BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22771_g1_i3 len=406 path=[628:0-83 712:84-165 794:166-197
826:198-302 1387:303-405]

Length=406
                                                                      Score     E

ref|XP_009612191.1|  PREDICTED: APO protein 4, mitochondrial            133   1e-34   
ref|XP_009805015.1|  PREDICTED: APO protein 4, mitochondrial            131   6e-34   
ref|XP_004238237.2|  PREDICTED: APO protein 4, mitochondrial            127   3e-32   
ref|XP_006341909.1|  PREDICTED: APO protein 4, mitochondrial-like       126   4e-32   
emb|CDP07549.1|  unnamed protein product                                124   2e-31   
ref|XP_011074514.1|  PREDICTED: LOW QUALITY PROTEIN: APO protein ...    124   3e-31   
gb|EYU32798.1|  hypothetical protein MIMGU_mgv1a010138mg                119   2e-29   
ref|XP_006447520.1|  hypothetical protein CICLE_v10015921mg             108   2e-25   
ref|XP_002527241.1|  APO protein 4, mitochondrial precursor, puta...    101   6e-23   Ricinus communis
emb|CBI28952.3|  unnamed protein product                              99.0    1e-22   
ref|XP_007033060.1|  APO protein 4 isoform 1                          99.8    3e-22   
ref|XP_002273999.2|  PREDICTED: APO protein 4, mitochondrial          97.8    1e-21   Vitis vinifera
ref|XP_006372950.1|  hypothetical protein POPTR_0017s06490g           97.8    1e-21   
ref|XP_011037010.1|  PREDICTED: APO protein 4, mitochondrial          97.8    1e-21   
ref|XP_008455841.1|  PREDICTED: APO protein 4, mitochondrial          96.3    5e-21   
ref|XP_004151879.1|  PREDICTED: APO protein 4, mitochondrial-like     95.9    7e-21   
ref|XP_004158556.1|  PREDICTED: APO protein 4, mitochondrial-like     95.9    7e-21   
ref|XP_008776097.1|  PREDICTED: APO protein 4, mitochondrial isof...  95.1    1e-20   
ref|XP_008776099.1|  PREDICTED: APO protein 4, mitochondrial isof...  94.7    1e-20   
gb|KHN36547.1|  APO protein 4, mitochondrial                          94.7    2e-20   
ref|XP_007149961.1|  hypothetical protein PHAVU_005G114000g           93.6    4e-20   
ref|XP_010052452.1|  PREDICTED: APO protein 4, mitochondrial          92.8    7e-20   
ref|XP_003597021.1|  APO protein                                      92.8    9e-20   
gb|EPS60487.1|  hypothetical protein M569_14314                       92.0    1e-19   
ref|XP_004287928.1|  PREDICTED: APO protein 4, mitochondrial-like     91.7    2e-19   
ref|XP_006279193.1|  hypothetical protein CARUB_v10016518mg           90.9    4e-19   
ref|XP_009417984.1|  PREDICTED: APO protein 4, mitochondrial          90.5    5e-19   
ref|XP_004487390.1|  PREDICTED: APO protein 4, mitochondrial-like...  90.5    5e-19   
gb|KDP41149.1|  hypothetical protein JCGZ_03643                       91.3    7e-19   
ref|XP_009365158.1|  PREDICTED: APO protein 4, mitochondrial-like     89.7    1e-18   
ref|XP_009337730.1|  PREDICTED: APO protein 4, mitochondrial-like     89.7    1e-18   
ref|XP_010248521.1|  PREDICTED: APO protein 4, mitochondrial isof...  89.7    1e-18   
ref|XP_010248590.1|  PREDICTED: APO protein 4, mitochondrial isof...  89.4    1e-18   
ref|XP_010551030.1|  PREDICTED: APO protein 4, mitochondrial-like     89.0    1e-18   
emb|CAJ86368.1|  OSIGBa0117N13.12                                     89.0    2e-18   Oryza sativa [red rice]
ref|NP_001053956.1|  Os04g0628000                                     89.0    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008379620.1|  PREDICTED: LOW QUALITY PROTEIN: APO protein ...  88.6    3e-18   
ref|XP_010248529.1|  PREDICTED: APO protein 4, mitochondrial isof...  88.6    3e-18   
ref|XP_003580603.1|  PREDICTED: APO protein 4, mitochondrial          87.8    4e-18   
ref|XP_002885464.1|  hypothetical protein ARALYDRAFT_318914           87.8    4e-18   
ref|NP_188811.2|  APO protein 4                                       87.8    5e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CAE04242.3|  OSJNBa0089N06.3                                      89.7    6e-18   Oryza sativa [red rice]
ref|XP_006652862.1|  PREDICTED: APO protein 4, mitochondrial-like     87.4    6e-18   
ref|XP_002448571.1|  hypothetical protein SORBIDRAFT_06g029350        87.4    6e-18   Sorghum bicolor [broomcorn]
dbj|BAB02836.1|  unnamed protein product                              88.6    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237745.1|  PREDICTED: APO protein 4, mitochondrial-like     87.0    7e-18   
ref|XP_010694573.1|  PREDICTED: APO protein 4, mitochondrial          87.0    9e-18   
gb|EMT11106.1|  hypothetical protein F775_07337                       86.7    1e-17   
ref|XP_008230090.1|  PREDICTED: APO protein 4, mitochondrial          86.3    2e-17   
ref|XP_007215688.1|  hypothetical protein PRUPE_ppa008702mg           85.9    2e-17   
dbj|BAK06104.1|  predicted protein                                    85.9    2e-17   
ref|XP_010466431.1|  PREDICTED: APO protein 4, mitochondrial          85.1    4e-17   
gb|KDP41156.1|  hypothetical protein JCGZ_03650                       84.7    4e-17   
gb|EMS51284.1|  hypothetical protein TRIUR3_05793                     84.0    1e-16   
ref|XP_004976898.1|  PREDICTED: APO protein 4, mitochondrial-like     83.6    1e-16   
ref|XP_010510550.1|  PREDICTED: APO protein 4, mitochondrial-like     83.6    2e-16   
ref|XP_010488194.1|  PREDICTED: APO protein 4, mitochondrial-like     83.6    2e-16   
ref|XP_006836549.1|  hypothetical protein AMTR_s00131p00039570        83.2    3e-16   
ref|XP_006406612.1|  hypothetical protein EUTSA_v10021082mg           82.4    4e-16   
gb|KFK39492.1|  hypothetical protein AALP_AA3G251000                  82.0    5e-16   
ref|NP_001143703.1|  hypothetical protein                             81.3    1e-15   Zea mays [maize]
emb|CDY38637.1|  BnaA05g19500D                                        81.3    1e-15   
ref|XP_009145455.1|  PREDICTED: APO protein 4, mitochondrial          81.3    1e-15   
emb|CDY33138.1|  BnaCnng07090D                                        80.9    2e-15   
ref|XP_002447052.1|  hypothetical protein SORBIDRAFT_06g027590        80.1    2e-15   Sorghum bicolor [broomcorn]
gb|AGT17276.1|  hypothetical protein SHCRBa_020_L15_F_200             79.3    5e-15   
ref|XP_009353258.1|  PREDICTED: LOW QUALITY PROTEIN: APO protein ...  79.0    8e-15   
ref|XP_010089336.1|  APO protein 4                                    77.8    2e-14   
tpg|DAA36167.1|  TPA: hypothetical protein ZEAMMB73_204749            68.9    2e-12   
ref|XP_007199896.1|  hypothetical protein PRUPE_ppa007230mg           70.1    2e-11   
ref|XP_006296587.1|  hypothetical protein CARUB_v100143370mg          65.1    4e-11   
ref|XP_010532481.1|  PREDICTED: APO protein 4, mitochondrial          67.4    9e-11   



