPGLV  180

Query  1243  NVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGG  1422
             NVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGG
Sbjct  181   NVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGG  240

Query  1423  TDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDD-KPLQ  1599
             +DLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPS+SGQVSITLIATGFKRQE ++ +PLQ
Sbjct  241   SDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSLSGQVSITLIATGFKRQEENEGRPLQ  300

Query  1600  ANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPRA  1728
             A+QLA GDA+ G++RRP SF +G SVEIPEFLKKKGRSRYPRA
Sbjct  301   ASQLAQGDANFGMSRRP-SFTEGGSVEIPEFLKKKGRSRYPRA  342



>ref|XP_007015822.1| Tubulin/FtsZ family protein isoform 1 [Theobroma cacao]
 gb|EOY33441.1| Tubulin/FtsZ family protein isoform 1 [Theobroma cacao]
Length=478

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/487 (70%), Positives = 384/487 (79%), Gaps = 17/487 (3%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLN--------EKNGSLSLSVNRRGGLN  429
             MA C    F+  D+    GV  +        + +N         K GSL     +R   +
Sbjct  1     MAACLSPCFVPFDSRASVGVFALSRKYSLKERWINGASFLKGFSKRGSLGACQRQRDFPS  60

Query  430   WSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTE  609
             ++  KCS NSNN++         SK  FL+LHPE+SML GE N  +   R E+  +N+T+
Sbjct  61    FTKFKCSVNSNNASPN------HSKASFLDLHPEVSMLSGEENDALSNLRNENYSKNITK  114

Query  610   SSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQ  789
             S  + SS +N++EAKIKVVGVGGGGSNAVNRMIESSMKGVEF IVNTD QAM+MSPV P+
Sbjct  115   SLSEPSSPSNYSEAKIKVVGVGGGGSNAVNRMIESSMKGVEFLIVNTDAQAMKMSPVLPK  174

Query  790   HRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapv  969
             +RLQIG+ELTRGLGAGGNP+ G NAA ES+ AIE+AV+GADMVFVTAGMGGGTGTG APV
Sbjct  175   NRLQIGKELTRGLGAGGNPETGMNAASESRAAIEDAVHGADMVFVTAGMGGGTGTGGAPV  234

Query  970   iagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPS  1149
             IAG AKS GILTVGIVTTPFSFEGR+RA+QAQEGIA LRENVDTLIV+PNDKLLTAVS S
Sbjct  235   IAGIAKSKGILTVGIVTTPFSFEGRKRAIQAQEGIATLRENVDTLIVVPNDKLLTAVSQS  294

Query  1150  TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTR  1329
             TPVTEAFNLADDIL QGVRGISDIIT+PGLVNVDFADV AIM+  GSSLMGIGTATGK+R
Sbjct  295   TPVTEAFNLADDILWQGVRGISDIITVPGLVNVDFADVHAIMKDTGSSLMGIGTATGKSR  354

Query  1330  ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGA  1509
             ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGA
Sbjct  355   ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPNANLIFGA  414

Query  1510  VIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPE  1689
             VIDPS+SGQVSITLIATGFK QE  D   +  QL P + SIG NRR     DGS  EIPE
Sbjct  415   VIDPSLSGQVSITLIATGFKHQE--DSEGKGAQLVPAEVSIGFNRRTPDTDDGSP-EIPE  471

Query  1690  FLKKKGR  1710
             FL+KKGR
Sbjct  472   FLRKKGR  478



>ref|XP_003579697.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
[Brachypodium distachyon]
Length=460

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/412 (78%), Positives = 358/412 (87%), Gaps = 6/412 (1%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             ++ KD FL+LHPE+++LRGE ++ ++  R  S   +  E        N++NEAKIKVVGV
Sbjct  53    FKKKDSFLDLHPEVTLLRGEQSNDVINSRNASSEVSTLEGLGVPPDRNDYNEAKIKVVGV  112

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIE SM GVEFWIVNTD+QA+RMSPV  Q+RLQIGQELTRGLGAGGNPDI
Sbjct  113   GGGGSNAVNRMIEFSMNGVEFWIVNTDVQAIRMSPVHSQNRLQIGQELTRGLGAGGNPDI  172

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKES E+I+EA+YGADMVFVTAGMGGGTGTG  PVIAG AKSMGILTVGIVTTPFS
Sbjct  173   GMNAAKESCESIQEALYGADMVFVTAGMGGGTGTGGVPVIAGIAKSMGILTVGIVTTPFS  232

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRAVQAQEGIAALR +VDTLIVIPNDKLL+AVSP+TPVTEAFNLADDILRQG+RGI
Sbjct  233   FEGRRRAVQAQEGIAALRNSVDTLIVIPNDKLLSAVSPNTPVTEAFNLADDILRQGIRGI  292

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM++AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERA
Sbjct  293   SDIITVPGLVNVDFADVRAIMQNAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERA  352

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGGTDLTLFEVNAAAE+IYDLVDP+ANLIFGAVIDPS+SGQVSITLIATGFKR
Sbjct  353   TGIVWNITGGTDLTLFEVNAAAEIIYDLVDPNANLIFGAVIDPSLSGQVSITLIATGFKR  412

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q E + +  +  Q   GD     N R  S  D S VEIPEFL+++G SR+PR
Sbjct  413   QDEPEGRTSKGAQQMHGD-----NGRHPSSTDASKVEIPEFLRRRGPSRFPR  459



>ref|XP_004965609.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X1 [Setaria italica]
 ref|XP_004965610.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X2 [Setaria italica]
Length=464

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/412 (78%), Positives = 362/412 (88%), Gaps = 6/412 (1%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             +Q KD FL+LHPE+S+LRG+ N  ++ P + +   +  E        +++NEAKIKVVGV
Sbjct  57    FQKKDSFLDLHPEVSLLRGKKNVEVVDPLKGASDGSPLEGLGVPPDRSDYNEAKIKVVGV  116

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIESSM GVEFWIVNTD+QA+RMSPV P +RLQIGQELTRGLGAGGNPDI
Sbjct  117   GGGGSNAVNRMIESSMNGVEFWIVNTDVQAIRMSPVLPHNRLQIGQELTRGLGAGGNPDI  176

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKES E+I+EA+YGADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFS
Sbjct  177   GMNAAKESSESIQEALYGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFS  236

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRAVQAQEGIAALR +VDTLIVIPNDKLL+AVSP+TPVTEAFNLADDILRQG+RGI
Sbjct  237   FEGRRRAVQAQEGIAALRNSVDTLIVIPNDKLLSAVSPNTPVTEAFNLADDILRQGIRGI  296

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM++AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERA
Sbjct  297   SDIITVPGLVNVDFADVRAIMQNAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERA  356

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG DLTLFEVNAAAE+IYDLVDP+ANLIFGAVIDPS+SGQVSITLIATGFKR
Sbjct  357   TGIVWNITGGMDLTLFEVNAAAEIIYDLVDPNANLIFGAVIDPSLSGQVSITLIATGFKR  416

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q E + +  +  Q   G+      RRP+S  +GS VEIPEFL+++G SR+PR
Sbjct  417   QDEPEGRTSKGGQQIQGEN----GRRPSS-GEGSMVEIPEFLRRRGPSRFPR  463



>gb|AFW59980.1| hypothetical protein ZEAMMB73_019582 [Zea mays]
Length=470

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/435 (75%), Positives = 366/435 (84%), Gaps = 5/435 (1%)
 Frame = +1

Query  424   LNWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENV  603
             L     +C A   ++ +    + ++ KD FL LHPE+S+LRGE  S  + P + S    +
Sbjct  39    LGHCHFRCCAGPRSANSFKKKDSFEKKDSFLELHPEVSLLRGE-KSAEVVPMKGSSDGGL  97

Query  604   TESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVF  783
              E        N+++EAKIKVVGVGGGGSNAVNRMIESSM GVEFWIVNTD+QA+RMSPV 
Sbjct  98    LEGLGVPPDRNDYSEAKIKVVGVGGGGSNAVNRMIESSMNGVEFWIVNTDVQAIRMSPVL  157

Query  784   PQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaa  963
             P +RLQIGQELTRGLGAGGNPDIG NAAKES E+I+EA++GADMVFVTAGMGGGTGTG A
Sbjct  158   PHNRLQIGQELTRGLGAGGNPDIGMNAAKESSESIQEALFGADMVFVTAGMGGGTGTGGA  217

Query  964   pviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVS  1143
             PVIAG AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR +VDTLIVIPNDKLL+AVS
Sbjct  218   PVIAGIAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRNSVDTLIVIPNDKLLSAVS  277

Query  1144  PSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGK  1323
             P+TPVTEAFNLADDILRQG+RGISDIIT+PGLVNVDFADVRAIM++AGSSLMGIGTATGK
Sbjct  278   PNTPVTEAFNLADDILRQGIRGISDIITVPGLVNVDFADVRAIMQNAGSSLMGIGTATGK  337

Query  1324  TRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF  1503
             +RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAE+IYDLVDP+ANLIF
Sbjct  338   SRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEIIYDLVDPNANLIF  397

Query  1504  GAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIGIN-RRPASFMDGSSVE  1680
             GAVIDPS+SGQVSITLIATGFKRQ   D+P       P     G N RRP+     S+VE
Sbjct  398   GAVIDPSLSGQVSITLIATGFKRQ---DEPEGRVSKVPLGGQQGENGRRPSPAEGSSTVE  454

Query  1681  IPEFLKKKGRSRYPR  1725
             IPEFL+++G SR+PR
Sbjct  455   IPEFLRRRGPSRFPR  469



>ref|XP_002447361.1| hypothetical protein SORBIDRAFT_06g033640 [Sorghum bicolor]
 gb|EES11689.1| hypothetical protein SORBIDRAFT_06g033640 [Sorghum bicolor]
Length=461

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/411 (79%), Positives = 361/411 (88%), Gaps = 7/411 (2%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             ++ KD FL LHPE+S+LRGE  +  + P + S   ++ E        N++NEAKIKVVGV
Sbjct  57    FKKKDSFLELHPEVSLLRGE-KTVDVVPMKGSTDGSLLEGPGVPPDRNDYNEAKIKVVGV  115

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIESSM GVEFWIVNTD+QA+RMSPV P +RLQIGQELTRGLGAGGNPDI
Sbjct  116   GGGGSNAVNRMIESSMNGVEFWIVNTDVQAIRMSPVLPHNRLQIGQELTRGLGAGGNPDI  175

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKES E+I+EA++GADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFS
Sbjct  176   GMNAAKESSESIQEALFGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFS  235

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRAVQAQEGIAALR +VDTLIVIPNDKLL+AVSP+TPVTEAFNLADDILRQG+RGI
Sbjct  236   FEGRRRAVQAQEGIAALRNSVDTLIVIPNDKLLSAVSPNTPVTEAFNLADDILRQGIRGI  295

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM++AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERA
Sbjct  296   SDIITVPGLVNVDFADVRAIMQNAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERA  355

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGGTDLTLFEVNAAAE+IYDLVDP+ANLIFGAVIDPS+SGQVSITLIATGFKR
Sbjct  356   TGIVWNITGGTDLTLFEVNAAAEIIYDLVDPNANLIFGAVIDPSLSGQVSITLIATGFKR  415

Query  1573  QEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q   D+P    + + G       RRP+S  +GS VEIPEFL+++G SR+PR
Sbjct  416   Q---DEP--EGRASKGGQQGENGRRPSS-AEGSMVEIPEFLRRRGPSRFPR  460



>gb|KCW90554.1| hypothetical protein EUGRSUZ_A02664 [Eucalyptus grandis]
Length=431

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/349 (89%), Positives = 332/349 (95%), Gaps = 5/349 (1%)
 Frame = +1

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
             SNAVNRMIES+MKGVEFWIVNTDIQAMRMSPVFP +RLQIGQELTRGLGAGGNP+IG NA
Sbjct  87    SNAVNRMIESAMKGVEFWIVNTDIQAMRMSPVFPDNRLQIGQELTRGLGAGGNPEIGMNA  146

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             AKESKEAIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG AKSMGILTVGIVTTPFSFEGR
Sbjct  147   AKESKEAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKSMGILTVGIVTTPFSFEGR  206

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             +R VQAQEGIA+LR+NVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII
Sbjct  207   KRTVQAQEGIASLRDNVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  266

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
             TIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV
Sbjct  267   TIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  326

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ-EG  1581
             WNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS+SGQVSITLIATGFKRQ E 
Sbjct  327   WNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPSLSGQVSITLIATGFKRQEES  386

Query  1582  DDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPRA  1728
             + + LQ+ Q+  GD   G+NRRP+S+ +G+SVEIPEFLKKKGRSR+PRA
Sbjct  387   EGRSLQSGQIQ-GD---GLNRRPSSYGEGTSVEIPEFLKKKGRSRFPRA  431



>ref|XP_008663752.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Zea mays]
 gb|AFW59979.1| hypothetical protein ZEAMMB73_019582 [Zea mays]
Length=467

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/434 (75%), Positives = 367/434 (85%), Gaps = 6/434 (1%)
 Frame = +1

Query  424   LNWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENV  603
             L     +C A   ++ +    + ++ KD FL LHPE+S+LRGE  S  + P + S    +
Sbjct  39    LGHCHFRCCAGPRSANSFKKKDSFEKKDSFLELHPEVSLLRGE-KSAEVVPMKGSSDGGL  97

Query  604   TESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVF  783
              E        N+++EAKIKVVGVGGGGSNAVNRMIESSM GVEFWIVNTD+QA+RMSPV 
Sbjct  98    LEGLGVPPDRNDYSEAKIKVVGVGGGGSNAVNRMIESSMNGVEFWIVNTDVQAIRMSPVL  157

Query  784   PQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaa  963
             P +RLQIGQELTRGLGAGGNPDIG NAAKES E+I+EA++GADMVFVTAGMGGGTGTG A
Sbjct  158   PHNRLQIGQELTRGLGAGGNPDIGMNAAKESSESIQEALFGADMVFVTAGMGGGTGTGGA  217

Query  964   pviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVS  1143
             PVIAG AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR +VDTLIVIPNDKLL+AVS
Sbjct  218   PVIAGIAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRNSVDTLIVIPNDKLLSAVS  277

Query  1144  PSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGK  1323
             P+TPVTEAFNLADDILRQG+RGISDIIT+PGLVNVDFADVRAIM++AGSSLMGIGTATGK
Sbjct  278   PNTPVTEAFNLADDILRQGIRGISDIITVPGLVNVDFADVRAIMQNAGSSLMGIGTATGK  337

Query  1324  TRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF  1503
             +RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAE+IYDLVDP+ANLIF
Sbjct  338   SRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEIIYDLVDPNANLIF  397

Query  1504  GAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEI  1683
             GAVIDPS+SGQVSITLIATGFKRQ   D+P    +++ G       RRP+     S+VEI
Sbjct  398   GAVIDPSLSGQVSITLIATGFKRQ---DEP--EGRVSKGGQQGENGRRPSPAEGSSTVEI  452

Query  1684  PEFLKKKGRSRYPR  1725
             PEFL+++G SR+PR
Sbjct  453   PEFLRRRGPSRFPR  466



>gb|EMS54959.1| Cell division protein ftsZ-like protein 2-1, chloroplastic [Triticum 
urartu]
Length=464

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/412 (78%), Positives = 357/412 (87%), Gaps = 6/412 (1%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             +Q KD FL+LHPE+S+LRGE N   + PR+ S   +  E      S +++N AKIKVVGV
Sbjct  57    FQKKDSFLDLHPEVSLLRGEQNDEAINPRKASSDGSTLEGLGVPPSQDDYNAAKIKVVGV  116

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIE SM GVEFWIVNTD+QA+RMSPV  Q+RLQIGQELTRGLGAGGNPDI
Sbjct  117   GGGGSNAVNRMIEYSMNGVEFWIVNTDVQAIRMSPVHSQNRLQIGQELTRGLGAGGNPDI  176

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKES E+IEEA++GADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFS
Sbjct  177   GMNAAKESCESIEEALHGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFS  236

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRAVQAQEGI+ALR +VDTLIVIPNDKLL+AVSP+TPVTEAFNLADDIL QG+RGI
Sbjct  237   FEGRRRAVQAQEGISALRNSVDTLIVIPNDKLLSAVSPNTPVTEAFNLADDILWQGIRGI  296

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM++AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERA
Sbjct  297   SDIITVPGLVNVDFADVRAIMQNAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERA  356

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG DLTLFEVNAAAEVIYDLVDP+ANLIFG+VIDPS++GQVSITLIATGFKR
Sbjct  357   TGIVWNITGGNDLTLFEVNAAAEVIYDLVDPNANLIFGSVIDPSLNGQVSITLIATGFKR  416

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q E +   ++  Q   GD     N R  S   GS VEIPEFL+++G SR+PR
Sbjct  417   QDEAESHTVKGGQQMQGD-----NGRHPSSTGGSKVEIPEFLRRRGPSRFPR  463



>gb|EEE59586.1| hypothetical protein OsJ_11892 [Oryza sativa Japonica Group]
Length=452

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/412 (77%), Positives = 360/412 (87%), Gaps = 6/412 (1%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             +Q KD FL+LHPE+++LRG   + ++  R+ S   +  E         +++ AKIKVVGV
Sbjct  45    FQKKDSFLDLHPEVTLLRGGDEAAVVATRKGSPNGSPLEGLGAPPDHCDYDGAKIKVVGV  104

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIESSM GVEFWIVNTD+QA+RMSPV PQ+RLQIGQELTRGLGAGGNPDI
Sbjct  105   GGGGSNAVNRMIESSMNGVEFWIVNTDVQAIRMSPVLPQNRLQIGQELTRGLGAGGNPDI  164

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKES E+I+EA+YGADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFS
Sbjct  165   GMNAAKESVESIQEALYGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFS  224

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRAVQAQEGIAALR +VDTLIVIPNDKLL+AVSP+TPVTEAFNLADDILRQG+RGI
Sbjct  225   FEGRRRAVQAQEGIAALRNSVDTLIVIPNDKLLSAVSPNTPVTEAFNLADDILRQGIRGI  284

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM++AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERA
Sbjct  285   SDIITVPGLVNVDFADVRAIMQNAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERA  344

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG D+TLFEVN+AAE+IYDLVDP+ANLIFGAVIDPS++GQVSITLIATGFKR
Sbjct  345   TGIVWNITGGADMTLFEVNSAAEIIYDLVDPNANLIFGAVIDPSLNGQVSITLIATGFKR  404

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q E + +  +  Q   GD      RRP+S  +GS +EIPEFL+++G SR+PR
Sbjct  405   QDEPEGRTTKGGQQTQGDN----GRRPSS-AEGSMIEIPEFLRRRGPSRFPR  451



>ref|NP_001050766.1| Os03g0646100 [Oryza sativa Japonica Group]
 gb|ABF97878.1| Cell division protein ftsZ, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12680.1| Os03g0646100 [Oryza sativa Japonica Group]
 dbj|BAG94641.1| unnamed protein product [Oryza sativa Japonica Group]
Length=452

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/412 (77%), Positives = 360/412 (87%), Gaps = 6/412 (1%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             +Q KD FL+LHPE+++LRG   + ++  R+ S   +  E         +++ AKIKVVGV
Sbjct  45    FQKKDSFLDLHPEVTLLRGGDEAAVVATRKGSPNGSPLEGLGAPPDHCDYDGAKIKVVGV  104

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIESSM GVEFWIVNTD+QA+RMSPV PQ+RLQIGQELTRGLGAGGNPDI
Sbjct  105   GGGGSNAVNRMIESSMNGVEFWIVNTDVQAIRMSPVLPQNRLQIGQELTRGLGAGGNPDI  164

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKES E+I+EA+YGADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFS
Sbjct  165   GMNAAKESVESIQEALYGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFS  224

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRAVQAQEGIAALR +VDTLIVIPNDKLL+AVSP+TPVTEAFNLADDILRQG+RGI
Sbjct  225   FEGRRRAVQAQEGIAALRNSVDTLIVIPNDKLLSAVSPNTPVTEAFNLADDILRQGIRGI  284

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM++AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERA
Sbjct  285   SDIITVPGLVNVDFADVRAIMQNAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERA  344

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG D+TLFEVN+AAE+IYDLVDP+ANLIFGAVIDPS++GQVSITLIATGFKR
Sbjct  345   TGIVWNITGGADMTLFEVNSAAEIIYDLVDPNANLIFGAVIDPSLNGQVSITLIATGFKR  404

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q E + +  +  Q   GD      RRP+S  +GS +EIPEFL+++G SR+PR
Sbjct  405   QDEPEGRTTKGGQQTQGDN----GRRPSS-AEGSMIEIPEFLRRRGPSRFPR  451



>gb|EEC75829.1| hypothetical protein OsI_12805 [Oryza sativa Indica Group]
Length=452

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/412 (77%), Positives = 360/412 (87%), Gaps = 6/412 (1%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             +Q KD FL+LHPE+++LRG   + ++  R+ S   +  E         +++ AKIKVVGV
Sbjct  45    FQKKDSFLDLHPEVTLLRGGDEAAVVATRKGSPNGSPLEGLGAPPDHCDYDGAKIKVVGV  104

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIESSM GVEFWIVNTD+QA+RMSPV PQ+RLQIGQELTRGLGAGGNPDI
Sbjct  105   GGGGSNAVNRMIESSMNGVEFWIVNTDVQAIRMSPVLPQNRLQIGQELTRGLGAGGNPDI  164

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKES E+I+EA+YGADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFS
Sbjct  165   GMNAAKESVESIQEALYGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFS  224

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRAVQAQEGIAALR +VDTLIVIPNDKLL+AVSP+TPVTEAFNLADDILRQG+RGI
Sbjct  225   FEGRRRAVQAQEGIAALRNSVDTLIVIPNDKLLSAVSPNTPVTEAFNLADDILRQGIRGI  284

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM++AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERA
Sbjct  285   SDIITVPGLVNVDFADVRAIMQNAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERA  344

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG D+TLFEVN+AAE+IYDLVDP+ANLIFGAVIDP+++GQVSITLIATGFKR
Sbjct  345   TGIVWNITGGADMTLFEVNSAAEIIYDLVDPNANLIFGAVIDPTLNGQVSITLIATGFKR  404

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q E + +  +  Q   GD      RRP+S  +GS +EIPEFL+++G SR+PR
Sbjct  405   QDEPEGRTTKGGQQTQGDN----GRRPSS-AEGSMIEIPEFLRRRGPSRFPR  451



>gb|ABR17393.1| unknown [Picea sitchensis]
Length=572

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/415 (78%), Positives = 364/415 (88%), Gaps = 4/415 (1%)
 Frame = +1

Query  493   YQSK-DPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvg  669
             Y S+ DPFL+LHPE+S+LRG+G +   + ++E   ++V    +D S   N NEAKIKV+G
Sbjct  158   YSSRPDPFLDLHPEVSILRGDGRNMTSSTKKEIA-KHVPSPLEDFSPPANNNEAKIKVIG  216

Query  670   vggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPD  849
             VGGGGSNAVNRMIES MKGVEFWIVNTD+QAM+MSP+ P++RLQIG+ELTRGLGAGGNP+
Sbjct  217   VGGGGSNAVNRMIESEMKGVEFWIVNTDVQAMKMSPISPENRLQIGKELTRGLGAGGNPE  276

Query  850   IGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPF  1029
             IG NAAKES+  +EEAV GADMVFVTAGMGGGTGTG APVIAG AKS+GILTVGIVTTPF
Sbjct  277   IGMNAAKESRSVVEEAVSGADMVFVTAGMGGGTGTGGAPVIAGVAKSLGILTVGIVTTPF  336

Query  1030  SFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRG  1209
             SFEGRRRAVQAQEGIAALR NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRG
Sbjct  337   SFEGRRRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRG  396

Query  1210  ISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIER  1389
             ISDIIT+PGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLD+GIER
Sbjct  397   ISDIITVPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDVGIER  456

Query  1390  ATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFK  1569
             ATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVID S++GQVSITLIATGFK
Sbjct  457   ATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPNANLIFGAVIDESLTGQVSITLIATGFK  516

Query  1570  RQEG-DDKPLQAN-QLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPRA  1728
              Q+  + K  Q   Q + GD + G +   +   +G++VEIPEFLK+KGRSRYPRA
Sbjct  517   GQDAMEGKAAQGTRQFSYGDVNSGGSHGSSVPTNGATVEIPEFLKRKGRSRYPRA  571



>dbj|BAJ86189.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/412 (78%), Positives = 355/412 (86%), Gaps = 6/412 (1%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             +Q KD FL+LHPE+S+LRGE N   + PR+ S   +         S +++N AKIKVVGV
Sbjct  57    FQKKDSFLDLHPEVSLLRGEQNDESINPRKASSDGSTLGGLGVPPSQDDYNAAKIKVVGV  116

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIE S+ GVEFWIVNTD+QA+RMSPV  Q+RLQIGQELTRGLGAGGNPDI
Sbjct  117   GGGGSNAVNRMIEYSINGVEFWIVNTDVQAIRMSPVHSQNRLQIGQELTRGLGAGGNPDI  176

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKES E+IEEA++GADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFS
Sbjct  177   GMNAAKESCESIEEALHGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFS  236

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRAVQAQEGIAALR +VDTLIVIPNDKLL+AVSP+TPV EAFNLADDIL QG+RGI
Sbjct  237   FEGRRRAVQAQEGIAALRNSVDTLIVIPNDKLLSAVSPNTPVMEAFNLADDILWQGIRGI  296

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM++AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERA
Sbjct  297   SDIITVPGLVNVDFADVRAIMQNAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERA  356

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFG+VIDPS++GQVSITLIATGFKR
Sbjct  357   TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPNANLIFGSVIDPSLNGQVSITLIATGFKR  416

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q E + +  +  Q   GD     N R  S   GS VEIPEFL+K+G SR+ R
Sbjct  417   QDEAEGRTAKGGQQMQGD-----NGRDPSSTGGSKVEIPEFLRKRGPSRFLR  463



>ref|XP_003568351.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Brachypodium distachyon]
Length=473

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/413 (77%), Positives = 353/413 (85%), Gaps = 7/413 (2%)
 Frame = +1

Query  496   QSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvg  675
             ++KD   +LHPEISML GE N  +  P +E GI   TES  D+S    +NE +IKV+GVG
Sbjct  64    RTKDTLYDLHPEISMLYGEDNGAIAAPSKEEGIGKATESLPDTSITYRYNEPRIKVIGVG  123

Query  676   gggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIG  855
             GGGSNAVNRMIESSMKGVEFWIVNTD QAMRMSP+ P++RL IGQELTRGLGAGGNP+IG
Sbjct  124   GGGSNAVNRMIESSMKGVEFWIVNTDFQAMRMSPLDPENRLPIGQELTRGLGAGGNPEIG  183

Query  856   TNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSF  1035
              NAAKES+E +E+AV GADMVFVTAGMGGGTGTG AP+IAG AKSMGILTVGIVTTPFSF
Sbjct  184   MNAAKESQELVEQAVSGADMVFVTAGMGGGTGTGGAPIIAGIAKSMGILTVGIVTTPFSF  243

Query  1036  EGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGIS  1215
             EGRRRA+QAQEGIA+LR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLADDILRQGVRGIS
Sbjct  244   EGRRRALQAQEGIASLRSNVDTLIVIPNDKLLTAVSPNTPVTEAFNLADDILRQGVRGIS  303

Query  1216  DIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  1395
             DIIT+PGLVNVDFADVR++M  AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT
Sbjct  304   DIITVPGLVNVDFADVRSVMSDAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  363

Query  1396  GIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ  1575
             GIVWNITGG+DLTL EVNAAAEVIYDLVDP ANLIFG+VIDPS +GQVSITLIATGFKRQ
Sbjct  364   GIVWNITGGSDLTLTEVNAAAEVIYDLVDPGANLIFGSVIDPSYTGQVSITLIATGFKRQ  423

Query  1576  -EGDDKPLQANQLAPGDASIGINR--RPASFMDGSSVEIPEFLKKKGRSRYPR  1725
              EG  +  Q      GD + G N     +S  +G  ++IPEFL++KGRS + R
Sbjct  424   EEGQSRSAQVG----GDNNHGRNTWFSSSSQEEGPKLQIPEFLQRKGRSGFSR  472



>gb|KEH24136.1| cell division FtsZ-like protein [Medicago truncatula]
Length=464

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/455 (74%), Positives = 375/455 (82%), Gaps = 22/455 (5%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRV---------SPVKMLNEKNGSLSLSVNRRGGL  426
             MA C    F  +++    GVL V GGR          S    ++E   + S   NR+ GL
Sbjct  8     MASC----FAPTNSRNSAGVLAVNGGRKLLENHHINKSCFVKIHENKFAFSSVNNRKCGL  63

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTM---MTPRQESGIE  597
                      ++    +   +  + SKDPFL+LHPEISMLRGEG+S +     PR+++   
Sbjct  64    FQ-----VKSTGLPNSHSVSPYHHSKDPFLDLHPEISMLRGEGSSGLNNSTRPRKDTSGG  118

Query  598   NVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSP  777
             +V E  +D+ + +N+NEAKIKV+GVGGGGSNAVNRMIESSM GVEFWIVNTD+QAMRMSP
Sbjct  119   DVMEGLEDNLTPSNYNEAKIKVIGVGGGGSNAVNRMIESSMNGVEFWIVNTDVQAMRMSP  178

Query  778   VFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtg  957
             V  ++RL IGQELTRGLGAGGNP+IG NAAKESK++I+EAVYGADMVFVTAGMGGGTGTG
Sbjct  179   VNSENRLPIGQELTRGLGAGGNPEIGMNAAKESKDSIQEAVYGADMVFVTAGMGGGTGTG  238

Query  958   aapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTA  1137
             AAPVIAG  KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR+NVDTLIVIPNDKLLTA
Sbjct  239   AAPVIAGITKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDNVDTLIVIPNDKLLTA  298

Query  1138  VSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTAT  1317
             VS STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTAT
Sbjct  299   VSQSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTAT  358

Query  1318  GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANL  1497
             GKTRARDAALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANL
Sbjct  359   GKTRARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANL  418

Query  1498  IFGAVIDPSISGQVSITLIATGFKRQ-EGDDKPLQ  1599
             IFGAVIDPS+SGQVSITLIATGFKRQ E + +P+Q
Sbjct  419   IFGAVIDPSLSGQVSITLIATGFKRQEESEARPVQ  453



>ref|XP_004961927.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Setaria italica]
Length=474

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/413 (76%), Positives = 355/413 (86%), Gaps = 7/413 (2%)
 Frame = +1

Query  496   QSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvg  675
             ++KD   +LHPEIS+L GE N       +E GI+   E   D+ +   +NE +IKV+GVG
Sbjct  65    RTKDTLYDLHPEISLLYGEDNGAASVSSKEQGIDAAAERLVDAPASYRYNEPRIKVIGVG  124

Query  676   gggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIG  855
             GGGSNAVNRMIESSMKGVEFWIVNTD QAMRMSP+ P++RLQIGQELTRGLGAGGNP+IG
Sbjct  125   GGGSNAVNRMIESSMKGVEFWIVNTDFQAMRMSPIDPENRLQIGQELTRGLGAGGNPEIG  184

Query  856   TNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSF  1035
              NAAKES+E +E+AV GADMVFVTAGMGGGTGTG AP+IAG AKSMGILTVGIVTTPFSF
Sbjct  185   MNAAKESQELVEQAVAGADMVFVTAGMGGGTGTGGAPIIAGIAKSMGILTVGIVTTPFSF  244

Query  1036  EGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGIS  1215
             EGRRRA+QAQEGIA+LR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLADDILRQGVRGIS
Sbjct  245   EGRRRALQAQEGIASLRSNVDTLIVIPNDKLLTAVSPNTPVTEAFNLADDILRQGVRGIS  304

Query  1216  DIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  1395
             DIIT+PGLVNVDFADVR++M  AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT
Sbjct  305   DIITVPGLVNVDFADVRSVMSDAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  364

Query  1396  GIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ  1575
             GIVWNITGG DLTL EVNAAAEVIYDLVDP ANLIFG+VIDPS +GQVSITLIATGFKRQ
Sbjct  365   GIVWNITGGNDLTLTEVNAAAEVIYDLVDPGANLIFGSVIDPSYTGQVSITLIATGFKRQ  424

Query  1576  -EGDDKPLQANQLAPGDASIGIN--RRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
              E +++  QA     GD++ G +    P S  +G +++IPEFL++KGRS +PR
Sbjct  425   EESENRSSQAG----GDSNRGHSGWFSPTSQEEGPALQIPEFLQRKGRSGFPR  473



>ref|XP_008363816.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Malus domestica]
Length=428

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/426 (77%), Positives = 362/426 (85%), Gaps = 6/426 (1%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA     Y   SDT  P G+LT +GG +     L   +   SL V+   G     LK S 
Sbjct  2     MATYASNYVTLSDTRNPVGILTRLGGHLGTENHLGRVS---SLKVSXEYGFMGVTLKSSL  58

Query  454   -nsnnsanahsanQYQS-KDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSS  627
                  S N+ S   YQ+ +DPFLNLHPE+S+LRGEGN+T+  PR++   E VTES  D S
Sbjct  59    PQVKCSINSKSVGSYQNNRDPFLNLHPEVSLLRGEGNNTLSNPRKDISGEGVTESLSDKS  118

Query  628   SVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIG  807
             S +N  EAKIKV+GVGGGGSNAVNRMIES+MKGVEFWI+NTDIQAM+MSPVFP++R+QIG
Sbjct  119   SPSN-GEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWILNTDIQAMKMSPVFPENRIQIG  177

Query  808   QELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaK  987
             QELTRGLGAGGNPDIG NAAKESKE+IEEA+YG+DMVFVTAGMGGGTGTG AP++AG AK
Sbjct  178   QELTRGLGAGGNPDIGMNAAKESKESIEEALYGSDMVFVTAGMGGGTGTGGAPIVAGVAK  237

Query  988   SMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEA  1167
             SMGILTVG+VTTPFSFEGR+RAVQAQEGIAALRENVDTLIVIPNDKLLTAVS STPVTEA
Sbjct  238   SMGILTVGVVTTPFSFEGRKRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSQSTPVTEA  297

Query  1168  FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAAL  1347
             FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAAL
Sbjct  298   FNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAAL  357

Query  1348  NAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSI  1527
             NAIQSPLLDIGIERATGIVWNITGGTDLTL+EVNAAAEVIYDLVDP+ANLIFGAV DPS+
Sbjct  358   NAIQSPLLDIGIERATGIVWNITGGTDLTLYEVNAAAEVIYDLVDPTANLIFGAVTDPSL  417

Query  1528  SGQVSI  1545
             SGQVSI
Sbjct  418   SGQVSI  423



>ref|XP_008656239.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Zea mays]
Length=473

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/477 (69%), Positives = 377/477 (79%), Gaps = 19/477 (4%)
 Frame = +1

Query  307   SDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGG-LNWSLLKCsansnnsanahs  483
             S   CP G+      R++  K L  ++ S     +  GG   +S   CSANS  +     
Sbjct  11    SSCHCPLGI-----SRINVGKTLLGESASFQRKKSFSGGSYRFSRFDCSANSRRAGPR--  63

Query  484   anQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKv  663
                 ++KD   +LHPEIS+L GE N       +E GI+   E   D+S    +NE +IKV
Sbjct  64    ----RTKDTLYDLHPEISLLYGEDNGAATLSSKEQGIDTTAERLVDTSPSYRYNEPRIKV  119

Query  664   vgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGN  843
             +GVGGGGSNAVNRMIESSMKGVEFWIVNTD QAMRMSP+ P++RLQIGQELTRGLGAGGN
Sbjct  120   IGVGGGGSNAVNRMIESSMKGVEFWIVNTDFQAMRMSPIEPENRLQIGQELTRGLGAGGN  179

Query  844   PDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTT  1023
             P+IG NAAKES+E +E+AV GADMVFVTAGMGGGTGTG AP+IAG AKSMGILTVGIVTT
Sbjct  180   PEIGMNAAKESQELVEQAVAGADMVFVTAGMGGGTGTGGAPIIAGIAKSMGILTVGIVTT  239

