BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22754_g1_i2 len=4269 path=[535:0-143 678:144-241 775:242-245
@534@!:246-2418 @475@!:2419-3123 3654:3124-4268]

Length=4269
                                                                      Score     E

ref|XP_009800493.1|  PREDICTED: DNA repair protein rhp26               1628   0.0     
ref|XP_009608324.1|  PREDICTED: DNA repair protein rhp26               1611   0.0     
ref|XP_006351663.1|  PREDICTED: DNA repair protein rhp26-like          1609   0.0     
ref|XP_004247239.1|  PREDICTED: protein CHROMATIN REMODELING 8         1593   0.0     
ref|XP_011083038.1|  PREDICTED: protein CHROMATIN REMODELING 8         1580   0.0     
ref|XP_010262355.1|  PREDICTED: protein CHROMATIN REMODELING 8 is...   1546   0.0     
ref|XP_010262354.1|  PREDICTED: protein CHROMATIN REMODELING 8 is...   1546   0.0     
gb|KHG13918.1|  DNA repair rhp26                                       1521   0.0     
gb|KDP26514.1|  hypothetical protein JCGZ_17672                        1514   0.0     
ref|XP_007050253.1|  DNA excision repair protein E                     1511   0.0     
ref|XP_010101407.1|  DNA repair and recombination protein RAD26        1506   0.0     
ref|XP_010262353.1|  PREDICTED: protein CHROMATIN REMODELING 8 is...   1497   0.0     
ref|XP_006443810.1|  hypothetical protein CICLE_v10018548mg            1497   0.0     
ref|XP_010262352.1|  PREDICTED: protein CHROMATIN REMODELING 8 is...   1497   0.0     
ref|XP_010262356.1|  PREDICTED: protein CHROMATIN REMODELING 8 is...   1496   0.0     
ref|XP_006479510.1|  PREDICTED: DNA repair and recombination prot...   1496   0.0     
emb|CDP03758.1|  unnamed protein product                               1495   0.0     
gb|KDO60453.1|  hypothetical protein CISIN_1g0447982mg                 1492   0.0     
gb|EYU17927.1|  hypothetical protein MIMGU_mgv1a000355mg               1491   0.0     
ref|XP_002272543.1|  PREDICTED: protein CHROMATIN REMODELING 8         1491   0.0     Vitis vinifera
ref|XP_008235652.1|  PREDICTED: DNA repair protein rhp26               1488   0.0     
emb|CAN67815.1|  hypothetical protein VITISV_002502                    1478   0.0     Vitis vinifera
ref|XP_004289961.1|  PREDICTED: DNA excision repair protein ERCC-...   1476   0.0     
ref|XP_002529848.1|  DNA repair and recombination protein RAD26, ...   1474   0.0     Ricinus communis
ref|XP_007199683.1|  hypothetical protein PRUPE_ppa000387mg            1472   0.0     
ref|XP_009336130.1|  PREDICTED: DNA repair protein rhp26               1465   0.0     
ref|XP_008372358.1|  PREDICTED: DNA repair protein rhp26               1462   0.0     
ref|XP_006594029.1|  PREDICTED: DNA repair and recombination prot...   1459   0.0     
ref|XP_002307656.2|  hypothetical protein POPTR_0005s24820g            1447   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010679320.1|  PREDICTED: protein CHROMATIN REMODELING 8         1443   0.0     
ref|XP_011004030.1|  PREDICTED: protein CHROMATIN REMODELING 8         1442   0.0     
gb|KHN48923.1|  DNA repair and recombination protein RAD26             1441   0.0     
ref|XP_007144880.1|  hypothetical protein PHAVU_007G191600g            1439   0.0     
gb|KEH42504.1|  DNA repair and recombination protein RAD26             1416   0.0     
ref|XP_004495082.1|  PREDICTED: DNA repair protein rhp26-like          1415   0.0     
ref|XP_010929630.1|  PREDICTED: protein CHROMATIN REMODELING 8 is...   1408   0.0     
ref|XP_008447405.1|  PREDICTED: DNA repair protein rhp26 isoform X1    1407   0.0     
ref|XP_004151991.1|  PREDICTED: DNA repair protein rhp26-like          1403   0.0     
ref|XP_010526496.1|  PREDICTED: protein CHROMATIN REMODELING 8         1399   0.0     