>ref|XP_009612191.1| PREDICTED: APO protein 4, mitochondrial [Nicotiana tomentosiformis]
Length=323

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = -2

Query  276  RSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAR  97
            RS+ELW+   I+    M+  RFY +KPKV DLKKLRPMILKRIENRAKDYPVK MVPVA 
Sbjct  2    RSRELWQHKTIIFKGTMEFYRFYSSKPKV-DLKKLRPMILKRIENRAKDYPVKSMVPVAE  60

Query  96   EVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            EVLKA+  LYHGVS L+Q  P W CKYCPEVY
Sbjct  61   EVLKARTILYHGVSALIQRFPTWACKYCPEVY  92



>ref|XP_009805015.1| PREDICTED: APO protein 4, mitochondrial [Nicotiana sylvestris]
Length=323

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = -2

Query  276  RSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAR  97
            RS++LW+   ++    M+  RFY +KPKV DLKKLRPMILKRIENRAKDYPVK MVPVA 
Sbjct  2    RSRKLWQHKTMIFNGTMEFYRFYSSKPKV-DLKKLRPMILKRIENRAKDYPVKSMVPVAE  60

Query  96   EVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            EVLKA+  LYHGVS L+Q  P W CKYCPEVY
Sbjct  61   EVLKARTILYHGVSALIQRFPTWACKYCPEVY  92



>ref|XP_004238237.2| PREDICTED: APO protein 4, mitochondrial [Solanum lycopersicum]
Length=343

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = -2

Query  291  VGMAWRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDM  112
              MA R+++LW+Q +++    M+  RF+ +KPKV DL+KLRPMILKRIE+RAKDYPVK M
Sbjct  17   AAMALRNRQLWQQTKMIYKVTMEYYRFFSSKPKV-DLRKLRPMILKRIEDRAKDYPVKSM  75

Query  111  VPVAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            VPVA  V KA+  LYHGVS L+Q  P W CKYCPEVY
Sbjct  76   VPVAEGVFKARTILYHGVSALMQRFPTWACKYCPEVY  112



>ref|XP_006341909.1| PREDICTED: APO protein 4, mitochondrial-like [Solanum tuberosum]
Length=325

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = -2

Query  285  MAWRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVP  106
            MA R+++LW+Q +++    M+  RF+ +KPKV DL+KLRPMILKRIE+RAKDYPVK MVP
Sbjct  1    MALRNRQLWQQTKMIYKVTMEYYRFFSSKPKV-DLRKLRPMILKRIEDRAKDYPVKSMVP  59

Query  105  VAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            VA  V KA+  LYHGVS L+Q  P W CKYCPEVY
Sbjct  60   VAEGVFKARTILYHGVSALMQRFPTWACKYCPEVY  94



>emb|CDP07549.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  MAWRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVP  106
            M  R  ELW   +++L +M+   R Y +K KVVDLKKLRPMILKRIENRAKDYPVK MVP
Sbjct  1    MGLRYLELWHHRKLILDSMIGCYRCYSSKAKVVDLKKLRPMILKRIENRAKDYPVKAMVP  60

Query  105  VAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            VA EV+KA+  LY GVS LLQ +PVW CKYC EV+
Sbjct  61   VANEVVKARTTLYRGVSILLQRVPVWACKYCQEVF  95



>ref|XP_011074514.1| PREDICTED: LOW QUALITY PROTEIN: APO protein 4, mitochondrial 
[Sesamum indicum]
Length=324

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  MAWRSQELWRQGEIVLGTMMDGCRFYRTKPK-VVDLKKLRPMILKRIENRAKDYPVKDMV  109
            M  R  +LW    ++L  M  G RFY T+ K  VDLKKLRPMILKRIE RAK+YPVK M+
Sbjct  1    MGLREHKLWHNSSLILEEMFSGIRFYSTRSKPEVDLKKLRPMILKRIEERAKEYPVKGML  60

Query  108  PVAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
             VAREVL+A+ ALY GVSTL Q +P+W CKYCPEVY
Sbjct  61   TVAREVLQARPALYDGVSTLSQRIPIWACKYCPEVY  96



>gb|EYU32798.1| hypothetical protein MIMGU_mgv1a010138mg [Erythranthe guttata]
Length=321

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  MAWRSQELWRQGEIVLGTMMDGCRFYRTKPK-VVDLKKLRPMILKRIENRAKDYPVKDMV  109
            M  R+  LW++  ++L  ++ G RFY TK    VDL+KLRP+ILKRIE RAK+YPV+ M+
Sbjct  1    MNARNLRLWQKSSLILEQVLIGSRFYSTKSNPTVDLRKLRPVILKRIEERAKEYPVRGML  60

Query  108  PVAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            P+A EVL+A+ ALY GVSTL+ H+P+W CKYC EVY
Sbjct  61   PLAHEVLQARTALYDGVSTLIHHIPIWACKYCSEVY  96



>ref|XP_006447520.1| hypothetical protein CICLE_v10015921mg [Citrus clementina]
 ref|XP_006469706.1| PREDICTED: APO protein 4, mitochondrial-like [Citrus sinensis]
 gb|ESR60760.1| hypothetical protein CICLE_v10015921mg [Citrus clementina]
Length=326

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 3/79 (4%)
 Frame = -2

Query  237  GTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGV  58
            G + +G RFY +K    DLKKLRPMI+KRIENRAKDYP++DMVPVAREVLKA+A L  GV
Sbjct  13   GELSNGQRFYSSK---FDLKKLRPMIMKRIENRAKDYPIRDMVPVAREVLKARALLIRGV  69

Query  57   STLLQHLPVWICKYCPEVY  1
            STL++  PV  CK+CPEV+
Sbjct  70   STLIKVFPVQACKFCPEVF  88



>ref|XP_002527241.1| APO protein 4, mitochondrial precursor, putative [Ricinus communis]
 gb|EEF35167.1| APO protein 4, mitochondrial precursor, putative [Ricinus communis]
Length=325

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 3/90 (3%)
 Frame = -2

Query  270  QELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREV  91
            +++W+      G  +   RFY ++   VD KKLRPMILKRIENRAKDYPV+D+VPVA EV
Sbjct  5    KKIWQDFARFYGNHITHFRFYSSQ---VDWKKLRPMILKRIENRAKDYPVRDLVPVAHEV  61

Query  90   LKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            L+A+  L  GVSTL+Q +PV  CK+CPEV+
Sbjct  62   LQARMLLIQGVSTLIQVIPVVACKFCPEVH  91



>emb|CBI28952.3| unnamed protein product [Vitis vinifera]
Length=200

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 57/72 (79%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            RFY  K   VDLKKLRPMILKRIENRAK+YP+  M+PVA++VLKA++ L  GVSTL+   
Sbjct  23   RFYSVK---VDLKKLRPMILKRIENRAKEYPISSMIPVAQDVLKARSLLIQGVSTLMNVF  79