Query  1024  PFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGV  1203
             PFSFEGRRRA+QAQEGIA+LR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLADDILRQGV
Sbjct  240   PFSFEGRRRALQAQEGIASLRSNVDTLIVIPNDKLLTAVSPNTPVTEAFNLADDILRQGV  299

Query  1204  RGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGI  1383
             RGISDIIT+PGLVNVDFADVR++M  AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGI
Sbjct  300   RGISDIITVPGLVNVDFADVRSVMSDAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGI  359

Query  1384  ERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATG  1563
             ERATGIVWNITGG DLTL EVNAAAEVIYDLVDP ANLIFG+VIDPS +GQVSITLIATG
Sbjct  360   ERATGIVWNITGGNDLTLTEVNAAAEVIYDLVDPGANLIFGSVIDPSYTGQVSITLIATG  419

Query  1564  FKRQ-EGDDKPLQANQLAPGDASIGIN--RRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             FKRQ E + +  QA +    D++ G +    P S  +G +++IPEFL++KGR  +PR
Sbjct  420   FKRQEESESRSSQAGE----DSNRGRSGWFSPTSQEEGHALQIPEFLQRKGRPGFPR  472



>ref|XP_006650344.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Oryza brachyantha]
Length=465

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/412 (76%), Positives = 361/412 (88%), Gaps = 6/412 (1%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             +Q K+ FL+LHPE+++LRGE     +  R+E+   +  E     S  + ++ AKIKV+GV
Sbjct  58    FQKKESFLDLHPEVTLLRGEHGDEDVASRKEALNGSPLEGLGVPSDQDGYDGAKIKVIGV  117

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIESSM GVEFWIVNTD+QA+RMSPV PQ+RLQIGQELTRGLGAGGNPDI
Sbjct  118   GGGGSNAVNRMIESSMNGVEFWIVNTDVQAIRMSPVHPQNRLQIGQELTRGLGAGGNPDI  177

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKES E+I++A+YGADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFS
Sbjct  178   GMNAAKESVESIQDALYGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFS  237

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRAVQAQEGIAALR +VDTLIVIPNDKLL+AVSP+TPVTEAFNLADD+LRQG+RGI
Sbjct  238   FEGRRRAVQAQEGIAALRNSVDTLIVIPNDKLLSAVSPNTPVTEAFNLADDVLRQGIRGI  297

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDI+T+PGLVNVDFADVRAIM++AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERA
Sbjct  298   SDIVTVPGLVNVDFADVRAIMQNAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERA  357

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG D+TL EVNAAAE+IYDLVDP+ANLIFGAVIDPS++GQVSITLIATGFKR
Sbjct  358   TGIVWNITGGADMTLLEVNAAAEIIYDLVDPNANLIFGAVIDPSLNGQVSITLIATGFKR  417

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q E + +  + +Q   GD      RRP+S  +GS VEIPEFL+++G SR+PR
Sbjct  418   QDEPEGRTSKGDQQMQGDN----GRRPSS-AEGSMVEIPEFLRRRGPSRFPR  464



>ref|XP_009404365.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=467

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/413 (78%), Positives = 356/413 (86%), Gaps = 15/413 (4%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             Y SKDPFLN  P+  +LRGE +               T SS++  S N +NEAKIKV+GV
Sbjct  67    YDSKDPFLNRQPDGFLLRGEYSDI------------TTVSSREWPSPNEYNEAKIKVIGV  114

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIESSMKGVEFWIVNTD+QAMRMS ++P+HRLQIG+ELT+GLGAGGNPD+
Sbjct  115   GGGGSNAVNRMIESSMKGVEFWIVNTDVQAMRMSSIYPEHRLQIGEELTKGLGAGGNPDV  174

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKESKE I+EAVYGADMVFVTAGMGGGTGTG AP+IAG AKSMG+LTVGIVTTPFS
Sbjct  175   GMNAAKESKELIQEAVYGADMVFVTAGMGGGTGTGGAPIIAGIAKSMGVLTVGIVTTPFS  234

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRAVQAQEGIAALR++VDTLIVIPNDKLL+AVSP+TP+ EAFNLADDILRQGVRGI
Sbjct  235   FEGRRRAVQAQEGIAALRDSVDTLIVIPNDKLLSAVSPNTPMIEAFNLADDILRQGVRGI  294

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM  AGSSLMGIGT TGKTRARDAALNAIQSPLLDIGIERA
Sbjct  295   SDIITVPGLVNVDFADVRAIMADAGSSLMGIGTGTGKTRARDAALNAIQSPLLDIGIERA  354

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG+DLTL+EVNAAAEVIYDLVDPSAN+IFGAVID S+SGQVSITLIATG KR
Sbjct  355   TGIVWNITGGSDLTLYEVNAAAEVIYDLVDPSANIIFGAVIDQSLSGQVSITLIATGLKR  414

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPAS-FMDGSSVEIPEFLKKKGRSRYPR  1725
             Q E + + LQ  QL  GD ++G+ RR  S   +G  VEIPEFL+KK  SR PR
Sbjct  415   QDEQEGRNLQGAQLGHGD-NLGMKRRSNSRSTEGGIVEIPEFLRKKVHSRSPR  466



>dbj|BAJ99368.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   530 bits (1365),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 314/412 (76%), Positives = 345/412 (84%), Gaps = 4/412 (1%)
 Frame = +1

Query  499   SKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESS--KDSSSVNNFNEAKIKvvgv  672
             +KD   +LHPEISML GE N  +  P +E G+    E+    D+S    +NE +IKV+GV
Sbjct  63    TKDTMYDLHPEISMLYGEDNGAIAAPSKEQGLGKAIETLPLADASIAYRYNEPRIKVIGV  122

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GG GSNAVNRMIESSMKGVEFWIVNTD QAMRMSP+ P +RL IGQELTRGLGAGGNP+I
Sbjct  123   GGAGSNAVNRMIESSMKGVEFWIVNTDFQAMRMSPIDPANRLPIGQELTRGLGAGGNPEI  182

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKES+E +E AV GADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFS
Sbjct  183   GMNAAKESQELVERAVSGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFS  242

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRA+QAQEGIAALR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLADDILRQGVRGI
Sbjct  243   FEGRRRALQAQEGIAALRSNVDTLIVIPNDKLLTAVSPNTPVTEAFNLADDILRQGVRGI  302

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVR++M  AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA
Sbjct  303   SDIITVPGLVNVDFADVRSVMSDAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  362

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG+DLTL EVNAAAEVIYDLVDP ANLIFG+VIDPS +GQVSITLIATGFKR
Sbjct  363   TGIVWNITGGSDLTLTEVNAAAEVIYDLVDPGANLIFGSVIDPSYTGQVSITLIATGFKR  422

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q E + +P QA               P S  +G  ++IPEFL++KGRS + R
Sbjct  423   QEESEGRPAQAGGDGNRGRGGSRFSSP-SQDEGPKLQIPEFLQRKGRSGFSR  473



>ref|XP_002523799.1| Cell division protein ftsZ, putative [Ricinus communis]
 gb|EEF38525.1| Cell division protein ftsZ, putative [Ricinus communis]
Length=491

 Score =   530 bits (1365),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 330/487 (68%), Positives = 385/487 (79%), Gaps = 26/487 (5%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPV---------KMLNEKNGSLSLSVNRRGGL  426
             MA C   +F       P  +  + G R+S           K+  +K+G+      ++ GL
Sbjct  1     MATCISPHFCV-----PVDLQILFGERISKATQTSRLISSKISYKKSGACHAC--QKTGL  53

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
             ++  +KCS NS+N +         SKD F +LHPE+SMLRG+ +      R+E    N T
Sbjct  54    SFPQIKCSINSHNVSPN------NSKDTFSDLHPEVSMLRGKEDDLYSGWRKERSEGNTT  107

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
               S+DSS   N +EAKIKV+GVGGGGSNAVNRMIESSM GVEFW+VNTDIQAM+ S VFP
Sbjct  108   RESRDSSISRNSDEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWVVNTDIQAMKTSLVFP  167

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             ++RLQIG+ELTRGLGAGG PD+G NAA ESK AIEEA+ GADMVFVTAGMGGGTGTG AP
Sbjct  168   ENRLQIGKELTRGLGAGGKPDVGKNAANESKLAIEEALSGADMVFVTAGMGGGTGTGGAP  227

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             V+AG +KS+G+LTVGIVTTPFSFEGR+R +QAQEGIAALR NVDTLIVIPNDKLL AVSP
Sbjct  228   VVAGISKSLGLLTVGIVTTPFSFEGRKRTIQAQEGIAALRNNVDTLIVIPNDKLLAAVSP  287

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKT  1326
             STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADV+AIM+ +GSSLMGIGTATGK+
Sbjct  288   STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVQAIMKDSGSSLMGIGTATGKS  347

Query  1327  RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFG  1506
             RARDAALNAIQSPLLDIGIERATG+VWNITGG+DL LFEVN AAEVIYDLVDPSANLIFG
Sbjct  348   RARDAALNAIQSPLLDIGIERATGVVWNITGGSDLKLFEVNTAAEVIYDLVDPSANLIFG  407

Query  1507  AVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIGINRRPASFMDGS-SVEI  1683
             AVID S+SGQVSITLIATGF R++  D   + +Q A  DAS+G+ RR AS+  GS ++EI
Sbjct  408   AVIDQSLSGQVSITLIATGFNRRDESDG--KDSQHACSDASVGM-RRHASYGSGSRTLEI  464

Query  1684  PEFLKKK  1704
             P+FL+K+
Sbjct  465   PKFLRKE  471



>gb|EMS50261.1| Cell division protein ftsZ-like protein 2-1, chloroplastic [Triticum 
urartu]
Length=473

 Score =   528 bits (1361),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 318/413 (77%), Positives = 351/413 (85%), Gaps = 9/413 (2%)
 Frame = +1

Query  502   KDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESS--KDSSSVNNFNEAKIKvvgvg  675
             KD   +LHPEISML GE N  +  P +E GI    E+    D+S    +NE +IKV+GVG
Sbjct  64    KDTMYDLHPEISMLYGEDNGAVAAPSKEQGIGKAIETLPLADASIAYRYNEPRIKVIGVG  123

Query  676   gggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIG  855
             G GSNAVNRMIESSMKGVEFWIVNTD QAMRMSP+ P +RL IGQELTRGLGAGGNP+IG
Sbjct  124   GAGSNAVNRMIESSMKGVEFWIVNTDFQAMRMSPIDPANRLPIGQELTRGLGAGGNPEIG  183

Query  856   TNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSF  1035
              NAAKES+E +E+AV GADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFSF
Sbjct  184   MNAAKESQELVEKAVSGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFSF  243

Query  1036  EGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGIS  1215
             EGRRRA+QAQEGIAALR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLADDILRQGVRGIS
Sbjct  244   EGRRRALQAQEGIAALRSNVDTLIVIPNDKLLTAVSPNTPVTEAFNLADDILRQGVRGIS  303

Query  1216  DIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  1395
             DIIT+PGLVNVDFADVR++M  AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT
Sbjct  304   DIITVPGLVNVDFADVRSVMSDAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  363

Query  1396  GIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ  1575
             GIVWNITGG+DLTL EVNAAAEVIYDLVDP ANLIFG+VIDPS +GQVSITLIATGFKRQ
Sbjct  364   GIVWNITGGSDLTLTEVNAAAEVIYDLVDPGANLIFGSVIDPSYTGQVSITLIATGFKRQ  423

Query  1576  EGDD-KPLQANQLAPGDASIGINRRPASFM--DGSSVEIPEFLKKKGRSRYPR  1725
             E  + +P QA     GD + G + R +S    +G  ++IPEFL++KGRS + R
Sbjct  424   EESEVRPAQAG----GDVNRGRSSRFSSSSQDEGPKLQIPEFLQRKGRSGFSR  472



>gb|EMT27316.1| Cell division protein ftsZ [Aegilops tauschii]
Length=457

 Score =   526 bits (1356),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 312/412 (76%), Positives = 349/412 (85%), Gaps = 13/412 (3%)
 Frame = +1

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             +Q KD FL+LHPE+S+LRGE N   + PR+ S   +  E      S +++N A+IK VGV
Sbjct  57    FQKKDSFLDLHPEVSLLRGEQNDEAINPRKPSSGGSTLEGLGVPPSQDDYNAAQIKGVGV  116

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             G G       MIE SM GVEFWIVNTD+QA+RMSPV  Q+RLQIGQELTRGLGAGGNPDI
Sbjct  117   GVG-------MIEYSMNGVEFWIVNTDVQAIRMSPVHSQNRLQIGQELTRGLGAGGNPDI  169

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAAKES E+IEEA++GADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFS
Sbjct  170   GMNAAKESCESIEEALHGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFS  229

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRRAVQAQEGI+ALR +VDTLIVIPNDKLL+AVSP+TPVTEAFNLADDIL QG+RGI
Sbjct  230   FEGRRRAVQAQEGISALRNSVDTLIVIPNDKLLSAVSPNTPVTEAFNLADDILWQGIRGI  289

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM++AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERA
Sbjct  290   SDIITVPGLVNVDFADVRAIMQNAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERA  349

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKR  1572
             TGIVWNITGG DLTLFEVNAAAEVIYDLVDP+ANLIFG+VIDPS++GQVSITLIATGFKR
Sbjct  350   TGIVWNITGGNDLTLFEVNAAAEVIYDLVDPNANLIFGSVIDPSLNGQVSITLIATGFKR  409

Query  1573  Q-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             Q E + +  +  Q   GD      R PAS   GS VEIPEFL+++G SR+PR
Sbjct  410   QDEAEGRTAKGGQQMQGDNG----RHPAS-TGGSKVEIPEFLRRRGPSRFPR  456



>gb|EEC79304.1| hypothetical protein OsI_20135 [Oryza sativa Indica Group]
Length=472

 Score =   527 bits (1357),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 312/412 (76%), Positives = 352/412 (85%), Gaps = 7/412 (2%)
 Frame = +1

Query  496   QSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvg  675
             ++KD   +LHPEISML GE N  +  P +E  I   TE  +D S+ + ++E +IKV+GVG
Sbjct  65    RTKDALYDLHPEISMLYGEDNGAVAAPGKEQDIVKTTERLEDVSASHRYSEPRIKVIGVG  124

Query  676   gggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIG  855
             GGGSNAVNRMIES MKGVEFWIVNTD QAMRMSP+ P ++LQIGQELTRGLGAGGNP+IG
Sbjct  125   GGGSNAVNRMIESDMKGVEFWIVNTDFQAMRMSPIDPDNKLQIGQELTRGLGAGGNPEIG  184

Query  856   TNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSF  1035
              NAAKES+E +E+AV GADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPF+F
Sbjct  185   MNAAKESQELVEQAVSGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFAF  244

Query  1036  EGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGIS  1215
             EGRRRA+QAQEGIA+LR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLADDILRQGVRGIS
Sbjct  245   EGRRRALQAQEGIASLRSNVDTLIVIPNDKLLTAVSPNTPVTEAFNLADDILRQGVRGIS  304

Query  1216  DIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  1395
             DIIT+PGLVNVDFADVR++M  AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT
Sbjct  305   DIITVPGLVNVDFADVRSVMSDAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  364

Query  1396  GIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ  1575
             GIVWNITGG DLTL EVNAAAEVIYDLVDP ANLIFG+VIDPS +GQVSITLIATGFKRQ
Sbjct  365   GIVWNITGGNDLTLTEVNAAAEVIYDLVDPGANLIFGSVIDPSYTGQVSITLIATGFKRQ  424

Query  1576  EGDDKPLQANQLAPGDASIGINRRPASFM--DGSSVEIPEFLKKKGRSRYPR  1725
             E  +     ++ A GD S   +   +S    +G +++IPEFL++KGRS + R
Sbjct  425   EEAE-----SRQAGGDNSRSHSSWFSSSSQEEGPTLQIPEFLQRKGRSGFSR  471



>ref|NP_001055677.1| Os05g0443800 [Oryza sativa Japonica Group]
 gb|AAT69612.1| putative cell division protein FtsZ [Oryza sativa Japonica Group]
 dbj|BAF17591.1| Os05g0443800 [Oryza sativa Japonica Group]
 dbj|BAG97769.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63888.1| hypothetical protein OsJ_18713 [Oryza sativa Japonica Group]
Length=472

 Score =   526 bits (1356),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 311/412 (75%), Positives = 352/412 (85%), Gaps = 7/412 (2%)
 Frame = +1

Query  496   QSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvg  675
             ++KD   +LHPEISML GE N  +  P +E  I   TE  +D S+ + ++E +IKV+GVG
Sbjct  65    RTKDALYDLHPEISMLYGEDNGAVAAPGKEQDIVKTTERLEDVSASHRYSEPRIKVIGVG  124

Query  676   gggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIG  855
             GGGSNAVNRMIES MKGVEFWIVNTD QAMRMSP+ P ++LQIGQELTRGLGAGGNP+IG
Sbjct  125   GGGSNAVNRMIESDMKGVEFWIVNTDFQAMRMSPIDPDNKLQIGQELTRGLGAGGNPEIG  184

Query  856   TNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSF  1035
              NAAKES+E +E+AV GADM+FVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPF+F
Sbjct  185   MNAAKESQELVEQAVSGADMIFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFAF  244

Query  1036  EGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGIS  1215
             EGRRRA+QAQEGIA+LR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLADDILRQGVRGIS
Sbjct  245   EGRRRALQAQEGIASLRSNVDTLIVIPNDKLLTAVSPNTPVTEAFNLADDILRQGVRGIS  304

Query  1216  DIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  1395
             DIIT+PGLVNVDFADVR++M  AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT
Sbjct  305   DIITVPGLVNVDFADVRSVMSDAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  364

Query  1396  GIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ  1575
             GIVWNITGG DLTL EVNAAAEVIYDLVDP ANLIFG+VIDPS +GQVSITLIATGFKRQ
Sbjct  365   GIVWNITGGNDLTLTEVNAAAEVIYDLVDPGANLIFGSVIDPSYTGQVSITLIATGFKRQ  424

Query  1576  EGDDKPLQANQLAPGDASIGINRRPASFM--DGSSVEIPEFLKKKGRSRYPR  1725
             E  +     ++ A GD S   +   +S    +G +++IPEFL++KGRS + R
Sbjct  425   EEAE-----SRQAGGDNSRSHSSWFSSSSQEEGPTLQIPEFLQRKGRSGFSR  471



>ref|XP_011000929.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X5 [Populus euphratica]
Length=441

 Score =   525 bits (1351),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 327/450 (73%), Positives = 365/450 (81%), Gaps = 25/450 (6%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSP---------VKMLNEKNGSLSLSVNRRGGL  426
             MA C       S  + P G    +G R+S           K  ++KNGS       R   
Sbjct  1     MATCL------SPPFTPSGTQISVGRRISTENRIGKTVTFKRFDKKNGSCG--AYERNVF  52

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
             +   ++CS NS+N +         SKD FL+LHPE+SMLR + N T    R+E+   NVT
Sbjct  53    SIPQIRCSVNSHNISPN------HSKDSFLDLHPEVSMLRSDANDTYYCLRKETSGVNVT  106

Query  607   ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFP  786
             ESS DSS ++N+NEAKIKV+GVGGGGSNAVNRMIESS+ GV+FWI+NTDIQAM+MSPV  
Sbjct  107   ESSGDSSFMSNYNEAKIKVIGVGGGGSNAVNRMIESSLTGVDFWIMNTDIQAMKMSPVLL  166

Query  787   QHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaap  966
             ++RLQ+G+ELTRGLGAGGNPD+G NAA ESK AIEEA+YGADMVF+TAGMGGGTGTG AP
Sbjct  167   KNRLQVGKELTRGLGAGGNPDVGMNAANESKAAIEEALYGADMVFITAGMGGGTGTGGAP  226

Query  967   viagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSP  1146
             VIA  AKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR NVDTLIVIPNDKLLTAVS 
Sbjct  227   VIASVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVSL  286

Query  1147  STPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTAT-GK  1323
             STPVTEAFNLADDIL QGVRGISDIIT+PGLVNVDFADVRAIM+ AGSSL+GIGTAT GK
Sbjct  287   STPVTEAFNLADDILWQGVRGISDIITVPGLVNVDFADVRAIMKDAGSSLLGIGTATAGK  346

Query  1324  TRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF  1503
              RARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF
Sbjct  347   ARARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIF  406

Query  1504  GAVIDPSISGQVSITLIATGF-KRQEGDDK  1590
             GAVIDPS++GQV+ITLIATGF +R EG+ K
Sbjct  407   GAVIDPSLTGQVNITLIATGFSRRDEGEGK  436



>ref|XP_006424245.1| hypothetical protein CICLE_v10028361mg [Citrus clementina]
 gb|ESR37485.1| hypothetical protein CICLE_v10028361mg [Citrus clementina]
Length=470

 Score =   525 bits (1352),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 332/459 (72%), Positives = 374/459 (81%), Gaps = 12/459 (3%)
 Frame = +1

Query  352   RVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnnsanahsanQYQSKDPFLNLHPE  531
             R S VK+L+ +  S S     R   ++  LKCSA ++N +         SKDPFL+LHPE
Sbjct  24    RASSVKILDYR--SDSWGACPRNVKDFLRLKCSAKAHNVSPN------HSKDPFLDLHPE  75

Query  532   ISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIE  711
             +SML G+G + +    +E   ++V+ES + SS  NN NEAKIKV+GVGGGGSNAVNRMIE
Sbjct  76    VSMLSGDGTNVLFGSMKEGLGKSVSESLRQSSVPNNNNEAKIKVIGVGGGGSNAVNRMIE  135

Query  712   SSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaie  891
             SSM GVEFWIVNTD QAM++SPV P++RLQIG +LTRGLGAGGNP +G NAA ESK AIE
Sbjct  136   SSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESKVAIE  195

Query  892   eaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEG  1071
             EA+ GADM+FVTAGMGGGTGTGAAPVIAG AKSMGILTVGI T PF FEGRRRA+QAQEG
Sbjct  196   EAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEG  255

Query  1072  IAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVD  1251
             +A LR NVDTLIVIPNDKLLTAVS STPVTEAFNLADD LRQGVRGISDIITIPGLVNVD
Sbjct  256   VANLRNNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDTLRQGVRGISDIITIPGLVNVD  315

Query  1252  FADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDL  1431
             FADVRAIM+ AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERATGIVWNITGGTDL
Sbjct  316   FADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERATGIVWNITGGTDL  375

Query  1432  TLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQL  1611
             TLFEVN AAEVIYDLVDPSANLIFGAVID S+S QVSITLIATGFKR + + K      L
Sbjct  376   TLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGFKRDKLEGK---GTHL  432

Query  1612  APGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPRA  1728
             +  D S+G++RR +S     SVEIPEFL+K+    +PRA
Sbjct  433   SHNDVSLGMSRR-SSNSGSGSVEIPEFLRKRPHIYHPRA  470



>ref|XP_008784025.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=436

 Score =   523 bits (1346),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 315/409 (77%), Positives = 354/409 (87%), Gaps = 3/409 (1%)
 Frame = +1

Query  319   CPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRG--GLNWSLLKCsansnnsanahsanQ  492
             C  G L + GGRV   +    +N SL +     G  G+  S+  CS+    SAN+HS + 
Sbjct  15    CSVGALQIPGGRVL-AENWTSRNSSLEMLGKGHGLLGMVQSVASCSSRVQCSANSHSISS  73

Query  493   YQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgv  672
             Y +KD FLNLHPE+S+LRGE N T++  R++   +++ E+   SS  +++NEAKIKV+GV
Sbjct  74    YHNKDRFLNLHPEVSLLRGEKNDTVIDSRRDYVGDDIAETLGGSSVQDDYNEAKIKVIGV  133

Query  673   ggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDI  852
             GGGGSNAVNRMIES MKGVEFW+VNTD+QAMRMSPVFP+H LQIGQELTRGLGAGGNPDI
Sbjct  134   GGGGSNAVNRMIESDMKGVEFWVVNTDVQAMRMSPVFPEHCLQIGQELTRGLGAGGNPDI  193

Query  853   GTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFS  1032
             G NAA+ESKE+I+EAVYGADM+FVTAGMGGGTGTG APVI+G AKSMGILTVGIVTTPF+
Sbjct  194   GMNAAEESKESIQEAVYGADMIFVTAGMGGGTGTGGAPVISGIAKSMGILTVGIVTTPFA  253

Query  1033  FEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGI  1212
             FEGRRR VQAQEGIAALRENVDTLIVIPNDKLLTAVSP+TPVTEAFNLADDILRQGVRGI
Sbjct  254   FEGRRRVVQAQEGIAALRENVDTLIVIPNDKLLTAVSPNTPVTEAFNLADDILRQGVRGI  313

Query  1213  SDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERA  1392
             SDIIT+PGLVNVDFADVRAIM +AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERA
Sbjct  314   SDIITVPGLVNVDFADVRAIMVNAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERA  373

Query  1393  TGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQV  1539
             TGIVWNITGG DLTL+EVNAAAEVIYDLVDPSANLIFGAVID S+SGQV
Sbjct  374   TGIVWNITGGNDLTLYEVNAAAEVIYDLVDPSANLIFGAVIDQSLSGQV  422



>ref|XP_007015824.1| Tubulin/FtsZ family protein isoform 3 [Theobroma cacao]
 gb|EOY33443.1| Tubulin/FtsZ family protein isoform 3 [Theobroma cacao]
Length=447

 Score =   523 bits (1346),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 320/443 (72%), Positives = 358/443 (81%), Gaps = 14/443 (3%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLN--------EKNGSLSLSVNRRGGLN  429
             MA C    F+  D+    GV  +        + +N         K GSL     +R   +
Sbjct  1     MAACLSPCFVPFDSRASVGVFALSRKYSLKERWINGASFLKGFSKRGSLGACQRQRDFPS  60

Query  430   WSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTE  609
             ++  KCS NSNN++         SK  FL+LHPE+SML GE N  +   R E+  +N+T+
Sbjct  61    FTKFKCSVNSNNASPN------HSKASFLDLHPEVSMLSGEENDALSNLRNENYSKNITK  114

Query  610   SSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQ  789
             S  + SS +N++EAKIKVVGVGGGGSNAVNRMIESSMKGVEF IVNTD QAM+MSPV P+
Sbjct  115   SLSEPSSPSNYSEAKIKVVGVGGGGSNAVNRMIESSMKGVEFLIVNTDAQAMKMSPVLPK  174

Query  790   HRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapv  969
             +RLQIG+ELTRGLGAGGNP+ G NAA ES+ AIE+AV+GADMVFVTAGMGGGTGTG APV
Sbjct  175   NRLQIGKELTRGLGAGGNPETGMNAASESRAAIEDAVHGADMVFVTAGMGGGTGTGGAPV  234

Query  970   iagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPS  1149
             IAG AKS GILTVGIVTTPFSFEGR+RA+QAQEGIA LRENVDTLIV+PNDKLLTAVS S
Sbjct  235   IAGIAKSKGILTVGIVTTPFSFEGRKRAIQAQEGIATLRENVDTLIVVPNDKLLTAVSQS  294

Query  1150  TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTR  1329
             TPVTEAFNLADDIL QGVRGISDIIT+PGLVNVDFADV AIM+  GSSLMGIGTATGK+R
Sbjct  295   TPVTEAFNLADDILWQGVRGISDIITVPGLVNVDFADVHAIMKDTGSSLMGIGTATGKSR  354

Query  1330  ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGA  1509
             ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGA
Sbjct  355   ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPNANLIFGA  414

Query  1510  VIDPSISGQVSITLIATGFKRQE  1578
             VIDPS+SGQVSITLIATGFK QE
Sbjct  415   VIDPSLSGQVSITLIATGFKHQE  437



>ref|XP_006487942.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Citrus sinensis]
Length=470

 Score =   524 bits (1349),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 338/485 (70%), Positives = 381/485 (79%), Gaps = 15/485 (3%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsa  453
             MA C  T F  S T   +   T I G  S VK+L+ ++ S    +  R   ++   KCSA
Sbjct  1     MATCISTCFSPSHTCISKE--TQISG-ASLVKILDYRSDSWGACL--RNVKDFPRFKCSA  55

Query  454   nsnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSV  633
              ++N +         SKDPFL+LHPE+SML G+G + +    +E   E+V+ES + SS  
Sbjct  56    KAHNVSPN------HSKDPFLDLHPEVSMLSGDGTNVLFGSMKEGLGESVSESLRQSSVP  109

Query  634   NNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQE  813
             NN NEAKIKV+GVGGGGSNAVNRMIESSM GVEFWIVNTD QAM++SPV P++RLQIG E
Sbjct  110   NNNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCE  169

Query  814   LTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSM  993
             LTRGLGAGGNP +G NAA ESK AIEEA+ GADM+FVTAGMGGGTGTGAAPVIAG AKSM
Sbjct  170   LTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSM  229

Query  994   GILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFN  1173
             GILTVGI T PF FEGRRRA+QAQEG+A LR NVDTLIVIPNDKLLTAVS STPVTEAFN
Sbjct  230   GILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIVIPNDKLLTAVSQSTPVTEAFN  289

Query  1174  LADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNA  1353
             LADD LR GVRGISDIITIPGLVNVDFADVRAIM+ AGSSLMGIGTATGK+RARDAALNA
Sbjct  290   LADDTLRHGVRGISDIITIPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNA  349

Query  1354  IQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISG  1533
             IQSPLLDIGIE ATGIVWNITGGTDLTLFEVN AAEVIYDLVDPSANLIFGAVID S+S 
Sbjct  350   IQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSN  409

Query  1534  QVSITLIATGFKRQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRS  1713
             QVSITLIATGFK   GD    +   L+  D S+G++RR +S     SVEIPEFL+++   
Sbjct  410   QVSITLIATGFK---GDKLEGKGTHLSHNDVSLGMSRR-SSNSGSGSVEIPEFLRQRPHI  465

Query  1714  RYPRA  1728
              +PRA
Sbjct  466   YHPRA  470



>ref|XP_010232593.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X1 [Brachypodium distachyon]
Length=479

 Score =   524 bits (1349),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 307/417 (74%), Positives = 349/417 (84%), Gaps = 12/417 (3%)
 Frame = +1

Query  496   QSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvg  675
             ++KD  L+L PEIS+L GEGN  +    +E  +E   E   D+    ++NEA IKV+GVG
Sbjct  67    RTKDAILDLQPEISLLHGEGNGAISVRSKEKSVEKSVERLVDTPVRYSYNEASIKVIGVG  126

Query  676   gggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIG  855
             GGGSNAVNRMIES MKGVEFW+VNTD QA+ MSPV  ++RL IGQELTRGLGAGGNP+IG
Sbjct  127   GGGSNAVNRMIESYMKGVEFWVVNTDFQALSMSPVDMENRLHIGQELTRGLGAGGNPNIG  186

Query  856   TNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSF  1035
              NAAKES+E IE+A+ G+DMVFVTAGMGGGTGTG AP+IA  AKSMGILTVGIVTTPFSF
Sbjct  187   MNAAKESQELIEQALSGSDMVFVTAGMGGGTGTGGAPIIAQIAKSMGILTVGIVTTPFSF  246

Query  1036  EGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGIS  1215
             EGRRRA+QAQEGIAALR NVDTLIVIPNDKLLTAVSP+ PVTEAFNL DDILRQGVRGIS
Sbjct  247   EGRRRAIQAQEGIAALRSNVDTLIVIPNDKLLTAVSPNAPVTEAFNLVDDILRQGVRGIS  306

Query  1216  DIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  1395
             DIIT+PGLVNVDFADVR+IM  AGSSLMGIGTA+GKTRARDAALNAIQSPLLDIGIERAT
Sbjct  307   DIITVPGLVNVDFADVRSIMADAGSSLMGIGTASGKTRARDAALNAIQSPLLDIGIERAT  366

Query  1396  GIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ  1575
             GIVW ITGG DLTL EVNAAAEVIYDLVDP+ANLIFG+VIDPS +GQVSITLIATGFKRQ
Sbjct  367   GIVWTITGGNDLTLMEVNAAAEVIYDLVDPTANLIFGSVIDPSYAGQVSITLIATGFKRQ  426

Query  1576  EGDD-KPLQANQLAPGDASIGINRRPASFM------DGSSVEIPEFLKKKGRSRYPR  1725
             EG++ + +Q +Q + GD     NRR  S        +G ++EIPEFL++ GR R+ +
Sbjct  427   EGNEGQSVQGSQPS-GDN----NRRQTSHFSSSARNEGHAIEIPEFLRRNGRPRFSK  478



>ref|XP_010232594.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like 
isoform X2 [Brachypodium distachyon]
Length=476

 Score =   521 bits (1342),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 306/417 (73%), Positives = 345/417 (83%), Gaps = 15/417 (4%)
 Frame = +1

Query  496   QSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvg  675
             ++KD  L+L PEIS+L GEGN  +    +E  +E   E   D+    ++NEA IKV+GVG
Sbjct  67    RTKDAILDLQPEISLLHGEGNGAISVRSKEKSVEKSVERLVDTPVRYSYNEASIKVIGVG  126

Query  676   gggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIG  855
             GGGSNAVNRMIES MKGVEFW+VNTD QA+ MSPV  ++RL IGQELTRGLGAGGNP+IG
Sbjct  127   GGGSNAVNRMIESYMKGVEFWVVNTDFQALSMSPVDMENRLHIGQELTRGLGAGGNPNIG  186

Query  856   TNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSF  1035
              NAAKES+E IE+A+ G+DMVFVTAGMGGGTGTG AP+IA  AKSMGILTVGIVTTPFSF
Sbjct  187   MNAAKESQELIEQALSGSDMVFVTAGMGGGTGTGGAPIIAQIAKSMGILTVGIVTTPFSF  246

Query  1036  EGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGIS  1215
             EGRRRA+QAQEGIAALR NVDTLIVIPNDKLLTAVSP+ PVTEAFNL DDILRQGVRGIS
Sbjct  247   EGRRRAIQAQEGIAALRSNVDTLIVIPNDKLLTAVSPNAPVTEAFNLVDDILRQGVRGIS  306

Query  1216  DIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  1395
             DIIT+PGLVNVDFADVR+IM  AGSSLMGIGTA+GKTRARDAALNAIQSPLLDIGIERAT
Sbjct  307   DIITVPGLVNVDFADVRSIMADAGSSLMGIGTASGKTRARDAALNAIQSPLLDIGIERAT  366

Query  1396  GIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ  1575
             GIVW ITGG DLTL EVNAAAEVIYDLVDP+ANLIFG+VIDPS +GQVSITLIATGFKRQ
Sbjct  367   GIVWTITGGNDLTLMEVNAAAEVIYDLVDPTANLIFGSVIDPSYAGQVSITLIATGFKRQ  426

Query  1576  EGDDKPLQANQLAP-GDASIGINRRPASFM------DGSSVEIPEFLKKKGRSRYPR  1725
             EG+    +   + P GD     NRR  S        +G ++EIPEFL++ GR R+ +
Sbjct  427   EGN----EGQSVQPSGDN----NRRQTSHFSSSARNEGHAIEIPEFLRRNGRPRFSK  475



>ref|XP_002441183.1| hypothetical protein SORBIDRAFT_09g021830 [Sorghum bicolor]
 gb|EES19613.1| hypothetical protein SORBIDRAFT_09g021830 [Sorghum bicolor]
Length=467

 Score =   519 bits (1337),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 306/412 (74%), Positives = 343/412 (83%), Gaps = 9/412 (2%)
 Frame = +1

Query  496   QSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvg  675
             ++KD   +LHPEIS+L GE N       +E GI+   E   D+     +NE +IKV+GVG
Sbjct  62    RTKDTLYDLHPEISLLYGEDNGAATVSSKEQGIDTAAERLVDTPPSYRYNEPRIKVIGVG  121