ref|XP_010037970.1|  PREDICTED: DNA repair protein rhp26               1384   0.0     
gb|KCW49760.1|  hypothetical protein EUGRSUZ_K03253                    1383   0.0     
ref|XP_008791071.1|  PREDICTED: DNA repair protein rhp26 isoform X1    1380   0.0     
ref|NP_179466.1|  chromatin remodeling 8                               1373   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004967914.1|  PREDICTED: DNA repair protein rhp26-like iso...   1364   0.0     
ref|XP_002457538.1|  hypothetical protein SORBIDRAFT_03g009030         1363   0.0     Sorghum bicolor [broomcorn]
ref|XP_009137797.1|  PREDICTED: DNA repair protein rhp26               1361   0.0     
emb|CDY51705.1|  BnaA03g58950D                                         1361   0.0     
ref|XP_006299332.1|  hypothetical protein CARUB_v10015488mg            1360   0.0     
ref|XP_004967913.1|  PREDICTED: DNA repair protein rhp26-like iso...   1357   0.0     
ref|XP_002886265.1|  predicted protein                                 1357   0.0     
ref|XP_008673826.1|  PREDICTED: DNA repair protein rhp26               1353   0.0     
ref|XP_009386580.1|  PREDICTED: DNA repair protein rhp26               1349   0.0     
ref|XP_010929631.1|  PREDICTED: protein CHROMATIN REMODELING 8 is...   1347   0.0     
ref|XP_010929632.1|  PREDICTED: protein CHROMATIN REMODELING 8 is...   1346   0.0     
ref|XP_010467713.1|  PREDICTED: protein CHROMATIN REMODELING 8-li...   1345   0.0     
ref|XP_010489593.1|  PREDICTED: protein CHROMATIN REMODELING 8 is...   1345   0.0     
ref|XP_010467716.1|  PREDICTED: protein CHROMATIN REMODELING 8-li...   1345   0.0     
ref|XP_010230474.1|  PREDICTED: protein CHROMATIN REMODELING 8         1343   0.0     
gb|EMS54331.1|  DNA repair and recombination protein RAD26             1338   0.0     
ref|XP_006643635.1|  PREDICTED: DNA repair protein rhp26-like          1336   0.0     
emb|CDX92882.1|  BnaC07g41400D                                         1335   0.0     
ref|NP_001041752.1|  Os01g0102800                                      1334   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EEC69769.1|  hypothetical protein OsI_00025                         1333   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_006409113.1|  hypothetical protein EUTSA_v10022523mg            1330   0.0     
ref|XP_006857326.1|  hypothetical protein AMTR_s00067p00081580         1329   0.0     
ref|XP_008447410.1|  PREDICTED: DNA repair protein rhp26 isoform X3    1328   0.0     
dbj|BAJ88557.1|  predicted protein                                     1326   0.0     
ref|XP_008447409.1|  PREDICTED: DNA repair protein rhp26 isoform X2    1326   0.0     
ref|XP_008791073.1|  PREDICTED: DNA repair protein rhp26 isoform X2    1320   0.0     
ref|XP_008791074.1|  PREDICTED: DNA repair protein rhp26 isoform X3    1319   0.0     
emb|CBI37137.3|  unnamed protein product                               1312   0.0     
gb|EMT18739.1|  DNA repair and recombination protein RAD26             1309   0.0     
gb|EPS63882.1|  chromatin remodeling complex subunit                   1283   0.0     
ref|XP_010489595.1|  PREDICTED: protein CHROMATIN REMODELING 8 is...   1262   0.0     
ref|XP_006443809.1|  hypothetical protein CICLE_v10018548mg            1238   0.0     
dbj|BAD45511.1|  putative RAD26                                        1117   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006479511.1|  PREDICTED: DNA repair and recombination prot...   1040   0.0     
ref|XP_002994066.1|  hypothetical protein SELMODRAFT_236903            1015   0.0     
ref|XP_002989066.1|  hypothetical protein SELMODRAFT_450679            1015   0.0     
gb|KGN57893.1|  hypothetical protein Csa_3G375720                       989   0.0     