Query  36   PVWICKYCPEVY  1
            PV  CK+CPEVY
Sbjct  80   PVMACKFCPEVY  91



>ref|XP_007033060.1| APO protein 4 isoform 1 [Theobroma cacao]
 ref|XP_007033061.1| APO protein 4 isoform 1 [Theobroma cacao]
 ref|XP_007033062.1| APO protein 4 isoform 1 [Theobroma cacao]
 gb|EOY03986.1| APO protein 4 isoform 1 [Theobroma cacao]
 gb|EOY03987.1| APO protein 4 isoform 1 [Theobroma cacao]
 gb|EOY03988.1| APO protein 4 isoform 1 [Theobroma cacao]
Length=312

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  213  FYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHLP  34
            ++R+    VDLKKLRPMILKRIENRAKDYPV  M+PVA+EVL A+A L+ GVS LL+  P
Sbjct  8    YWRSYSSKVDLKKLRPMILKRIENRAKDYPVPGMIPVAQEVLMARALLFQGVSILLKLFP  67

Query  33   VWICKYCPEVY  1
            V  CK+CPEVY
Sbjct  68   VLACKFCPEVY  78



>ref|XP_002273999.2| PREDICTED: APO protein 4, mitochondrial [Vitis vinifera]
Length=329

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 57/72 (79%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            RFY  K   VDLKKLRPMILKRIENRAK+YP+  M+PVA++VLKA++ L  GVSTL+   
Sbjct  23   RFYSVK---VDLKKLRPMILKRIENRAKEYPISSMIPVAQDVLKARSLLIQGVSTLMNVF  79

Query  36   PVWICKYCPEVY  1
            PV  CK+CPEVY
Sbjct  80   PVMACKFCPEVY  91



>ref|XP_006372950.1| hypothetical protein POPTR_0017s06490g [Populus trichocarpa]
 gb|ERP50747.1| hypothetical protein POPTR_0017s06490g [Populus trichocarpa]
Length=328

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            RFY ++   VD KKLRPMILKRI+NRAKDYPVK MVPVAREVL+ +  L  GVSTL++  
Sbjct  24   RFYSSR---VDFKKLRPMILKRIQNRAKDYPVKGMVPVAREVLEKRKLLIQGVSTLMEVF  80

Query  36   PVWICKYCPEVY  1
            PV  CK+CPEVY
Sbjct  81   PVLACKFCPEVY  92



>ref|XP_011037010.1| PREDICTED: APO protein 4, mitochondrial [Populus euphratica]
 ref|XP_011037011.1| PREDICTED: APO protein 4, mitochondrial [Populus euphratica]
 ref|XP_011037012.1| PREDICTED: APO protein 4, mitochondrial [Populus euphratica]
 ref|XP_011037013.1| PREDICTED: APO protein 4, mitochondrial [Populus euphratica]
Length=328

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 64/92 (70%), Gaps = 4/92 (4%)
 Frame = -2

Query  273  SQELWRQ-GEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAR  97
            +++LW    E    T     RFY ++   VD KKLRPMILKRI+NRAKDYPVK MVPVAR
Sbjct  4    TKKLWENLVEEFSKTYFMHSRFYSSR---VDFKKLRPMILKRIQNRAKDYPVKGMVPVAR  60

Query  96   EVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            EVL+ +  L  GVSTL++  PV  CK+CPEVY
Sbjct  61   EVLEKRKLLIQGVSTLMEVFPVLACKFCPEVY  92



>ref|XP_008455841.1| PREDICTED: APO protein 4, mitochondrial [Cucumis melo]
 ref|XP_008455842.1| PREDICTED: APO protein 4, mitochondrial [Cucumis melo]
Length=334

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R Y +K   V+LKKLRPMILKRI++RAK YP+K M PVA++VL+A+A L HGVSTLL+  
Sbjct  25   RCYSSK---VNLKKLRPMILKRIQDRAKSYPIKGMTPVAQQVLEARAMLIHGVSTLLKSF  81

Query  36   PVWICKYCPEVY  1
            PV  CKYCPEVY
Sbjct  82   PVLSCKYCPEVY  93



>ref|XP_004151879.1| PREDICTED: APO protein 4, mitochondrial-like [Cucumis sativus]
 gb|KGN63269.1| hypothetical protein Csa_2G421010 [Cucumis sativus]
Length=330

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R Y +K   V+LKKLRPMILKRI++RAK+YP+K M PVA++VL+A+A L HGVSTLL+  
Sbjct  25   RCYSSK---VNLKKLRPMILKRIQDRAKNYPIKGMTPVAQQVLEARAMLIHGVSTLLKSF  81

Query  36   PVWICKYCPEVY  1
            PV  CK+CPEVY
Sbjct  82   PVLSCKFCPEVY  93



>ref|XP_004158556.1| PREDICTED: APO protein 4, mitochondrial-like [Cucumis sativus]
Length=330

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R Y +K   V+LKKLRPMILKRI++RAK+YP+K M PVA++VL+A+A L HGVSTLL+  
Sbjct  25   RCYSSK---VNLKKLRPMILKRIQDRAKNYPIKGMTPVAQQVLEARAMLIHGVSTLLKSF  81

Query  36   PVWICKYCPEVY  1
            PV  CK+CPEVY
Sbjct  82   PVLSCKFCPEVY  93



>ref|XP_008776097.1| PREDICTED: APO protein 4, mitochondrial isoform X1 [Phoenix dactylifera]
 ref|XP_008776098.1| PREDICTED: APO protein 4, mitochondrial isoform X1 [Phoenix dactylifera]
Length=336

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 56/72 (78%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R+Y +K   VD KKLRPMILKRI+NRAKDYPVK M+PVA EVLKA+  L  GVS LLQ +
Sbjct  35   RYYSSK---VDWKKLRPMILKRIQNRAKDYPVKSMIPVANEVLKARELLTKGVSALLQVI  91

Query  36   PVWICKYCPEVY  1
             +  CKYCPEVY
Sbjct  92   AIKSCKYCPEVY  103



>ref|XP_008776099.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Phoenix dactylifera]
Length=324

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 56/72 (78%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R+Y +K   VD KKLRPMILKRI+NRAKDYPVK M+PVA EVLKA+  L  GVS LLQ +
Sbjct  23   RYYSSK---VDWKKLRPMILKRIQNRAKDYPVKSMIPVANEVLKARELLTKGVSALLQVI  79

Query  36   PVWICKYCPEVY  1
             +  CKYCPEVY
Sbjct  80   AIKSCKYCPEVY  91



>gb|KHN36547.1| APO protein 4, mitochondrial [Glycine soja]
Length=362

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R Y TK   VDLKKLRPMILKRIE RA  YPV+ MVPVA EVL+ +  L HGVSTLL  L
Sbjct  20   RLYATK---VDLKKLRPMILKRIEKRAHTYPVRGMVPVANEVLQVRNDLIHGVSTLLNFL  76

Query  36   PVWICKYCPEVY  1
            P+  CK+CPE+Y
Sbjct  77   PLMACKFCPEIY  88



>ref|XP_007149961.1| hypothetical protein PHAVU_005G114000g [Phaseolus vulgaris]
 gb|ESW21955.1| hypothetical protein PHAVU_005G114000g [Phaseolus vulgaris]
Length=335