Query  676   gggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIG  855
             GGGSNAVNRMIESSMKGVEFWIVNTD QAMRMSP+ P++RLQIGQELTRGLGAGGNP+IG
Sbjct  122   GGGSNAVNRMIESSMKGVEFWIVNTDFQAMRMSPIEPENRLQIGQELTRGLGAGGNPEIG  181

Query  856   TNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSF  1035
              NA KES+E     V  A      AGMGGGTGTG AP+IAG AKSMGILTVGIVTTPFSF
Sbjct  182   MNAGKESQEL----VEQAVAGADMAGMGGGTGTGGAPIIAGIAKSMGILTVGIVTTPFSF  237

Query  1036  EGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGIS  1215
             EGRRRA+QAQEGIA+LR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLADDILRQGVRGIS
Sbjct  238   EGRRRALQAQEGIASLRSNVDTLIVIPNDKLLTAVSPNTPVTEAFNLADDILRQGVRGIS  297

Query  1216  DIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  1395
             DIIT+PGLVNVDFADVR++M  AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT
Sbjct  298   DIITVPGLVNVDFADVRSVMSDAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERAT  357

Query  1396  GIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ  1575
             GIVWNITGG DLTL EVNAAAEVIYDLVDP ANLIFG+VIDPS +GQVSITLIATGFKRQ
Sbjct  358   GIVWNITGGNDLTLKEVNAAAEVIYDLVDPGANLIFGSVIDPSYTGQVSITLIATGFKRQ  417

Query  1576  EGDDKPLQANQLAPGDASIGIN--RRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
             E  +   +++Q A GD++ G +    P S  DG +++IPEFL++KGRS +PR
Sbjct  418   EESES--RSSQ-AGGDSNRGRSGWFSPTSQEDGHALQIPEFLQRKGRSGFPR  466



>ref|XP_006294123.1| hypothetical protein CARUB_v10023118mg [Capsella rubella]
 gb|EOA27021.1| hypothetical protein CARUB_v10023118mg [Capsella rubella]
Length=423

 Score =   517 bits (1331),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 296/351 (84%), Positives = 325/351 (93%), Gaps = 0/351 (0%)
 Frame = +1

Query  490   QYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvg  669
             Q  ++DPFLNLHPEISMLRGEG +T+  PR+E+    VTE  ++ S+  N+NEA+IKV+G
Sbjct  65    QTHAQDPFLNLHPEISMLRGEGVNTIANPRKETSAGPVTEDFEEPSAPTNYNEARIKVIG  124

Query  670   vggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPD  849
             VGGGGSNAVNRMIES M GVEFWIVNTDIQAMRMSPV P +RLQIG+ELTRGLGAGGNP+
Sbjct  125   VGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIGKELTRGLGAGGNPE  184

Query  850   IGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPF  1029
             IG NAA+ESKE IEEA+YG+DMVFVTAGMGGGTGTGAAPVIAG AK+MGILTVGI TTPF
Sbjct  185   IGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKAMGILTVGIATTPF  244

Query  1030  SFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRG  1209
             SFEGRRR VQAQEG+A+LR+NVDTLIVIPNDKLLTAVS STPVTEAFNLADDILRQGVRG
Sbjct  245   SFEGRRRTVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRG  304

Query  1210  ISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIER  1389
             ISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIER
Sbjct  305   ISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIER  364

Query  1390  ATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             ATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DPS++GQV 
Sbjct  365   ATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSLTGQVC  415



>gb|KCW90556.1| hypothetical protein EUGRSUZ_A02664 [Eucalyptus grandis]
Length=452

 Score =   517 bits (1332),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 326/426 (77%), Positives = 360/426 (85%), Gaps = 9/426 (2%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRV-SPVKMLNEKNGSLSLSVNRRGGLNWSLLKCs  450
             M+ C  T    S     +GVL + GGRV    +    K+G +  + N   G N  +    
Sbjct  1     MSTCLSTNLAPSVGGNRKGVLNLRGGRVLVENRWFEVKSGKMIGTKNNFLGAN--MRSVL  58

Query  451   ansnnsanahsanQYQSKDPFLNLHPEISMLRG---EGNSTMMTPRQESGIE-NVTESSK  618
                  S N+HS + YQSKDPFLN HPE++MLRG   EGN+T    +Q  G+  NV ES +
Sbjct  59    PQIMCSTNSHSVSTYQSKDPFLNSHPEVAMLRGNKGEGNNT--ANKQNDGLGGNVVESLR  116

Query  619   DSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRL  798
             D+S+ +N +EAKIKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTDIQAMRMSPVFP +RL
Sbjct  117   DTSNQSNHSEAKIKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDIQAMRMSPVFPDNRL  176

Query  799   QIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviag  978
             QIGQELTRGLGAGGNP+IG NAAKESKEAIEEA+YG+DMVFVTAGMGGGTGTG AP+IAG
Sbjct  177   QIGQELTRGLGAGGNPEIGMNAAKESKEAIEEALYGSDMVFVTAGMGGGTGTGGAPIIAG  236

Query  979   taKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPV  1158
              AKSMGILTVGIVTTPFSFEGR+R VQAQEGIA+LR+NVDTLIVIPNDKLLTAVSPSTPV
Sbjct  237   VAKSMGILTVGIVTTPFSFEGRKRTVQAQEGIASLRDNVDTLIVIPNDKLLTAVSPSTPV  296

Query  1159  TEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARD  1338
             TEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARD
Sbjct  297   TEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARD  356

Query  1339  AALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVID  1518
             AALNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVID
Sbjct  357   AALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVID  416

Query  1519  PSISGQ  1536
             PS+SGQ
Sbjct  417   PSLSGQ  422



>ref|XP_007027732.1| Tubulin/FtsZ family protein isoform 2, partial [Theobroma cacao]
 gb|EOY08234.1| Tubulin/FtsZ family protein isoform 2, partial [Theobroma cacao]
Length=408

 Score =   498 bits (1281),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 310/414 (75%), Positives = 344/414 (83%), Gaps = 23/414 (6%)
 Frame = +1

Query  295   YFMTSDTWCPRGVLTVIGGRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansnnsan  474
             YF  SD   P GVL V+GGRVS   +L  + G L +   + G  +        +   SAN
Sbjct  8     YFTPSDAR-PMGVLNVLGGRVSMDNLLG-RVGCLKMCDGKIGCSSAGQRSTMPHCRCSAN  65

Query  475   ahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNFNEAK  654
             + S + YQ+KDPFLN+HPE+SMLRGEGN+T+  PR++S   +VTES  D SS +N+NEAK
Sbjct  66    SQSVSPYQNKDPFLNMHPEVSMLRGEGNNTVTNPRKDSSSGSVTESLGDMSSSSNYNEAK  125

Query  655   IKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGA  834
             IKV+GVGGGGSNAVNRMIES+MKGVEFWIVNTD+QAM+MSPVFP+HRLQIGQELTRGLGA
Sbjct  126   IKVIGVGGGGSNAVNRMIESAMKGVEFWIVNTDVQAMKMSPVFPEHRLQIGQELTRGLGA  185

Query  835   GGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGI  1014
             GGNP+IG NAAKESKE+IEEA+YG+DMVFVTAGMGGGTGTG APVIAG AKS+GILTVGI
Sbjct  186   GGNPEIGMNAAKESKESIEEALYGSDMVFVTAGMGGGTGTGGAPVIAGVAKSLGILTVGI  245

Query  1015  VTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILR  1194
             VTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVS STPVTEAFNLADDILR
Sbjct  246   VTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILR  305

Query  1195  QGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLD  1374
             QGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAALNAIQSPLLD
Sbjct  306   QGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLD  365

Query  1375  IGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQ  1536
             +GIERATGIVWNITGG+DLTLFEV                     +IDPS+SGQ
Sbjct  366   LGIERATGIVWNITGGSDLTLFEV---------------------MIDPSLSGQ  398



>gb|EMT25022.1| Cell division protein ftsZ [Aegilops tauschii]
Length=677

 Score =   507 bits (1306),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 312/433 (72%), Positives = 343/433 (79%), Gaps = 36/433 (8%)
 Frame = +1

Query  517   NLHPEISMLRGEGNSTMMTPRQESGIENVTESS--KDSSSVNNFNEAKIKvvgvggggSN  690
             +LHPEISML GE N  +  P +E GI    E+    D+S    +NE +IKV+GVGG GSN
Sbjct  3     DLHPEISMLYGEDNGAIAAPSKEQGIGKAIETLPLADASIAYRYNEPRIKVIGVGGAGSN  62

Query  691   AVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaak  870
             AVNRMIESSMKGVEFWIVNTD QAMRMSP+ P +RL IGQELTRGLGAGGNP+IG NAAK
Sbjct  63    AVNRMIESSMKGVEFWIVNTDFQAMRMSPIDPANRLPIGQELTRGLGAGGNPEIGMNAAK  122

Query  871   eskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRR  1050
             ES+E +E+AV GADMVFVTAGMGGGTGTG APVIAG AKSMGILTVGIVTTPFSFEGRRR
Sbjct  123   ESQELVEKAVSGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGILTVGIVTTPFSFEGRRR  182

Query  1051  AVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITI  1230
             A+QAQEGIAALR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLADDILRQGVRGISDIIT+
Sbjct  183   ALQAQEGIAALRSNVDTLIVIPNDKLLTAVSPNTPVTEAFNLADDILRQGVRGISDIITV  242

Query  1231  PGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWN  1410
             PGLVNVDFADVR++M  AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWN
Sbjct  243   PGLVNVDFADVRSVMSDAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWN  302

Query  1411  ITGGTDLTLFE-------------------------------VNAAAEVIYDLVDPSANL  1497
             ITGG+DLTL E                               VNAAAEVIYDLVDP ANL
Sbjct  303   ITGGSDLTLTEVNAAAEVIYDLVDPGANLIFGSVIDPSYTGQVNAAAEVIYDLVDPGANL  362

Query  1498  IFGAVIDPSISGQVSITLIATGFKRQEGDD-KPLQANQLAPGDASIGINRRPASFMDGSS  1674
             IFG+VIDPS +GQVSITLIATGFKRQE  + +P QA     G+         +S  +G  
Sbjct  363   IFGSVIDPSYTGQVSITLIATGFKRQEESEVRPAQAG--GDGNRGRSSRFSSSSQDEGPK  420

Query  1675  VEIPEFLKKKGRS  1713
             ++IPEFL++KGRS
Sbjct  421   LQIPEFLQRKGRS  433



>dbj|BAC57987.1| ftsZ2 [Marchantia polymorpha]
 dbj|BAC57988.1| ftsZ2 [Marchantia polymorpha]
Length=530

 Score =   489 bits (1260),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 302/440 (69%), Positives = 355/440 (81%), Gaps = 18/440 (4%)
 Frame = +1

Query  427   NWSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVT  606
             NW  L+  +   +   + S+ ++Q +D +    P        GN ++   +   G   + 
Sbjct  100   NWESLRKVSALASQWGSESSVEWQ-EDEYQYTRP--------GNGSLTASKAGGGGSPLP  150

Query  607   ESS--KDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPV  780
              +S  + +  + +FNEAKIKV+GVGGGGSNAVNRM++S MKGVEFWIVNTD QAM MSPV
Sbjct  151   SASSWQGAPPIQSFNEAKIKVIGVGGGGSNAVNRMLQSEMKGVEFWIVNTDSQAMAMSPV  210

Query  781   FPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtga  960
               ++RLQIGQ+LTRGLGAGGNP+IG +AA+ESK  +EEA+ GADMVFVTAGMGGGTG+GA
Sbjct  211   QEENRLQIGQKLTRGLGAGGNPEIGMSAAEESKALVEEALRGADMVFVTAGMGGGTGSGA  270

Query  961   apviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAV  1140
             APVIAG AK++GILTVGIVTTPFSFEGRRR+VQAQEGIAALR NVDTLI+IPNDKLLTAV
Sbjct  271   APVIAGVAKALGILTVGIVTTPFSFEGRRRSVQAQEGIAALRNNVDTLIIIPNDKLLTAV  330

Query  1141  SPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATG  1320
             S STPVTEAFNLADDILRQGVRGISDIIT+PGLVNVDFADVRAIM  AGSSLMGIGTATG
Sbjct  331   SQSTPVTEAFNLADDILRQGVRGISDIITVPGLVNVDFADVRAIMADAGSSLMGIGTATG  390

Query  1321  KTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLI  1500
             K+RARDAAL+AIQSPLLD+GIERATGIVWNITGG+D+TLFEVNAAAEVIYDLVDP+ANLI
Sbjct  391   KSRARDAALSAIQSPLLDVGIERATGIVWNITGGSDMTLFEVNAAAEVIYDLVDPNANLI  450

Query  1501  FGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIGINRRPA-----SFMD  1665
             FGAV+D S +G+VSITLIATGF+ Q  DD  L++ Q           RRP+     S  +
Sbjct  451   FGAVVDESYTGEVSITLIATGFRGQ--DDSELRSVQQTGRSMDGDHGRRPSGVPPLSGSN  508

Query  1666  GSSVEIPEFLKKKGRSRYPR  1725
             GS+V+IP FLK++GRSRYPR
Sbjct  509   GSTVDIPSFLKRRGRSRYPR  528



>ref|XP_002966083.1| hypothetical protein SELMODRAFT_84291 [Selaginella moellendorffii]
 ref|XP_002971402.1| hypothetical protein SELMODRAFT_95671 [Selaginella moellendorffii]
 gb|EFJ27151.1| hypothetical protein SELMODRAFT_95671 [Selaginella moellendorffii]
 gb|EFJ33503.1| hypothetical protein SELMODRAFT_84291 [Selaginella moellendorffii]
Length=362

 Score =   472 bits (1214),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 283/359 (79%), Positives = 312/359 (87%), Gaps = 0/359 (0%)
 Frame = +1

Query  640   FNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELT  819
             FNEAKIKV+GVGGGGSNAVNRM++S MKGVEFWIVNTD QAM MSPV  Q+RLQIGQ+LT
Sbjct  4     FNEAKIKVIGVGGGGSNAVNRMVQSEMKGVEFWIVNTDAQAMAMSPVPAQNRLQIGQKLT  63

Query  820   RGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGI  999
             RGLGAGGNP+IG +AA+ESK  +EEAV GADMVFVTAGMGGGTG+GAAPVIAG AK +G+
Sbjct  64    RGLGAGGNPEIGMSAAEESKAIVEEAVRGADMVFVTAGMGGGTGSGAAPVIAGVAKELGV  123

Query  1000  LTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLA  1179
             LTVGIVTTPFSFEGRRR++QAQE  A L+ NVDTLI IPNDKLLTAVS STPVTEAFNLA
Sbjct  124   LTVGIVTTPFSFEGRRRSIQAQEATALLKNNVDTLITIPNDKLLTAVSQSTPVTEAFNLA  183

Query  1180  DDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQ  1359
             DDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGK+RARDAALNAIQ
Sbjct  184   DDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALNAIQ  243

Query  1360  SPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQV  1539
             SPLLD+GIERATGIVWNITGGTD+TLFEVNAAAEVIYDLVDP+ANLIFGAV+D S +G V
Sbjct  244   SPLLDVGIERATGIVWNITGGTDMTLFEVNAAAEVIYDLVDPNANLIFGAVVDDSFNGHV  303

Query  1540  SITLIATGFKRQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSR  1716
             SITLIATGFK QE  D  L      P   S      P     G+++EIP FL+++GR+R
Sbjct  304   SITLIATGFKSQEEPDVQLWQQLTRPSPRSKPSIASPLGNNGGATLEIPSFLRRRGRTR  362



>ref|XP_010905984.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=422

 Score =   472 bits (1215),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 292/387 (75%), Positives = 326/387 (84%), Gaps = 16/387 (4%)
 Frame = +1

Query  310   DTWCPRGVLTVIG---------GRVSPVKMLNEKNGSLSLSVNRRGGLNWSLLKCsansn  462
             D  CP GV  ++G         GR S   + NE+NG     V+ +  ++ S ++CSA SN
Sbjct  12    DGRCPGGVSAILGRRSLTVDWSGRCSSFNIWNERNG---FYVSGQRAVSCSRVRCSAKSN  68

Query  463   nsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNNF  642
             + +       Y +KDPFL+LHPE+SMLRGE    +M  +++    NVTES ++SS  +N+
Sbjct  69    SHSIG----SYHNKDPFLHLHPEVSMLRGEATDMIMDSKKDKLGSNVTESLRESSLPDNY  124

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             NEAKIKV+GVGGGGSNAVNRMIESSMKGVEFWIVNTD+QAMRMSPV+P++RLQIGQELTR
Sbjct  125   NEAKIKVIGVGGGGSNAVNRMIESSMKGVEFWIVNTDVQAMRMSPVYPENRLQIGQELTR  184

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNPDIG NAA+ESKE+IEEAV GADMVFVTAGMGGGTGTG APVIAG AKSMGIL
Sbjct  185   GLGAGGNPDIGMNAARESKESIEEAVSGADMVFVTAGMGGGTGTGGAPVIAGIAKSMGIL  244

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVGIVTTPFSFEGR+RAVQAQEGIAALR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLAD
Sbjct  245   TVGIVTTPFSFEGRKRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVSPNTPVTEAFNLAD  304

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             DILRQGVRGISDII +PGLVNVDFADVRAIM  AGSSLMGIGTATGKTRARDAALNAIQS
Sbjct  305   DILRQGVRGISDIIMVPGLVNVDFADVRAIMADAGSSLMGIGTATGKTRARDAALNAIQS  364

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFE  1443
             PLLDIGIERATGIVWNITGG DLTL+E
Sbjct  365   PLLDIGIERATGIVWNITGGNDLTLYE  391



>ref|XP_001765953.1| ftsZ2-1 plastid division protein [Physcomitrella patens]
 emb|CAA04845.2| plastid division protein FtsZ 2-1 precursor [Physcomitrella patens]
 emb|CAB54558.1| plastid division protein FtsZ 2-1 precursor [Physcomitrella patens]
 gb|EDQ69274.1| ftsZ2-1 plastid division protein [Physcomitrella patens]
Length=458

 Score =   465 bits (1196),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 277/366 (76%), Positives = 322/366 (88%), Gaps = 9/366 (2%)
 Frame = +1

Query  637   NFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQEL  816
             ++NEAKIKV+GVGGGGSNAVNRM+ES M+GVEFWIVNTD QAM +SPV  Q+RLQIGQ+L
Sbjct  97    SYNEAKIKVIGVGGGGSNAVNRMLESEMQGVEFWIVNTDAQAMALSPVPAQNRLQIGQKL  156

Query  817   TRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMG  996
             TRGLGAGGNP+IG +AA+ESK  +EEA+ GADMVFVTAGMGGGTG+GAAP+IAG AK +G
Sbjct  157   TRGLGAGGNPEIGCSAAEESKAMVEEALRGADMVFVTAGMGGGTGSGAAPIIAGVAKQLG  216

Query  997   ILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNL  1176
             ILTVGIVTTPF+FEGRRRAVQA EGIAAL+ NVDTLI IPN+KLLTAV+ STPVTEAFNL
Sbjct  217   ILTVGIVTTPFAFEGRRRAVQAHEGIAALKNNVDTLITIPNNKLLTAVAQSTPVTEAFNL  276

Query  1177  ADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAI  1356
             ADDILRQGVRGISDIIT+PGLVNVDFADVRAIM +AGSSLMGIGTATGK+RAR+AAL+AI
Sbjct  277   ADDILRQGVRGISDIITVPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRAREAALSAI  336

Query  1357  QSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQ  1536
             QSPLLD+GIERATGIVWNITGG+D+TLFEVNAAAEVIYDLVDP+ANLIFGAV+D ++ GQ
Sbjct  337   QSPLLDVGIERATGIVWNITGGSDMTLFEVNAAAEVIYDLVDPNANLIFGAVVDEALHGQ  396

Query  1537  VSITLIATGFKRQ-EGDDKPLQ-ANQLAPGDASIGINRRPASF---MDGSSVEIPEFLKK  1701
             VSITLIATGF  Q E D + +Q  +++  G A     R P       +GS++ IP FL+K
Sbjct  397   VSITLIATGFSSQDEPDARSMQNVSRILDGQA----GRSPTGLSQGSNGSAINIPSFLRK  452

Query  1702  KGRSRY  1719
             +G++R+
Sbjct  453   RGQTRH  458



>ref|XP_008804834.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=395

 Score =   460 bits (1183),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 289/388 (74%), Positives = 324/388 (84%), Gaps = 17/388 (4%)
 Frame = +1

Query  310   DTWCPRGVLTVIG---------GRVSPVKM-LNEKNGSLSLSVNRRGGLNWSLLKCsans  459
             D  CP GV  ++G         GR S   + LNE+NG     V+ +  ++ S ++CSANS
Sbjct  12    DGRCPVGVSAILGRRSLTVDGSGRCSSFNIFLNERNG---FYVSGQRAVSCSWVRCSANS  68

Query  460   nnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVNN  639
             N+         Y +KDPFL+LHPE+SMLRGE    ++  +++    NVTES ++SS  +N
Sbjct  69    NSHNIG----SYHNKDPFLHLHPEVSMLRGETTDKIIDSKKDKLGSNVTESLRESSLPDN  124

Query  640   FNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELT  819
             + EAKIKV+GVGGGGSNAVNRMIESSMKGVEFWIVNTD+QAMRMSPV+P++RLQIG ELT
Sbjct  125   YKEAKIKVIGVGGGGSNAVNRMIESSMKGVEFWIVNTDVQAMRMSPVYPENRLQIGHELT  184

Query  820   RGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGI  999
             RGLGAGGNPDIG NAAKESKE+IEEAV  ADMVF+TAGMGGGTGTG APVIAG AKSMGI
Sbjct  185   RGLGAGGNPDIGMNAAKESKESIEEAVSSADMVFITAGMGGGTGTGGAPVIAGIAKSMGI  244

Query  1000  LTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLA  1179
             LTVGIVTTPFSFEGR+RAVQAQEGIA+LR NVDTLIVIPNDKLLTAVSP+TPVTEAFNLA
Sbjct  245   LTVGIVTTPFSFEGRKRAVQAQEGIASLRNNVDTLIVIPNDKLLTAVSPNTPVTEAFNLA  304

Query  1180  DDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQ  1359
             DDILRQGVRGISDIIT+PGLVNVDFADVRAIM  AGSSLMGIGTATGKTRARDAALNAI 
Sbjct  305   DDILRQGVRGISDIITVPGLVNVDFADVRAIMADAGSSLMGIGTATGKTRARDAALNAIH  364

Query  1360  SPLLDIGIERATGIVWNITGGTDLTLFE  1443
             SPLLDIGIERATGIVWNITGG DLTL+E
Sbjct  365   SPLLDIGIERATGIVWNITGGNDLTLYE  392



>ref|XP_007015825.1| Tubulin/FtsZ family protein, putative isoform 4 [Theobroma cacao]
 gb|EOY33444.1| Tubulin/FtsZ family protein, putative isoform 4 [Theobroma cacao]
Length=433

 Score =   456 bits (1173),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 302/487 (62%), Positives = 341/487 (70%), Gaps = 62/487 (13%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLN--------EKNGSLSLSVNRRGGLN  429
             MA C    F+  D+    GV  +        + +N         K GSL     +R   +
Sbjct  1     MAACLSPCFVPFDSRASVGVFALSRKYSLKERWINGASFLKGFSKRGSLGACQRQRDFPS  60

Query  430   WSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTE  609
             ++  KCS NSNN++         SK  FL+LHPE+SML GE N  +   R E+  +N+T+
Sbjct  61    FTKFKCSVNSNNASPN------HSKASFLDLHPEVSMLSGEENDALSNLRNENYSKNITK  114

Query  610   SSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQ  789
             S  + SS +N++EAKIKVVGVGGGGSNAVNRMIESSMKGVEF IVNTD QAM+MSPV P+
Sbjct  115   SLSEPSSPSNYSEAKIKVVGVGGGGSNAVNRMIESSMKGVEFLIVNTDAQAMKMSPVLPK  174

Query  790   HRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapv  969
             +RLQIG+ELTRGLGAGGNP+ G NAA ES+ AIE+AV+GADMVFVTAGMGGGTGTG APV
Sbjct  175   NRLQIGKELTRGLGAGGNPETGMNAASESRAAIEDAVHGADMVFVTAGMGGGTGTGGAPV  234

Query  970   iagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPS  1149
             IAG AKS GILTVGIVTTPFSFEGR+RA+QAQEGIA LRENV                  
Sbjct  235   IAGIAKSKGILTVGIVTTPFSFEGRKRAIQAQEGIATLRENV------------------  276

Query  1150  TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTR  1329
                                        PGLVNVDFADV AIM+  GSSLMGIGTATGK+R
Sbjct  277   ---------------------------PGLVNVDFADVHAIMKDTGSSLMGIGTATGKSR  309

Query  1330  ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGA  1509
             ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGA
Sbjct  310   ARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPNANLIFGA  369

Query  1510  VIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPE  1689
             VIDPS+SGQVSITLIATGFK QE  D   +  QL P + SIG NRR     DGS  EIPE
Sbjct  370   VIDPSLSGQVSITLIATGFKHQE--DSEGKGAQLVPAEVSIGFNRRTPDTDDGSP-EIPE  426

Query  1690  FLKKKGR  1710
             FL+KKGR
Sbjct  427   FLRKKGR  433



>gb|KDO70388.1| hypothetical protein CISIN_1g024548mg [Citrus sinensis]
Length=266

 Score =   449 bits (1155),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 227/249 (91%), Positives = 240/249 (96%), Gaps = 1/249 (0%)
 Frame = +1

Query  985   KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTE  1164
             KSMGILTVGIVTTPFSFEGRRRAVQAQEGIA+LR+NVDTLIVIPNDKLLTAVS STPVTE
Sbjct  18    KSMGILTVGIVTTPFSFEGRRRAVQAQEGIASLRDNVDTLIVIPNDKLLTAVSQSTPVTE  77

Query  1165  AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAA  1344
             AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAA
Sbjct  78    AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAA  137

Query  1345  LNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPS  1524
             LNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS
Sbjct  138   LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPS  197

Query  1525  ISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKK  1701
             +SGQVSITLIATGFKRQ E + +PLQA+QLA GDA+ GINRRP+SF +G SVEIPEFLKK
Sbjct  198   LSGQVSITLIATGFKRQEESEGRPLQASQLAQGDAAFGINRRPSSFSEGGSVEIPEFLKK  257

Query  1702  KGRSRYPRA  1728
             KGRSR+PRA
Sbjct  258   KGRSRFPRA  266



>ref|XP_001766775.1| ftsZ2-2 plastid division protein [Physcomitrella patens]
 emb|CAB76386.1| plastid division protein FtsZ 2-2 precursor [Physcomitrella patens]
 emb|CAB76387.1| plastid division protein FtsZ 2-2 precursor [Physcomitrella patens]
 gb|EDQ68406.1| ftsZ2-2 plastid division protein [Physcomitrella patens]
Length=464

 Score =   449 bits (1155),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 277/383 (72%), Positives = 323/383 (84%), Gaps = 14/383 (4%)
 Frame = +1

Query  583   ESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQA  762
             E+GI  VT    +     + NEAKIKV+GVGGGGSNAVNRM+ES M+GVEFWIVNTD QA
Sbjct  88    ETGIP-VTAFGGNGDEYESSNEAKIKVIGVGGGGSNAVNRMLESEMQGVEFWIVNTDAQA  146

Query  763   MRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgg  942
             M +SPV  Q+RLQIGQ+LTRGLGAGGNP+IG +AA+ESK  +EEA+ GADMVFVTAGMGG
Sbjct  147   MALSPVPAQNRLQIGQKLTRGLGAGGNPEIGCSAAEESKAMVEEALRGADMVFVTAGMGG  206

Query  943   gtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPND  1122
             GTG+GAAP+IAG AK +GILTVGIVTTPF+FEGRRR+VQA EGIAAL+ NVDTLI IPN+
Sbjct  207   GTGSGAAPIIAGVAKQLGILTVGIVTTPFAFEGRRRSVQAHEGIAALKNNVDTLITIPNN  266

Query  1123  KLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMG  1302
             KLLTAV+ STPVTEAFNLADDILRQGVRGISDIIT+PGLVNVDFADVRAIM +AGSSLMG
Sbjct  267   KLLTAVAQSTPVTEAFNLADDILRQGVRGISDIITVPGLVNVDFADVRAIMANAGSSLMG  326

Query  1303  IGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVD  1482
             IGTATGK++AR+AAL+AIQSPLLD+GIERATGIVWNITGG+D+TLFEVNAAAEVIYDLVD
Sbjct  327   IGTATGKSKAREAALSAIQSPLLDVGIERATGIVWNITGGSDMTLFEVNAAAEVIYDLVD  386

Query  1483  PSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLA-------PGDASIGIN  1641
             P+ANLIFGAV+D ++  Q+SITLIATGF  Q  DD   ++ Q A        G +S+  +
Sbjct  387   PNANLIFGAVVDEALHDQISITLIATGFSSQ--DDPDARSMQYASRVLEGQAGRSSMASS  444

Query  1642  RRPASFMDGSSVEIPEFLKKKGR  1710
             R   S    S++ IP FL+K+G+
Sbjct  445   RGGNS----STINIPNFLRKRGQ  463



>gb|AFK36357.1| unknown [Lotus japonicus]
Length=272

 Score =   440 bits (1131),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 224/248 (90%), Positives = 237/248 (96%), Gaps = 2/248 (1%)
 Frame = +1

Query  985   KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTE  1164
             KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALR+NVDTLIVIPNDKLLTAVS STPVTE
Sbjct  25    KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDNVDTLIVIPNDKLLTAVSQSTPVTE  84

Query  1165  AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAA  1344
             AFNLADDILRQGVRGISD+ITIPGLVNVDFADVRAIM +AGSSLMGIGTATGKTRARDAA
Sbjct  85    AFNLADDILRQGVRGISDVITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAA  144

Query  1345  LNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPS  1524
             LNAIQSPLLDIGIERATGIVWNITGG+DLTLFEVNAAAEVIYDLVDP+ANLIFGAVIDPS
Sbjct  145   LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPS  204

Query  1525  ISGQVSITLIATGFKRQ-EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKK  1701
             +SGQVSITLIATGFKRQ E + +P+QA+QL  GD +IGINRRP+ F DGS VEIPEFL+K
Sbjct  205   LSGQVSITLIATGFKRQEESEGRPVQASQLTQGD-TIGINRRPSPFTDGSLVEIPEFLRK  263

Query  1702  KGRSRYPR  1725
             KGRSRYPR
Sbjct  264   KGRSRYPR  271



>gb|KHG08016.1| Cell division FtsZ-1, chloroplastic -like protein [Gossypium 
arboreum]
Length=374

 Score =   421 bits (1082),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 250/338 (74%), Positives = 274/338 (81%), Gaps = 15/338 (4%)
 Frame = +1

Query  526   PEISMLRGEGNSTMMTPRQESGIENVTESSKDSSSVN-NFNEAKIKvvgvggggSNAVNR  702
             P+   L GE N  M           + ES +++ + + N+ EAKIKVVGVGGGGSNAVNR
Sbjct  11    PKKLKLSGEENDAMFYS------TTINESLRETCNPSYNYGEAKIKVVGVGGGGSNAVNR  64

Query  703   MIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeske  882
             M+E S+KGVEF IVNTD QA++MSP+ P   LQIGQELTRGLGAGG P+IG NAA ES+E
Sbjct  65    MVEHSLKGVEFLIVNTDAQALKMSPMLPNKCLQIGQELTRGLGAGGKPEIGMNAANESRE  124

Query  883   aieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQA  1062
             AIEEAV            G         VIAG AKS GILTVGIVTTPFSFEGR+RAVQA
Sbjct  125   AIEEAV--------HGRNGRRNRHRWGSVIAGIAKSKGILTVGIVTTPFSFEGRKRAVQA  176

Query  1063  QEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLV  1242
             QEGIAALRE+VDTLI+IPN+KLL AVS +T +TEAFNLADDILRQGVRGISDIITIPGLV
Sbjct  177   QEGIAALRESVDTLIIIPNEKLLAAVSQATLMTEAFNLADDILRQGVRGISDIITIPGLV  236

Query  1243  NVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGG  1422
             NVDFADV AIM+ AGSSLMGIGTATGK+RARDAALNAIQSPLLDIGIERATGIVWNITGG
Sbjct  237   NVDFADVHAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERATGIVWNITGG  296

Query  1423  TDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQ  1536
             TDLTLFEVNAAAEVIYDLVDP ANLIFGAVIDPS+ GQ
Sbjct  297   TDLTLFEVNAAAEVIYDLVDPKANLIFGAVIDPSLCGQ  334



>emb|CDY70774.1| BnaAnng34970D [Brassica napus]
Length=266

 Score =   413 bits (1061),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 215/250 (86%), Positives = 230/250 (92%), Gaps = 5/250 (2%)
 Frame = +1

Query  985   KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTE  1164
             K+MGILTVGI TTPFSFEGRRRAVQAQEG+A+LR+NVDTLIVIPNDKLLTAVS STPVTE
Sbjct  18    KAMGILTVGIATTPFSFEGRRRAVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTPVTE  77

Query  1165  AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTAT-GKTRARDA  1341
             AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTAT GK+RARDA
Sbjct  78    AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATAGKSRARDA  137

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DP
Sbjct  138   ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDP  197

Query  1522  SISGQVSITLIATGFKRQEGDDKPLQANQLAPGD-ASIGINRRP-ASFMDGSSVEIPEFL  1695
             S++GQVSITLIATGFKRQE  +   +A Q+A  D AS G  RRP +SF +G SVEIPEFL
Sbjct  198   SLTGQVSITLIATGFKRQEEGEG--RAAQMAQADTASTGATRRPSSSFREGGSVEIPEFL  255

Query  1696  KKKGRSRYPR  1725
             KKKG SRYPR
Sbjct  256   KKKGSSRYPR  265



>emb|CDY72626.1| BnaAnng41710D [Brassica napus]
Length=267

 Score =   412 bits (1060),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 215/251 (86%), Positives = 230/251 (92%), Gaps = 6/251 (2%)
 Frame = +1

Query  985   KSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTE  1164
             K+MGILTVGI TTPFSFEGRRRAVQAQEG+A+LR+NVDTLIVIPNDKLLTAVS STPVTE
Sbjct  18    KAMGILTVGIATTPFSFEGRRRAVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTPVTE  77

Query  1165  AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTAT-GKTRARDA  1341
             AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM +AGSSLMGIGTAT GK+RARDA
Sbjct  78    AFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATAGKSRARDA  137

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDP+ANLIFGAV+DP
Sbjct  138   ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDP  197

Query  1522  SISGQVSITLIATGFKRQEGDDKPLQANQLAPGD-ASIGINRRP--ASFMDGSSVEIPEF  1692
             S++GQVSITLIATGFKRQE  +   +A Q+A  D AS G  RRP  +SF +G SVEIPEF
Sbjct  198   SLTGQVSITLIATGFKRQEEGEG--RAAQMAQADTASTGATRRPSSSSFREGGSVEIPEF  255

Query  1693  LKKKGRSRYPR  1725
             LKKKG SRYPR
Sbjct  256   LKKKGSSRYPR  266



>dbj|BAD12166.1| plastid division protein FtsZ2 [Nannochloris bacillaris]
Length=439

 Score =   373 bits (957),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 227/383 (59%), Positives = 292/383 (76%), Gaps = 8/383 (2%)
 Frame = +1

Query  580   QESGIENVTESS---KDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNT  750
             + S +E V   +   K  SS++   +A IKV+GVGGGGSNAVNRM+ S++  VEF+++NT
Sbjct  55    EASAVEEVVSQAVNVKQPSSIDRIGKATIKVLGVGGGGSNAVNRMVGSNIDEVEFFVLNT  114

Query  751   DIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVta  930
             D QA+ MSPV  ++++Q+G++ TRGLGAGGNP IG  AA+ES+ AI+  V G+DM+F+TA
Sbjct  115   DAQALLMSPVASENKVQLGEKSTRGLGAGGNPAIGEKAAQESRAAIQNIVEGSDMIFITA  174