ref|XP_001764202.1|  transcription-coupled repair protein CSB/RAD26     962   0.0     
ref|XP_003075208.1|  Cockayne syndrome group B (ISS)                    815   0.0     
emb|CEG01136.1|  SNF2-related                                           815   0.0     
gb|KHN05865.1|  DNA repair and recombination protein RAD26              722   0.0     
emb|CEG71759.1|  hypothetical protein RMATCC62417_07439                 738   0.0     
emb|CEG84102.1|  Putative YALI0C16643p                                  729   0.0     
ref|XP_005706328.1|  chromatin remodeling complex / DNA-dep ATPase      724   0.0     
ref|XP_003057492.1|  ran-binding dexh-box helicase                      743   0.0     
emb|CEG71760.1|  hypothetical protein RMATCC62417_07439                 728   0.0     
ref|XP_007514075.1|  DNA repair and recombination protein RAD26         724   0.0     
ref|XP_501912.1|  YALI0C16643p                                          718   0.0     Yarrowia lipolytica CLIB122
ref|XP_005652138.1|  hypothetical protein COCSUDRAFT_34894              699   0.0     
gb|EIE87512.1|  hypothetical protein RO3G_12223                         697   0.0     
gb|EFA85198.1|  SNF2-related domain-containing protein                  715   0.0     Heterostelium album PN500
ref|XP_007872223.1|  hypothetical protein PNEG_00350                    702   0.0     
dbj|GAM27604.1|  hypothetical protein SAMD00019534_107800               707   0.0     
emb|CCE45191.1|  hypothetical protein CPAR2_702030                      691   0.0     
ref|XP_002502040.1|  predicted protein                                  704   0.0     Micromonas commoda
ref|XP_002491552.1|  Protein involved in transcription-coupled re...    690   0.0     Komagataella phaffii GS115
ref|XP_003871023.1|  Rad26 protein                                      686   0.0     
ref|XP_459783.2|  DEHA2E10934p                                          689   0.0     Debaryomyces hansenii CBS767
ref|XP_002422295.1|  ATP-dependent helicase, putative; DNA repair...    684   0.0     Candida dubliniensis CD36
ref|XP_004202990.1|  Piso0_001862                                       686   0.0     
gb|EMG50087.1|  hypothetical protein G210_4903                          679   0.0     
emb|CDS07037.1|  hypothetical protein LRAMOSA09560                      681   0.0     
gb|KGU01780.1|  DNA excision repair protein ERCC-6                      678   0.0     
gb|KGR01163.1|  DNA excision repair protein ERCC-6                      678   0.0     
gb|KHC43820.1|  DNA excision repair protein ERCC-6                      678   0.0     
gb|KHC44495.1|  DNA excision repair protein ERCC-6                      678   0.0     
gb|KGT63062.1|  DNA excision repair protein ERCC-6                      678   0.0     
ref|XP_714234.1|  hypothetical protein CaO19.607                        678   0.0     Candida albicans SC5314
gb|KGQ82092.1|  DNA excision repair protein ERCC-6                      678   0.0     
gb|KGQ80968.1|  DNA excision repair protein ERCC-6                      678   0.0     
gb|KGR05680.1|  DNA excision repair protein ERCC-6                      678   0.0     
gb|KGU01022.1|  DNA excision repair protein ERCC-6                      678   0.0     
ref|XP_714194.1|  hypothetical protein CaO19.8240                       677   0.0     Candida albicans SC5314
ref|XP_004202370.1|  Piso0_001862                                       679   0.0     
ref|XP_002548373.1|  conserved hypothetical protein                     677   0.0     Candida tropicalis MYA-3404
gb|KFM24571.1|  DNA repair protein rhp26                                666   0.0     
gb|KGO69543.1|  Helicase, C-terminal                                    678   0.0     
ref|XP_001383607.2|  DNA dependent ATPase                               676   0.0     Scheffersomyces stipitis CBS 6054