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R Y TK   VDL+KLRPMILKRI+ RA+ YPV+ MVPVA EVL+A+  L HG+STLL  L
Sbjct  20   RLYGTK---VDLRKLRPMILKRIDKRAQGYPVRAMVPVANEVLQARNVLIHGISTLLDFL  76

Query  36   PVWICKYCPEVY  1
            P+  CK+CPE+Y
Sbjct  77   PLTACKFCPEIY  88



>ref|XP_010052452.1| PREDICTED: APO protein 4, mitochondrial [Eucalyptus grandis]
 ref|XP_010052460.1| PREDICTED: APO protein 4, mitochondrial [Eucalyptus grandis]
 ref|XP_010052467.1| PREDICTED: APO protein 4, mitochondrial [Eucalyptus grandis]
 gb|KCW89605.1| hypothetical protein EUGRSUZ_A01889 [Eucalyptus grandis]
Length=328

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R Y T+   VDLKKLRPMILKRIE RAKDYPV  MVPVA+EVLKA+  L  GVSTLL+  
Sbjct  23   RLYSTE---VDLKKLRPMILKRIEGRAKDYPVPGMVPVAQEVLKARTLLIQGVSTLLRFF  79

Query  36   PVWICKYCPEVY  1
            PV  CK C EVY
Sbjct  80   PVAACKLCSEVY  91



>ref|XP_003597021.1| APO protein [Medicago truncatula]
 gb|AES67272.1| APO RNA-binding protein [Medicago truncatula]
Length=344

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            RFY TK   VDL+KLRPMILKRIE R++ YPV+ M+PVA EVL A+  L HGVSTL+   
Sbjct  27   RFYATK---VDLRKLRPMILKRIERRSQLYPVRAMIPVANEVLLARNVLIHGVSTLINSF  83

Query  36   PVWICKYCPEVY  1
            P+  CK+CPE+Y
Sbjct  84   PLMACKFCPEIY  95



>gb|EPS60487.1| hypothetical protein M569_14314, partial [Genlisea aurea]
Length=295

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = -2

Query  222  GCRFYRTKPK-VVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLL  46
            G R YR+K    +D +KLRP+ILKRIE+R+K+YP+K ++PVA EVL+A+  L+ GVS L+
Sbjct  1    GRRHYRSKSNHGLDFRKLRPVILKRIEDRSKNYPIKALIPVADEVLRAREILHCGVSALI  60

Query  45   QHLPVWICKYCPEVY  1
              +P+W CK+CPEVY
Sbjct  61   TRIPIWACKFCPEVY  75



>ref|XP_004287928.1| PREDICTED: APO protein 4, mitochondrial-like [Fragaria vesca 
subsp. vesca]
Length=348

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R+Y +K   VDLKK+RPMILKRI++RAKDYPV  M+PVA EVL ++  L  GVSTLL+ +
Sbjct  23   RYYSSKK--VDLKKMRPMILKRIQDRAKDYPVHRMIPVAEEVLNSRRLLIQGVSTLLKAV  80

Query  36   PVWICKYCPEVY  1
            PV  CK+CPEVY
Sbjct  81   PVVACKFCPEVY  92



>ref|XP_006279193.1| hypothetical protein CARUB_v10016518mg, partial [Capsella rubella]
 gb|EOA12091.1| hypothetical protein CARUB_v10016518mg, partial [Capsella rubella]
Length=332

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  VGMAWRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDM  112
            V M+  S ++WR   ++ G           K K+ DL+K+RPMIL+RIENRAKDYPVK++
Sbjct  3    VAMSNWSHKVWRNLSLIQGASYSTTPSRTNKLKLDDLRKIRPMILRRIENRAKDYPVKEI  62

Query  111  VPVAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            VPVA +VL A+  L   V+ LL+ +PV  CK+C EV+
Sbjct  63   VPVAEDVLIARKYLLSDVTALLKVIPVLTCKFCSEVF  99



>ref|XP_009417984.1| PREDICTED: APO protein 4, mitochondrial [Musa acuminata subsp. 
malaccensis]
 ref|XP_009417992.1| PREDICTED: APO protein 4, mitochondrial [Musa acuminata subsp. 
malaccensis]
 ref|XP_009417999.1| PREDICTED: APO protein 4, mitochondrial [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418008.1| PREDICTED: APO protein 4, mitochondrial [Musa acuminata subsp. 
malaccensis]
Length=324

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 5/93 (5%)
 Frame = -2

Query  279  WRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVA  100
            WR  + + QG++    +    R Y +K   VD  KLRPMILKRI NRAKDYPV  M+P+A
Sbjct  4    WRQVQHYLQGDLYCSLLH--LRQYGSK---VDWNKLRPMILKRIRNRAKDYPVVRMIPIA  58

Query  99   REVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            ++VLK++  L  G+STLL+ +PV  CK+CPEVY
Sbjct  59   QDVLKSREMLAEGISTLLKFIPVKSCKFCPEVY  91



>ref|XP_004487390.1| PREDICTED: APO protein 4, mitochondrial-like isoform X1 [Cicer 
arietinum]
Length=337

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            RFY TK   VDL+KLRPMILKRIE R+  YP++ MVPVA EVL A+  L +GVSTLL+  
Sbjct  27   RFYATK---VDLRKLRPMILKRIEKRSHLYPIRAMVPVANEVLLARNFLINGVSTLLKSF  83

Query  36   PVWICKYCPEVY  1
            PV  CK+CPE+Y
Sbjct  84   PVMACKFCPEIY  95



>gb|KDP41149.1| hypothetical protein JCGZ_03643 [Jatropha curcas]
Length=449

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = -2

Query  258  RQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAK  79
            R  E+V+G + +   FY +K   VD KKLRPMILKR+ENRAK YP+++M+P+A+EVL  +
Sbjct  51   RASEMVVGILGNFAGFYSSK---VDWKKLRPMILKRVENRAKVYPIQEMLPLAQEVLGVR  107

Query  78   AALYHGVSTLLQHLPVWICKYCPEVY  1
              L  G+S L + +PV  CK+CPEVY
Sbjct  108  MLLIQGISILTRVIPVVACKFCPEVY  133



>ref|XP_009365158.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009365159.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009365160.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
Length=333

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = -2

Query  237  GTMMDG-CRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHG  61
            G +MD   R+Y +K   +DL+KL+PMI KRI+NRAKDYPV  M+PVA+EVL ++  +  G
Sbjct  15   GKIMDSFARYYSSK---MDLRKLKPMIQKRIQNRAKDYPVPAMLPVAQEVLDSRRLVMQG  71

Query  60   VSTLLQHLPVWICKYCPEVY  1
            VSTLL+ +PV  CK+CPEVY
Sbjct  72   VSTLLKMVPVLACKFCPEVY  91



>ref|XP_009337730.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009337732.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009337733.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009337734.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
Length=333

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = -2

Query  237  GTMMDG-CRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHG  61
            G +MD   R+Y  K   +DL+KL+PMI KRI+NRAKDYPV  MVPVA+EVL ++  +  G
Sbjct  15   GKIMDSFARYYSLK---MDLRKLKPMIQKRIQNRAKDYPVPAMVPVAQEVLDSRRLVMQG  71