Query  931   gmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIV  1110
             GMGGGTG+GAAP +A  AKS+G+LTV IVTTPF+FEGR R  QA   +  LR  VDTLI+
Sbjct  175   GMGGGTGSGAAPEVAKIAKSLGVLTVAIVTTPFAFEGRLRRQQAINAVEELRNVVDTLII  234

Query  1111  IPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGS  1290
             I NDKLL  + P+ P+ +AF +AD+ILRQGVRGISDIITIPGLVNVDFADVRA+M  AGS
Sbjct  235   IGNDKLLEVMDPNLPLADAFQVADNILRQGVRGISDIITIPGLVNVDFADVRAVMMGAGS  294

Query  1291  SLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIY  1470
             SLMG G A+GKTRARDAA+ A+ SPLLD+ I+RATGIVWNITG  D+TLFEVN AAE+IY
Sbjct  295   SLMGEGRASGKTRARDAAMAAVSSPLLDVDIDRATGIVWNITGPPDMTLFEVNEAAEIIY  354

Query  1471  DLVDPSANLIFGAVIDPSISGQVSITLIATGFK-----RQEGDDKPLQANQLAPGDASIG  1635
             DLVDPSANLIFGAV+DP ++G+V ITLIATGF      +Q+  + P  A Q    +  + 
Sbjct  355   DLVDPSANLIFGAVVDPKLNGEVQITLIATGFGSGSSVQQQSVEAPRVAVQKEIAEVPME  414

Query  1636  INRRPASFMDGSSVEIPEFLKKK  1704
                  A+  +G  +++P+FL++K
Sbjct  415   KPAPAAAQSNGGGIKVPDFLRRK  437



>ref|WP_015194198.1| cell division protein FtsZ [Stanieria cyanosphaera]
 ref|YP_007133498.1| cell division protein FtsZ [Stanieria cyanosphaera PCC 7437]
 gb|AFZ36532.1| cell division protein FtsZ [Stanieria cyanosphaera PCC 7437]
Length=417

 Score =   365 bits (938),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 225/377 (60%), Positives = 287/377 (76%), Gaps = 6/377 (2%)
 Frame = +1

Query  601   VTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPV  780
             +T     S+ +   N AKIKV+GVGGGG NAVNRMI+S + G+EFW +NTD QA+  +  
Sbjct  46    ITREDNKSNKIIPSNIAKIKVMGVGGGGCNAVNRMIDSGVSGIEFWAINTDAQALSHAGA  105

Query  781   FPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtga  960
              PQ RLQIGQ++TRGLGAGGNP IG  AA+ES++ I  A+   D+VF+TAGMGGGTGTGA
Sbjct  106   -PQ-RLQIGQKITRGLGAGGNPAIGQKAAEESRDEIAHALENTDLVFITAGMGGGTGTGA  163

Query  961   apviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAV  1140
             AP+ A  AK MG LTVG+VT PF+FEGRRR  QA+EGIAA    VDTLIVIPN++LLT +
Sbjct  164   APIAAEVAKEMGCLTVGVVTRPFTFEGRRRTNQAEEGIAAFGTRVDTLIVIPNNQLLTVI  223

Query  1141  SPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATG  1320
             SP TP+ EAF +ADD+LRQGV+GISDIITIPGL+NVDFADVRAIM  AGS+LMGIG  +G
Sbjct  224   SPETPMQEAFRIADDVLRQGVQGISDIITIPGLINVDFADVRAIMADAGSALMGIGIGSG  283

Query  1321  KTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLI  1500
             K+RAR+AA+ A+ SPLL+  IE A G+V NITGGTDL+L EVNAAAE IYD+VDP AN+I
Sbjct  284   KSRAREAAIAAVSSPLLEASIEGAKGVVINITGGTDLSLHEVNAAAESIYDVVDPDANII  343

Query  1501  FGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIGINR-RPASFMDGSSV  1677
             FGAVID  + G+V IT+IATGF  ++  +       L P + S   N+ +  + + G+ +
Sbjct  344   FGAVIDERMQGEVCITVIATGFDGEQNLESRTDVFPLTPPEPSFNRNQPQTPTQISGNRL  403

Query  1678  EIPEFLKKKGRSRYPRA  1728
             +IP+FL+++   R+P++
Sbjct  404   DIPDFLQRR---RFPKS  417



>ref|XP_007015823.1| Tubulin/FtsZ family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY33442.1| Tubulin/FtsZ family protein, putative isoform 2 [Theobroma cacao]
Length=372

 Score =   360 bits (923),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 238/368 (65%), Positives = 277/368 (75%), Gaps = 14/368 (4%)
 Frame = +1

Query  274   MAICTPTYFMTSDTWCPRGVLTVIGGRVSPVKMLN--------EKNGSLSLSVNRRGGLN  429
             MA C    F+  D+    GV  +        + +N         K GSL     +R   +
Sbjct  1     MAACLSPCFVPFDSRASVGVFALSRKYSLKERWINGASFLKGFSKRGSLGACQRQRDFPS  60

Query  430   WSLLKCsansnnsanahsanQYQSKDPFLNLHPEISMLRGEGNSTMMTPRQESGIENVTE  609
             ++  KCS NSNN++         SK  FL+LHPE+SML GE N  +   R E+  +N+T+
Sbjct  61    FTKFKCSVNSNNASPN------HSKASFLDLHPEVSMLSGEENDALSNLRNENYSKNITK  114

Query  610   SSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQ  789
             S  + SS +N++EAKIKVVGVGGGGSNAVNRMIESSMKGVEF IVNTD QAM+MSPV P+
Sbjct  115   SLSEPSSPSNYSEAKIKVVGVGGGGSNAVNRMIESSMKGVEFLIVNTDAQAMKMSPVLPK  174

Query  790   HRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapv  969
             +RLQIG+ELTRGLGAGGNP+ G NAA ES+ AIE+AV+GADMVFVTAGMGGGTGTG APV
Sbjct  175   NRLQIGKELTRGLGAGGNPETGMNAASESRAAIEDAVHGADMVFVTAGMGGGTGTGGAPV  234

Query  970   iagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPS  1149
             IAG AKS GILTVGIVTTPFSFEGR+RA+QAQEGIA LRENVDTLIV+PNDKLLTAVS S
Sbjct  235   IAGIAKSKGILTVGIVTTPFSFEGRKRAIQAQEGIATLRENVDTLIVVPNDKLLTAVSQS  294

Query  1150  TPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTR  1329
             TPVTEAFNLADDIL QGVRGISDIIT+PGLVNVDFADV AIM+  GSSLMGIGTATG+ +
Sbjct  295   TPVTEAFNLADDILWQGVRGISDIITVPGLVNVDFADVHAIMKDTGSSLMGIGTATGQEQ  354

Query  1330  ARDAALNA  1353
              +   +  
Sbjct  355   GKRCCIEC  362



>ref|WP_009785798.1| cell division protein FtsZ [Lyngbya sp. PCC 8106]
 gb|EAW35671.1| cell division protein FtsZ [Lyngbya sp. PCC 8106]
Length=429

 Score =   360 bits (924),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 231/399 (58%), Positives = 288/399 (72%), Gaps = 18/399 (5%)
 Frame = +1

Query  556   NSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEF  735
             N  M+ P  ES      ES   S+ +   N AKIKV+GVGG G NAVNRMIES + GVEF
Sbjct  39    NERMVNPNNESNSMPHEESW--STDIIPSNAAKIKVIGVGGSGGNAVNRMIESEVSGVEF  96

Query  736   WIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADM  915
             W VNTD QA+  S      RLQ+GQ+LTRGLGAGGNP IG  AA+ES++ I  ++ GAD+
Sbjct  97    WAVNTDAQALAQSKAL--KRLQVGQKLTRGLGAGGNPAIGQKAAEESRDEIAHSLEGADL  154

Query  916   VFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENV  1095
             VF+TAG+GGGTGTG APV+A  AK +G LT+G+VT PF+FEGRRR  QA EG+AAL+  V
Sbjct  155   VFITAGLGGGTGTGGAPVVAEVAKEVGALTIGVVTRPFTFEGRRRISQADEGVAALQSRV  214

Query  1096  DTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  1275
             DTLI+IPN+KLL+ ++  TPV EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M
Sbjct  215   DTLIIIPNNKLLSVINEQTPVQEAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVM  274

Query  1276  ESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAA  1455
               AGS+L+GIG  +GK+RAR+AA+ AI SPLL+  I+ A G+V+NITGGTDLTL EVNAA
Sbjct  275   ADAGSALLGIGLGSGKSRAREAAMGAISSPLLESSIDGAKGVVFNITGGTDLTLHEVNAA  334

Query  1456  AEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF---KRQ------EGDDKPLQANQ  1608
             AE IY++VDP+AN+IFGAVID  + G++ IT+IATGF   K+Q      E   +P  A  
Sbjct  335   AETIYEVVDPNANIIFGAVIDERLQGEIKITVIATGFSGEKQQSISSTRETTPQPRNAPS  394

Query  1609  LAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
              +P   S   ++ P        ++IP+FL    R R PR
Sbjct  395   -SPSPLSQQPSKEPDVQPQQPGLDIPDFL----RQRRPR  428



>ref|WP_023065873.1| cell division protein FtsZ [Lyngbya aestuarii]
 gb|ERT07916.1| cell division protein FtsZ [Lyngbya aestuarii BL J]
Length=428

 Score =   360 bits (924),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 229/398 (58%), Positives = 287/398 (72%), Gaps = 16/398 (4%)
 Frame = +1

Query  556   NSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEF  735
             N  M+ P  ES      ES   S+ +   N AKIKV+GVGG G NAVNRMIES + GVEF
Sbjct  38    NERMVNPNNESNSMPHEESW--STDIIPSNAAKIKVIGVGGSGGNAVNRMIESEVSGVEF  95

Query  736   WIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADM  915
             W VNTD QA+  S      RLQ+GQ+LTRGLGAGGNP IG  AA+ES++ I  ++ GAD+
Sbjct  96    WAVNTDAQALAQSKAL--KRLQVGQKLTRGLGAGGNPAIGQKAAEESRDEIAHSLEGADL  153

Query  916   VFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENV  1095
             VF+TAG+GGGTGTG APV+A  AK +G LT+G+VT PF+FEGRRR  QA EG+AAL+  V
Sbjct  154   VFITAGLGGGTGTGGAPVVAEVAKEVGALTIGVVTRPFTFEGRRRISQADEGVAALQSRV  213

Query  1096  DTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  1275
             DTLI+IPN+KLL+ ++  TPV EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M
Sbjct  214   DTLIIIPNNKLLSVINEQTPVQEAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVM  273

Query  1276  ESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAA  1455
               AGS+L+GIG  +GK+RAR+AA+ AI SPLL+  I+ A G+V+NITGGTDLTL EVNAA
Sbjct  274   ADAGSALLGIGLGSGKSRAREAAMGAISSPLLESSIDGAKGVVFNITGGTDLTLHEVNAA  333

Query  1456  AEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF--KRQEG-----DDKPLQANQLA  1614
             AE IY++VDP+AN+IFGAVID  + G++ IT+IATGF  ++Q+      +  P   N   
Sbjct  334   AEAIYEVVDPNANIIFGAVIDERLQGEIKITVIATGFSGEKQQSIPSTRETTPQPRNAPP  393

Query  1615  PGDASIGINRRPASFMDGS-SVEIPEFLKKKGRSRYPR  1725
             P       ++ PA        ++IP+FL    R R PR
Sbjct  394   PSPLGQQPSKDPAEQQSQQPGLDIPDFL----RQRRPR  427



>ref|WP_019504285.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=422

 Score =   359 bits (922),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 228/397 (57%), Positives = 286/397 (72%), Gaps = 21/397 (5%)
 Frame = +1

Query  553   GNSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVE  732
             GN++   P++E     +  S          N AKIKV+GVGGGG NAVNRMIES + G+E
Sbjct  40    GNNSSQIPKEEIRSNKIVPS----------NVAKIKVMGVGGGGCNAVNRMIESQVSGIE  89

Query  733   FWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGAD  912
             FW +NTD QA+  +   PQ +LQIGQ++TRGLGAGGNP IG  AA+ES++ +  A+   D
Sbjct  90    FWAINTDAQALNNAQA-PQ-KLQIGQKITRGLGAGGNPAIGQKAAEESRDELAHALENTD  147

Query  913   MVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALREN  1092
             +VF+TAGMGGGTGTGAAP+ A  AK MG LTVG+VT PF+FEGRRR  QA++GI A R  
Sbjct  148   LVFITAGMGGGTGTGAAPIAAEVAKEMGCLTVGVVTRPFTFEGRRRTKQAEKGIDAFRSR  207

Query  1093  VDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAI  1272
             VDTLIVIPN++LL+ +SP TPV EAF +ADD+LRQGV+GISDIITIPGL+NVDFADVRAI
Sbjct  208   VDTLIVIPNNQLLSVISPETPVQEAFGVADDVLRQGVQGISDIITIPGLINVDFADVRAI  267

Query  1273  MESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNA  1452
             M  AGS+LMGIG  +GK+RAR+AA+ A+ SPLL+  I  A G+V NITGG DLTL EVNA
Sbjct  268   MADAGSALMGIGMGSGKSRAREAAIAAVSSPLLEASIHGAKGVVINITGGYDLTLHEVNA  327

Query  1453  AAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASI  1632
             AA+ IY++VD  AN+IFGAVID S+ G+V IT+IATGF  +  +D  L+  Q  P     
Sbjct  328   AADSIYEVVDEDANIIFGAVIDESMDGEVRITVIATGFDAEGTEDFELEEPQAEPRSVFP  387

Query  1633  GIN------RRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
              +N      R      D S +EIP+FL+   R R+P+
Sbjct  388   SMNAMSQPDRSRTRESDRSRIEIPDFLQ---RRRFPK  421



>ref|WP_017303420.1| hypothetical protein [Spirulina subsalsa]
Length=382

 Score =   357 bits (915),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 220/377 (58%), Positives = 276/377 (73%), Gaps = 21/377 (6%)
 Frame = +1

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             N A+IKV+GVGGGG NAVNRMI S + GVEFW +NTD QA+ ++     HRLQIGQ+LTR
Sbjct  10    NAAQIKVIGVGGGGCNAVNRMIASGITGVEFWAINTDSQALELTAA--PHRLQIGQKLTR  67

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP IG  AA+ES++ I  A+ G D+VF+T+GMGGGTGTGA+ ++A  AK +G L
Sbjct  68    GLGAGGNPAIGQKAAEESRDEIANALEGTDLVFITSGMGGGTGTGASAIVAEVAKEIGCL  127

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVGIVT PF+FEG RR  QA EGIAAL+  VDTLIVIPN+KLL+ +SP TPV +AF +AD
Sbjct  128   TVGIVTRPFTFEGHRRTTQANEGIAALQGRVDTLIVIPNNKLLSVISPETPVQQAFMVAD  187

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             DILRQGV+GISDII IPGLVNVDFADVRA+M  AGS+LMGIGT +GK+RAR+AA  AI S
Sbjct  188   DILRQGVQGISDIIIIPGLVNVDFADVRAVMADAGSALMGIGTGSGKSRAREAASMAISS  247

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             PLL+  IE A G+V+NITGG+DLTL EVN AAE IY++VDP+AN+IFGAVID    G+++
Sbjct  248   PLLESSIEGAKGVVFNITGGSDLTLHEVNTAAETIYEVVDPNANIIFGAVIDDQSQGELT  307

Query  1543  ITLIATGFKRQEGDDKPLQANQLAPGDASIGINRRP----------------ASFMDGSS  1674
             IT+IATGF  +           +           +P                +S + G+ 
Sbjct  308   ITVIATGFSGETPAKSTTSGRTIPTAPKPNRAVNQPTTPPKPAANPAPPPDVSSPLKGTG  367

Query  1675  VEIPEFLKKKGRSRYPR  1725
             ++IPEFL+++   R+PR
Sbjct  368   LDIPEFLQRR---RFPR  381



>gb|AEL23173.1| cell division protein [Arthrospira platensis ZJU0117]
 gb|AEL23174.1| cell division protein [Arthrospira platensis ZJU0117/S]
Length=342

 Score =   355 bits (910),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 212/315 (67%), Positives = 257/315 (82%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  5     SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  62

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+TAG+GGGTGTG AP++A  
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  122

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VDTLIVIPN+KLL+ ++  TPV 
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  182

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  183   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  242

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+V+NITGGTDLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  243   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  303   RMQGEVKITVIATGF  317



>gb|AEL23175.1| cell division protein [Arthrospira platensis ZJU0118]
 gb|AFP55288.1| FtsZ, partial [Arthrospira platensis ZJU0118/S]
 gb|AFP55290.1| FtsZ, partial [Arthrospira platensis ZJU0137/S]
 gb|AFP55291.1| FtsZ, partial [Arthrospira platensis ZJU0137/R]
Length=342

 Score =   355 bits (910),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 212/315 (67%), Positives = 257/315 (82%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  5     SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  62

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+TAG+GGGTGTG AP++A  
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  122

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VDTLIVIPN+KLL+ ++  TPV 
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  182

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  183   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  242

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+V+NITGGTDLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  243   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  303   RMQGEVKITVIATGF  317



>gb|AEL23168.1| cell division protein [Arthrospira platensis ZJU0101/S]
Length=343

 Score =   354 bits (908),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 257/315 (82%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  5     SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  62

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+TAG+GGGTGTG AP++A  
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  122

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VDTLIVIPN+KLL+ ++  TPV 
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  182

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  183   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  242

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+++NITGGTDLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  243   ALTAISSPLLESSIEGARGVIFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  303   RMQGEVKITVIATGF  317



>gb|AFP55289.1| FtsZ, partial [Arthrospira platensis ZJU0137]
Length=341

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 256/315 (81%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  5     SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  62

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+TAG+GGGTGTG AP++A  
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  122

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VDTLIVIPN+KLL+ ++  TPV 
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  182

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  183   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  242

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+V+NITGGTDLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  243   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IA GF
Sbjct  303   RMQGEVKITVIAAGF  317



>gb|AEL23170.1| cell division protein [Arthrospira platensis ZJU0104]
Length=342

 Score =   353 bits (906),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 256/315 (81%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  5     SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  62

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+TAG+GGGTGTG AP++A  
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  122

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VDTLIVIPN+KLL+ ++  TPV 
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  182

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  183   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMAGAGSALLGIGIGSGKSRAREA  242

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+V+NITGG DLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  243   ALTAISSPLLESSIEGARGVVFNITGGCDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  303   RMQGEVKITVIATGF  317



>ref|WP_015186821.1| cell division protein FtsZ [Gloeocapsa sp. PCC 7428]
 ref|YP_007126104.1| cell division protein FtsZ [Gloeocapsa sp. PCC 7428]
 gb|AFZ28944.1| cell division protein FtsZ [Gloeocapsa sp. PCC 7428]
Length=423

 Score =   356 bits (913),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 227/370 (61%), Positives = 277/370 (75%), Gaps = 20/370 (5%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A IKV+GVGGGG NAVNRMI S + G+EFW +NTD QA+  +      RLQIGQ+LTRGL
Sbjct  64    ANIKVIGVGGGGGNAVNRMIASEVSGIEFWSINTDAQALTNTSA--TRRLQIGQKLTRGL  121

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES+E I  A+  AD+VF+TAGMGGGTGTGAAP++A  AK +G LTV
Sbjct  122   GAGGNPAIGQKAAEESREEIAAALENADLVFITAGMGGGTGTGAAPIVAEVAKELGALTV  181

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G++T PF FEGRRR  QA++GI AL+  VDTLIVIPNDKLL+ +S  TPV EAF +ADDI
Sbjct  182   GVITRPFMFEGRRRTSQAEQGIEALQSRVDTLIVIPNDKLLSVISEQTPVQEAFRIADDI  241

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFADVRAIM  AGS+LMGIG  +GK+RAR+AA  AI SPL
Sbjct  242   LRQGVQGISDIITIPGLVNVDFADVRAIMADAGSALMGIGIGSGKSRAREAANAAISSPL  301

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  IE A G+V+NITGG DLTL EVNAAAE IY++VDP+AN+IFGAVID  + G++ IT
Sbjct  302   LESSIEGAKGVVFNITGGHDLTLHEVNAAAETIYEVVDPNANIIFGAVIDEKLQGEIRIT  361

Query  1549  LIATGFKRQEGDD---------KPL-QANQLAPGDASIGINRRPASFMDGSSVEIPEFLK  1698
             +IATGF  + G +         KP  QA   AP   +I I       ++   ++IPEFL+
Sbjct  362   VIATGFSTETGAEPQASTRVVSKPQPQATPSAPSSPTIEIET-----VEKPGLDIPEFLQ  416

Query  1699  KKGRSRYPRA  1728
             ++   R PR+
Sbjct  417   RR---RNPRS  423



>gb|AEL23169.1| cell division protein [Arthrospira platensis ZJU0103]
 gb|AEL23171.1| cell division protein [Arthrospira platensis ZJU0104/S]
 gb|AEL23172.1| cell division protein [Arthrospira platensis ZJU0112]
 gb|AFP55286.1| FtsZ, partial [Arthrospira platensis ZJU0103/S]
 gb|AFP55287.1| FtsZ, partial [Arthrospira platensis ZJU0112/S]
Length=342

 Score =   353 bits (905),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 256/315 (81%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  5     SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  62

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+TAG+GGGTGTG AP++A  
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  122

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VDTLIVIPN+KLL+ ++  TPV 
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  182

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  183   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  242

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+V+NITGG DLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  243   ALTAISSPLLESSIEGARGVVFNITGGCDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  303   RMQGEVKITVIATGF  317



>ref|WP_008186504.1| cell division protein FtsZ [Moorea producens]
 gb|EGJ31657.1| cell division protein FtsZ [Moorea producens 3L]
Length=423

 Score =   355 bits (912),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 217/357 (61%), Positives = 266/357 (75%), Gaps = 25/357 (7%)
 Frame = +1

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMI S + GVEFW +NTD QA+  S   PQ RLQ+GQ+LTRGLGAGGNP IG  AA
Sbjct  77    NAVNRMIASDVSGVEFWSINTDAQALAQSSA-PQ-RLQMGQKLTRGLGAGGNPAIGQKAA  134

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
             +ES+E I +A+   D+VF+TAGMGGGTGTGAAP++A  AK MG LTVG+VT PF+FEGRR
Sbjct  135   EESREEIAQALEDTDLVFITAGMGGGTGTGAAPIVAEVAKEMGALTVGVVTRPFTFEGRR  194

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             R  QA+EGIAAL   VDTLIVIPN+KLL+ +S  TPV EAF +ADDILRQGV+GISDIIT
Sbjct  195   RTSQAEEGIAALGSRVDTLIVIPNNKLLSVISEQTPVQEAFKVADDILRQGVQGISDIIT  254

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  1407
             IPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RAR+AA+ AI SPLL+  IE A G+V 
Sbjct  255   IPGLVNVDFADVRAVMADAGSALMGIGMGSGKSRAREAAVAAISSPLLESSIEGARGVVL  314

Query  1408  NITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDD  1587
             NITGG+DLTL EVN+AAE +Y++VDP+AN+IFGAVID  + G++ IT+IATGF  +    
Sbjct  315   NITGGSDLTLHEVNSAAETVYEVVDPNANIIFGAVIDDKLQGEIRITVIATGFTGEA---  371

Query  1588  KPLQANQLAPGDASIGINRRPASFM-----------DGSSVEIPEFLKKKGRSRYPR  1725
                   Q AP      +NRRP +                 ++IPEFL+++   R+PR
Sbjct  372   ------QSAPKSVETPLNRRPIAPTPMPPTPKVEPKSRPGLDIPEFLQRR---RFPR  419



>emb|CEF98657.1| Cell division protein FtsZ, C-terminal [Ostreococcus tauri]
Length=424

 Score =   355 bits (912),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 228/316 (72%), Positives = 259/316 (82%), Gaps = 3/316 (1%)
 Frame = +1

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             N A IKV+GVGGGGSNAVNRM  S + GVEFWIVNTD QA+    V   ++LQIG ELTR
Sbjct  42    NAATIKVIGVGGGGSNAVNRMQNSDITGVEFWIVNTDAQALDQQAVDAPNQLQIGAELTR  101

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP+IG  AA+ES+ A+E A+ GADMVFVTAGMGGGTG+GAAPV+A  AKS GIL
Sbjct  102   GLGAGGNPEIGQKAAEESRTAVEAALTGADMVFVTAGMGGGTGSGAAPVVAQVAKSAGIL  161

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVGIVT PF FEGR+R  QA E +  LR+NVDTLIVIPND+LL AV P+  V +AF LAD
Sbjct  162   TVGIVTMPFKFEGRQRYNQAMEAVERLRQNVDTLIVIPNDRLLAAVDPTLSVQDAFLLAD  221

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             DILRQGVRGI+DIIT+PGL+NVDFADVRA+M  AGSSLMGIG A+GK RAR+AA  AI S
Sbjct  222   DILRQGVRGITDIITLPGLINVDFADVRAVMADAGSSLMGIGRASGKNRAREAAEAAISS  281

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVI---DPSISG  1533
             PLLD+GI+RATGIVWNITGG+DLTL EVN AAEVIYDLVDPSA +IFGAVI   + +  G
Sbjct  282   PLLDLGIDRATGIVWNITGGSDLTLHEVNEAAEVIYDLVDPSALIIFGAVIKDGNRATDG  341

Query  1534  QVSITLIATGFKRQEG  1581
             +VSITLIATGF    G
Sbjct  342   EVSITLIATGFSPSAG  357



>ref|XP_001418657.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96950.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=393

 Score =   354 bits (909),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 226/312 (72%), Positives = 261/312 (84%), Gaps = 3/312 (1%)
 Frame = +1

Query  655   IKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGA  834
             IKVVGVGGGGSNAVNRM+++ + GVEFWIVNTD QA+  +   P++ LQIG ELTRGLGA
Sbjct  18    IKVVGVGGGGSNAVNRMVDADINGVEFWIVNTDAQALETAVADPRNHLQIGAELTRGLGA  77

Query  835   GGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGI  1014
             GGNP+IG  AA+ES+ AIE+A+ G+DMVFVTAGMGGGTG+GAAPV+A  AKS GILTVGI
Sbjct  78    GGNPEIGQKAAEESRAAIEQALSGSDMVFVTAGMGGGTGSGAAPVVAQVAKSAGILTVGI  137

Query  1015  VTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILR  1194
             VT PF FEGR+R  QA E +  LR+NVDTLIVIPND+LL AV  S PV +AF LADDILR
Sbjct  138   VTMPFKFEGRQRYNQAMEAVERLRQNVDTLIVIPNDRLLAAVDASLPVQDAFLLADDILR  197

Query  1195  QGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLD  1374
             QGVRGI+DIIT+PGL+NVDFADVRA+M  AGSSLMGIG A+GK RAR+AA  AI SPLLD
Sbjct  198   QGVRGITDIITLPGLINVDFADVRAVMADAGSSLMGIGRASGKNRAREAAEAAISSPLLD  257

Query  1375  IGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVI---DPSISGQVSI  1545
             +GI+RATGIVWNITGG+DLTL EVN AAEVIYDLVDPSA +IFGAV+   + +  G+VSI
Sbjct  258   LGIDRATGIVWNITGGSDLTLHEVNEAAEVIYDLVDPSALIIFGAVVKDGNRATDGEVSI  317

Query  1546  TLIATGFKRQEG  1581
             TLIATGF    G
Sbjct  318   TLIATGFSPSAG  329



>ref|WP_034935803.1| cell division protein FtsZ, partial [Gloeocapsa sp. PCC 73106]
Length=377

 Score =   353 bits (907),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 225/363 (62%), Positives = 279/363 (77%), Gaps = 11/363 (3%)
 Frame = +1

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             N A+IKV+GVGGGG NAVNRMIE  + GVEFW +NTD QA+  +     +RLQ+G+++TR
Sbjct  19    NVAQIKVIGVGGGGCNAVNRMIERDVSGVEFWAINTDAQALAHAAA--TYRLQVGKKITR  76

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP IG  AA+ES+E I  A+   DMVF+TAGMGGGTGTGAAP++A  AK MG L
Sbjct  77    GLGAGGNPAIGQKAAEESREEIAGALENTDMVFITAGMGGGTGTGAAPIVAEVAKEMGCL  136

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVG+VT PF+FEGRRR  QA+EGI AL+  VDTLIVIPN++LL+ ++P TP+ EAF  AD
Sbjct  137   TVGVVTRPFTFEGRRRTNQAEEGINALQTRVDTLIVIPNNQLLSVINPDTPMQEAFRTAD  196

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             DILRQGV+GISDIITIPGLVNVDFADVRAIM  AGS++MGIG  TGK+RA++ A+ AI S
Sbjct  197   DILRQGVQGISDIITIPGLVNVDFADVRAIMADAGSAMMGIGIGTGKSRAKEGAIAAISS  256

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             PLL+  IE A G+V NITGG DLTL EVNAAAE+IY++VDP+AN+IFGAVIDP + G++ 
Sbjct  257   PLLESSIEGAKGVVLNITGGKDLTLHEVNAAAEIIYEIVDPNANIIFGAVIDPEMQGEIR  316

Query  1543  ITLIATGFKRQEGDDKP--LQANQLAPGDASIGINRRPASFMDGSS-VEIPEFLKKKGRS  1713
             +T+IATGF    GD +   +     AP   S     RP S  + SS ++IPEFL+K+   
Sbjct  317   VTVIATGFT---GDTRATNIATGSKAPVTPSKNPQSRPPSRPESSSGLDIPEFLQKR---  370

Query  1714  RYP  1722
             R+P
Sbjct  371   RFP  373



>ref|XP_002499616.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO60874.1| predicted protein [Micromonas sp. RCC299]
Length=442

 Score =   355 bits (912),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 225/321 (70%), Positives = 265/321 (83%), Gaps = 3/321 (1%)
 Frame = +1

Query  616   KDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHR  795
             K ++    FN A IKV+GVGGGGSNAVNRM+ S + GVEFWIVNTD QAM  + V     
Sbjct  63    KPAAPTQAFNAASIKVIGVGGGGSNAVNRMVGSDINGVEFWIVNTDAQAMATAAVPSSCH  122

Query  796   LQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapvia  975
             +QIG ELTRGLGAGGNP+IG  AA+ES+++IE+++ G+DMVFVTAGMGGGTG+GAAPV+A
Sbjct  123   IQIGSELTRGLGAGGNPEIGQKAAEESRQSIEQSLAGSDMVFVTAGMGGGTGSGAAPVVA  182

Query  976   gtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTP  1155
             G AK+ GILTVGIVT PF FEGR+R  QA + +  LR NVDTLIVIPND+LL+AV  + P
Sbjct  183   GVAKAAGILTVGIVTMPFKFEGRQRYNQAMDAVERLRRNVDTLIVIPNDRLLSAVDTALP  242

Query  1156  VTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRAR  1335
             V +AF LADDILRQGVRGI DIIT+PGL+NVDFADVRA+M  AGSSLMGIG ATGK RAR
Sbjct  243   VQDAFLLADDILRQGVRGICDIITLPGLINVDFADVRAVMADAGSSLMGIGRATGKNRAR  302

Query  1336  DAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVI  1515
             +AA  AI SPLLD+GI+RATGIVWNITG  DLTL EVN AAEVIY+LVDPSA +IFGAV+
Sbjct  303   EAAAAAISSPLLDLGIDRATGIVWNITGSKDLTLHEVNEAAEVIYELVDPSALIIFGAVV  362

Query  1516  DPSIS---GQVSITLIATGFK  1569
             +P+I    G+V+ITLIATGF+
Sbjct  363   NPAIQLAEGEVAITLIATGFQ  383



>ref|WP_015221984.1| cell division protein FtsZ [Cyanobacterium stanieri]
 ref|YP_007164315.1| cell division protein FtsZ [Cyanobacterium stanieri PCC 7202]
 gb|AFZ46666.1| cell division protein FtsZ [Cyanobacterium stanieri PCC 7202]
Length=418

 Score =   355 bits (910),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 228/397 (57%), Positives = 289/397 (73%), Gaps = 17/397 (4%)
 Frame = +1

Query  571   TPRQESGIENVT---ESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWI  741
             TPR+    +  T   E++ +S  +   N A+IKV+GVGGGG NAVNRMI+SS+ GVEFW 
Sbjct  26    TPRKTQKTKAQTPPLENNMNSRQIVPSNVAQIKVIGVGGGGCNAVNRMIQSSVSGVEFWQ  85

Query  742   VNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVF  921
             +NTD QA+  S     + LQIGQ+LTRGLGAGGNP IG  AA+ES+E I +A+   D+VF
Sbjct  86    INTDAQALTES--MATYCLQIGQKLTRGLGAGGNPSIGQKAAEESREEIAKALENTDLVF  143

Query  922   VtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDT  1101
             +TAGMGGGTGTGAAP++A  AK MG LTVG+VT PF+FEGRRR  QA +GI+AL+  VDT
Sbjct  144   ITAGMGGGTGTGAAPIVAEVAKEMGCLTVGVVTRPFTFEGRRRTTQADDGISALQSRVDT  203

Query  1102  LIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMES  1281
             LIVIPN+KLL+ +   TP+ E+F +ADDILRQGV+GISDIITIPGLVNVDFADVRA+M  
Sbjct  204   LIVIPNNKLLSVIPSDTPLQESFRIADDILRQGVQGISDIITIPGLVNVDFADVRAVMAD  263

Query  1282  AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAE  1461
             AGS+LMGIG  +GK+RA+++A+ AI SPL++  I+ A G+V NITGG DLTL EVN  AE
Sbjct  264   AGSALMGIGIGSGKSRAKESAVAAISSPLIESSIQGAKGVVLNITGGNDLTLHEVNTVAE  323

Query  1462  VIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAP----GDAS  1629
              IYD+VDP+AN+IFGAVID S+ G++ IT+IATGF  +   D  LQA    P       S
Sbjct  324   TIYDIVDPNANIIFGAVIDESMQGEIRITVIATGFSAENNGDDSLQAIISPPTIPQTSTS  383

Query  1630  IGINRRPASFMDGSS-----VEIPEFLKKKGRSRYPR  1725
                  + A+  +  S     ++IPEFL+   R R+PR
Sbjct  384   DDEEEKTATNSESESNPLAGLDIPEFLQ---RRRFPR  417



>ref|XP_003058209.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58160.1| predicted protein [Micromonas pusilla CCMP1545]
Length=443

 Score =   355 bits (912),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 227/313 (73%), Positives = 262/313 (84%), Gaps = 3/313 (1%)
 Frame = +1

Query  640   FNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELT  819
             FN A IKVVGVGGGGSNAVNRM+ S + GVEFWIVNTD QAM  + V     +QIG+E+T
Sbjct  70    FNAASIKVVGVGGGGSNAVNRMVGSDIGGVEFWIVNTDAQAMATAAVNDACHIQIGREVT  129

Query  820   RGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGI  999
             RGLGAGGNP+IG  AA+ES++AIE A+ G+DMVFVTAGMGGGTG+GAAPV+AG AK+ GI
Sbjct  130   RGLGAGGNPEIGQKAAEESRQAIEAALAGSDMVFVTAGMGGGTGSGAAPVVAGVAKAAGI  189

Query  1000  LTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLA  1179
             LTVGIVT PF FEGR+R  QA + +  LR NVDTLIVIPND+LL+AV  S PV +AF LA
Sbjct  190   LTVGIVTMPFKFEGRQRYNQAMDAVERLRRNVDTLIVIPNDRLLSAVDTSLPVQDAFLLA  249

Query  1180  DDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQ  1359
             DDILRQGVRGI DIIT+PGL+NVDFADVRA+M  AGSSLMGIG ATGK RAR+AA  AI 
Sbjct  250   DDILRQGVRGICDIITLPGLINVDFADVRAVMADAGSSLMGIGRATGKNRAREAAAAAIS  309

Query  1360  SPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSIS---  1530
             SPLLD+GI+RATGIVWNITG  DLTL EVN AAEVIY+LVDPSA +IFGAV++P+I    
Sbjct  310   SPLLDLGIDRATGIVWNITGSKDLTLHEVNEAAEVIYELVDPSALIIFGAVVNPAIKLAE  369