gb|EKV16005.1|  DNA repair protein Rhp26/Rad26, putative                677   0.0     
ref|XP_003067838.1|  SNF2 family N-terminal domain containing pro...    679   0.0     
emb|CDH16567.1|  probable DNA repair and recombination protein RAD26    674   0.0     
gb|EFW16014.1|  DNA repair and recombination protein RAD26              678   0.0     
ref|XP_007729735.1|  DNA excision repair protein ERCC-6                 678   0.0     
gb|KEY81873.1|  DNA repair protein Rhp26/Rad26                          678   0.0     
ref|XP_746571.1|  DNA repair protein Rhp26/Rad26                        678   0.0     Aspergillus fumigatus Af293
dbj|GAM43350.1|  protein involved in transcription-coupled repair       676   0.0     
gb|EWG87973.1|  Rad26p                                                  674   0.0     
gb|EDZ71203.1|  YJR035Wp-like protein                                   672   0.0     Saccharomyces cerevisiae AWRI1631
ref|NP_012569.1|  DNA-dependent ATPase RAD26                            674   0.0     Saccharomyces cerevisiae S288C
gb|EIW09557.1|  Rad26p                                                  673   0.0     
gb|EEU05949.1|  Rad26p                                                  673   0.0     Saccharomyces cerevisiae JAY291
gb|EDN63356.1|  DNA dependent ATPase                                    673   0.0     Saccharomyces cerevisiae YJM789
gb|EDV12779.1|  DNA dependent ATPase                                    673   0.0     Saccharomyces cerevisiae RM11-1a
ref|XP_007723422.1|  DNA excision repair protein ERCC-6                 676   0.0     
gb|EPS30715.1|  hypothetical protein PDE_05667                          675   0.0     
dbj|GAA24384.1|  K7_Rad26p                                              672   0.0     
gb|KGO44998.1|  Helicase, C-terminal                                    674   0.0     
emb|CAA57290.1|  RAD26                                                  672   0.0     Saccharomyces cerevisiae [brewer's yeast]
gb|KGO47105.1|  Helicase, C-terminal                                    673   0.0     
ref|XP_007373433.1|  hypothetical protein SPAPADRAFT_133417             671   0.0     
ref|XP_664707.1|  hypothetical protein AN7103.2                         675   0.0     Aspergillus nidulans FGSC A4
ref|XP_001240720.1|  hypothetical protein CIMG_07883                    675   0.0     Coccidioides immitis RS
ref|XP_002542686.1|  hypothetical protein UREG_02202                    675   0.0     Uncinocarpus reesii 1704
gb|EYE91379.1|  DNA repair protein Rhp26/Rad26                          675   0.0     
ref|NP_588091.1|  SNF2 family helicase Rhp26                            667   0.0     Schizosaccharomyces pombe
ref|XP_007757868.1|  DNA excision repair protein ERCC-6                 674   0.0     
ref|XP_001274839.1|  DNA repair protein Rhp26/Rad26, putative           675   0.0     Aspergillus clavatus NRRL 1
ref|XP_002559134.1|  Pc13g07020                                         671   0.0     Penicillium rubens Wisconsin 54-1255
gb|EAS29452.2|  DNA repair and recombination protein RAD26              674   0.0     
ref|XP_006676526.1|  hypothetical protein BATDEDRAFT_9561               664   0.0     
gb|EHN06219.1|  Rad26p                                                  670   0.0     
ref|XP_001643913.1|  hypothetical protein Kpol_1067p28                  669   0.0     Vanderwaltozyma polyspora DSM 70294
ref|XP_002618591.1|  hypothetical protein CLUG_02050                    673   0.0     Clavispora lusitaniae ATCC 42720
emb|CCG84055.1|  protein of unknown function                            672   0.0     
gb|EGA82189.1|  Rad26p                                                  669   0.0     