Query  60   VSTLLQHLPVWICKYCPEVY  1
            VSTLL+ +PV  CK+CPEVY
Sbjct  72   VSTLLKMVPVLACKFCPEVY  91



>ref|XP_010248521.1| PREDICTED: APO protein 4, mitochondrial isoform X1 [Nelumbo nucifera]
Length=360

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = -2

Query  291  VGMAWRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDM  112
            V MAWRS+ +W          +   R Y +K   VD  KLRPMIL+RI++RAK+YPV+ M
Sbjct  12   VHMAWRSK-IWHHLLEDYNYHLTSSRSYSSK---VDWDKLRPMILERIKSRAKNYPVRGM  67

Query  111  VPVAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            VPVA EV++A+A L  G+S LL+ +PV  CK+CPEV+
Sbjct  68   VPVAYEVIRARARLIEGLSMLLKAIPVKACKFCPEVF  104



>ref|XP_010248590.1| PREDICTED: APO protein 4, mitochondrial isoform X3 [Nelumbo nucifera]
Length=324

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = -2

Query  291  VGMAWRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDM  112
            V MAWRS+ +W          +   R Y +K   VD  KLRPMIL+RI++RAK+YPV+ M
Sbjct  12   VHMAWRSK-IWHHLLEDYNYHLTSSRSYSSK---VDWDKLRPMILERIKSRAKNYPVRGM  67

Query  111  VPVAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            VPVA EV++A+A L  G+S LL+ +PV  CK+CPEV+
Sbjct  68   VPVAYEVIRARARLIEGLSMLLKAIPVKACKFCPEVF  104



>ref|XP_010551030.1| PREDICTED: APO protein 4, mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010551031.1| PREDICTED: APO protein 4, mitochondrial-like [Tarenaya hassleriana]
Length=303

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = -2

Query  207  RTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHLPVW  28
            R+K K+ DLKKLRPMILKRIE RAK+YP+K MVPVA+EVL+A+  L  GVS LL+  PV 
Sbjct  2    RSKSKI-DLKKLRPMILKRIEERAKEYPIKPMVPVAKEVLEARRVLIQGVSMLLKAFPVL  60

Query  27   ICKYCPEVY  1
             CK CPEV+
Sbjct  61   SCKSCPEVF  69



>emb|CAJ86368.1| OSIGBa0117N13.12 [Oryza sativa Indica Group]
 emb|CAJ86418.1| H0303G06.7 [Oryza sativa Indica Group]
Length=327

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 62/79 (78%), Gaps = 4/79 (5%)
 Frame = -2

Query  237  GTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGV  58
            G++M+  R Y ++   VD K+LRPMILKRI+NRAK+YP+K M+PVA EV+KA+  +  GV
Sbjct  18   GSVMNQ-RLYSSR---VDWKQLRPMILKRIKNRAKEYPIKRMIPVAEEVVKAREIVTKGV  73

Query  57   STLLQHLPVWICKYCPEVY  1
            STLLQ +P+  CK+CPEV+
Sbjct  74   STLLQVVPIHSCKFCPEVH  92



>ref|NP_001053956.1| Os04g0628000 [Oryza sativa Japonica Group]
 dbj|BAF15870.1| Os04g0628000 [Oryza sativa Japonica Group]
 gb|EAY95662.1| hypothetical protein OsI_17528 [Oryza sativa Indica Group]
 dbj|BAG89110.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61737.1| hypothetical protein OsJ_16258 [Oryza sativa Japonica Group]
Length=327

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 62/79 (78%), Gaps = 4/79 (5%)
 Frame = -2

Query  237  GTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGV  58
            G++M+  R Y ++   VD K+LRPMILKRI+NRAK+YP+K M+PVA EV+KA+  +  GV
Sbjct  18   GSVMNQ-RLYSSR---VDWKQLRPMILKRIKNRAKEYPIKRMIPVAEEVVKAREIVTKGV  73

Query  57   STLLQHLPVWICKYCPEVY  1
            STLLQ +P+  CK+CPEV+
Sbjct  74   STLLQVVPIHSCKFCPEVH  92



>ref|XP_008379620.1| PREDICTED: LOW QUALITY PROTEIN: APO protein 4, mitochondrial 
[Malus domestica]
Length=343

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = -2

Query  237  GTMMDG-CRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHG  61
            G +MD   R+YR+K   +DL+KL+PMI KRI+NRAKDYPV  MVPVA EVL ++  +  G
Sbjct  15   GKIMDNFARYYRSK---MDLRKLKPMIQKRIQNRAKDYPVPAMVPVAXEVLDSRRLVMQG  71

Query  60   VSTLLQHLPVWICKYCPEVY  1
            VSTLL+ +PV  CK+C EVY
Sbjct  72   VSTLLKMVPVLACKFCLEVY  91



>ref|XP_010248529.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010248539.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010248547.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010248556.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010248565.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010248574.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010248582.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
Length=347

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 65/95 (68%), Gaps = 4/95 (4%)
 Frame = -2

Query  285  MAWRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVP  106
            MAWRS+ +W          +   R Y +K   VD  KLRPMIL+RI++RAK+YPV+ MVP
Sbjct  1    MAWRSK-IWHHLLEDYNYHLTSSRSYSSK---VDWDKLRPMILERIKSRAKNYPVRGMVP  56

Query  105  VAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            VA EV++A+A L  G+S LL+ +PV  CK+CPEV+
Sbjct  57   VAYEVIRARARLIEGLSMLLKAIPVKACKFCPEVF  91



>ref|XP_003580603.1| PREDICTED: APO protein 4, mitochondrial [Brachypodium distachyon]
 ref|XP_010240466.1| PREDICTED: APO protein 4, mitochondrial [Brachypodium distachyon]
Length=332

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R Y ++   VD K+LRPMILKRI+NR+KDYP+K M+PVA EV++A+  L  GVSTLL+ +
Sbjct  24   RLYSSR---VDWKQLRPMILKRIKNRSKDYPIKRMIPVAEEVVRAREILTEGVSTLLRVV  80

Query  36   PVWICKYCPEVY  1
            PV  CK+CPE++
Sbjct  81   PVHSCKFCPEIH  92



>ref|XP_002885464.1| hypothetical protein ARALYDRAFT_318914 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61723.1| hypothetical protein ARALYDRAFT_318914 [Arabidopsis lyrata subsp. 
lyrata]
Length=337

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = -2

Query  279  WRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVA  100
            WR  ++WR      G+          K K+ DL+K+RPMIL+RIENRAKDYPVK++VPVA
Sbjct  4    WR-HKVWRNLSSFQGSCYSTTPSRTNKLKLDDLRKIRPMILRRIENRAKDYPVKEIVPVA  62

Query  99   REVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
             E+L A+  L   V+ LL+  PV  CK+C EV+
Sbjct  63   EEILIARKNLLSNVTALLKVFPVLTCKFCSEVF  95



>ref|NP_188811.2| APO protein 4 [Arabidopsis thaliana]
 sp|Q9LSZ0.2|APO4_ARATH RecName: Full=APO protein 4, mitochondrial; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAC42155.1| unknown protein [Arabidopsis thaliana]
 gb|ABF85786.1| At3g21740 [Arabidopsis thaliana]
 gb|AEE76547.1| APO protein 4 [Arabidopsis thaliana]
Length=337