Query  1531  GQVSITLIATGFK  1569
             G+V+ITLIATGF+
Sbjct  370   GEVAITLIATGFQ  382



>ref|WP_012161432.1| cell division protein FtsZ [Acaryochloris marina]
 ref|YP_001515164.1| cell division protein FtsZ [Acaryochloris marina MBIC11017]
 gb|ABW25850.1| cell division protein FtsZ [Acaryochloris marina MBIC11017]
Length=375

 Score =   353 bits (905),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 220/382 (58%), Positives = 283/382 (74%), Gaps = 23/382 (6%)
 Frame = +1

Query  613   SKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQH  792
             S +  ++     A IKV+GVGGGG NAVNRMI S++ GVEFW +NTD Q++  S      
Sbjct  2     SMEDDNIVRHGAATIKVIGVGGGGGNAVNRMIASNVSGVEFWSINTDAQSLTQSSA--AK  59

Query  793   RLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapvi  972
             RLQ+GQ+LTRGLGAGGNP IG  AA+ES++ I  A+ G+D+VF+T GMGGGTGTGAAP+I
Sbjct  60    RLQVGQKLTRGLGAGGNPAIGQKAAEESRDDIAAALAGSDLVFITCGMGGGTGTGAAPII  119

Query  973   agtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPST  1152
             A  AK MG LTVG+VT PF+FEGRRR+ QA+EGIAAL+  VDTLI+IPNDK+L+ ++  T
Sbjct  120   AEIAKEMGALTVGVVTRPFTFEGRRRSHQAEEGIAALQTRVDTLIMIPNDKILSVIAEQT  179

Query  1153  PVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRA  1332
             PV EAF  ADD+LRQGV+GISDII +PGLVNVDFADV+AIM  AGS++MGIG  +GK+RA
Sbjct  180   PVQEAFQTADDVLRQGVQGISDIINVPGLVNVDFADVKAIMADAGSAMMGIGVGSGKSRA  239

Query  1333  RDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAV  1512
             ++AA+ AI SPLLD  I  A G+V+NITGG DL+L EVN AAE IY++VD SAN+IFGAV
Sbjct  240   KEAAIAAIDSPLLDASIRGAKGVVFNITGGHDLSLHEVNTAAETIYEVVDASANIIFGAV  299

Query  1513  IDPSISGQVSITLIATGF--------KRQEGDDK-----PLQANQLAPGDASIGINRRPA  1653
             ID S+ G++ +T+IATGF        ++ E   K     P Q  + AP      + +RP 
Sbjct  300   IDESLQGEIKMTVIATGFSSDAGTPPRKSEAKPKAKAATPTQQQKAAPKT----VTQRPP  355

Query  1654  SFMDGSSVEIPEFLKKK--GRS  1713
             +   G +++IP+FL+K+  GRS
Sbjct  356   T--RGGNLDIPDFLQKRRPGRS  375



>ref|WP_015117120.1| cell division protein FtsZ [Rivularia sp. PCC 7116]
 ref|YP_007054089.1| cell division protein FtsZ [Rivularia sp. PCC 7116]
 gb|AFY53542.1| cell division protein FtsZ [Rivularia sp. PCC 7116]
Length=440

 Score =   355 bits (911),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 224/369 (61%), Positives = 274/369 (74%), Gaps = 19/369 (5%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A IKV+GVGGGG NAVNRMI S + GVEFW +NTD QA+ M+      RLQIGQ+LTRGL
Sbjct  69    ANIKVIGVGGGGGNAVNRMIASDLSGVEFWSINTDAQALTMAAA--PCRLQIGQKLTRGL  126

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES++ I  A+ GAD+VF+TAGMGGGTGTGAA V+A  AK MG LTV
Sbjct  127   GAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAASVVAEVAKEMGALTV  186

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G+VT PF FEGRRR  QA++G+ AL+  VDTLI+IPN+KLL  +   TPV EAF  ADD+
Sbjct  187   GVVTRPFVFEGRRRTTQAEQGVEALKSRVDTLIIIPNNKLLEVIPEQTPVQEAFRYADDV  246

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+LMGIG  +GK+R+R+AA+ AI SPL
Sbjct  247   LRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRSREAAIAAISSPL  306

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  IE A G+V+NITGG+DLTL EVNAAAE IY++VDP+AN+IFGAVID  + G+V IT
Sbjct  307   LECSIEGARGVVFNITGGSDLTLHEVNAAAEAIYEVVDPNANIIFGAVIDDRLEGEVRIT  366

Query  1549  LIATGF-----KRQEGDDKP---------LQANQLAPGDASIGIN--RRP-ASFMDGSSV  1677
             +IATGF     +RQ+    P          Q  +  P  +S G N  ++P A       +
Sbjct  367   VIATGFTGEIQERQQQSATPNNRVVTPQTPQQRRQMPQPSSTGANSPKQPQAEPKQKPGL  426

Query  1678  EIPEFLKKK  1704
             EIP FL+K+
Sbjct  427   EIPPFLQKR  435



>gb|AEL23167.1| cell division protein [Arthrospira platensis ZJU0101]
Length=342

 Score =   351 bits (901),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 254/315 (81%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  5     SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  62

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+ AG+GGGTGTG AP++A  
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFIIAGLGGGTGTGGAPIVAEI  122

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VD LIVIPN+KLL+ ++  TPV 
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDALIVIPNNKLLSVINEQTPVQ  182

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EA   ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  183   EALRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  242

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+V+NITGGTDLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  243   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  303   RMQGEVKITVIATGF  317



>gb|ELR98955.1| cell division protein FtsZ [Gloeocapsa sp. PCC 73106]
Length=422

 Score =   354 bits (908),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 225/363 (62%), Positives = 279/363 (77%), Gaps = 11/363 (3%)
 Frame = +1

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             N A+IKV+GVGGGG NAVNRMIE  + GVEFW +NTD QA+  +     +RLQ+G+++TR
Sbjct  64    NVAQIKVIGVGGGGCNAVNRMIERDVSGVEFWAINTDAQALAHAAA--TYRLQVGKKITR  121

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP IG  AA+ES+E I  A+   DMVF+TAGMGGGTGTGAAP++A  AK MG L
Sbjct  122   GLGAGGNPAIGQKAAEESREEIAGALENTDMVFITAGMGGGTGTGAAPIVAEVAKEMGCL  181

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVG+VT PF+FEGRRR  QA+EGI AL+  VDTLIVIPN++LL+ ++P TP+ EAF  AD
Sbjct  182   TVGVVTRPFTFEGRRRTNQAEEGINALQTRVDTLIVIPNNQLLSVINPDTPMQEAFRTAD  241

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             DILRQGV+GISDIITIPGLVNVDFADVRAIM  AGS++MGIG  TGK+RA++ A+ AI S
Sbjct  242   DILRQGVQGISDIITIPGLVNVDFADVRAIMADAGSAMMGIGIGTGKSRAKEGAIAAISS  301

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             PLL+  IE A G+V NITGG DLTL EVNAAAE+IY++VDP+AN+IFGAVIDP + G++ 
Sbjct  302   PLLESSIEGAKGVVLNITGGKDLTLHEVNAAAEIIYEIVDPNANIIFGAVIDPEMQGEIR  361

Query  1543  ITLIATGFKRQEGDDKP--LQANQLAPGDASIGINRRPASFMDGSS-VEIPEFLKKKGRS  1713
             +T+IATGF    GD +   +     AP   S     RP S  + SS ++IPEFL+K+   
Sbjct  362   VTVIATGFT---GDTRATNIATGSKAPVTPSKNPQSRPPSRPESSSGLDIPEFLQKR---  415

Query  1714  RYP  1722
             R+P
Sbjct  416   RFP  418



>ref|WP_008050554.1| cell division protein FtsZ [Arthrospira sp. PCC 8005]
 emb|CCE16326.1| cell division protein; tubulin-like GTP-binding protein and GTPase, 
forms circumferential ring in cell division [Arthrospira 
sp. PCC 8005]
 emb|CDM94936.1| cell division protein; tubulin-like GTP-binding protein and GTPase, 
forms circumferential ring in cell division [Arthrospira 
sp. PCC 8005]
Length=427

 Score =   354 bits (908),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 212/315 (67%), Positives = 257/315 (82%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  56    SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  113

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+TAG+GGGTGTG AP++A  
Sbjct  114   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  173

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VDTLIVIPN+KLL+ ++  TPV 
Sbjct  174   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  233

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  234   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  293

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+V+NITGGTDLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  294   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  353

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  354   RMQGEVKITVIATGF  368



>ref|WP_006669768.1| cell division protein FtsZ [Arthrospira maxima]
 gb|EDZ93797.1| cell division protein FtsZ [Arthrospira maxima CS-328]
Length=428

 Score =   354 bits (908),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 212/315 (67%), Positives = 257/315 (82%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  57    SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  114

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+TAG+GGGTGTG AP++A  
Sbjct  115   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  174

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VDTLIVIPN+KLL+ ++  TPV 
Sbjct  175   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  234

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  235   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  294

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+V+NITGGTDLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  295   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  354

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  355   RMQGEVKITVIATGF  369



>ref|WP_006625893.1| cell division protein FtsZ [Arthrospira platensis]
 gb|EKD06333.1| cell division protein FtsZ [Arthrospira platensis C1]
Length=428

 Score =   354 bits (908),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 212/315 (67%), Positives = 257/315 (82%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  57    SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  114

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+TAG+GGGTGTG AP++A  
Sbjct  115   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  174

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VDTLIVIPN+KLL+ ++  TPV 
Sbjct  175   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  234

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  235   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  294

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+V+NITGGTDLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  295   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  354

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  355   RMQGEVKITVIATGF  369



>gb|AFP55293.1| FtsZ [Arthrospira platensis ZJU0101/S]
Length=427

 Score =   353 bits (907),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 257/315 (82%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  56    SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  113

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+TAG+GGGTGTG AP++A  
Sbjct  114   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  173

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VDTLIVIPN+KLL+ ++  TPV 
Sbjct  174   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  233

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  234   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  293

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+++NITGGTDLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  294   ALTAISSPLLESSIEGARGVIFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  353

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  354   RMQGEVKITVIATGF  368



>ref|WP_006511475.1| cell division protein FtsZ [Xenococcus sp. PCC 7305]
 gb|ELS01413.1| cell division protein FtsZ [Xenococcus sp. PCC 7305]
Length=436

 Score =   353 bits (905),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 222/382 (58%), Positives = 278/382 (73%), Gaps = 29/382 (8%)
 Frame = +1

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             N A IKV+GVGGGG NAVNRMIES + G+EFW +NTD QA+  S    + +LQIG ++TR
Sbjct  62    NVANIKVMGVGGGGCNAVNRMIESQISGIEFWAINTDAQALEKSDA--EQKLQIGHKITR  119

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP IG  AA+ES++ I  A+   D+VF+TAGMGGGTGTGAAP+ A  AK MG L
Sbjct  120   GLGAGGNPAIGQKAAEESRDEIAHALENTDLVFITAGMGGGTGTGAAPIAAEVAKEMGCL  179

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVG+VT PFSFEGRRR  QA+EGI ALR  VDT+IVIPN++LLT +SP TPV +AF +AD
Sbjct  180   TVGVVTRPFSFEGRRRTNQAEEGINALRSRVDTMIVIPNNQLLTVISPETPVQQAFQVAD  239

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             D+LRQGV+GISDIITIPGL+NVDFADVRAIM  AGS+LMGIG A+GK+RAR+AA+ A+ S
Sbjct  240   DVLRQGVQGISDIITIPGLINVDFADVRAIMADAGSALMGIGVASGKSRAREAAIAAVSS  299

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             PLL+  I  A G+V NITGG DLTL EVNAAA+ +Y++VD  AN+IFGAVID S+ G++ 
Sbjct  300   PLLESSIYGARGVVLNITGGYDLTLHEVNAAADSVYEVVDQDANIIFGAVIDDSMDGEIR  359

Query  1543  ITLIATGFKRQEGDDKPLQANQLAPG---------------DASIGINRR------PASF  1659
             IT+IATGF    GD +  +   L  G               ++ + I  R      P   
Sbjct  360   ITVIATGFT---GDSEEEEIPGLEDGPQVFAESAKRNQVKRNSGVRITERREESKKPEPR  416

Query  1660  MDGSSVEIPEFLKKKGRSRYPR  1725
              D + +EIP+FL+K+   R+P+
Sbjct  417   RDNNRIEIPDFLQKR---RFPK  435



>ref|WP_014276905.1| cell division protein FtsZ [Arthrospira platensis]
 ref|YP_005071738.1| cell division protein FtsZ [Arthrospira platensis NIES-39]
 dbj|BAI93200.1| cell division protein FtsZ [Arthrospira platensis NIES-39]
 gb|AFP55294.1| FtsZ [Arthrospira platensis ZJU0103]
 gb|AFP55295.1| FtsZ [Arthrospira platensis ZJU0103/S]
Length=426

 Score =   352 bits (904),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 256/315 (81%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  55    SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  112

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+TAG+GGGTGTG AP++A  
Sbjct  113   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  172

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VDTLIVIPN+KLL+ ++  TPV 
Sbjct  173   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  232

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  233   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  292

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+V+NITGG DLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  293   ALTAISSPLLESSIEGARGVVFNITGGCDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  352

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  353   RMQGEVKITVIATGF  367



>ref|WP_006620261.1| cell division protein FtsZ [Arthrospira platensis]
 gb|KDR58373.1| cell division protein FtsZ [Arthrospira platensis str. Paraca]
Length=427

 Score =   352 bits (904),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 256/315 (81%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  56    SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  113

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+TAG+GGGTGTG AP++A  
Sbjct  114   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  173

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VDTLIVIPN+KLL+ ++  TPV 
Sbjct  174   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  233

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EAF  ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  234   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  293

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+V+NITGG DLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  294   ALTAISSPLLESSIEGARGVVFNITGGCDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  353

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  354   RMQGEVKITVIATGF  368



>ref|WP_012630079.1| cell division protein FtsZ [Cyanothece sp. PCC 7425]
 ref|YP_002485398.1| cell division protein FtsZ [Cyanothece sp. PCC 7425]
 gb|ACL47037.1| cell division protein FtsZ [Cyanothece sp. PCC 7425]
Length=454

 Score =   353 bits (905),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 215/334 (64%), Positives = 266/334 (80%), Gaps = 4/334 (1%)
 Frame = +1

Query  574   PRQESGIENVTESSKDSSSVNNFNE--AKIKvvgvggggSNAVNRMIESSMKGVEFWIVN  747
             PR  +     + SS+ + S  N  E  A+IKV+GVGGGG NAVNRMI SS+ GVEFW VN
Sbjct  61    PRNHNKQSAKSLSSERTRSETNVLEGGARIKVIGVGGGGGNAVNRMIASSISGVEFWSVN  120

Query  748   TDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVt  927
             TD QA+  S     +RLQ+GQ+LTRGLGAGGNP IG  AA+ES++ I  A+  +D++F+T
Sbjct  121   TDAQALTQSAA--PNRLQLGQKLTRGLGAGGNPAIGQKAAEESRDEIAAALDNSDLIFIT  178

Query  928   agmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLI  1107
             +GMGGGTGTGAAP++A  AK +G LTVG+VT PF+FEGRRR  QA EGIAAL+  VDTLI
Sbjct  179   SGMGGGTGTGAAPIVAEVAKELGALTVGVVTRPFTFEGRRRGFQADEGIAALQSRVDTLI  238

Query  1108  VIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAG  1287
             VIPNDK+L+ +S  TPV EAF +ADDILRQGV+GISDII +PGLVNVDFADVRA+M  AG
Sbjct  239   VIPNDKILSVISEQTPVQEAFQIADDILRQGVQGISDIINLPGLVNVDFADVRAVMADAG  298

Query  1288  SSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVI  1467
             S+LMG+G A+GK+RA++AA  AI SPLL+  I+ A G+V+NITGG DLTL EV+AAAEVI
Sbjct  299   SALMGVGIASGKSRAKEAATTAISSPLLESSIQGAKGVVFNITGGLDLTLHEVSAAAEVI  358

Query  1468  YDLVDPSANLIFGAVIDPSISGQVSITLIATGFK  1569
             Y++VDPSAN+IFGAVID  I G++ IT+IATGF+
Sbjct  359   YEVVDPSANIIFGAVIDEQIQGEIHITVIATGFQ  392



>ref|WP_015147980.1| cell division protein FtsZ [Oscillatoria acuminata]
 ref|YP_007085256.1| cell division protein FtsZ [Oscillatoria acuminata PCC 6304]
 gb|AFY81336.1| cell division protein FtsZ [Oscillatoria acuminata PCC 6304]
Length=427

 Score =   351 bits (901),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 217/366 (59%), Positives = 264/366 (72%), Gaps = 32/366 (9%)
 Frame = +1

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
              NAVNRMI S + GVEFW VNTD QA+  S      RLQ+GQ+LTRGLGAGGNP IG  A
Sbjct  75    CNAVNRMIASEVSGVEFWAVNTDAQALVQSTA--TKRLQVGQKLTRGLGAGGNPAIGQKA  132

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A+ES++ I  A+  +D+VF+TAGMGGGTGTGAAP++A  AK +G LTVG+VT PF FEGR
Sbjct  133   AEESRDEIAHALEHSDLVFITAGMGGGTGTGAAPIVAEAAKEVGALTVGVVTRPFMFEGR  192

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RR  QA+EGIAAL+  VDTLIVIPNDKLL+ +S  TPV EAF +ADDILRQGV+GISDII
Sbjct  193   RRTNQAEEGIAALQSRVDTLIVIPNDKLLSVISEQTPVQEAFRVADDILRQGVQGISDII  252

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
             TIPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RAR+AAL+AI SPLL+  IE A G+V
Sbjct  253   TIPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAREAALSAISSPLLESSIEGAKGVV  312

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGD  1584
              NITGGTDLTL EVNAAAE +Y++VDP+AN+IFGAVID  + G++ IT+IATGF      
Sbjct  313   LNITGGTDLTLHEVNAAAETVYEVVDPNANIIFGAVIDERLQGEIRITVIATGFS----S  368

Query  1585  DKPLQANQLAPGDASIGINRRPASFMDGSS-------------------VEIPEFLKKKG  1707
             D P    Q+    A +    +P  F+                       ++IP+FL+K+ 
Sbjct  369   DPPQPGTQV----ARVVTQPQPQRFIPKPPAASPPPPPTPDPSRGKPPGLDIPDFLQKR-  423

Query  1708  RSRYPR  1725
               R PR
Sbjct  424   --RPPR  427



>ref|WP_006632966.1| cell division protein FtsZ [Microcoleus vaginatus]
 gb|EGK88184.1| cell division protein FtsZ [Microcoleus vaginatus FGP-2]
Length=424

 Score =   351 bits (900),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 216/359 (60%), Positives = 267/359 (74%), Gaps = 21/359 (6%)
 Frame = +1

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMI S + GVEFW VNTD QA+ +S      RLQ+GQ+LTRGLGAGGNP IG  AA
Sbjct  74    NAVNRMIASEVSGVEFWCVNTDSQALVLSNA--PKRLQVGQKLTRGLGAGGNPAIGQKAA  131

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
             +ES++ +  A+  AD+VF+TAGMGGGTGTGAAP++A  AK MG LTVGIVT PF+FEGRR
Sbjct  132   EESRDEVANALNHADLVFITAGMGGGTGTGAAPIVAEVAKEMGALTVGIVTRPFTFEGRR  191

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             R  QA+EGIAAL+  VDTLIVIPNDKLL+ +S   PV EAF +ADDILRQGV+GISDIIT
Sbjct  192   RTSQAEEGIAALQTRVDTLIVIPNDKLLSVISEQMPVQEAFRVADDILRQGVQGISDIIT  251

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDI-GIERATGIV  1404
             IPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RAR+AA+ AI SPLL+   IE A G+V
Sbjct  252   IPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAREAAMQAISSPLLEASSIEGARGVV  311

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFK-----  1569
             +NITGGTD+TL EVNAAAE IY++VDP+AN+IFGAVID  + G++ IT+IATGF      
Sbjct  312   FNITGGTDMTLHEVNAAAETIYEVVDPNANIIFGAVIDERLQGEIKITVIATGFSGEVPS  371

Query  1570  -----RQEGDDKPLQANQL--APGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
                  R +  + P +A  +  +P   +     +P   +    ++IPEFL+ +   R PR
Sbjct  372   PPAPGRTQNVNAPWRAATVPTSPAQQTPDPTTKPPQDL---GLDIPEFLRNR---RPPR  424



>gb|AFP55292.1| FtsZ [Arthrospira platensis ZJU0101]
Length=427

 Score =   351 bits (900),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 254/315 (81%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             SS +   N AKIKV+GVGG G NA+NRMI+S + GVEFW VNTD QA+  S      RLQ
Sbjct  56    SSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKA--SKRLQ  113

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             +GQ+LTRGLGAGGNP IG  AA+ES++ I +A+ GAD+VF+ AG+GGGTGTG AP++A  
Sbjct  114   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFIIAGLGGGTGTGGAPIVAEI  173

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK +G LT+G+VT PF+FEGRRR  QA EGIAAL+  VD LIVIPN+KLL+ ++  TPV 
Sbjct  174   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDALIVIPNNKLLSVINEQTPVQ  233

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             EA   ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L+GIG  +GK+RAR+A
Sbjct  234   EALRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  293

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             AL AI SPLL+  IE A G+V+NITGGTDLTL EVNAAAE IY++VDP+AN+IFGAVID 
Sbjct  294   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  353

Query  1522  SISGQVSITLIATGF  1566
              + G+V IT+IATGF
Sbjct  354   RMQGEVKITVIATGF  368



>ref|WP_009557129.1| cell division protein FtsZ [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ68364.1| cell division protein FtsZ [Oscillatoriales cyanobacterium JSC-12]
Length=422

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 218/352 (62%), Positives = 265/352 (75%), Gaps = 12/352 (3%)
 Frame = +1

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMI S + GVEFW +NTD QA+  S      RLQ+GQ+LTRGLGAGGNP IG  AA
Sbjct  77    NAVNRMIASDVTGVEFWSINTDAQALEGSDA--PKRLQVGQKLTRGLGAGGNPAIGQKAA  134

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
             +ES++ I  A+ GAD+VF+TAGMGGGTGTGAAP++A  AK +G LTVGIVT PF+FEGRR
Sbjct  135   EESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKELGALTVGIVTRPFTFEGRR  194

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             RA QA EGI AL+  VDTLI+IPNDKLL+ +S  TPV EAF  ADDILRQGV+GISDIIT
Sbjct  195   RASQAAEGIEALQSRVDTLIMIPNDKLLSVISEQTPVQEAFRAADDILRQGVQGISDIIT  254

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  1407
             I GLVNVDFADVRA+M  AGS+LMGIG  TGK+RAR+AA+ +I SPLL+  I+ A G+V+
Sbjct  255   IRGLVNVDFADVRAVMADAGSALMGIGVGTGKSRAREAAVASISSPLLESSIDGARGVVF  314

Query  1408  NITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDD  1587
             NITGGTDLTL EVNAAAE+IY++VDP+AN+IFGAVID  + G++ IT+IATGF   E   
Sbjct  315   NITGGTDLTLHEVNAAAEIIYEVVDPNANIIFGAVIDERLQGELRITVIATGFS-GEVQP  373

Query  1588  KPLQANQLA----PGDASIGINRRPASFM--DGSSVEIPEFLKKKGRSRYPR  1725
             +P Q  + +    P   S G    P S     G  ++IP+FL+ +   R PR
Sbjct  374   QPQQITKPSALKRPPATSTGTISPPQSPARPRGDVLDIPDFLRNR---RPPR  422



>ref|XP_003080256.1| ftsZ2 (ISS) [Ostreococcus tauri]
Length=440

 Score =   350 bits (899),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 217/302 (72%), Positives = 247/302 (82%), Gaps = 3/302 (1%)
 Frame = +1

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
             SNAVNRM  S + GVEFWIVNTD QA+    V   ++LQIG ELTRGLGAGGNP+IG  A
Sbjct  72    SNAVNRMQNSDITGVEFWIVNTDAQALDQQAVDAPNQLQIGAELTRGLGAGGNPEIGQKA  131

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A+ES+ A+E A+ GADMVFVTAGMGGGTG+GAAPV+A  AKS GILTVGIVT PF FEGR
Sbjct  132   AEESRTAVEAALTGADMVFVTAGMGGGTGSGAAPVVAQVAKSAGILTVGIVTMPFKFEGR  191

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             +R  QA E +  LR+NVDTLIVIPND+LL AV P+  V +AF LADDILRQGVRGI+DII
Sbjct  192   QRYNQAMEAVERLRQNVDTLIVIPNDRLLAAVDPTLSVQDAFLLADDILRQGVRGITDII  251

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
             T+PGL+NVDFADVRA+M  AGSSLMGIG A+GK RAR+AA  AI SPLLD+GI+RATGIV
Sbjct  252   TLPGLINVDFADVRAVMADAGSSLMGIGRASGKNRAREAAEAAISSPLLDLGIDRATGIV  311

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVI---DPSISGQVSITLIATGFKRQ  1575
             WNITGG+DLTL EVN AAEVIYDLVDPSA +IFGAVI   + +  G+VSITLIATGF   
Sbjct  312   WNITGGSDLTLHEVNEAAEVIYDLVDPSALIIFGAVIKDGNRATDGEVSITLIATGFSPS  371

Query  1576  EG  1581
              G
Sbjct  372   AG  373



>ref|WP_015167500.1| cell division protein FtsZ [Synechococcus sp. PCC 7502]
 ref|YP_007104976.1| cell division protein FtsZ [Synechococcus sp. PCC 7502]
 gb|AFY72841.1| cell division protein FtsZ [Synechococcus sp. PCC 7502]
Length=407

 Score =   349 bits (895),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 262/343 (76%), Gaps = 12/343 (3%)
 Frame = +1

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMI S + GVEFW +NTD QA+  S      R QIGQ++T+GLGAGGNP IG  AA
Sbjct  76    NAVNRMIASEISGVEFWSLNTDAQALLQSS--SPKRFQIGQKITKGLGAGGNPAIGQKAA  133

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
             +ES+  I  A+ GAD+VF+TAGMGGGTGTGAAPVIA  AK  G LTVGIVT PF+FEGRR
Sbjct  134   EESRAEIAHALEGADLVFITAGMGGGTGTGAAPVIAEIAKEAGALTVGIVTRPFTFEGRR  193

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             R  QA+EGI AL+  VDTLI+IPN+KLL+  +  TP+ EAF +ADDILRQGV+GISD+IT
Sbjct  194   RLQQAEEGIDALQSRVDTLIIIPNNKLLSVTAEQTPIQEAFRVADDILRQGVQGISDMIT  253

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  1407
             IPGLVNVDFAD+RA+M  AGS+L+GIG  +GK+RAR+AA+ AI SPLL+  IE A G+V+
Sbjct  254   IPGLVNVDFADIRAVMADAGSALLGIGIGSGKSRAREAAMTAISSPLLESSIEGANGVVF  313

Query  1408  NITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDD  1587
             NITGG+DLTL EVNAAAE+IY++VDP+AN+IFGAVID  ++G+V IT+IATGF       
Sbjct  314   NITGGSDLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMAGEVRITVIATGFSNNPDGS  373

Query  1588  KPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSR  1716
                +++ L   DA    N +P       S++IP+FL+++  +R
Sbjct  374   TYRRSSTLGGFDAK---NTKP-------SLDIPDFLQRRRPNR  406



>ref|WP_039778672.1| cell division protein FtsZ [Acaryochloris sp. CCMEE 5410]
Length=375

 Score =   348 bits (892),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 219/382 (57%), Positives = 280/382 (73%), Gaps = 23/382 (6%)
 Frame = +1

Query  613   SKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQH  792
             S +  ++     A IKV+GVGGGG NAVNRMI S++ GVEFW +NTD Q++  S      
Sbjct  2     SMEDDNIVRHGAATIKVIGVGGGGGNAVNRMIASNVSGVEFWSINTDAQSLTQSSA--AK  59

Query  793   RLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapvi  972
             RLQ+GQ+LTRGLGAGGNP IG  AA+ES++ I  A+ G+D+VF+T GMGGGTGTGAAP+I
Sbjct  60    RLQVGQKLTRGLGAGGNPAIGQKAAEESRDDIAAALAGSDLVFITCGMGGGTGTGAAPII  119

Query  973   agtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPST  1152
             A  AK MG LTVG+VT PF+FEGRRR+ QA+EGIAAL+  VDTLI+IPNDK+L+ ++  T
Sbjct  120   AEIAKEMGALTVGVVTRPFTFEGRRRSHQAEEGIAALQTRVDTLIMIPNDKILSVIAEQT  179

Query  1153  PVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRA  1332
             PV EAF  ADD+LRQGV+GISDII +PGLVNVDFADV+AIM  AGS++MGIG  +GK+RA
Sbjct  180   PVQEAFQTADDVLRQGVQGISDIINVPGLVNVDFADVKAIMADAGSAMMGIGVGSGKSRA  239

Query  1333  RDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAV  1512
             ++AA+ AI SPLLD  I  A G+V+NITGG DL+L EVN AAE IY++VD SAN+IFGAV
Sbjct  240   KEAAIAAIDSPLLDASIRGAKGVVFNITGGHDLSLHEVNTAAETIYEVVDASANIIFGAV  299

Query  1513  IDPSISGQVSITLIATGFKRQEG-------------DDKPLQANQLAPGDASIGINRRPA  1653
             ID S+ G++ +T+IATGF    G                P Q  + AP      + +RP 
Sbjct  300   IDESLQGEIKMTVIATGFSSDAGTPPRKSEAKPKAKAAAPTQQQKAAPKT----VTQRPP  355

Query  1654  SFMDGSSVEIPEFLKKK--GRS  1713
             +   G +++IP+FL+K+  GRS
Sbjct  356   T--RGGNLDIPDFLQKRRPGRS  375



>ref|WP_015201234.1| cell division protein FtsZ [Crinalium epipsammum]
 ref|YP_007140600.1| cell division protein FtsZ [Crinalium epipsammum PCC 9333]
 gb|AFZ11090.1| cell division protein FtsZ [Crinalium epipsammum PCC 9333]
Length=418

 Score =   349 bits (895),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 203/293 (69%), Positives = 241/293 (82%), Gaps = 2/293 (1%)
 Frame = +1

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMI S + GVEFW +NTD QA+  S      RLQ+GQ+LTRGLGAGGNP IG  AA
Sbjct  76    NAVNRMIASDLNGVEFWTLNTDAQALSHSSA--PKRLQVGQKLTRGLGAGGNPAIGQKAA  133

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
             +ES++ I  A+ G D+VF+TAGMGGGTGTGAAPV+A  AK MG LTVG+VT PF FEGRR
Sbjct  134   EESRDDIAAALDGTDLVFITAGMGGGTGTGAAPVVAEVAKEMGALTVGVVTRPFLFEGRR  193

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             R  QA+EGIAAL+  VDTLIVIPNDKLL+ +S  TPV EAF +ADDILRQGV+GISDIIT
Sbjct  194   RTSQAEEGIAALQGRVDTLIVIPNDKLLSVISEQTPVQEAFRVADDILRQGVQGISDIIT  253

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  1407
             IPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RAR+AA+ AI SPLL+  +E A G+V+
Sbjct  254   IPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRAREAAMAAISSPLLESSVEGARGVVF  313

Query  1408  NITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF  1566
             NITGG+DLTL EVNAAAE IY++VDP+AN+IFGAVID  + G++ IT+IATGF
Sbjct  314   NITGGSDLTLHEVNAAAETIYEVVDPNANIIFGAVIDDRLQGEIRITVIATGF  366



>ref|WP_015180997.1| cell division protein FtsZ [Microcoleus sp. PCC 7113]
 ref|YP_007120243.1| cell division protein FtsZ [Microcoleus sp. PCC 7113]
 gb|AFZ16837.1| cell division protein FtsZ [Microcoleus sp. PCC 7113]
Length=423

 Score =   349 bits (896),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 213/359 (59%), Positives = 262/359 (73%), Gaps = 27/359 (8%)
 Frame = +1

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMI S + GVEFW +NTD QA+  +      RLQ+GQ+LTRGLGAGGNP IG  AA
Sbjct  78    NAVNRMIASEVSGVEFWSINTDSQALAQNAA--ARRLQMGQKLTRGLGAGGNPAIGQKAA  135

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
             +ES+E I  A+  AD+VF+TAGMGGGTGTGAAP++A  AK MG LTVG+VT PF+FEGRR
Sbjct  136   EESREEIAHAIENADLVFITAGMGGGTGTGAAPIVAEVAKEMGALTVGVVTRPFTFEGRR  195

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             R  QA+EGIAAL+  VDTLIVIPN+KLL+ ++  TPV EAF +ADDILRQGV+GISDIIT
Sbjct  196   RTTQAEEGIAALQSRVDTLIVIPNNKLLSVINEQTPVQEAFRVADDILRQGVQGISDIIT  255

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  1407
             IPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RAR+AA  AI SPLL+  I+ A G+V 
Sbjct  256   IPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRAREAASQAISSPLLEASIDGARGVVL  315

Query  1408  NITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDD  1587
             NITGG+DLTL EVNAAAE +Y++VDP+AN+IFGAVID  + G+V IT+IATGF  +    
Sbjct  316   NITGGSDLTLHEVNAAAETVYEVVDPNANIIFGAVIDDKMQGEVRITVIATGFSGE----  371

Query  1588  KPLQANQLAPGD-ASIGINRRPASFMDG------------SSVEIPEFLKKKGRSRYPR  1725
                   Q AP         RRP +                  ++IPEFL+++   R+P+
Sbjct  372   -----TQSAPSSMKETPYPRRPIAPTPNPPMPPVEPRGRQQELDIPEFLQRR---RFPK  422



>ref|WP_015179039.1| cell division protein FtsZ [Oscillatoria nigro-viridis]
 ref|YP_007118250.1| cell division protein FtsZ [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ09834.1| cell division protein FtsZ [Oscillatoria nigro-viridis PCC 7112]
Length=454

 Score =   350 bits (898),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 216/359 (60%), Positives = 266/359 (74%), Gaps = 21/359 (6%)
 Frame = +1

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMI S + GVEFW VNTD QA+ +S      RLQ+GQ+LTRGLGAGGNP IG  AA
Sbjct  104   NAVNRMIASEVSGVEFWCVNTDSQALVLSNA--PKRLQVGQKLTRGLGAGGNPAIGQKAA  161

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
             +ES++ +  A+  AD+VF+TAGMGGGTGTGAAP++A  AK MG LTVGIVT PF+FEGRR
Sbjct  162   EESRDEVANALNHADLVFITAGMGGGTGTGAAPIVAEVAKEMGALTVGIVTRPFTFEGRR  221

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             R  QA+EGIAAL+  VDTLIVIPNDKLL+ +S   PV EAF +ADDILRQGV+GISDIIT
Sbjct  222   RTSQAEEGIAALQTRVDTLIVIPNDKLLSVISEQMPVQEAFRVADDILRQGVQGISDIIT  281

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDI-GIERATGIV  1404
             IPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RAR+AA+ AI SPLL+   IE A G+V
Sbjct  282   IPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAREAAMQAISSPLLEASSIEGARGVV  341

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFK-----  1569
             +NITGGTD+TL EVNAAAE IY++VDP+AN+IFGAVID  + G++ IT+IATGF      
Sbjct  342   FNITGGTDMTLHEVNAAAETIYEVVDPNANIIFGAVIDERLQGEIKITVIATGFSGEVPS  401

Query  1570  -----RQEGDDKPLQANQ--LAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
                  R +  + P +A    + P   +     +P   +    ++IPEFL+ +   R PR
Sbjct  402   PPTPGRTQNVNAPWRAATVPVTPAQQTPDPKAKPPQDL---GLDIPEFLRNR---RPPR  454



>ref|WP_017712109.1| cell division protein FtsZ [Prochlorothrix hollandica]
Length=381