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = -2

Query  279  WRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVA  100
            WR  +LWR+                 K K+ DL+KLRPMILKRIENRAKDYPVK++VPVA
Sbjct  4    WR-HKLWRKLSSFQRASYSTTSSRNNKLKLDDLRKLRPMILKRIENRAKDYPVKEIVPVA  62

Query  99   REVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
             E+L A+  L   ++ LL+  PV  CK+C EV+
Sbjct  63   EEILIARKNLISNIAALLKVFPVLTCKFCSEVF  95



>emb|CAE04242.3| OSJNBa0089N06.3 [Oryza sativa Japonica Group]
Length=580

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 62/79 (78%), Gaps = 4/79 (5%)
 Frame = -2

Query  237  GTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGV  58
            G++M+  R Y ++   VD K+LRPMILKRI+NRAK+YP+K M+PVA EV+KA+  +  GV
Sbjct  18   GSVMNQ-RLYSSR---VDWKQLRPMILKRIKNRAKEYPIKRMIPVAEEVVKAREIVTKGV  73

Query  57   STLLQHLPVWICKYCPEVY  1
            STLLQ +P+  CK+CPEV+
Sbjct  74   STLLQVVPIHSCKFCPEVH  92



>ref|XP_006652862.1| PREDICTED: APO protein 4, mitochondrial-like [Oryza brachyantha]
Length=327

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 4/79 (5%)
 Frame = -2

Query  237  GTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGV  58
            G++M+  R Y ++   VD K+LRPMILKRI+NRA+DYPVK M+PVA EV +A+  +  GV
Sbjct  18   GSVMNQ-RLYSSR---VDWKQLRPMILKRIKNRAQDYPVKRMIPVAEEVFEAREIVTRGV  73

Query  57   STLLQHLPVWICKYCPEVY  1
            S LLQ +PV  CK+CPEV+
Sbjct  74   SALLQVVPVHSCKFCPEVH  92



>ref|XP_002448571.1| hypothetical protein SORBIDRAFT_06g029350 [Sorghum bicolor]
 gb|EES12899.1| hypothetical protein SORBIDRAFT_06g029350 [Sorghum bicolor]
Length=328

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 65/93 (70%), Gaps = 8/93 (9%)
 Frame = -2

Query  264  LWRQGEIVL-----GTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVA  100
            LWR+    +     GT ++  R+  ++   VD K+LRPMILKRI+NR K+YP+K M+PVA
Sbjct  4    LWRRAGSYICSELCGTTLNQRRYSTSR---VDWKQLRPMILKRIKNRTKEYPIKRMIPVA  60

Query  99   REVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
             EV++A+  +Y GVS LL+ +PV  CK+CPEV+
Sbjct  61   EEVVRAREVVYEGVSRLLKVVPVQSCKFCPEVH  93



>dbj|BAB02836.1| unnamed protein product [Arabidopsis thaliana]
Length=429

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = -2

Query  279  WRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVA  100
            WR  +LWR+                 K K+ DL+KLRPMILKRIENRAKDYPVK++VPVA
Sbjct  96   WR-HKLWRKLSSFQRASYSTTSSRNNKLKLDDLRKLRPMILKRIENRAKDYPVKEIVPVA  154

Query  99   REVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
             E+L A+  L   ++ LL+  PV  CK+C EV+
Sbjct  155  EEILIARKNLISNIAALLKVFPVLTCKFCSEVF  187



>ref|XP_008237745.1| PREDICTED: APO protein 4, mitochondrial-like [Prunus mume]
Length=327

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  VDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHLPVWICKYCP  10
            +DL+KL+PMI KRI++RAKDYPV+ M+PVA+EVL ++  +  GVSTLL+ LPV  CK+CP
Sbjct  30   MDLRKLKPMIQKRIQDRAKDYPVQGMIPVAQEVLNSRRLIMQGVSTLLKVLPVMACKFCP  89

Query  9    EVY  1
            EVY
Sbjct  90   EVY  92



>ref|XP_010694573.1| PREDICTED: APO protein 4, mitochondrial [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010694581.1| PREDICTED: APO protein 4, mitochondrial [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010694588.1| PREDICTED: APO protein 4, mitochondrial [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010694595.1| PREDICTED: APO protein 4, mitochondrial [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010694599.1| PREDICTED: APO protein 4, mitochondrial [Beta vulgaris subsp. 
vulgaris]
Length=340

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 66/100 (66%), Gaps = 6/100 (6%)
 Frame = -2

Query  285  MAWRSQELWRQ---GEIVLGTMMD--GCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPV  121
            MA   Q  W +   G ++    +D  G R+Y +  KV D  KLRPMI +RIE RA+ YP+
Sbjct  1    MALFRQSNWYKILNGGLLANIEIDKLGTRWYASHKKV-DWDKLRPMIKQRIEKRARGYPI  59

Query  120  KDMVPVAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            + M+PVA E+L+A++ + HGVS LL+ LPV  CK+CPEV+
Sbjct  60   RSMIPVAEEILQARSIVIHGVSALLKMLPVVACKFCPEVH  99



>gb|EMT11106.1| hypothetical protein F775_07337 [Aegilops tauschii]
Length=332

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 56/72 (78%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R Y ++   VD K+LRPMILKRI+NR KDYP+K M+PVA+EV++A+  L  GVS LL+ +
Sbjct  24   RMYSSR---VDWKQLRPMILKRIKNRTKDYPIKRMIPVAQEVVRAREILTEGVSILLRAV  80

Query  36   PVWICKYCPEVY  1
            PV  CK+CPE++
Sbjct  81   PVQSCKFCPEIH  92



>ref|XP_008230090.1| PREDICTED: APO protein 4, mitochondrial [Prunus mume]
 ref|XP_008230091.1| PREDICTED: APO protein 4, mitochondrial [Prunus mume]
Length=330

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  VDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHLPVWICKYCP  10
            +DL+KL+PMI KRI+ RAKDYPV  M+PVA+EVL ++  L  GVSTLL+ LPV  CK+CP
Sbjct  38   MDLRKLKPMIQKRIQERAKDYPVPGMIPVAQEVLNSRRLLMQGVSTLLKVLPVMACKFCP  97

Query  9    EVY  1
            EVY
Sbjct  98   EVY  100



>ref|XP_007215688.1| hypothetical protein PRUPE_ppa008702mg [Prunus persica]
 gb|EMJ16887.1| hypothetical protein PRUPE_ppa008702mg [Prunus persica]
Length=322

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  VDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHLPVWICKYCP  10
            +DL+KL+PMI KRI+ RAKDYPV  M+PVA+EVL ++  L  GVSTLL+ LPV  CK+CP
Sbjct  30   MDLRKLKPMIQKRIQERAKDYPVPGMIPVAQEVLNSRRLLMQGVSTLLKVLPVMACKFCP  89

Query  9    EVY  1
            EVY
Sbjct  90   EVY  92



>dbj|BAK06104.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 56/72 (78%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R Y ++   VD K+LRPMILKRI+NR KDYP+K M+PVA+EV++A+  L  GVS LL+ +
Sbjct  24   RMYSSR---VDWKQLRPMILKRIKNRTKDYPIKRMIPVAQEVVRAREILTEGVSILLRAV  80

Query  36   PVWICKYCPEVY  1
            PV  CK+CPE++
Sbjct  81   PVHSCKFCPEIH  92



>ref|XP_010466431.1| PREDICTED: APO protein 4, mitochondrial [Camelina sativa]
Length=338