 Score =   347 bits (891),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 213/322 (66%), Positives = 259/322 (80%), Gaps = 2/322 (1%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A+IKV+GVGGGGSNAVNRMI S + GVEFW +NTD QA+  +      RLQIGQ+LTRGL
Sbjct  13    ARIKVIGVGGGGSNAVNRMIASDLGGVEFWAMNTDAQALLNAATI--QRLQIGQKLTRGL  70

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES++ I +A+  AD+VF+TAGMGGGTGTGAAP++A  AK +G LTV
Sbjct  71    GAGGNPAIGQKAAEESRDEIAKALEHADLVFITAGMGGGTGTGAAPIVAEVAKELGALTV  130

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             GI+T PF+FEGRRR +QA EGIAAL+  VDTLI+IPNDKLL  +S  TPV EAF +ADDI
Sbjct  131   GIITRPFTFEGRRRQMQADEGIAALQTRVDTLIMIPNDKLLAVISDQTPVQEAFRMADDI  190

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFAD+RA+M  AGS++MGIG  +GK+RA++AA  AI SPL
Sbjct  191   LRQGVQGISDIITIPGLVNVDFADIRAVMADAGSAMMGIGIGSGKSRAKEAAAAAISSPL  250

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             LD  +E A G+V+NITGG+DLTL EVNAAAE IY++VDP AN+IFG+VID  + G+V IT
Sbjct  251   LDASVEGAKGVVFNITGGSDLTLHEVNAAAETIYEVVDPEANIIFGSVIDERLQGEVQIT  310

Query  1549  LIATGFKRQEGDDKPLQANQLA  1614
             +IATGF  Q       QA ++A
Sbjct  311   VIATGFGAQSAAVAATQAPRMA  332



>ref|WP_023171980.1| cell division protein FtsZ [Gloeobacter kilaueensis]
 ref|YP_008710642.1| cell division protein FtsZ [Gloeobacter kilaueensis JS1]
 gb|AGY56935.1| cell division protein FtsZ [Gloeobacter kilaueensis JS1]
Length=417

 Score =   348 bits (894),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 225/360 (63%), Positives = 270/360 (75%), Gaps = 10/360 (3%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A IKVVGVGGGG NAVNRMI S++ GVEFW +NTD Q++  S   PQ RLQIGQ+LTRGL
Sbjct  56    ALIKVVGVGGGGGNAVNRMIASNVVGVEFWAINTDAQSLTQSSA-PQ-RLQIGQKLTRGL  113

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES+E I  A+ GAD+VF+TAGMGGGTGTGAA ++A  AK +G LTV
Sbjct  114   GAGGNPSIGQKAAEESREEIMAALEGADLVFITAGMGGGTGTGAAAIVAEAAKEVGALTV  173

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
              +VT PF+FEGRRR  QA+ GI AL+  VDTLIVIPNDKLLT +S  TPV EAF +ADDI
Sbjct  174   AVVTRPFTFEGRRRMQQAESGIEALQGRVDTLIVIPNDKLLTVISEQTPVQEAFRIADDI  233

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGL+NVDFADVRAIM  AGS+LMGIG  +GK+RAR+AA+ AI SPL
Sbjct  234   LRQGVQGISDIITIPGLINVDFADVRAIMADAGSALMGIGMGSGKSRAREAAMTAISSPL  293

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  IE A G+V N+TGG DLTL EVN AA VIY++VDP+AN+IFGAVID  + G++ IT
Sbjct  294   LESSIEGANGVVLNVTGGHDLTLHEVNEAAAVIYEVVDPNANIIFGAVIDEKLQGELRIT  353

Query  1549  LIATGFKRQEGDDKPLQANQLAPGDA-----SIG---INRRPASFMDGSSVEIPEFLKKK  1704
             +IATGF       K  +     PGD      +IG       PA       ++IPEFL+++
Sbjct  354   VIATGFNGVLPAVKAGKVRLTEPGDVPTAKPTIGPPPTAANPARATGDEVLDIPEFLRRR  413



>ref|WP_006106232.1| cell division protein FtsZ [Coleofasciculus chthonoplastes]
 gb|EDX70873.1| cell division protein FtsZ [Coleofasciculus chthonoplastes PCC 
7420]
Length=362

 Score =   346 bits (888),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 207/306 (68%), Positives = 255/306 (83%), Gaps = 2/306 (1%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A+IKVVGVGGGG NAVNRMI S + G+EFW +NTD QA+  +      RLQ+GQ+LTRGL
Sbjct  6     ARIKVVGVGGGGGNAVNRMIASEVAGIEFWSINTDSQALSQNSA--AKRLQVGQKLTRGL  63

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES++ I +A+  +D+VF+TAGMGGGTGTGAAP++A  AK MG LTV
Sbjct  64    GAGGNPAIGQKAAEESRDEIAQALAESDLVFITAGMGGGTGTGAAPIVAEIAKEMGALTV  123

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G+VT PF+FEGRRR  QA+EGIAAL+  VDTLIVIPN+KLL+ +S  TPV +AF +ADDI
Sbjct  124   GVVTRPFTFEGRRRTSQAEEGIAALQSRVDTLIVIPNNKLLSVISEQTPVQDAFRVADDI  183

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIIT+PGLVNVDFADVRA+M  AGS+LMGIG  +GK+RAR+AA+ AI SPL
Sbjct  184   LRQGVQGISDIITVPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAREAAVAAISSPL  243

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  +E A G+V+NITGG+DLTL EVNAAAE IY++VDP+AN+IFGAVID  + G++ IT
Sbjct  244   LESSVEGARGVVFNITGGSDLTLHEVNAAAETIYEVVDPNANIIFGAVIDDRLQGEIRIT  303

Query  1549  LIATGF  1566
             +IATGF
Sbjct  304   VIATGF  309



>ref|WP_035156917.1| cell division protein FtsZ [Calothrix sp. 336/3]
 gb|KFB85522.1| cell division protein FtsZ [Calothrix sp. 336/3]
Length=429

 Score =   347 bits (891),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 208/306 (68%), Positives = 252/306 (82%), Gaps = 2/306 (1%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A IKV+GVGGGG NAVNRMI S + GVEFW +NTD QA+ ++      RLQIGQ+LTRGL
Sbjct  64    ANIKVIGVGGGGGNAVNRMIASDVSGVEFWTINTDAQALTLAAA--PSRLQIGQKLTRGL  121

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IGT AA+ES++ I  A+ GAD+VF+TAGMGGGTGTGAAP++A  AK MG LTV
Sbjct  122   GAGGNPAIGTKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMGALTV  181

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G+VT PF FEGRRRA QA++GI AL+  VDTLI+IPN+KLL  +   TP+ +AF  ADD+
Sbjct  182   GVVTRPFVFEGRRRASQAEQGIEALKSRVDTLIIIPNNKLLEVIPEQTPMQDAFRYADDV  241

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+LMGIG ++GK+RAR+AA+ AI SPL
Sbjct  242   LRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVSSGKSRAREAAMAAISSPL  301

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  IE A G+V+NITGG+D TL EVNAAAE IY++VDP+AN+IFGAVID  + G+V IT
Sbjct  302   LECSIEGARGVVFNITGGSDFTLHEVNAAAETIYEVVDPNANIIFGAVIDDRLQGEVRIT  361

Query  1549  LIATGF  1566
             +IATGF
Sbjct  362   VIATGF  367



>ref|WP_015157768.1| cell division protein FtsZ [Chamaesiphon minutus]
 ref|YP_007095100.1| cell division protein FtsZ [Chamaesiphon minutus PCC 6605]
 gb|AFY91573.1| cell division protein FtsZ [Chamaesiphon minutus PCC 6605]
Length=412

 Score =   347 bits (890),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 253/308 (82%), Gaps = 2/308 (1%)
 Frame = +1

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             N A+IKV+GVGGGGSNAVNRMI S ++G+EFW +NTD QA+  S      R+Q+GQ+LTR
Sbjct  37    NTARIKVIGVGGGGSNAVNRMIASDIEGIEFWTMNTDAQALSHSDA--TRRIQLGQKLTR  94

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP IG  AA+ES+E I  A+ GAD+VF+TAGMGGGTGTGAA ++A  AK MG L
Sbjct  95    GLGAGGNPAIGQKAAEESREEIAHALEGADLVFITAGMGGGTGTGAARIVAEVAKEMGAL  154

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVG+VT PF+FEGRRR  QA+EGI+ L+  VDTLI+IPNDKLL A++  TPV EAF +AD
Sbjct  155   TVGVVTRPFTFEGRRRTNQAEEGISGLQSQVDTLIIIPNDKLLQAINEQTPVQEAFRIAD  214

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             D+LR GV+GISDIITIPGL+NVDFADVR +M  AGS+LMGIG  +GK+RAR+AA+ AI S
Sbjct  215   DVLRSGVQGISDIITIPGLINVDFADVRTVMADAGSALMGIGEGSGKSRAREAAVQAINS  274

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             PLL+  IE A G+V NITGG+D+TL EV+ AA+ IY++VDP+AN+IFGAVIDP + G++ 
Sbjct  275   PLLESSIEGARGVVLNITGGSDMTLIEVSTAADTIYEVVDPNANIIFGAVIDPQMQGEMR  334

Query  1543  ITLIATGF  1566
             IT+IATGF
Sbjct  335   ITVIATGF  342



>ref|WP_037222028.1| cell division protein FtsZ [Richelia intracellularis]
 emb|CDN14743.1| Cell division protein FtsZ [Richelia intracellularis]
Length=434

 Score =   347 bits (891),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 225/380 (59%), Positives = 279/380 (73%), Gaps = 31/380 (8%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRM--SPVFPQHRLQIGQELTR  822
             A IKV+GVGGGG NAVNRMI S + GVEFW +NTD QA+ +  SP     RLQIGQ+LTR
Sbjct  64    ANIKVIGVGGGGGNAVNRMIASDVSGVEFWTINTDAQALTLASSP----SRLQIGQKLTR  119

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP IG  AA+ES++ I  A+ GAD+VF+TAGMGGGTGTGAAP++A  AK MG L
Sbjct  120   GLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMGAL  179

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVG+VT PF FEGRRR  QA++GI  L+  VDTLI+IPN+KLL  +   TPV EAF  AD
Sbjct  180   TVGVVTRPFVFEGRRRTTQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQTPVQEAFRYAD  239

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             D+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+LMGIG ++GK+RAR+AA+ AI S
Sbjct  240   DVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVSSGKSRAREAAVAAISS  299

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             PLL+  IE A G+V+NITGG+DLTL EVN+AAE IY++VDP+AN+IFGAVID  + G+V 
Sbjct  300   PLLECSIEGARGVVFNITGGSDLTLHEVNSAAEAIYEVVDPNANIIFGAVIDDRLQGEVR  359

Query  1543  ITLIATGFKRQEGDDKPLQ-----ANQLAPGDAS-----------IGINRRPASFMD---  1665
             IT+IATGF    GD    Q     +N++APG  S                 P   ++   
Sbjct  360   ITVIATGFT---GDLTTAQQQNATSNRVAPGAPSRKQSQKSQPQPQASTNSPKPVVEPKG  416

Query  1666  GSSVEIPEFLKKKGRSRYPR  1725
               +++IP+FL+++   R PR
Sbjct  417   KPALDIPDFLQRR---RIPR  433



>ref|WP_015219491.1| cell division protein FtsZ [Cyanobacterium aponinum]
 ref|YP_007161808.1| cell division protein FtsZ [Cyanobacterium aponinum PCC 10605]
 gb|AFZ53764.1| cell division protein FtsZ [Cyanobacterium aponinum PCC 10605]
Length=420

 Score =   347 bits (889),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 230/401 (57%), Positives = 288/401 (72%), Gaps = 29/401 (7%)
 Frame = +1

Query  568   MTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVN  747
             M P+ ES   N+     +S+S+   N AKIKV+GVGGGG NAVNRMI+SS+ GV+FW +N
Sbjct  35    MRPKDESPDLNM-----NSNSITPSNIAKIKVIGVGGGGCNAVNRMIQSSVVGVDFWQIN  89

Query  748   TDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVt  927
             TD QA+  S     + LQIGQ+LTRGLGAGGNP IG  AA+ES++ I +A+   D+VF+T
Sbjct  90    TDAQALAQS--MTTYCLQIGQKLTRGLGAGGNPAIGQKAAEESRDEIAKALENTDLVFIT  147

Query  928   agmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLI  1107
             AGMGGGTGTGAAP++A  AK MG LTVG+VT PF+FEGRRR  QA EGI AL   VDTLI
Sbjct  148   AGMGGGTGTGAAPIVAEIAKDMGCLTVGVVTRPFTFEGRRRTNQADEGIRALESKVDTLI  207

Query  1108  VIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAG  1287
             VIPN++LL  + P TP+ E+F +ADD LRQGV+GISDIITIPGLVNVDFADVRA+M  AG
Sbjct  208   VIPNNQLLAVIPPETPLQESFRMADDTLRQGVQGISDIITIPGLVNVDFADVRAVMADAG  267

Query  1288  SSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVI  1467
             S+LMGIG  +GK+RA++ A+ AI SPL++  IE ATG+V NITGG DLTL EVNAAAE I
Sbjct  268   SALMGIGIGSGKSRAKEGAIAAISSPLIESSIEGATGVVLNITGGKDLTLHEVNAAAETI  327

Query  1468  YDLVDPSANLIFGAVIDPSISGQVSITLIATGF---KRQEGD-----------DKPLQAN  1605
             Y++VDP+AN+IFGAVID  + G+V +T+IATGF   K+   D           D P   N
Sbjct  328   YEIVDPNANIIFGAVIDEKMQGEVRVTVIATGFSGEKKNNPDRAKTIPSPPNLDSPTSEN  387

Query  1606  QLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYPRA  1728
             +    ++       P S   G  ++IPEFL+   R R+PR+
Sbjct  388   KETANNSP---ETDPQSISSG--LDIPEFLQ---RRRFPRS  420



>ref|WP_010468588.1| cell division protein FtsZ [Acaryochloris sp. CCMEE 5410]
Length=437

 Score =   347 bits (890),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 218/370 (59%), Positives = 276/370 (75%), Gaps = 23/370 (6%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A IKV+GVGGGG NAVNRMI S++ GVEFW +NTD Q++  S      RLQ+GQ+LTRGL
Sbjct  76    ATIKVIGVGGGGGNAVNRMIASNVSGVEFWSINTDAQSLTQSSA--AKRLQVGQKLTRGL  133

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES++ I  A+ G+D+VF+T GMGGGTGTGAAP+IA  AK MG LTV
Sbjct  134   GAGGNPAIGQKAAEESRDDIAAALAGSDLVFITCGMGGGTGTGAAPIIAEIAKEMGALTV  193

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G+VT PF+FEGRRR+ QA+EGIAAL+  VDTLI+IPNDK+L+ ++  TPV EAF  ADD+
Sbjct  194   GVVTRPFTFEGRRRSHQAEEGIAALQTRVDTLIMIPNDKILSVIAEQTPVQEAFQTADDV  253

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDII +PGLVNVDFADV+AIM  AGS++MGIG  +GK+RA++AA+ AI SPL
Sbjct  254   LRQGVQGISDIINVPGLVNVDFADVKAIMADAGSAMMGIGVGSGKSRAKEAAIAAIDSPL  313

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             LD  I  A G+V+NITGG DL+L EVN AAE IY++VD SAN+IFGAVID S+ G++ +T
Sbjct  314   LDASIRGAKGVVFNITGGHDLSLHEVNTAAETIYEVVDASANIIFGAVIDESLQGEIKMT  373

Query  1549  LIATGFKRQEG-------------DDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPE  1689
             +IATGF    G                P Q  + AP      + +RP +   G +++IP+
Sbjct  374   VIATGFSSDAGTPPRKSEAKPKAKAAAPTQQQKAAPKT----VTQRPPT--RGGNLDIPD  427

Query  1690  FLKKK--GRS  1713
             FL+K+  GRS
Sbjct  428   FLQKRRPGRS  437



>ref|WP_017287543.1| cell division protein FtsZ [Leptolyngbya boryana]
Length=425

 Score =   346 bits (888),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 209/349 (60%), Positives = 264/349 (76%), Gaps = 11/349 (3%)
 Frame = +1

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
             SNAVNRMI S++ GVEFW +NTD QA+  S      RLQ+GQ+LTRGLGAGGNP IG  A
Sbjct  75    SNAVNRMIASNVSGVEFWSINTDAQALAQSTAL--KRLQVGQKLTRGLGAGGNPAIGQKA  132

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A+ES++ I  A+  AD+VF+TAGMGGGTGTGAAP++A  AK +G LTVG+VT PF+FEGR
Sbjct  133   AEESRDEIAAALENADLVFITAGMGGGTGTGAAPIVAEVAKELGALTVGVVTRPFTFEGR  192

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RR  QA++G++AL   VDTLI+IPNDKLLT +S  TPV EAF  ADDILRQGV+GISDII
Sbjct  193   RRTGQAEDGVSALASRVDTLIIIPNDKLLTVISEQTPVQEAFRTADDILRQGVQGISDII  252

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
             TIPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RAR+AA+ AI SPLL+  I+ A G+V
Sbjct  253   TIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRAREAAVAAISSPLLEASIDGARGVV  312

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQ---  1575
             +NITGG+DLTL EV+AAA++IY+ VDP+AN+IFGAVID  + G+V IT+IATGF ++   
Sbjct  313   FNITGGSDLTLHEVSAAADIIYEAVDPNANIIFGAVIDDRLQGEVRITVIATGFTQEAQP  372

Query  1576  ----EGDDKPLQANQL-APGDASIGINRRPASFMDGS-SVEIPEFLKKK  1704
                 +G   P +   + AP  +   +         GS  ++IPEFL+ +
Sbjct  373   QAVGKGAAAPAKPRSISAPAVSPNPVQPAAEPQKPGSGGLDIPEFLRSR  421



>ref|WP_009633359.1| cell division protein FtsZ [Synechocystis sp. PCC 7509]
Length=419

 Score =   346 bits (887),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 220/361 (61%), Positives = 272/361 (75%), Gaps = 8/361 (2%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A IKV+GVGGGG NAVNRMI S++ G+EFW +NTD QA+  S      RLQIGQ+LTRGL
Sbjct  62    ANIKVIGVGGGGGNAVNRMIASNVSGIEFWSINTDAQALVQSASV--KRLQIGQKLTRGL  119

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES++ I  A+  AD+VF+T+GMGGGTGTGAAP++A  AK MG LTV
Sbjct  120   GAGGNPAIGQKAAEESRDEIAAALENADLVFITSGMGGGTGTGAAPIVAEIAKEMGALTV  179

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G+VT PF FEGRRR  QA++GI  L   VDTLIVIPNDKLL+ +S  TPV EAF  ADDI
Sbjct  180   GVVTRPFIFEGRRRTSQAEQGIEGLESRVDTLIVIPNDKLLSVISEQTPVQEAFRFADDI  239

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFADVRAIM  AGS+LMGIG  +GK+RA++AA  AI SPL
Sbjct  240   LRQGVQGISDIITIPGLVNVDFADVRAIMADAGSALMGIGVGSGKSRAQEAANAAISSPL  299

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  IE A G+++NITGG+DLTL EVNAAAE+IY++VDP+AN+IFGAVID  + G+V IT
Sbjct  300   LESSIEGARGVIFNITGGSDLTLHEVNAAAEIIYEVVDPNANIIFGAVIDERLQGEVRIT  359

Query  1549  LIATGFKRQEGDDKPLQANQLA---PGDASIGINRRPASF--MDGSSVEIPEFLKKKGRS  1713
             +IATGF  +     P  A ++A               AS+   + + ++IP+FL+++  S
Sbjct  360   VIATGFTGEAVAASP-TATKVAQTTKTPQPTTPPPSAASYEPKEKTGLDIPDFLQRRRPS  418

Query  1714  R  1716
             R
Sbjct  419   R  419



>dbj|BAP17020.1| cell division protein [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=362

 Score =   343 bits (881),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 205/352 (58%), Positives = 261/352 (74%), Gaps = 13/352 (4%)
 Frame = +1

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
              NAVNRM+ESS+ G+EFW +NTD QA+  S   PQ RLQIGQ+LTRGLGAGGNP IGT A
Sbjct  18    CNAVNRMVESSLTGIEFWAINTDAQALSQSAA-PQ-RLQIGQKLTRGLGAGGNPSIGTQA  75

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A+ES++ I  A+   D+ F+TAGMGGGTGTGAAP++A  AK MG LTVG+VT PF+FEGR
Sbjct  76    AEESRDEIAHALENTDLAFITAGMGGGTGTGAAPIVAEVAKEMGCLTVGVVTRPFTFEGR  135

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RR  QA EG+  L+ NVDTLIVIPN++LL  + P TP+ EAF  AD+ILRQGV+GISDII
Sbjct  136   RRTTQAAEGVNNLQNNVDTLIVIPNNQLLQVIPPDTPLQEAFLTADNILRQGVQGISDII  195

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
             TIPGLVNVDFADVRA+M  AGS+LMG+GT +GK+RA DAA+ AI SPLL+  I+ A G+V
Sbjct  196   TIPGLVNVDFADVRAVMADAGSALMGLGTGSGKSRANDAAVQAISSPLLEHSIKGAKGVV  255

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGD  1584
             +NITGG+DLTL EV  AAE I+++VDP AN+IFGAVID  + G+V IT+IATGF    G+
Sbjct  256   FNITGGSDLTLHEVTTAAETIFEVVDPEANIIFGAVIDSVLQGEVIITVIATGFS---GE  312

Query  1585  DKPLQANQLAPGDASIGINRRPASFMDGSS-----VEIPEFLKKKGRSRYPR  1725
                + +  +         N      ++  S     ++IP+FL+++   R+P+
Sbjct  313   SDNIASKTVKSTSVRRVSNTTTTKVLESESPKPTGLDIPDFLQQR---RFPK  361



>ref|WP_026099047.1| cell division protein FtsZ [Oscillatoria sp. PCC 10802]
Length=423

 Score =   345 bits (886),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 220/365 (60%), Positives = 273/365 (75%), Gaps = 10/365 (3%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A+IKV+GVGGGG NA+NRMI S + GVEFW +NTD QA+  S   PQ RLQIGQ+LTRGL
Sbjct  64    ARIKVIGVGGGGGNAINRMIASDVSGVEFWTINTDAQALNQSSA-PQ-RLQIGQKLTRGL  121

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES++ I +A+   D+VF+TAGMGGGTGTGAAP++A  AK +G LTV
Sbjct  122   GAGGNPAIGQKAAEESRDEIAQALGQCDLVFITAGMGGGTGTGAAPIVAEVAKEVGALTV  181

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G+VT PF+FEGRRR  QA EGI AL+  VDTLI+IPNDKLL  +S  TPV EAF +ADDI
Sbjct  182   GVVTRPFTFEGRRRTSQADEGINALQSRVDTLIIIPNDKLLAVISEQTPVQEAFRVADDI  241

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RAR+AA  AI SPL
Sbjct  242   LRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRAREAATAAISSPL  301

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  IE A G+V+NITGG+DLTL EV+ AA++IY+ VDP+AN+IFGAVID  + G++ IT
Sbjct  302   LESSIEGAKGVVFNITGGSDLTLHEVSGAADIIYEAVDPNANIIFGAVIDDRLQGEIRIT  361

Query  1549  LIATGFKRQEGDDKPLQ-----ANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKKGRS  1713
             +IATGF  +   + P       + Q A   A       P        ++IPEFL+++   
Sbjct  362   VIATGFTGEPQSNAPAAKVITPSRQAARPAAPPPPAYEPQKPQQPPGLDIPEFLQRR---  418

Query  1714  RYPRA  1728
             R P++
Sbjct  419   RPPKS  423



>ref|WP_015225997.1| cell division protein FtsZ [Halothece sp. PCC 7418]
 ref|YP_007168336.1| cell division protein FtsZ [Halothece sp. PCC 7418]
 gb|AFZ44122.1| cell division protein FtsZ [Halothece sp. PCC 7418]
Length=420

 Score =   345 bits (885),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 221/384 (58%), Positives = 282/384 (73%), Gaps = 11/384 (3%)
 Frame = +1

Query  586   SGIENVTESSKDSSSVNNF---NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDI  756
             S   N  +S+K  +  +N    N A+IKV+GVGG G NAVNRMI S + GVEFW +NTD 
Sbjct  38    SSHSNDPKSTKTEARSDNIVPGNVARIKVIGVGGAGCNAVNRMIASDVTGVEFWAINTDA  97

Query  757   QAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagm  936
             QA+  S     +RLQ+G++LTRGLGAGGNP IG  AA+ES++ I  A+   D+ F+TAGM
Sbjct  98    QAL--SRASAPNRLQVGEKLTRGLGAGGNPSIGQKAAEESRDEISSALENTDLAFITAGM  155

Query  937   gggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIP  1116
             GGGTGTGAAP++A  AK MG LTVG+VT PF+FEGRRR  QA+EG +AL+  VDTLIVIP
Sbjct  156   GGGTGTGAAPIVAEVAKEMGCLTVGVVTRPFTFEGRRRTSQAEEGTSALQTRVDTLIVIP  215

Query  1117  NDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSL  1296
             N+KLL+ +   TPV +AF +ADDILRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+L
Sbjct  216   NNKLLSVIDEQTPVQDAFRVADDILRQGVQGISDIITIPGLVNVDFADVRAVMADAGSAL  275

Query  1297  MGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDL  1476
             MGIGTA+GK+RA +AA  AI SPLL+  I+ A G+V+NITGG+DLTL EVN AAE IYD 
Sbjct  276   MGIGTASGKSRAAEAATGAISSPLLESSIQGAKGVVFNITGGSDLTLHEVNTAAETIYDN  335

Query  1477  VDPSANLIFGAVI-DPSISGQVSITLIATGFKRQEGDDKPLQANQLAP---GDASIGINR  1644
             VDP+AN+IFGAVI D  + G++ IT+IATGF  +E      +  +  P     + +    
Sbjct  336   VDPNANIIFGAVIDDEKMEGEIRITVIATGFSGEEPKKTQKKETKTTPQTKNPSPLPQKT  395

Query  1645  RPASFMDGSS--VEIPEFLKKKGR  1710
             +P +  DG +  ++IPEFL+++ R
Sbjct  396   KPETKSDGENKGLDIPEFLQRRRR  419



>ref|WP_009628587.1| cell division protein FtsZ [Pseudanabaena biceps]
 gb|ELS31330.1| cell division protein FtsZ [Pseudanabaena biceps PCC 7429]
Length=426

 Score =   345 bits (886),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 199/293 (68%), Positives = 238/293 (81%), Gaps = 2/293 (1%)
 Frame = +1

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMI S + GVEFW  NTD QA+  S      R Q+GQ+LTRGLGAGGNP IG  AA
Sbjct  77    NAVNRMIASDVVGVEFWSFNTDAQALLQSSA--SKRFQMGQKLTRGLGAGGNPAIGQKAA  134

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
             +ES++ I  AV GAD+VF+TAGMGGGTGTGAAP+IA  AK  G LTVGIVT PF+FEGRR
Sbjct  135   EESRDDIAAAVEGADLVFITAGMGGGTGTGAAPIIAEVAKEAGALTVGIVTRPFTFEGRR  194

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             R  QA+EGIA L+  VDTLIVIPNDKLL+ +S  TPV EAF +ADDILRQGV+GISDII 
Sbjct  195   RGQQAEEGIAGLQSRVDTLIVIPNDKLLSVISEQTPVQEAFRVADDILRQGVQGISDIIM  254

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  1407
             IPGLVNVDFAD+RA+M  AGS++MGIG  +GK+RAR+AA+ AI SPLL+  +E A+G+V+
Sbjct  255   IPGLVNVDFADIRAVMADAGSAMMGIGIGSGKSRAREAAMTAISSPLLETSVEGASGVVF  314

Query  1408  NITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF  1566
             NITGG D+TL EVNAAAE IY++VD +AN+IFGAVIDP + G++ IT+IATGF
Sbjct  315   NITGGEDMTLHEVNAAAETIYEVVDQNANIIFGAVIDPKLDGEIRITVIATGF  367



>gb|AAM22891.1| plastid division protein FtsZ2 [Chlamydomonas reinhardtii]
Length=434

 Score =   345 bits (886),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 209/313 (67%), Positives = 258/313 (82%), Gaps = 1/313 (0%)
 Frame = +1

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             ++A IKV+GVGGGGSNAVN M+ S ++GVEFWI NTD QA+  SPV  + ++QIG +LTR
Sbjct  33    DQAIIKVLGVGGGGSNAVNNMVNSDVQGVEFWIANTDAQALATSPVNGKCKVQIGGKLTR  92

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP+IG  AA+ES+++I  A+   DMVFVTAGMGGGTG+GAAPV+A  A+ +GIL
Sbjct  93    GLGAGGNPEIGAKAAEESRDSIAAALQDTDMVFVTAGMGGGTGSGAAPVVAEVARELGIL  152

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVGIVTTPF+FEGR+RA QA+  +A LR  VDTLIVIPND+LL+A+  + P+ +AF +AD
Sbjct  153   TVGIVTTPFTFEGRQRAQQARSALANLRAAVDTLIVIPNDRLLSAMDSNVPIKDAFKIAD  212

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             D+LRQGV+GIS+IIT+PGLVNVDFADVRAIM  AGSSLMG G  +G  RA DAAL AI S
Sbjct  213   DVLRQGVKGISEIITVPGLVNVDFADVRAIMAGAGSSLMGQGYGSGPRRASDAALRAISS  272

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSI-SGQV  1539
             PLL++GIERATG+VWNITG  ++TL EVN AAE+IYD+VDP+ANLIFGAV+D ++    V
Sbjct  273   PLLEVGIERATGVVWNITGPPNMTLHEVNEAAEIIYDMVDPNANLIFGAVVDSTLPDDTV  332

Query  1540  SITLIATGFKRQE  1578
             SIT+IATGF   E
Sbjct  333   SITIIATGFGHVE  345



>ref|XP_001700508.1| plastid division protein FtsZ2 [Chlamydomonas reinhardtii]
 gb|EDO98063.1| plastid division protein FtsZ2 [Chlamydomonas reinhardtii]
Length=434

 Score =   345 bits (886),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 209/313 (67%), Positives = 258/313 (82%), Gaps = 1/313 (0%)
 Frame = +1

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             ++A IKV+GVGGGGSNAVN M+ S ++GVEFWI NTD QA+  SPV  + ++QIG +LTR
Sbjct  33    DQAIIKVLGVGGGGSNAVNNMVNSDVQGVEFWIANTDAQALATSPVNGKCKVQIGGKLTR  92

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP+IG  AA+ES+++I  A+   DMVFVTAGMGGGTG+GAAPV+A  A+ +GIL
Sbjct  93    GLGAGGNPEIGAKAAEESRDSIAAALQDTDMVFVTAGMGGGTGSGAAPVVAQVARELGIL  152

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVGIVTTPF+FEGR+RA QA+  +A LR  VDTLIVIPND+LL+A+  + P+ +AF +AD
Sbjct  153   TVGIVTTPFTFEGRQRAQQARSALANLRAAVDTLIVIPNDRLLSAMDSNVPIKDAFKIAD  212

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             D+LRQGV+GIS+IIT+PGLVNVDFADVRAIM  AGSSLMG G  +G  RA DAAL AI S
Sbjct  213   DVLRQGVKGISEIITVPGLVNVDFADVRAIMAGAGSSLMGQGYGSGPRRASDAALRAISS  272

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQ-V  1539
             PLL++GIERATG+VWNITG  ++TL EVN AAE+IYD+VDP+ANLIFGAV+D ++    V
Sbjct  273   PLLEVGIERATGVVWNITGPPNMTLHEVNEAAEIIYDMVDPNANLIFGAVVDSTLPDDTV  332

Query  1540  SITLIATGFKRQE  1578
             SIT+IATGF   E
Sbjct  333   SITIIATGFGHVE  345



>ref|WP_035996963.1| cell division protein FtsZ [Leptolyngbya sp. JSC-1]
Length=437

 Score =   345 bits (886),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 202/311 (65%), Positives = 249/311 (80%), Gaps = 2/311 (1%)
 Frame = +1

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
              NAVNRMI S + GVEFW VNTD QA+ ++     +RLQ+GQ+LTRGLGAGGNP IG  A
Sbjct  78    CNAVNRMIMSGVAGVEFWSVNTDAQALTLASA--HNRLQVGQKLTRGLGAGGNPAIGQKA  135

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A+ES++ I  A+  AD+VF+TAGMGGGTGTGAAPV+A  AK +G LTVG+VT PF+FEG+
Sbjct  136   AEESRDEIGAALENADLVFITAGMGGGTGTGAAPVVAEVAKEVGALTVGVVTRPFTFEGK  195

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RR  QA EGIAAL+  VDTLI+IPNDKLL+ +S  TPV EAF +ADDILRQGV+GISDII
Sbjct  196   RRTSQADEGIAALQSRVDTLIIIPNDKLLSVISEQTPVQEAFRVADDILRQGVQGISDII  255

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
             TIPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RAR+AA  AI SPLL+  I+ A G+V
Sbjct  256   TIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRAREAATAAISSPLLESSIDGAKGVV  315

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGD  1584
             +NITGG+DLTL EVN+AAE+IY+ VDP+AN+IFGAV+D  + G+V IT+IATGF  +   
Sbjct  316   FNITGGSDLTLHEVNSAAEIIYEAVDPNANIIFGAVLDDRLQGEVRITVIATGFSTEVQA  375

Query  1585  DKPLQANQLAP  1617
                 QA +++P
Sbjct  376   PPVQQATRVSP  386



>ref|WP_006457598.1| cell division protein FtsZ [Synechococcus sp. PCC 7335]
 gb|EDX87769.1| cell division protein FtsZ [Synechococcus sp. PCC 7335]
Length=412

 Score =   344 bits (883),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 214/370 (58%), Positives = 278/370 (75%), Gaps = 17/370 (5%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A+IKV+GVGGGG NAVNRMI++ + G+EFW VNTD QA+  S     + +Q+GQ+LTRGL
Sbjct  46    ARIKVIGVGGGGCNAVNRMIDTGLVGIEFWTVNTDAQALTYSST--TNAMQLGQKLTRGL  103

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES++ I +A+ G+D+VF+TAGMGGGTGTGAAPV+A  AK  G LTV
Sbjct  104   GAGGNPSIGQKAAEESRDEIFQALEGSDLVFITAGMGGGTGTGAAPVVAECAKEAGALTV  163

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G++T PF+FEGRRR  QA  GIAAL+  VDTLI+IPNDKLL+ +S  TPV EAF +ADDI
Sbjct  164   GVITRPFTFEGRRRTSQADSGIAALQACVDTLIIIPNDKLLSVISEQTPVQEAFRVADDI  223

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITI GLVNVDFADVRA+M  AGS+LMGIG  +GK+RAR+AA+ A  SPL
Sbjct  224   LRQGVQGISDIITISGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAREAAIAATSSPL  283

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  I  A G+V+NITGG DLTL EVN AAE+IY+ VDP+AN+IFGAVID  + G+V IT
Sbjct  284   LETSINGAGGVVFNITGGNDLTLHEVNQAAEIIYESVDPNANIIFGAVIDDRLQGEVRIT  343

Query  1549  LIATGFKRQEGDDKPLQANQLAPGDASIGINRRPASF--------------MDGSSVEIP  1686
             +IATGF  +      + ++++ P D + G++   +S               +   +++IP
Sbjct  344   VIATGFSMESRSIPSMASSKVTPMDRTSGLSLEESSLPLKEESTEEVKTPPVISPNLDIP  403

Query  1687  EFLKKKGRSR  1716
             +FL+++ R+R
Sbjct  404   DFLQRR-RNR  412



>ref|WP_008226369.1| Cell division protein FtsZ [Richelia intracellularis]
 emb|CCH64899.1| Cell division protein FtsZ [Richelia intracellularis HM01]
Length=426

 Score =   345 bits (885),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 215/366 (59%), Positives = 272/366 (74%), Gaps = 14/366 (4%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRM--SPVFPQHRLQIGQELTR  822
             A IKV+GVGGGG NAVNRMI S ++ VEFW +NTD QA+ +  SP     RLQIGQ+LTR
Sbjct  64    ANIKVIGVGGGGGNAVNRMIASDVESVEFWTINTDAQALTLASSP----SRLQIGQKLTR  119

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP IG  AA+ES++ I  A+ GAD+VF+TAGMGGGTGTGAAP++A  AK MG L
Sbjct  120   GLGAGGNPAIGQKAAEESRDEIITALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMGAL  179

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVG+VT PF FEGRRR  QA++GI  L++ VDTLI+IPN+KLL  +   TPV EAF  AD
Sbjct  180   TVGVVTRPFIFEGRRRTTQAEQGIGGLKDCVDTLIIIPNNKLLEVIPEQTPVQEAFRYAD  239

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             D+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+LMGIG ++GK+RA++AA+ AI S
Sbjct  240   DVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGISSGKSRAKEAAVAAISS  299

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             PLL+  IE A G+V+NITGG+DLTL EVN+AAE +Y++VDP+AN+IFGAVID  + G+V 
Sbjct  300   PLLECSIEGARGVVFNITGGSDLTLHEVNSAAEAVYEVVDPNANIIFGAVIDDRLQGEVR  359

Query  1543  ITLIATGFKRQEGDDKPLQANQLAPGDASIGINRRPASFMDGSS--------VEIPEFLK  1698
             IT+IATGF  +    +       A    S G   +    +   +        ++IP+FL+
Sbjct  360   ITVIATGFTTEAAAPQQNSNRNQASSAVSSGKQSQQKYQLQSQTRISYPKPGLDIPDFLQ  419

Query  1699  KKGRSR  1716
             ++  SR
Sbjct  420   RRRGSR  425



>ref|WP_011244037.1| cell division protein FtsZ [Synechococcus elongatus]
 ref|YP_172437.1| cell division protein FtsZ [Synechococcus elongatus PCC 6301]
 ref|YP_401395.1| cell division protein FtsZ [Synechococcus elongatus PCC 7942]
 gb|AAC26227.1| cell division protein FtsZ [Synechococcus elongatus PCC 7942]
 dbj|BAD79917.1| cell division protein FtsZ [Synechococcus elongatus PCC 6301]
 gb|ABB58408.1| cell division protein FtsZ [Synechococcus elongatus PCC 7942]
 gb|AJD57129.1| cell division protein FtsZ [Synechococcus sp. UTEX 2973]
Length=393

 Score =   343 bits (881),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 219/357 (61%), Positives = 273/357 (76%), Gaps = 3/357 (1%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A+IKV+GVGGGGSN VNRMI S + GVEFW +NTD QA+  S      R+Q+GQ+LTRGL
Sbjct  38    ARIKVIGVGGGGSNGVNRMISSDVSGVEFWALNTDAQALLHSAA--PKRMQLGQKLTRGL  95

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES+E +  A+ GAD+VF+TAGMGGGTGTGAAP++A  AK +G LTV
Sbjct  96    GAGGNPAIGMKAAEESREELIAALEGADLVFITAGMGGGTGTGAAPIVAEVAKEVGALTV  155

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             GIVT PF+FEGRRR  QA+EG AAL+ +VDTLI IPND+LL A+S  TP+ EAF +ADDI
Sbjct  156   GIVTKPFTFEGRRRMKQAEEGTAALQSSVDTLITIPNDRLLHAISEQTPIQEAFRVADDI  215

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+LMGIG+ +GK+RAR+AA  AI SPL
Sbjct  216   LRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGSGSGKSRAREAAHAAISSPL  275

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  IE A G+V+NITGG D+TL EVNAAA+ IY++VDP AN+IFGAVID  + G++ IT
Sbjct  276   LESSIEGARGVVFNITGGRDMTLHEVNAAADAIYEVVDPEANIIFGAVIDDRLEGELRIT  335

Query  1549  LIATGFKRQEGDDKPLQANQLAP-GDASIGINRRPASFMDGSSVEIPEFLKKKGRSR  1716
             +IATGF     +   +  +   P    S+  N   A    G  ++IP FL++K ++R
Sbjct  336   VIATGFSTDRPNLNTISTSTSQPTSQPSVSPNPASAPPASGGGLDIPAFLQRKIQNR  392



>ref|WP_002765213.1| cell division protein FtsZ [Microcystis aeruginosa]
 emb|CCI05063.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9443]
Length=415

 Score =   344 bits (883),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 225/388 (58%), Positives = 283/388 (73%), Gaps = 25/388 (6%)
 Frame = +1

Query  556   NSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEF  735
             + + MTPR+ES    +  S          N AKIKV+GVGGGG NAVNRMI S + G+EF
Sbjct  43    HESQMTPREESRSNRIVPS----------NVAKIKVIGVGGGGCNAVNRMIASGVTGIEF  92

Query  736   WIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADM  915
             W +NTD QA+  S   PQ RLQIG +LTRGLGAGGNP IG  AA+ES++ I +A+ G D+
Sbjct  93    WAINTDAQALAHSSA-PQ-RLQIGTKLTRGLGAGGNPAIGQKAAEESRDEIAQALEGTDL  150

Query  916   VFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENV  1095
             VF+TAGMGGGTGTGAAP++A  AK +G LTVG+VT PF+FEGRRR  QA EG+  L+  V
Sbjct  151   VFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQADEGVGGLQSRV  210

Query  1096  DTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  1275
             DTLI+IPN++LL  +   TP+ EAF +ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M
Sbjct  211   DTLIIIPNNQLLQVIPADTPLQEAFRVADDVLRQGVQGISDIITIPGLVNVDFADVRAVM  270

Query  1276  ESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAA  1455
               AGS+LMGIG  +GK+RA++ A+ AI SPLL+  IE A G+V+NITGG DLTL EVNAA
Sbjct  271   ADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQDLTLHEVNAA  330

Query  1456  AEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF-----KRQEGDDKPLQANQLAPG  1620
             AE+IY++VDP+AN+IFGAVID  + G+V IT+IATGF      R  G+   +  N  AP 
Sbjct  331   AEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFSGESPSRSTGNK--VVINTPAPS  388

Query  1621  DASIGINRRPASFMDGSSVEIPEFLKKK  1704
              A+     +PA        +IPEFL+++
Sbjct  389   PAATPEPPKPAGL------DIPEFLQRR  410



>ref|WP_008232986.1| Cell division protein FtsZ [Richelia intracellularis]
 emb|CCH66956.1| Cell division protein FtsZ [Richelia intracellularis HH01]
Length=426

 Score =   344 bits (883),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 215/366 (59%), Positives = 276/366 (75%), Gaps = 14/366 (4%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRM--SPVFPQHRLQIGQELTR  822
             A IKV+GVGGGG NAVNRMI S ++ VEFW +NTD QA+ +  SP     RLQIGQ+LTR
Sbjct  64    ANIKVIGVGGGGGNAVNRMIASDVESVEFWTINTDAQALTLASSP----SRLQIGQKLTR  119

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP IG  AA+ES++ I  A+ GAD+VF+TAGMGGGTGTGAAP++A  AK MG L
Sbjct  120   GLGAGGNPAIGQKAAEESRDEIITALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMGAL  179

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVG+VT PF FEGRRR  QA++GI  L++ VDTLI+IPN+KLL  +   TPV EAF  AD
Sbjct  180   TVGVVTRPFIFEGRRRTTQAEQGIGGLKDCVDTLIIIPNNKLLEVIPEQTPVQEAFRYAD  239

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             D+LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+LMGIG ++GK+RA++AA+ AI S
Sbjct  240   DVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGISSGKSRAKEAAVAAISS  299

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             PLL+  IE A G+V+NITGG+DLTL EVN+AAE +Y++VDP+AN+IFGAVID  + G+V 
Sbjct  300   PLLECSIEGARGVVFNITGGSDLTLHEVNSAAEAVYEVVDPNANIIFGAVIDDRLQGEVR  359

Query  1543  ITLIATGFKR-----QEGDDKPLQANQLAPGDAS---IGINRRPASFMDGSSVEIPEFLK  1698
             IT+IATGF       Q+  ++   ++ ++ G  S     +  +         ++IP+FL+
Sbjct  360   ITVIATGFTTEVAAPQQNSNRNQASSAVSSGKQSQQKYQLQSQTRISYPKPGLDIPDFLQ  419

Query  1699  KKGRSR  1716
             ++  SR
Sbjct  420   RRRGSR  425



>ref|WP_038027290.1| cell division protein FtsZ [Synechococcus sp. PCC 7336]
Length=369

 Score =   342 bits (878),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 215/359 (60%), Positives = 268/359 (75%), Gaps = 13/359 (4%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             AKIKVVGVGGGG NAVNRM+ SS+ GVEFW +NTD QA+  S      RLQIGQ+LTRGL
Sbjct  14    AKIKVVGVGGGGGNAVNRMVASSLNGVEFWTINTDAQALVQSQSM--QRLQIGQKLTRGL  71

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP +G  AA+ES + I+ A+ GAD+VF+ AGMGGGTGTGAAP++A  AK  G LTV
Sbjct  72    GAGGNPAVGQKAAEESHDEIQAALEGADLVFIAAGMGGGTGTGAAPIVAQIAKETGALTV  131

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G+VT PF+FEGRRR  Q+ EGI AL+  VDTLIVIPNDKLL+ +S  TPV EAF +ADD+
Sbjct  132   GVVTRPFTFEGRRRTKQSNEGIVALQTCVDTLIVIPNDKLLSVISEQTPVQEAFRVADDV  191

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFADVR++M  AGS+LMGIG  +GK+RAR+AA+ AI SPL
Sbjct  192   LRQGVQGISDIITIPGLVNVDFADVRSVMADAGSALMGIGMGSGKSRAREAAMTAISSPL  251

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  I+ A G++ N+TGG DLTL EV AA+E+I + VD  AN+IFGAVID  + G++ IT
Sbjct  252   LESSIDGAKGVLLNVTGGEDLTLHEVTAASEIIAEAVDEEANIIFGAVIDEKMQGEIRIT  311

Query  1549  LIATGFKRQEGDD-----KPLQANQLAP--GDASIGINRRPASFMDGSSVEIPEFLKKK  1704
             +IATGF     +      +   A Q  P  G A+    R   +  +  +++IPEFL+K+
Sbjct  312   VIATGFHGLPANQFIAAVESRVAEQAVPPAGPAA----REAEAPSEDRTLDIPEFLRKR  366



>ref|WP_015164337.1| cell division protein FtsZ [Pseudanabaena sp. PCC 7367]
 ref|YP_007101792.1| cell division protein FtsZ [Pseudanabaena sp. PCC 7367]
 gb|AFY69364.1| cell division protein FtsZ [Pseudanabaena sp. PCC 7367]
Length=428

 Score =   344 bits (883),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 218/368 (59%), Positives = 274/368 (74%), Gaps = 20/368 (5%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             AKIKV+GVGG G NAVNRMI S + GVEFW VNTD QA+  S      R Q+GQ+LTRGL
Sbjct  69    AKIKVIGVGGAGGNAVNRMIASEVSGVEFWSVNTDAQALIQSSA--SQRFQLGQKLTRGL  126

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES++ I  A+ GAD+VF+TAGMGGGTGTGAAP+IA  AK  G LT+
Sbjct  127   GAGGNPAIGQKAAEESRDDIAAAIEGADLVFITAGMGGGTGTGAAPIIAEVAKETGALTI  186

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G+VT PF+FEGRRR  Q+++G+ +L+  VDTLI+IPNDKLL+ +S  TPV EAF +ADD+
Sbjct  187   GVVTRPFTFEGRRRTQQSEDGVESLQSRVDTLIIIPNDKLLSVISEQTPVQEAFRVADDV  246

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFAD+RA+M  AGS+LMGIGT +GK+RAR+AA+ AI SPL
Sbjct  247   LRQGVQGISDIITIPGLVNVDFADIRAVMADAGSALMGIGTGSGKSRAREAAMTAISSPL  306

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  IE A G+V+NITGG+DLTL EVNAAAE IY++VDP+AN+IFGAVID S+ G++ IT
Sbjct  307   LEASIEGANGVVFNITGGSDLTLHEVNAAAETIYEVVDPNANIIFGAVIDDSMEGEIRIT  366

Query  1549  LIATGF------------KRQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEF  1692
             +IATGF            K+Q     P+  N  AP   +          +    ++IP+F
Sbjct  367   VIATGFSQKPNVAPTPKIKKQVPVKSPIVPNTPAPSPTAAD------PRISKPGLDIPDF  420

Query  1693  LKKKGRSR  1716
             L+++   R
Sbjct  421   LQRRRPKR  428



>ref|WP_015785230.1| MULTISPECIES: cell division protein FtsZ [Cyanothece]
 ref|YP_002374333.1| cell division protein FtsZ [Cyanothece sp. PCC 8801]
 ref|YP_003139935.1| cell division protein FtsZ [Cyanothece sp. PCC 8802]
 gb|ACK68177.1| cell division protein FtsZ [Cyanothece sp. PCC 8801]
 gb|ACV03100.1| cell division protein FtsZ [Cyanothece sp. PCC 8802]
Length=425

 Score =   344 bits (882),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 206/354 (58%), Positives = 261/354 (74%), Gaps = 16/354 (5%)
 Frame = +1

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
              NAVNRMIESS+ G+EFW +NTD QA+  S      RLQIGQ+LTRGLGAGGNP IGT A
Sbjct  77    CNAVNRMIESSLTGIEFWAINTDAQALSQSAA--SQRLQIGQKLTRGLGAGGNPSIGTQA  134

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A+ES++ I +A+   D+VF+TAGMGGGTGTGAAP++A  AK MG LTVG+VT PF+FEGR
Sbjct  135   AEESRDEIAQALENTDLVFITAGMGGGTGTGAAPIVAEVAKEMGCLTVGVVTRPFTFEGR  194

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RR  QA +G+  L+ NVDTLIVIPN++LL  + P TP+ +AF  AD+ILRQGV+GISDII
Sbjct  195   RRTSQASQGVEKLQNNVDTLIVIPNNQLLQVIPPDTPLQQAFLAADNILRQGVQGISDII  254

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
             TIPGLVNVDFADVRA+M  AGS+LMG+G  +GK+RA DAA+ AI SPLL+  I+ A G+V
Sbjct  255   TIPGLVNVDFADVRAVMADAGSALMGLGIGSGKSRASDAAVAAISSPLLEHSIKGARGVV  314

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGD  1584
             +NITGG DLTL EVN AAE I+++VDP AN+IFGAVIDP++ G+V IT+IATGF    G+
Sbjct  315   FNITGGDDLTLHEVNTAAETIFEVVDPDANIIFGAVIDPTLQGEVIITVIATGFT---GE  371

Query  1585  DKPLQANQLAP--------GDASIGINRRPASFMDGSSVEIPEFLKKKGRSRYP  1722
              +     ++AP              I          + ++IP+FL+K+   R+P
Sbjct  372   SEGSGTTKVAPIATPTPRKAPERTVIPEPEPEPPKSTGLDIPDFLQKR---RFP  422



>ref|WP_015229558.1| cell division protein FtsZ [Dactylococcopsis salina]
 ref|YP_007171918.1| cell division protein FtsZ [Dactylococcopsis salina PCC 8305]
 gb|AFZ50561.1| cell division protein FtsZ [Dactylococcopsis salina PCC 8305]
Length=363

 Score =   341 bits (875),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 210/356 (59%), Positives = 262/356 (74%), Gaps = 22/356 (6%)
 Frame = +1

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
              NAVNRMI S + GVEFW VNTD QA+  S V   + LQ+G++LTRGLGAGGNP IG  A
Sbjct  18    CNAVNRMIASDVTGVEFWAVNTDAQAL--SRVTAPNSLQVGEKLTRGLGAGGNPSIGQKA  75

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A+ES++ I  A+   D+VF+TAGMGGGTGTGAAP++A  AK MG LTVG+VT PF+FEGR
Sbjct  76    AEESRDEISNALEETDLVFITAGMGGGTGTGAAPIVAEVAKEMGCLTVGVVTRPFTFEGR  135

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RR  Q +EGIAAL+  VDTLI+IPNDKLL+ +   TPV +AF +ADDILRQGV+GISDII
Sbjct  136   RRTSQGEEGIAALQTRVDTLIIIPNDKLLSVIDERTPVQDAFRVADDILRQGVQGISDII  195

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
             TIPGLVNVDFADVRA+M  AGS+LMGIGTA+GK+RA +AA  AI SPLL+  I+ A G+V
Sbjct  196   TIPGLVNVDFADVRAVMADAGSALMGIGTASGKSRAAEAATGAISSPLLESSIQGAKGVV  255

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP-SISGQVSITLIATGFKRQEG  1581
             +NITGG+DLTL EVN AAE IY+ VDP+AN+IFGAVID   + G++ IT+IATGF  +E 
Sbjct  256   FNITGGSDLTLHEVNTAAETIYEGVDPNANIIFGAVIDDGKMEGEIRITVIATGFSGEE-  314

Query  1582  DDKPLQANQLAPGDASIGINRRPASFM-----------DGSSVEIPEFLKKKGRSR  1716
               KP +       +A     ++P               D   ++IPEFL+++ R+R
Sbjct  315   TSKPTKK------EAKTTATKKPTPLSQKERKENTDQGDKKELDIPEFLQRR-RNR  363



>ref|WP_002801422.1| cell division protein FtsZ [Microcystis aeruginosa]
 emb|CCI39019.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9701]
Length=415

 Score =   343 bits (879),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 224/387 (58%), Positives = 281/387 (73%), Gaps = 23/387 (6%)
 Frame = +1

Query  556   NSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEF  735
             + + MTPR+ES    +  S          N AKIKV+GVGGGG NAVNRMI S + G+EF
Sbjct  43    HESQMTPREESRSNRIVPS----------NVAKIKVIGVGGGGCNAVNRMIASGVTGIEF  92

Query  736   WIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADM  915
             W +NTD QA+  S   PQ RLQIG +LTRGLGAGGNP IG  AA+ES++ I +A+ G D+
Sbjct  93    WAINTDAQALAHSSA-PQ-RLQIGTKLTRGLGAGGNPAIGQKAAEESRDEIAQALEGTDL  150

Query  916   VFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENV  1095
             VF+TAGMGGGTGTGAAP++A  AK +G LTVG+VT PF+FEGRRR  QA EG+  L+  V
Sbjct  151   VFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQADEGVGGLQSRV  210

Query  1096  DTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  1275
             DTLI+IPN++LL  +   TP+ EAF +ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M
Sbjct  211   DTLIIIPNNQLLQVIPAETPLQEAFRVADDVLRQGVQGISDIITIPGLVNVDFADVRAVM  270

Query  1276  ESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAA  1455
               AGS+LMGIG  +GK+RA++ A+ AI SPLL+  IE A G+V+NITGG DLTL EVNAA
Sbjct  271   ADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQDLTLHEVNAA  330

Query  1456  AEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKP----LQANQLAPGD  1623
             AE+IY++VDP+AN+IFGAVID  + G+V IT+IATGF   E   +P    +  N  AP  
Sbjct  331   AEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS-GESPSRPTTNKVVINTPAPSP  389

Query  1624  ASIGINRRPASFMDGSSVEIPEFLKKK  1704
                    +PA        +IPEFL+++
Sbjct  390   VPTPEAPKPAGL------DIPEFLQRR  410



>ref|WP_011433691.1| cell division protein FtsZ [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_478319.1| cell division protein FtsZ [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD03056.1| cell division protein FtsZ [Synechococcus sp. JA-2-3B'a(2-13)]
Length=371

 Score =   341 bits (875),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 206/311 (66%), Positives = 249/311 (80%), Gaps = 2/311 (1%)
 Frame = +1

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             N AKIKVVGVGGGG NAV+RM  S++ GVEFW VNTD QA+  S     +RLQIGQ+LTR
Sbjct  4     NAAKIKVVGVGGGGGNAVSRMAASNLVGVEFWSVNTDAQALAQSSTV--NRLQIGQKLTR  61

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP IG  AA+ES E I  A+ GAD+VF+ AGMGGGTGTG APVIA  AK+ G L
Sbjct  62    GLGAGGNPAIGQKAAEESSEEISAAIKGADLVFIAAGMGGGTGTGGAPVIAQIAKASGAL  121

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVG+VT PFSFEG+RR+ QA+EGI ALRE VDTLIVIPNDKLL+ +S  TPV EAF +AD
Sbjct  122   TVGVVTRPFSFEGKRRSKQAEEGIQALREAVDTLIVIPNDKLLSVISEQTPVQEAFRVAD  181

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             D+LRQGV+GISDII IPG++NVDFADVR++M  AGS+LMGIG  +GK+RAR+AA+ A+ S
Sbjct  182   DVLRQGVQGISDIILIPGMINVDFADVRSVMADAGSALMGIGMGSGKSRAREAAITAVSS  241

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             PLL+  IE A G+++NITGG DL+L EV  AAE+I + VDP AN+IFG V D  + G+V 
Sbjct  242   PLLETSIEGAKGVLFNITGGPDLSLHEVTVAAEIIAEAVDPEANIIFGTVQDERMQGEVR  301

Query  1543  ITLIATGFKRQ  1575
             IT+IATGF+ +
Sbjct  302   ITVIATGFQEK  312



>ref|WP_011140302.1| cell division protein FtsZ [Gloeobacter violaceus]
 ref|NP_923244.1| cell division protein FtsZ [Gloeobacter violaceus PCC 7421]
 dbj|BAC88239.1| cell division protein [Gloeobacter violaceus PCC 7421]
Length=419

 Score =   343 bits (879),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 224/365 (61%), Positives = 276/365 (76%), Gaps = 18/365 (5%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A IKVVGVGGGG NAVNRMI S++ GVEFW +NTD Q++  S   PQ RLQIGQ+LTRGL
Sbjct  56    ALIKVVGVGGGGGNAVNRMIASNVVGVEFWAINTDAQSLTQSSA-PQ-RLQIGQKLTRGL  113

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES+E I  A+ GAD+VF+TAGMGGGTGTGAA ++A  AK +G LTV
Sbjct  114   GAGGNPSIGQKAAEESREEIMTALEGADLVFITAGMGGGTGTGAAAIVAEAAKEVGALTV  173

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
              +VT PF+FEGRRR  QA  GI AL+  VDTLIVIPNDKLL+ +S  TPV EAF +ADDI
Sbjct  174   AVVTRPFTFEGRRRMQQADSGIEALQGRVDTLIVIPNDKLLSVISEQTPVQEAFRIADDI  233

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGL+NVDFADVRAIM  AGS+LMGIG  +GK+RAR+AA+ AI SPL
Sbjct  234   LRQGVQGISDIITIPGLINVDFADVRAIMADAGSALMGIGMGSGKSRAREAAMTAISSPL  293

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  IE A G+V N+TGG DLTL EVN AA VIY++VDP+AN+IFGAVID  + G++ IT
Sbjct  294   LESSIEGANGVVLNVTGGHDLTLHEVNEAAAVIYEVVDPNANIIFGAVIDEKLQGELRIT  353

Query  1549  LIATGFKRQEGDDKPLQANQLAPGDASI-GINRR--------PASFMDGSS----VEIPE  1689
             +IATGF    G    ++A +    ++S  G+  +        PAS   G++    ++IPE
Sbjct  354   VIATGFN---GIAPAVKAGKARLSESSAEGLTGKAPSNNGPNPASPNRGTAGEDVLDIPE  410

Query  1690  FLKKK  1704
             FL+++
Sbjct  411   FLRRR  415



>ref|WP_009544135.1| MULTISPECIES: cell division protein FtsZ [Cyanothece]
 ref|YP_001802730.1| cell division protein [Cyanothece sp. ATCC 51142]
 gb|ACB50664.1| cell division protein [Cyanothece sp. ATCC 51142]
Length=419

 Score =   342 bits (878),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 223/393 (57%), Positives = 285/393 (73%), Gaps = 10/393 (3%)
 Frame = +1

Query  556   NSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEF  735
             NST    +     EN  E S+ +  V N N A+IKV+GVGGGG NAV+RMIES++ GVEF
Sbjct  33    NSTAPFSQMNEPPENPGEDSRRNVIVPN-NVARIKVIGVGGGGCNAVDRMIESALMGVEF  91

Query  736   WIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADM  915
             W +NTD QA+  S     HRLQIG++LT+GLGAGGNP+IG  AA ES++ I EA+   D+
Sbjct  92    WTMNTDAQALTQSSA--PHRLQIGRKLTKGLGAGGNPNIGKEAAVESRDEIAEALEDTDL  149

Query  916   VFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENV  1095
             VF+TAGMGGGTGTGAA ++A  AK  G LTVG+VT PF+FEGRRR VQA +GI+ L+ NV
Sbjct  150   VFITAGMGGGTGTGAAAIVAEIAKEKGCLTVGVVTRPFTFEGRRRMVQASQGISDLQNNV  209

Query  1096  DTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  1275
             DTLIVIPN++LL  +SP TP+ EAF  AD++LRQGV+GISDIITIPGLVNVDFADVRA+M
Sbjct  210   DTLIVIPNNQLLQVISPETPLKEAFLAADNVLRQGVQGISDIITIPGLVNVDFADVRAVM  269

Query  1276  ESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAA  1455
               AGS+LMGIG  +GK+RA DAA  AI SPLL+  I+ A G+V+NITGG+DL+L EVN A
Sbjct  270   ADAGSALMGIGVGSGKSRANDAASLAISSPLLEHSIQGAKGVVFNITGGSDLSLHEVNTA  329

Query  1456  AEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIG  1635
             AE I+++VDP AN+IFGAVID  + G+V +T+IATGF   E ++ P   +   P      
Sbjct  330   AETIFEVVDPDANIIFGAVIDERVQGEVIVTVIATGFS-AEAENIPNNQSTSTPNRNLST  388

Query  1636  IN---RRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
              N   +  +     + ++IP FL+ +   R+PR
Sbjct  389   PNPPKKEQSPPPKPTGLDIPPFLQDR---RFPR  418



>ref|WP_008274607.1| cell division protein FtsZ [Cyanothece sp. CCY0110]
 gb|EAZ92371.1| cell division protein FtsZ [Cyanothece sp. CCY0110]
Length=419

 Score =   342 bits (878),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 225/393 (57%), Positives = 284/393 (72%), Gaps = 10/393 (3%)
 Frame = +1

Query  556   NSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEF  735
             NST    +     EN  E S+ +  V N N A+IKV+GVGGGG NAV+RMIES++ GVEF
Sbjct  33    NSTAPFSQMNEPPENPGEDSRRNVIVPN-NIARIKVIGVGGGGCNAVDRMIESALMGVEF  91

Query  736   WIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADM  915
             W +NTD QA+  S     HRLQIG++LT+GLGAGGNP+IG  AA ES++ I EA+   D+
Sbjct  92    WTMNTDAQALTQSSA--PHRLQIGRKLTKGLGAGGNPNIGKEAAVESRDEIAEALEDTDL  149

Query  916   VFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENV  1095
             VF+TAGMGGGTGTGAA ++A  AK  G LTVG+VT PF+FEGRRR VQA +GI+ L+ NV
Sbjct  150   VFITAGMGGGTGTGAAAIVAEIAKEKGCLTVGVVTRPFTFEGRRRMVQAGQGISDLQNNV  209

Query  1096  DTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  1275
             DTLIVIPN++LL  +SP TP+ EAF  AD++LRQGV+GISDIITIPGLVNVDFADVRA+M
Sbjct  210   DTLIVIPNNQLLQVISPETPLKEAFLAADNVLRQGVQGISDIITIPGLVNVDFADVRAVM  269

Query  1276  ESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAA  1455
               AGS+LMGIG  +GK+RA DAA  AI SPLL+  I+ A G+V+NITGG+DL+L EVN A
Sbjct  270   ADAGSALMGIGVGSGKSRANDAASLAISSPLLEHSIQGAKGVVFNITGGSDLSLHEVNTA  329

Query  1456  AEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIG  1635
             AE IY++VDP AN+IFGAVID  + G+V +T+IATGF   E ++ P       P      
Sbjct  330   AETIYEVVDPDANIIFGAVIDERVQGEVIVTVIATGFS-AEAENTPNNQTTSTPTRNVST  388

Query  1636  IN---RRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
              N   +  A     + ++IP FL+ +   R+PR
Sbjct  389   PNPPKKEEAPPPKPTGLDIPPFLQDR---RFPR  418



>ref|WP_024125914.1| cell division tubulin protein FtsZ [Thermosynechococcus sp. NK55a]
 ref|YP_008901059.1| cell division tubulin protein FtsZ [Thermosynechococcus sp. NK55a]
 gb|AHB89546.1| cell division tubulin protein FtsZ [Thermosynechococcus sp. NK55a]
Length=411

 Score =   342 bits (877),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 214/365 (59%), Positives = 271/365 (74%), Gaps = 23/365 (6%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHR-LQIGQELTRG  825
             A+IKV+GVGGGG NAVNRMI S++ GVEFW VNTD QA+  S     HR LQIGQ+LTRG
Sbjct  53    ARIKVIGVGGGGGNAVNRMIASNVAGVEFWCVNTDAQALAQSQA---HRCLQIGQKLTRG  109

Query  826   LGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILT  1005
             LGAGGNP IG  AA+ES+E +  A+  AD++F+T GMGGGTGTGAAP++A  AK  G LT
Sbjct  110   LGAGGNPAIGQKAAEESREDLAAALKDADLIFITCGMGGGTGTGAAPIVAEVAKEQGALT  169

Query  1006  VGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADD  1185
             V +VT PF+FEGRRRA QA EGI AL+  VDTLIVIPNDK+L+ +S  T V +AF +ADD
Sbjct  170   VAVVTRPFTFEGRRRASQADEGIEALQSRVDTLIVIPNDKILSVISEQTSVQDAFRVADD  229

Query  1186  ILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSP  1365
             +LRQGV+GISDII +PGL+NVDFAD+R++M  AGS++MGIG A+GK+RA +AAL+AI SP
Sbjct  230   VLRQGVQGISDIINLPGLINVDFADIRSVMADAGSAMMGIGIASGKSRATEAALSAISSP  289

Query  1366  LLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSI  1545
             LL+  IE A G+V+NITGGTDLTL EVNAAAEVIY++ D +AN+IFGAVIDP + G+V I
Sbjct  290   LLEGSIEGAKGVVFNITGGTDLTLHEVNAAAEVIYNVADANANIIFGAVIDPQMQGEVQI  349

Query  1546  TLIATGFKRQ------------EGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPE  1689
             T+IATGF  +               ++PL      P   +  +  +P        ++IPE
Sbjct  350   TVIATGFSGEPMSRSRTTTKTTPLTNRPLTTAPPTPEAPAPEVEAKP-------RLDIPE  402

Query  1690  FLKKK  1704
             FL+++
Sbjct  403   FLQRR  407



>ref|WP_027841036.1| cell division protein FtsZ [Mastigocoleus testarum]
Length=426

 Score =   342 bits (877),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 219/372 (59%), Positives = 270/372 (73%), Gaps = 22/372 (6%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A IKV+GVGGGG NAVNRMI S + GVEFW +NTD QA+ M+      RLQIGQ+LTRGL
Sbjct  63    ANIKVIGVGGGGGNAVNRMIASDVSGVEFWTINTDAQALTMASA--PSRLQIGQKLTRGL  120

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP IG  AA+ES++ I  A+ GAD+VF+TAGMGGGTGTGAAP++A  AK MG LTV
Sbjct  121   GAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMGALTV  180

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G+VT PF FEGRRR+ QA++GI  L+  VDTLI+IPN+KLL  +   T + EAF  ADD+
Sbjct  181   GVVTRPFIFEGRRRSTQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQTSMQEAFRYADDV  240

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+LMGIG  +GK+R+R+AA+ AI SPL
Sbjct  241   LRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRSREAAIAAISSPL  300

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  IE A G+V NITGG+DLTL EVNAAAE IY++VDP+AN+IFGAVID  + G+V IT
Sbjct  301   LESSIEGARGVVLNITGGSDLTLHEVNAAAEAIYEVVDPNANIIFGAVIDDRLQGEVRIT  360

Query  1549  LIATGFKRQEGDDKPLQANQL-------------APGDASIGINRRPASFMDGSSVEIPE  1689
             +IATGF    GD  P Q   +             +P    +          + S ++IP+
Sbjct  361   VIATGFT---GDLPPQQPQNVTNVRMAPQPQKRQSPSTQPLNSPNPTPEPKEKSVLDIPD  417

Query  1690  FLKKKGRSRYPR  1725
             FL++    R PR
Sbjct  418   FLRR----RSPR  425



>ref|WP_011429031.1| cell division protein FtsZ [Synechococcus sp. JA-3-3Ab]
 ref|YP_473602.1| cell division protein FtsZ [Synechococcus sp. JA-3-3Ab]
 gb|ABC98339.1| cell division protein FtsZ [Synechococcus sp. JA-3-3Ab]
Length=373

 Score =   340 bits (872),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 201/308 (65%), Positives = 246/308 (80%), Gaps = 0/308 (0%)
 Frame = +1

Query  643   NEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTR  822
             N AKIKVVGVGGGG NAV+RM  S++KGVEFW +NTD QA+        +RLQIGQ+LTR
Sbjct  4     NAAKIKVVGVGGGGGNAVSRMAASNLKGVEFWSINTDAQALAQCSTSTVNRLQIGQKLTR  63

Query  823   GLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGIL  1002
             GLGAGGNP IG  AA+ES E I  A+ GAD+VF+ AGMGGGTGTG AP++A  AK+ G L
Sbjct  64    GLGAGGNPAIGQKAAEESSEEIAAALKGADLVFIAAGMGGGTGTGGAPIVAQIAKASGAL  123

Query  1003  TVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLAD  1182
             TVG+VT PFSFEG+RR  QA+EGI AL+E VDTLIVIPNDKLL+ +S  TPV EAF +AD
Sbjct  124   TVGVVTRPFSFEGKRRTKQAEEGIQALQEAVDTLIVIPNDKLLSVISEQTPVHEAFRVAD  183

Query  1183  DILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQS  1362
             D+LRQGV+GISDII IPG++NVDFADVR++M  AG++LMGIG  +GK+RAR+AA+ A+ S
Sbjct  184   DVLRQGVQGISDIILIPGMINVDFADVRSVMADAGTALMGIGMGSGKSRAREAAITAVSS  243

Query  1363  PLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVS  1542
             PLL+  IE A G+++NITGG DL+L EV  AAE+I + VDP AN+IFG V D  + G+V 
Sbjct  244   PLLETSIEGAKGVLFNITGGLDLSLHEVTVAAEIIAEAVDPEANIIFGTVQDERMQGEVR  303

Query  1543  ITLIATGF  1566
             IT+IATGF
Sbjct  304   ITVIATGF  311



>ref|WP_015125672.1| cell division protein FtsZ [Synechococcus sp. PCC 6312]
 ref|YP_007062673.1| cell division protein FtsZ [Synechococcus sp. PCC 6312]
 gb|AFY62130.1| cell division protein FtsZ [Synechococcus sp. PCC 6312]
Length=363

 Score =   340 bits (871),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 200/347 (58%), Positives = 257/347 (74%), Gaps = 13/347 (4%)
 Frame = +1

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMI S + GVEFW VNTD QA+  S       LQ+G +LTRGLGAGGNP IG  AA
Sbjct  18    NAVNRMISSQVAGVEFWSVNTDAQALSQS--LAHQCLQLGNKLTRGLGAGGNPSIGQKAA  75

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
             +ES+E +  A+  AD++F+T GMGGGTGTGAAPV+A  AK  G LTV +VT PF+FEGRR
Sbjct  76    EESREDLANALKDADLIFITCGMGGGTGTGAAPVVAEVAKEQGALTVAVVTRPFTFEGRR  135

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             R  QA+EGI AL+  VDTLIVIPNDK+L+ +S  T V EAF +ADD+LRQGV+GISDII 
Sbjct  136   RGQQAEEGIEALQSRVDTLIVIPNDKILSVISEQTTVQEAFQVADDVLRQGVQGISDIIN  195