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = -2

Query  279  WRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVA  100
            WR  ++WR    + G           K K+  L+KLRPMIL+RIENRAKDYPVK++VPVA
Sbjct  4    WR-HKVWRNLSSIQGASYSTTPSRTNKLKLDALRKLRPMILRRIENRAKDYPVKEIVPVA  62

Query  99   REVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
             ++L A+  L   V+ LL+  PV  CK+C EV+
Sbjct  63   EDILIARKNLLSNVTALLKVFPVLTCKFCSEVF  95



>gb|KDP41156.1| hypothetical protein JCGZ_03650 [Jatropha curcas]
Length=303

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 58/80 (73%), Gaps = 4/80 (5%)
 Frame = -2

Query  240  LGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHG  61
             G  M+  +FY +K   VD KKLRPMILKR+ENRAK YP+++M+P+A+EVL  +  L  G
Sbjct  4    FGQTMN-LKFYSSK---VDWKKLRPMILKRVENRAKVYPIQEMLPLAQEVLGVRMLLIQG  59

Query  60   VSTLLQHLPVWICKYCPEVY  1
            +S L + +PV  CK+CPEVY
Sbjct  60   ISILTRVIPVVACKFCPEVY  79



>gb|EMS51284.1| hypothetical protein TRIUR3_05793 [Triticum urartu]
Length=332

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R Y ++   VD K+LRPMILKRI+NR KDYP+K M+PVA+EV++A+  L  GVS LL+ +
Sbjct  24   RMYSSR---VDWKQLRPMILKRIKNRTKDYPIKRMIPVAQEVVRAREILTEGVSILLRAV  80

Query  36   PVWICKYCPEVY  1
            PV  CK+CP ++
Sbjct  81   PVHSCKFCPAIH  92



>ref|XP_004976898.1| PREDICTED: APO protein 4, mitochondrial-like [Setaria italica]
Length=328

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  207  RTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHLPVW  28
            R     VD K+LRPMILKRI++R+K+YP+K M+PVA EV++A+  +  GVSTLL+ +PV 
Sbjct  25   RHSSSRVDWKQLRPMILKRIKSRSKEYPIKRMIPVAEEVMRAREIVTEGVSTLLKAVPVH  84

Query  27   ICKYCPEVY  1
             CK+CPEV+
Sbjct  85   SCKFCPEVH  93



>ref|XP_010510550.1| PREDICTED: APO protein 4, mitochondrial-like [Camelina sativa]
Length=338

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -2

Query  204  TKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHLPVWI  25
             K K+ DL+KLRPMILKRIENRAKDYPVK++VPVA ++L A+  L   V+ LL+  PV  
Sbjct  28   NKLKLDDLRKLRPMILKRIENRAKDYPVKEIVPVAEDILIARKNLISNVTALLKVFPVLT  87

Query  24   CKYCPEVY  1
            CK+C EV+
Sbjct  88   CKFCSEVF  95



>ref|XP_010488194.1| PREDICTED: APO protein 4, mitochondrial-like [Camelina sativa]
Length=338

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -2

Query  207  RTKP-KVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHLPV  31
            RTK  K+ DL+KLRPMILKRIENRAKDYPVK++VPVA ++L A+  L   V+ LL+  PV
Sbjct  26   RTKKLKLDDLRKLRPMILKRIENRAKDYPVKEIVPVAEDILIARKNLISNVTALLKVFPV  85

Query  30   WICKYCPEVY  1
              CK+C EV+
Sbjct  86   LTCKFCSEVF  95



>ref|XP_006836549.1| hypothetical protein AMTR_s00131p00039570 [Amborella trichopoda]
 gb|ERM99402.1| hypothetical protein AMTR_s00131p00039570 [Amborella trichopoda]
Length=373

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 56/72 (78%), Gaps = 3/72 (4%)
 Frame = -2

Query  216  RFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHL  37
            R Y++K    + +KLRPMIL+R+ +RAKDYPV++MVPVA +VLKA+  +  GVSTL++ +
Sbjct  23   RCYKSK---AEWQKLRPMILERLRSRAKDYPVRNMVPVANDVLKARGEVVDGVSTLIKFI  79

Query  36   PVWICKYCPEVY  1
            PV  CK+C EVY
Sbjct  80   PVKACKFCSEVY  91



>ref|XP_006406612.1| hypothetical protein EUTSA_v10021082mg [Eutrema salsugineum]
 ref|XP_006406613.1| hypothetical protein EUTSA_v10021082mg [Eutrema salsugineum]
 gb|ESQ48065.1| hypothetical protein EUTSA_v10021082mg [Eutrema salsugineum]
 gb|ESQ48066.1| hypothetical protein EUTSA_v10021082mg [Eutrema salsugineum]
Length=338

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = -2

Query  279  WRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVA  100
            WR  ++WR      G           K  + +L+K+RPMI +RIENRAKDYP+KD++PVA
Sbjct  4    WR-HKVWRHLSSFQGATYSTTPSRINKSMLNNLRKIRPMIHRRIENRAKDYPIKDIIPVA  62

Query  99   REVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            +++L+A+  L   V+ LL+  PV  CK+C EV+
Sbjct  63   QDILEARRNLLANVNVLLKVFPVLTCKFCSEVF  95



>gb|KFK39492.1| hypothetical protein AALP_AA3G251000 [Arabis alpina]
Length=341

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = -2

Query  303  LFTLVGMAWRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYP  124
            L  L    WR  +LW   +   G           K K  D +K+RPMIL+RIENR K+YP
Sbjct  3    LVNLAMANWR-HKLWSSFQ---GVSYSTTSSRINKSKFDDFRKIRPMILRRIENRGKEYP  58

Query  123  VKDMVPVAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            +KD+V VA E+LKA+  L   V+ LL+  PV  CK+C EV+
Sbjct  59   IKDIVSVAEEILKARHNLITNVTALLKVFPVLTCKFCSEVF  99



>ref|NP_001143703.1| hypothetical protein [Zea mays]
 gb|ACG34370.1| hypothetical protein [Zea mays]
 gb|ACN34039.1| unknown [Zea mays]
 tpg|DAA36166.1| TPA: hypothetical protein ZEAMMB73_204749 [Zea mays]
Length=328

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = -2

Query  237  GTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGV  58
            GT ++  R+  ++   VD K+LRPMILKRI+NR K+YP+K M+PVA EV++A+  +  GV
Sbjct  18   GTTLNQRRYSTSR---VDWKQLRPMILKRIKNRTKEYPIKSMIPVAEEVVRAREIVNEGV  74

Query  57   STLLQHLPVWICKYCPEVY  1
            S LL+ +PV  CK+C EV+
Sbjct  75   SRLLKVVPVQSCKFCHEVH  93



>emb|CDY38637.1| BnaA05g19500D [Brassica napus]
Length=331

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 62/99 (63%), Gaps = 13/99 (13%)
 Frame = -2

Query  279  WRSQELWRQGEIVLGTMMDGCRFYRTKPKVV------DLKKLRPMILKRIENRAKDYPVK  118
            WR  ++WR      G        Y T+P  +      DL+++RPMI +RIENRAKDYP++
Sbjct  4    WR-HKVWRHLSSFHGAS------YSTRPSRINKSMLNDLRRIRPMIQRRIENRAKDYPIQ  56