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  1407
             +PGL+NVDFADVRA+M  AGS++MGIG A+GK+RAR+AA+ AI SPLL+  IE A GIV 
Sbjct  196   LPGLINVDFADVRAVMADAGSAMMGIGVASGKSRAREAAITAISSPLLESSIEGARGIVL  255

Query  1408  NITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFK------  1569
             N+ GG DLTL EVNAAAEVIY++VD  AN+IFGAV+D S+ G++ +T+IATGF       
Sbjct  256   NVRGGVDLTLHEVNAAAEVIYEVVDVDANIIFGAVVDDSLQGEIKVTVIATGFSGGIEPK  315

Query  1570  --RQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKK  1704
                ++ + +P+ A    P   +I ++   A+  +   ++IP+FL+K+
Sbjct  316   TINKQKNIRPISATVTNPSPPNISLS---ATDTNKPKLDIPDFLQKR  359



>ref|WP_007355195.1| MULTISPECIES: cell division protein FtsZ [Kamptonema]
 emb|CBN55980.1| cell division protein FtsZ [ [[Oscillatoria] sp. PCC 6506]
Length=420

 Score =   342 bits (876),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 229/391 (59%), Positives = 284/391 (73%), Gaps = 28/391 (7%)
 Frame = +1

Query  574   PRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTD  753
             PR+ES   ++  SS           A+IKV+GVGGGG+NAVNRMI S + GVEFW VNTD
Sbjct  51    PREESRSGDIVPSSA----------ARIKVIGVGGGGNNAVNRMIASEVAGVEFWTVNTD  100

Query  754   IQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtag  933
              QA+ +S      RLQ+GQ+LTRGLGAGGNP IG  AA+ES++ I  A+  +D+VF+TAG
Sbjct  101   AQALSLSNA--PKRLQVGQKLTRGLGAGGNPAIGQKAAEESRDEIVNALSNSDLVFITAG  158

Query  934   mgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVI  1113
             MGGGTGTGAAP++A  AK MG LTVG+VT PF+FEGRRR  QA EGIAAL+  VDTLIVI
Sbjct  159   MGGGTGTGAAPIVAEVAKEMGALTVGVVTRPFTFEGRRRTSQADEGIAALQSRVDTLIVI  218

Query  1114  PNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSS  1293
             PNDKLL+ +S   PV EAF +ADDILRQGV+GISDIIT+PGLVNVDFADVRA+M  AGS+
Sbjct  219   PNDKLLSVISEQMPVQEAFRVADDILRQGVQGISDIITVPGLVNVDFADVRAVMADAGSA  278

Query  1294  LMGIGTATGKTRARDAALNAIQSPLLDI-GIERATGIVWNITGGTDLTLFEVNAAAEVIY  1470
             LMGIG  +GK+RAR+AA+ AI SPLL+   IE A G+V+NITGGTD+TL EVNAAAE IY
Sbjct  279   LMGIGLGSGKSRAREAAMQAISSPLLEASSIEGARGVVFNITGGTDMTLHEVNAAAETIY  338

Query  1471  DLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQ------ANQLAPGDASI  1632
             ++VDP+AN+IFGAVID  + G++ IT+IATGF  +      ++      +N  +P     
Sbjct  339   EVVDPNANIIFGAVIDERLQGEIKITVIATGFSGEVLSVPTVKEIGVRRSNTSSPAATPT  398

Query  1633  GINRRPASFMDGSSVEIPEFLKKKGRSRYPR  1725
                + PA        +IPEFL+ +   R PR
Sbjct  399   PDPKVPAGL------DIPEFLRNR---RPPR  420



>ref|WP_019499271.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=424

 Score =   342 bits (876),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 257/343 (75%), Gaps = 6/343 (2%)
 Frame = +1

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMI S + GVEFW VNTD QA+  S      R Q+GQ+LTRGLGAGGNP IG  AA
Sbjct  80    NAVNRMIVSEVAGVEFWAVNTDAQALLQSAA--PKRFQMGQKLTRGLGAGGNPSIGQKAA  137

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
             +ES++ I +A+ GAD+VF+TAGMGGGTGTGAAPVIA  AK +G LTVG+VT PF+FEG++
Sbjct  138   EESRDEIAQALEGADLVFITAGMGGGTGTGAAPVIAEIAKGVGALTVGVVTKPFTFEGKK  197

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             R  QA +GI  L+ +VDTLIVIPNDKLL+ V  +TPV EAF +ADD+LRQGV+GISDIIT
Sbjct  198   RINQATDGIEQLQGHVDTLIVIPNDKLLSVVPENTPVQEAFRIADDVLRQGVQGISDIIT  257

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  1407
             IPGLVNVDFADVRAIM  AGS+LMGIG  +GK+RAR+AA+ AI SPLL+  IE A G+V+
Sbjct  258   IPGLVNVDFADVRAIMADAGSALMGIGLGSGKSRAREAAMTAISSPLLEASIEGANGVVF  317

Query  1408  NITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDD  1587
             NITGG DLTL EV AAAE IY++VDP+AN+IFGAVID  + G+V IT+IATGF  +    
Sbjct  318   NITGGNDLTLHEVTAAAETIYEVVDPNANIIFGAVIDDKMDGEVRITVIATGFSHKAVVP  377

Query  1588  KPLQANQLAPGDASI----GINRRPASFMDGSSVEIPEFLKKK  1704
              P    Q      S+     +++          ++IPEFL+++
Sbjct  378   APQIKKQQPVKVTSVTSQQSVSQAEPKQSSSGGLDIPEFLQRR  420



>ref|WP_015956956.1| cell division protein FtsZ [Cyanothece sp. PCC 7424]
 ref|YP_002380244.1| cell division protein FtsZ [Cyanothece sp. PCC 7424]
 gb|ACK73376.1| cell division protein FtsZ [Cyanothece sp. PCC 7424]
Length=418

 Score =   341 bits (875),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 254/315 (81%), Gaps = 2/315 (1%)
 Frame = +1

Query  622   SSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQ  801
             S+++   N A+IKV+GVGGGG NAVNRMI S + G+EFW +NTD QA+  S   PQ RLQ
Sbjct  55    SNTIVQSNVAQIKVIGVGGGGCNAVNRMIASGIIGIEFWSINTDAQALAHSAA-PQ-RLQ  112

Query  802   IGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagt  981
             IGQ++TRGLGAGGNP IG  AA+ES++ I  A+   D+VF+TAGMGGGTGTGAAP++A  
Sbjct  113   IGQKITRGLGAGGNPAIGQKAAEESRDEIAHALENTDLVFITAGMGGGTGTGAAPIVAEV  172

Query  982   aKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVT  1161
             AK MG LTVG+VT PF+FEGRRR  QA+EGI AL+  VDTLIVIPN++LL  +   TP+ 
Sbjct  173   AKEMGCLTVGVVTRPFTFEGRRRTNQAEEGINALQSRVDTLIVIPNNQLLAVIPQETPLQ  232

Query  1162  EAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDA  1341
             +AF  ADDILRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RA++ 
Sbjct  233   DAFRAADDILRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAKEG  292

Query  1342  ALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDP  1521
             A+ AI SPLL+  IE A G+V NITGGTDLTLFEVN AAE IY++VDP+AN+IFGAVID 
Sbjct  293   AIAAISSPLLEHSIEGAKGVVLNITGGTDLTLFEVNTAAETIYEVVDPNANIIFGAVIDE  352

Query  1522  SISGQVSITLIATGF  1566
              + G++ IT+IATGF
Sbjct  353   KMQGEILITVIATGF  367



>gb|AIE75824.1| Cell division protein FtsZ [Synechocystis sp. PCC 6714]
Length=430

 Score =   341 bits (875),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 205/356 (58%), Positives = 266/356 (75%), Gaps = 14/356 (4%)
 Frame = +1

Query  685   SNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNa  864
              NAVNRMI S + G++FW +NTD QA+  +      R+QIGQ+LTRGLGAGGNP IG  A
Sbjct  79    CNAVNRMIASGVTGIDFWAINTDSQALTNTTA--PDRIQIGQKLTRGLGAGGNPAIGQKA  136

Query  865   akeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGR  1044
             A+ES++ I  ++ G D+VF+TAGMGGGTGTGAAP++A  AK MG LTVGIVT PF+FEGR
Sbjct  137   AEESRDEIARSLEGTDLVFITAGMGGGTGTGAAPIVAEVAKEMGCLTVGIVTRPFTFEGR  196

Query  1045  RRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDII  1224
             RRA QA+EGI+AL+  VDTLIVIPN++LL+ +   TP+ EAF +ADDILRQGV+GISDII
Sbjct  197   RRAKQAEEGISALQSRVDTLIVIPNNQLLSVIPAETPLQEAFRVADDILRQGVQGISDII  256

Query  1225  TIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIV  1404
              IPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RA++AA  AI SPLL+  I+ A G+V
Sbjct  257   IIPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAKEAATAAISSPLLESSIQGAKGVV  316

Query  1405  WNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF--KRQE  1578
             +N+TGGTDLTL EVN AAE+IY++VDP AN+IFGAVID  + G++ IT+IATGF  ++++
Sbjct  317   FNVTGGTDLTLHEVNVAAEIIYEVVDPDANIIFGAVIDDRLQGEMRITVIATGFNGEKEK  376

Query  1579  GDDKPLQANQLAPGDASIGINRRPASFMD-------GSSVEIPEFLKKKGRSRYPR  1725
                K      L+   A + +    A+  D          ++IP+FL+K+   R+PR
Sbjct  377   PQAKATNRTVLSGPPAGVEMVESAAASEDPLGEIPMAPELDIPDFLQKR---RFPR  429



>ref|WP_011058214.1| cell division protein FtsZ [Thermosynechococcus elongatus]
 ref|NP_683172.1| cell division protein FtsZ [Thermosynechococcus elongatus BP-1]
 dbj|BAC09934.1| cell division protein [Thermosynechococcus elongatus BP-1]
Length=418

 Score =   340 bits (873),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 214/360 (59%), Positives = 267/360 (74%), Gaps = 13/360 (4%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHR-LQIGQELTRG  825
             A+IKV+GVGGGG NAVNRMI S++ GVEFW VNTD QA+  S     HR LQIGQ+LTRG
Sbjct  60    ARIKVIGVGGGGGNAVNRMIASNVAGVEFWCVNTDAQAIAQSQA---HRCLQIGQKLTRG  116

Query  826   LGAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILT  1005
             LGAGGNP IG  AA+ES+E +  A+  AD++F+T GMGGGTGTGAAP++A  AK  G LT
Sbjct  117   LGAGGNPAIGQKAAEESREDLAAALKDADLIFITCGMGGGTGTGAAPIVAEVAKEQGALT  176

Query  1006  VGIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADD  1185
             V +VT PF+FEGRRRA QA EGI AL+  VDTLIVIPNDK+L+ +S  T V +AF +ADD
Sbjct  177   VAVVTRPFTFEGRRRANQADEGIEALQSRVDTLIVIPNDKILSVISEQTSVQDAFRVADD  236

Query  1186  ILRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSP  1365
             +LRQGV+GISDII +PGL+NVDFAD+R++M  AGS++MGIG A+GK+RA +AAL+AI SP
Sbjct  237   VLRQGVQGISDIINVPGLINVDFADIRSVMADAGSAMMGIGIASGKSRATEAALSAISSP  296

Query  1366  LLDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSI  1545
             LL+  IE A G+V+NITGGTDL+L EVNAAA+VIY++ D +AN+IFGAVIDP + G+V I
Sbjct  297   LLERSIEGAKGVVFNITGGTDLSLHEVNAAADVIYNVADANANIIFGAVIDPQMQGEVQI  356

Query  1546  TLIATGFK-------RQEGDDKPLQANQLAPGDASIGINRRPASFMDGSSVEIPEFLKKK  1704
             T+IATGF        R      PL    LA    S               ++IPEFL+++
Sbjct  357   TVIATGFSGEPMSRTRATTKTTPLTNRPLAT--TSPPPEAPAPEVEAKPKLDIPEFLQRR  414



>gb|EHJ13165.1| cell division protein [Crocosphaera watsonii WH 0003]
 emb|CCQ67080.1| Cell division protein FtsZ [Crocosphaera watsonii WH 0402]
Length=362

 Score =   338 bits (867),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 215/363 (59%), Positives = 271/363 (75%), Gaps = 11/363 (3%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A+IKV+GVGGGG NAV+RMIES + GVEFW +NTD QA+  S     HRLQIG++LT+GL
Sbjct  6     ARIKVIGVGGGGCNAVDRMIESDLMGVEFWTMNTDAQALTQSSA--PHRLQIGRKLTKGL  63

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP+IG  AA ES++ I EA+   D+VF+TAGMGGGTGTGAA ++A  AK  G LTV
Sbjct  64    GAGGNPNIGKEAAVESRDEIAEALEDTDLVFITAGMGGGTGTGAAAIVAEIAKERGCLTV  123

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G+VT PF+FEGRRR VQA +GI+ L+ NVDTLI+IPN++LL  +SP TP+ EAF  AD++
Sbjct  124   GVVTRPFTFEGRRRMVQAGQGISDLQNNVDTLIIIPNNQLLQVISPETPLREAFLAADNV  183

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RA DAA +AI SPL
Sbjct  184   LRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRANDAASSAISSPL  243

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  I+ A G+V+NITGG DL+L EVN AAE I+D+VDP AN+IFGAVID  + G+V +T
Sbjct  244   LEHSIQGAKGVVFNITGGHDLSLHEVNTAAETIFDVVDPDANIIFGAVIDERVQGEVIVT  303

Query  1549  LIATGFKRQEGDDKPLQANQLAPGDASIGINRRPASFMDG----SSVEIPEFLKKKGRSR  1716
             +IATGF   E ++ P       P   SI     P    +     + ++IP FL+ +   R
Sbjct  304   VIATGFS-PEVENAPNNQTTSTP-TRSISTPNPPKKEEEAPPKPAGLDIPPFLQDR---R  358

Query  1717  YPR  1725
             +PR
Sbjct  359   FPR  361



>ref|WP_011613145.1| cell division protein FtsZ [Trichodesmium erythraeum]
 ref|YP_723288.1| cell division protein FtsZ [Trichodesmium erythraeum IMS101]
 gb|ABG52815.1| cell division protein FtsZ [Trichodesmium erythraeum IMS101]
Length=423

 Score =   340 bits (872),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 261/343 (76%), Gaps = 8/343 (2%)
 Frame = +1

Query  688   NAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaa  867
             NAVNRMI S + G+EFW VNTD QA+ +S      RLQ+GQ+LTRGLGAGGNP IG  AA
Sbjct  79    NAVNRMIASEVSGIEFWTVNTDAQALTLSRA--PKRLQLGQKLTRGLGAGGNPAIGQKAA  136

Query  868   keskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRR  1047
             +ES++ I  A+   D+VF+TAGMGGGTGTGAAPVIA  AK  G LTVG+VT PF+FEGRR
Sbjct  137   EESRDEIANALDHPDLVFITAGMGGGTGTGAAPVIAEIAKEAGSLTVGVVTRPFTFEGRR  196

Query  1048  RAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIIT  1227
             R  QA EGI AL+  VDTLIVIPN++LL+ ++  TPV EAF +ADDILRQG++GISDIIT
Sbjct  197   RITQADEGITALQTRVDTLIVIPNNRLLSVINDQTPVQEAFIIADDILRQGIQGISDIIT  256

Query  1228  IPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVW  1407
             +PGLVNVDFADVRA+M  AGS+LMGIG  +GK+RAR+AA  AI SPLL+  IE A G+V+
Sbjct  257   VPGLVNVDFADVRAVMADAGSALMGIGMGSGKSRAREAANAAISSPLLESSIEGAKGVVF  316

Query  1408  NITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDD  1587
             NITGGTDLTL EVNAAAE+IY++VDP+AN+IFGAVID  + G++ IT+IATGF   E   
Sbjct  317   NITGGTDLTLHEVNAAAEIIYEVVDPNANIIFGAVIDDKLQGEIKITVIATGFS-GEVQT  375

Query  1588  KPLQANQLAP----GDASIGINRRPASFMDGSSVEIPEFLKKK  1704
             +P+Q  ++ P     + +   N  P        ++IP+FL+++
Sbjct  376   QPIQ-EKVQPRRPVPNPTQNPNSTPEPQRKLPGLDIPDFLQRR  417



>ref|WP_012265734.1| cell division protein FtsZ [Microcystis aeruginosa]
 ref|YP_001657656.1| cell division protein FtsZ [Microcystis aeruginosa NIES-843]
 dbj|BAG02464.1| cell division protein [Microcystis aeruginosa NIES-843]
Length=415

 Score =   340 bits (871),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 222/389 (57%), Positives = 281/389 (72%), Gaps = 27/389 (7%)
 Frame = +1

Query  556   NSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEF  735
             + + MTPR+ES    +  S          N AKIKV+GVGGGG NAVNRMI S + G+EF
Sbjct  43    HESQMTPREESRSNRIVPS----------NVAKIKVIGVGGGGCNAVNRMIASGVTGIEF  92

Query  736   WIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADM  915
             W +NTD QA+  S   PQ RLQIG +LTRGLGAGGNP IG  AA+ES++ I +A+ G D+
Sbjct  93    WAINTDAQALAHSSA-PQ-RLQIGTKLTRGLGAGGNPAIGQKAAEESRDEIAQALEGTDL  150

Query  916   VFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENV  1095
             VF+TAGMGGGTGTGAAP++A  AK +G LTVG+VT PF+FEGRRR  QA EG+  L+  V
Sbjct  151   VFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQADEGVGGLQSRV  210

Query  1096  DTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  1275
             DTLI+IPN++LL  +   TP+ EAF +ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M
Sbjct  211   DTLIIIPNNQLLQVIPADTPLQEAFRVADDVLRQGVQGISDIITIPGLVNVDFADVRAVM  270

Query  1276  ESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAA  1455
               AGS+LMGIG  +GK+RA++ A+ AI SPLL+  IE A G+V+NITGG DLTL EVNAA
Sbjct  271   ADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQDLTLHEVNAA  330

Query  1456  AEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIG  1635
             AE+IY++VDP+AN+IFGAVID  + G+V IT+IATGF      D P +     P  + + 
Sbjct  331   AEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS----GDSPSR-----PTSSKVV  381

Query  1636  IN------RRPASFMDGSSVEIPEFLKKK  1704
             IN               + ++IPEFL+++
Sbjct  382   INAPAPSPAPTPEPPKPAGLDIPEFLQRR  410



>ref|WP_035826132.1| cell division protein FtsZ [Crocosphaera watsonii]
Length=419

 Score =   340 bits (871),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 215/363 (59%), Positives = 271/363 (75%), Gaps = 11/363 (3%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A+IKV+GVGGGG NAV+RMIES + GVEFW +NTD QA+  S     HRLQIG++LT+GL
Sbjct  63    ARIKVIGVGGGGCNAVDRMIESDLMGVEFWTMNTDAQALTQSSA--PHRLQIGRKLTKGL  120

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP+IG  AA ES++ I EA+   D+VF+TAGMGGGTGTGAA ++A  AK  G LTV
Sbjct  121   GAGGNPNIGKEAAVESRDEIAEALEDTDLVFITAGMGGGTGTGAAAIVAEIAKERGCLTV  180

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G+VT PF+FEGRRR VQA +GI+ L+ NVDTLI+IPN++LL  +SP TP+ EAF  AD++
Sbjct  181   GVVTRPFTFEGRRRMVQAGQGISDLQNNVDTLIIIPNNQLLQVISPETPLREAFLAADNV  240

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RA DAA +AI SPL
Sbjct  241   LRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRANDAASSAISSPL  300

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  I+ A G+V+NITGG DL+L EVN AAE I+D+VDP AN+IFGAVID  + G+V +T
Sbjct  301   LEHSIQGAKGVVFNITGGHDLSLHEVNTAAETIFDVVDPDANIIFGAVIDERVQGEVIVT  360

Query  1549  LIATGFKRQEGDDKPLQANQLAPGDASIGINRRPASFMDG----SSVEIPEFLKKKGRSR  1716
             +IATGF   E ++ P       P   SI     P    +     + ++IP FL+ +   R
Sbjct  361   VIATGFS-PEVENAPNNQTTSTP-TRSISTPNPPKKEEEAPPKPAGLDIPPFLQDR---R  415

Query  1717  YPR  1725
             +PR
Sbjct  416   FPR  418



>ref|WP_002756934.1| cell division protein FtsZ [Microcystis aeruginosa]
 emb|CCH97661.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9717]
 emb|CCI28972.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9809]
Length=415

 Score =   339 bits (870),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 222/389 (57%), Positives = 281/389 (72%), Gaps = 27/389 (7%)
 Frame = +1

Query  556   NSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEF  735
             + + MTPR+ES    +  S          N AKIKV+GVGGGG NAVNRMI S + G+EF
Sbjct  43    HESQMTPREESRSNRIVPS----------NVAKIKVIGVGGGGCNAVNRMIASGVTGIEF  92

Query  736   WIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADM  915
             W +NTD QA+  S   PQ RLQIG +LTRGLGAGGNP IG  AA+ES++ I +A+ G D+
Sbjct  93    WAINTDAQALAHSSA-PQ-RLQIGTKLTRGLGAGGNPAIGQKAAEESRDEIAQALEGTDL  150

Query  916   VFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENV  1095
             VF+TAGMGGGTGTGAAP++A  AK +G LTVG+VT PF+FEGRRR  QA EG+  L+  V
Sbjct  151   VFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQADEGVGGLQSRV  210

Query  1096  DTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  1275
             DTLI+IPN++LL  +   TP+ EAF +ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M
Sbjct  211   DTLIIIPNNQLLQVIPADTPLQEAFRVADDVLRQGVQGISDIITIPGLVNVDFADVRAVM  270

Query  1276  ESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAA  1455
               AGS+LMGIG  +GK+RA++ A+ AI SPLL+  IE A G+V+NITGG DLTL EVNAA
Sbjct  271   ADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQDLTLHEVNAA  330

Query  1456  AEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIG  1635
             AE+IY++VDP+AN+IFGAVID  + G+V IT+IATGF      D P +     P  + + 
Sbjct  331   AEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS----GDSPSR-----PTSSKVV  381

Query  1636  IN------RRPASFMDGSSVEIPEFLKKK  1704
             IN               + ++IPEFL+++
Sbjct  382   INAPAPSPAPTPEPPKPAGLDIPEFLQRR  410



>ref|WP_007305196.1| cell division protein FtsZ [Crocosphaera watsonii]
 gb|EAM51192.1| Cell division protein FtsZ [Crocosphaera watsonii WH 8501]
Length=419

 Score =   339 bits (870),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 222/393 (56%), Positives = 283/393 (72%), Gaps = 17/393 (4%)
 Frame = +1

Query  559   STMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEFW  738
             S +  P +E G     ES +D    N+   A+IKV+GVGGGG NAV+RMIES + G+EFW
Sbjct  39    SQVNDPPEEPG----QESRRDVIVPNSI--ARIKVIGVGGGGCNAVDRMIESDLMGIEFW  92

Query  739   IVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMV  918
              +NTD QA+  S     HRLQIG++LT+GLGAGGNP+IG  AA ES++ I EA+   D+V
Sbjct  93    TMNTDAQALTQSSA--PHRLQIGRKLTKGLGAGGNPNIGKEAAVESRDEIAEALEDTDLV  150

Query  919   FVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVD  1098
             F+TAGMGGGTGTGAA ++A  AK  G LTVG+VT PF+FEGRRR VQA +GI+ L+ NVD
Sbjct  151   FITAGMGGGTGTGAAAIVAEIAKERGCLTVGVVTRPFTFEGRRRMVQAGQGISDLQNNVD  210

Query  1099  TLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIME  1278
             TLI+IPN++LL  +SP TP+ EAF  AD++LRQGV+GISDIITIPGLVNVDFADVRA+M 
Sbjct  211   TLIIIPNNQLLQVISPETPLREAFLAADNVLRQGVQGISDIITIPGLVNVDFADVRAVMA  270

Query  1279  SAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAA  1458
              AGS+LMGIG  +GK+RA DAA +AI SPLL+  I+ A G+V+NITGG DL+L EVN AA
Sbjct  271   DAGSALMGIGIGSGKSRANDAASSAISSPLLEHSIQGAKGVVFNITGGHDLSLHEVNTAA  330

Query  1459  EVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIGI  1638
             E I+D+VDP AN+IFGAVID  + G+V +T+IATGF   E ++ P       P   SI  
Sbjct  331   ETIFDVVDPDANIIFGAVIDERVQGEVIVTVIATGFS-PEVENAPNNQTTSTP-TRSIST  388

Query  1639  NRRPASFMDG----SSVEIPEFLKKKGRSRYPR  1725
                P    +     + ++IP FL+ +   R+PR
Sbjct  389   PNPPKKEEEAPPKPAGLDIPPFLQDR---RFPR  418



>ref|WP_002781797.1| Cell division protein ftsZ [Microcystis aeruginosa]
 emb|CCI16360.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9806]
Length=415

 Score =   339 bits (870),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 221/383 (58%), Positives = 279/383 (73%), Gaps = 15/383 (4%)
 Frame = +1

Query  556   NSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEF  735
             + + MTPR+ES    +  S          N AKIKV+GVGGGG NAVNRMI S + G+EF
Sbjct  43    HESQMTPREESRSNRIVPS----------NVAKIKVIGVGGGGCNAVNRMIASGVTGIEF  92

Query  736   WIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADM  915
             W +NTD QA+  S   PQ RLQIG +LTRGLGAGGNP IG  AA+ES++ I +A+ G D+
Sbjct  93    WAINTDAQALAHSSA-PQ-RLQIGTKLTRGLGAGGNPAIGQKAAEESRDEIAQALEGTDL  150

Query  916   VFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENV  1095
             VF+TAGMGGGTGTGAAP++A  AK +G LTVG+VT PF+FEGRRR  QA EG+  L+  V
Sbjct  151   VFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQADEGVGGLQSRV  210

Query  1096  DTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  1275
             DTLI+IPN++LL  +   TP+ EAF +ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M
Sbjct  211   DTLIIIPNNQLLQVIPAETPLQEAFRVADDVLRQGVQGISDIITIPGLVNVDFADVRAVM  270

Query  1276  ESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAA  1455
               AGS+LMGIG  +GK+RA++ A+ AI SPLL+  IE A G+V+NITGG DLTL EVNAA
Sbjct  271   ADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQDLTLHEVNAA  330

Query  1456  AEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIG  1635
             AE+IY++VDP+AN+IFGAVID  + G+V IT+IATGF   E   +P     +    A   
Sbjct  331   AEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS-GESPSRPTSNKVVINTPAPSP  389

Query  1636  INRRPASFMDGSSVEIPEFLKKK  1704
             +         G  ++IPEFL+++
Sbjct  390   VPTPEPPKPAG--LDIPEFLQRR  410



>ref|WP_008206746.1| cell division protein FtsZ [Microcystis sp. T1-4]
 emb|CCI34382.1| Cell division protein ftsZ [Microcystis sp. T1-4]
Length=415

 Score =   339 bits (869),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 219/383 (57%), Positives = 277/383 (72%), Gaps = 15/383 (4%)
 Frame = +1

Query  556   NSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEF  735
             + + MTPR+ES    +  S          N AKIKV+GVGGGG NAVNRMI S + G+EF
Sbjct  43    HESQMTPREESRSNRIVPS----------NVAKIKVIGVGGGGCNAVNRMIASGVTGIEF  92

Query  736   WIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADM  915
             W +NTD QA+  S   PQ RLQIG +LTRGLGAGGNP IG  AA+ES++ I +A+ G D+
Sbjct  93    WAINTDAQALAHSSA-PQ-RLQIGTKLTRGLGAGGNPAIGQKAAEESRDEIAQALEGTDL  150

Query  916   VFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENV  1095
             VF+TAGMGGGTGTGAAP++A  AK +G LTVG+VT PF+FEGRRR  QA EG+  L+  V
Sbjct  151   VFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQADEGVGGLQSRV  210

Query  1096  DTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  1275
             DTLI+IPN++LL  +   TP+ EAF +ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M
Sbjct  211   DTLIIIPNNQLLQVIPAETPLQEAFRVADDVLRQGVQGISDIITIPGLVNVDFADVRAVM  270

Query  1276  ESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAA  1455
               AGS+LMGIG  +GK+RA++ A+ AI SPLL+  IE A G+V+NITGG DLTL EVNAA
Sbjct  271   ADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQDLTLHEVNAA  330

Query  1456  AEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAPGDASIG  1635
             AE+IY++VDP+AN+IFGAVID  + G+V IT+IATGF    GD      +     +    
Sbjct  331   AEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS---GDSPSRPTSNKVVINTPAP  387

Query  1636  INRRPASFMDGSSVEIPEFLKKK  1704
                        + ++IPEFL+++
Sbjct  388   SPAPTPEPAKPAGLDIPEFLQRR  410



>ref|WP_021834441.1| Cell division protein FtsZ [Crocosphaera watsonii]
 emb|CCQ59866.1| Cell division protein FtsZ [Crocosphaera watsonii WH 0401]
Length=419

 Score =   339 bits (869),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 214/363 (59%), Positives = 271/363 (75%), Gaps = 11/363 (3%)
 Frame = +1

Query  649   AKIKvvgvggggSNAVNRMIESSMKGVEFWIVNTDIQAMRMSPVFPQHRLQIGQELTRGL  828
             A+IKV+GVGGGG NAV+RMIES + G+EFW +NTD QA+  S     HRLQIG++LT+GL
Sbjct  63    ARIKVIGVGGGGCNAVDRMIESDLMGIEFWTMNTDAQALTQSSA--PHRLQIGRKLTKGL  120

Query  829   GAGGNPDIGTNaakeskeaieeaVYGADMVFVtagmgggtgtgaapviagtaKSMGILTV  1008
             GAGGNP+IG  AA ES++ I EA+   D+VF+TAGMGGGTGTGAA ++A  AK  G LTV
Sbjct  121   GAGGNPNIGKEAAVESRDEIAEALEDTDLVFITAGMGGGTGTGAAAIVAEIAKERGCLTV  180

Query  1009  GIVTTPFSFEGRRRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDI  1188
             G+VT PF+FEGRRR VQA +GI+ L+ NVDTLI+IPN++LL  +SP TP+ EAF  AD++
Sbjct  181   GVVTRPFTFEGRRRMVQAGQGISDLQNNVDTLIIIPNNQLLQVISPETPLREAFLAADNV  240

Query  1189  LRQGVRGISDIITIPGLVNVDFADVRAIMESAGSSLMGIGTATGKTRARDAALNAIQSPL  1368
             LRQGV+GISDIITIPGLVNVDFADVRA+M  AGS+LMGIG  +GK+RA DAA +AI SPL
Sbjct  241   LRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRANDAASSAISSPL  300

Query  1369  LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPSANLIFGAVIDPSISGQVSIT  1548
             L+  I+ A G+V+NITGG DL+L EVN AAE I+D+VDP AN+IFGAVID  + G+V +T
Sbjct  301   LEHSIQGAKGVVFNITGGHDLSLHEVNTAAETIFDVVDPDANIIFGAVIDERVQGEVIVT  360

Query  1549  LIATGFKRQEGDDKPLQANQLAPGDASIGINRRPASFMDG----SSVEIPEFLKKKGRSR  1716
             +IATGF   E ++ P       P   SI     P    +     + ++IP FL+ +   R
Sbjct  361   VIATGFS-PEVENAPNNQTTSTP-TRSISTPNPPKKEEEAPPKPAGLDIPPFLQDR---R  415

Query  1717  YPR  1725
             +PR
Sbjct  416   FPR  418



>gb|KFM23856.1| Cell division protein FtsZ-like protein 1, chloroplastic [Auxenochlorella 
protothecoides]
Length=389

 Score =   338 bits (866),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 210/352 (60%), Positives = 267/352 (76%), Gaps = 6/352 (2%)
 Frame = +1

Query  565   MMTPRQESGIENVTESSKDSSSVNNFN-EAKIKvvgvggggSNAVNRMIESSMKGVEFWI  741
             M  PR   G   VT++S  S +      +A+IKV+GVGGGG NAVNRMI S ++GVEFW 
Sbjct  1     MHRPRSHIGF--VTQASYGSGNYGPVGGDARIKVIGVGGGGGNAVNRMISSGLQGVEFWA  58

Query  742   VNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADMVF  921
             VNTD QA+        ++LQIG  LTRGLG GG P++G  AA+ES + +  AV GADMVF
Sbjct  59    VNTDAQALESHQAL--NKLQIGTTLTRGLGTGGKPELGEEAAQESHQELASAVQGADMVF  116

Query  922   VtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENVDT  1101
             +TAGMGGGTGTGAAPV+A  +K +G+LTVG+VT PF+FEGRRRA QA +GI  LR+NVDT
Sbjct  117   ITAGMGGGTGTGAAPVVARLSKDLGVLTVGVVTFPFTFEGRRRAGQATDGIDTLRKNVDT  176

Query  1102  LIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMES  1281
             LIVIPND+LL  V  STP+ +AF LADD+LRQGV+GISDIITIPGLVNVDFADV+AIM +
Sbjct  177   LIVIPNDRLLDVVGDSTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAIMCN  236

Query  1282  AGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAAAE  1461
             +G++++G+G ++GK RA +AA+ A  +PL++  IERATGIV+NITGG DLTL EVN  +E
Sbjct  237   SGTAMLGVGVSSGKNRAEEAAMAATSAPLIERSIERATGIVYNITGGRDLTLQEVNRVSE  296

Query  1462  VIYDLVDPSANLIFGAVIDPSISGQVSITLIATGFKRQEGDDKPLQANQLAP  1617
             V+  L DPSAN+IFGAVID +  G++ +T+IATGF  Q  +D+ L    + P
Sbjct  297   VVTSLADPSANVIFGAVIDDAYEGEIHVTIIATGFN-QTFEDQLLSGRSVLP  347



>dbj|BAE20183.1| FtsZ protein [Microcystis aeruginosa]
Length=415

 Score =   338 bits (868),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 213/337 (63%), Positives = 262/337 (78%), Gaps = 12/337 (4%)
 Frame = +1

Query  556   NSTMMTPRQESGIENVTESSKDSSSVNNFNEAKIKvvgvggggSNAVNRMIESSMKGVEF  735
             + + MTPR+ES    +  S          N AKIKV+GVGGGG NAVNRMI S + G+EF
Sbjct  43    HESQMTPREESRSNRIVPS----------NVAKIKVIGVGGGGCNAVNRMIASGVTGIEF  92

Query  736   WIVNTDIQAMRMSPVFPQHRLQIGQELTRGLGAGGNPDIGTNaakeskeaieeaVYGADM  915
             W +NTD QA+  S   PQ RLQIG +LTRGLGAGGNP IG  AA+ES+E I +A+ G D+
Sbjct  93    WAINTDAQALAHSSA-PQ-RLQIGTKLTRGLGAGGNPAIGQKAAEESREEIAQALEGTDL  150

Query  916   VFVtagmgggtgtgaapviagtaKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRENV  1095
             VF+TAGMGGGTGTGAAP++A  AK +G LTVG+VT PF+FEGRRR  QA EG+  L+  V
Sbjct  151   VFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQADEGVGGLQSRV  210

Query  1096  DTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIM  1275
             DTLI+IPN++LL  +   TP+ EAF +ADD+LRQGV+GISDIITIPGLVNVDFADVRA+M
Sbjct  211   DTLIIIPNNQLLQVIPAETPLQEAFRVADDVLRQGVQGISDIITIPGLVNVDFADVRAVM  270

Query  1276  ESAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGTDLTLFEVNAA  1455
               AGS+LMGIG  +GK+RA++ A+ AI SPLL+  IE A G+V+NITGG DLTL EVNAA
Sbjct  271   ADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQDLTLHEVNAA  330

Query  1456  AEVIYDLVDPSANLIFGAVIDPSISGQVSITLIATGF  1566
             AE+IY++VDP+AN+IFGAVID  + G+V IT+IATGF
Sbjct  331   AEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGF  367



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6586426838210