Query  117  DMVPVAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            ++VPVA+++LKA+  L   V+ LL+  PV  CK+C EV+
Sbjct  57   EIVPVAKDILKARQNLLTNVTVLLKAFPVLRCKFCSEVF  95



>ref|XP_009145455.1| PREDICTED: APO protein 4, mitochondrial [Brassica rapa]
Length=331

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 62/99 (63%), Gaps = 13/99 (13%)
 Frame = -2

Query  279  WRSQELWRQGEIVLGTMMDGCRFYRTKPKVV------DLKKLRPMILKRIENRAKDYPVK  118
            WR  ++WR      G        Y T+P  +      DL+++RPMI +RIENRAKDYP++
Sbjct  4    WR-HKVWRHLSSFHGAS------YSTRPSRINKTMLNDLRRIRPMIQRRIENRAKDYPIQ  56

Query  117  DMVPVAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            ++VPVA+++LKA+  L   V+ LL+  PV  CK+C EV+
Sbjct  57   EIVPVAKDILKARQNLLTNVTVLLKAFPVLRCKFCSEVF  95



>emb|CDY33138.1| BnaCnng07090D [Brassica napus]
Length=336

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = -2

Query  279  WRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVA  100
            WR +++WR      G           K  + DL+++RPMI +RIENRAKDYP++++VPVA
Sbjct  4    WR-RKVWRHWSSFHGASYSTRPSRINKSMLNDLRRIRPMIQRRIENRAKDYPIQEIVPVA  62

Query  99   REVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            +++LKA+  L   V+ LL+  PV  CK+C EV+
Sbjct  63   KDILKARQNLLTNVTVLLKAFPVLRCKFCSEVF  95



>ref|XP_002447052.1| hypothetical protein SORBIDRAFT_06g027590 [Sorghum bicolor]
 gb|EES11380.1| hypothetical protein SORBIDRAFT_06g027590 [Sorghum bicolor]
Length=328

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = -2

Query  237  GTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGV  58
            GT ++  R Y T    VD K+LRPMILKRI+ R+KDYP+K M+PVA EV++A+  +  GV
Sbjct  18   GTALNQ-RHYSTS--RVDWKQLRPMILKRIKKRSKDYPIKRMIPVAEEVVRAREIVNEGV  74

Query  57   STLLQHLPVWICKYCPEVY  1
            S LL+ +PV  CK+CPE +
Sbjct  75   SRLLKVVPVQSCKFCPEAH  93



>gb|AGT17276.1| hypothetical protein SHCRBa_020_L15_F_200 [Saccharum hybrid cultivar 
R570]
Length=328

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = -2

Query  249  EIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAAL  70
             ++ GT ++  R Y T    VD K+LRPMILKRI+ R+K+YP+K M+PVA EV++A+  +
Sbjct  14   SVLCGTALNQ-RHYSTS--RVDWKQLRPMILKRIKKRSKEYPIKRMIPVAEEVVRAREIV  70

Query  69   YHGVSTLLQHLPVWICKYCPEVY  1
              GVS LL+ +PV  CK+CPE +
Sbjct  71   NEGVSRLLKVVPVQSCKFCPEAH  93



>ref|XP_009353258.1| PREDICTED: LOW QUALITY PROTEIN: APO protein 4, mitochondrial 
[Pyrus x bretschneideri]
Length=333

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 4/80 (5%)
 Frame = -2

Query  237  GTMMDG-CRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHG  61
            G +MD   R+Y +K   + L+KL+PMI KRI+NRAKDYPV  MVPVA+EVL     +  G
Sbjct  15   GKIMDCLARYYSSK---MGLRKLKPMIQKRIQNRAKDYPVPAMVPVAQEVLDTGRLVMQG  71

Query  60   VSTLLQHLPVWICKYCPEVY  1
            VSTLL+ + +  CK CPEVY
Sbjct  72   VSTLLKMVRLLACKLCPEVY  91



>ref|XP_010089336.1| APO protein 4 [Morus notabilis]
 gb|EXB37661.1| APO protein 4 [Morus notabilis]
Length=347

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -2

Query  174  LRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHLPVWICKYCPEVY  1
            LR M+ KRI+ RA D+P+  ++PVA EVL+++  L+HGVSTLL+  PV  CK+CPEVY
Sbjct  46   LRSMLQKRIQRRANDFPIMALIPVAEEVLRSRKILFHGVSTLLKFFPVLACKFCPEVY  103



>tpg|DAA36167.1| TPA: hypothetical protein ZEAMMB73_204749 [Zea mays]
Length=82

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = -2

Query  237  GTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGV  58
            GT ++  R+  ++   VD K+LRPMILKRI+NR K+YP+K M+PVA EV++A+  +  GV
Sbjct  18   GTTLNQRRYSTSR---VDWKQLRPMILKRIKNRTKEYPIKSMIPVAEEVVRAREIVNEGV  74

Query  57   STLLQHLP  34
            S LL+ L 
Sbjct  75   SRLLKVLS  82



>ref|XP_007199896.1| hypothetical protein PRUPE_ppa007230mg [Prunus persica]
 gb|EMJ01095.1| hypothetical protein PRUPE_ppa007230mg [Prunus persica]
Length=377

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 7/63 (11%)
 Frame = -2

Query  189  VDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHLPVWICKYCP  10
            +DL+KL+PMI KRI++RAKDYPV  M+PVA+EVL ++  +  GVSTLL+        +CP
Sbjct  30   MDLRKLKPMIQKRIQDRAKDYPVLGMIPVAQEVLNSRRLIMQGVSTLLK-------VFCP  82

Query  9    EVY  1
            EVY
Sbjct  83   EVY  85



>ref|XP_006296587.1| hypothetical protein CARUB_v100143370mg, partial [Capsella rubella]
 gb|EOA29485.1| hypothetical protein CARUB_v100143370mg, partial [Capsella rubella]
Length=69

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = -2

Query  279  WRSQELWRQGEIVLGTMMDGCRFYRTKPKVVDLKKLRPMILKRIENRAKDYPVKDMVPVA  100
            WR  ++WR    + G           K K+ DL+K+RPMIL+RIENRAKDYPVK++VPVA
Sbjct  4    WR-HKVWRNLSSIQGASYSTTPSRTNKLKLDDLRKIRPMILRRIENRAKDYPVKEIVPVA  62

Query  99   REVLKAK  79
             +VL A+
Sbjct  63   EDVLIAR  69



>ref|XP_010532481.1| PREDICTED: APO protein 4, mitochondrial [Tarenaya hassleriana]
 ref|XP_010532482.1| PREDICTED: APO protein 4, mitochondrial [Tarenaya hassleriana]
 ref|XP_010532483.1| PREDICTED: APO protein 4, mitochondrial [Tarenaya hassleriana]
Length=300

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  VDLKKLRPMILKRIENRAKDYPVKDMVPVAREVLKAKAALYHGVSTLLQHLPVWICKYCP  10
            +DL+ L  MI KRIE + KD+P+  M+PVA++VL+A+  L  GVS LL+  PV  CK CP
Sbjct  6    IDLRILGTMIRKRIEEQRKDHPILHMIPVAKKVLEARRVLIQGVSLLLKVFPVLACKSCP  65

Query  9    EVY  1
            EV+
Sbjct  66   EVF  68



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506499748756