gb|EPY50589.1|  SNF2 family helicase Rhp26                              666   0.0     
emb|CAY80752.1|  Rad26p                                                 669   0.0     Saccharomyces cerevisiae EC1118
gb|EPX70945.1|  SNF2 family helicase Rhp26                              665   0.0     
ref|XP_003169974.1|  DNA repair and recombination protein RAD26         673   0.0     
gb|ESZ99345.1|  putative DNA repair and recombination protein RAD26     672   0.0     
ref|XP_007919986.1|  hypothetical protein MYCFIDRAFT_46188              672   0.0     
ref|XP_001262421.1|  DNA repair protein Rhp26/Rad26, putative           672   0.0     Aspergillus fischeri NRRL 181
emb|CDM26849.1|  DNA repair and recombination protein RAD26             668   0.0     
ref|XP_008729393.1|  hypothetical protein G647_06852                    670   0.0     
ref|XP_009160484.1|  DNA excision repair protein ERCC-6                 670   0.0     
ref|XP_002556477.1|  KLTH0H14300p                                       663   0.0     Lachancea thermotolerans CBS 6340
gb|KFX51723.1|  DNA repair and recombination protein RAD26              667   0.0     
ref|XP_003679873.1|  hypothetical protein TDEL_0B05330                  664   0.0     
ref|XP_002148405.1|  DNA repair protein Rhp26/Rad26, putative           667   0.0     Talaromyces marneffei ATCC 18224
ref|XP_003855543.1|  SNF2 family DNA repair and recombination pro...    668   0.0     
ref|XP_007787806.1|  hypothetical protein EPUS_03186                    668   0.0     
ref|XP_007751653.1|  DNA excision repair protein ERCC-6                 667   0.0     
ref|XP_003236151.1|  DNA repair protein Rhp26/Rad26                     667   0.0     
ref|XP_001211380.1|  hypothetical protein ATEG_02202                    665   0.0     Aspergillus terreus NIH2624
gb|EMR85305.1|  putative dna repair protein rhp26 protein               664   0.0     
ref|XP_007679886.1|  hypothetical protein BAUCODRAFT_42604              664   0.0     
ref|XP_447327.1|  hypothetical protein                                  660   0.0     [Candida] glabrata CBS 138
emb|CCD51337.1|  similar to DNA repair protein Rhp26/Rad26              664   0.0     
emb|CDF90213.1|  ZYBA0S06-03334g1_1                                     658   0.0     
gb|EZF36106.1|  hypothetical protein H101_00388                         663   0.0     
emb|CCJ28090.1|  unnamed protein product                                652   0.0     
ref|XP_002482676.1|  DNA repair protein Rhp26/Rad26, putative           663   0.0     Talaromyces stipitatus ATCC 10500
emb|CDK25202.1|  unnamed protein product                                659   0.0     
ref|XP_003288733.1|  hypothetical protein DICPUDRAFT_153008             672   0.0     
gb|EGD95238.1|  DNA repair and recombination protein RAD26              663   0.0     
dbj|GAD94405.1|  DNA repair protein Rhp26/Rad26                         662   0.0     
ref|XP_003018145.1|  hypothetical protein TRV_07841                     662   0.0     
emb|CEI92616.1|  hypothetical protein RMCBS344292_06870                 641   0.0     
ref|XP_002175235.1|  SNF2 family helicase Rhp26                         654   0.0     Schizosaccharomyces japonicus yFS275
gb|EMF11036.1|  SNF2_N-domain-containing protein                        663   0.0     
ref|XP_002946233.1|  hypothetical protein VOLCADRAFT_120230             672   0.0     
ref|XP_002669658.1|  DEAD/DEAH box helicase                             655   0.0     Naegleria gruberi strain NEG-M
emb|CDH11563.1|  probable DNA repair and recombination protein RAD26    655   0.0     
ref|XP_001536381.1|  DNA repair and recombination protein RAD26         663   0.0     Histoplasma capsulatum NAm1
gb|AGO12295.1|  AaceriAEL065Cp                                          654   0.0     
ref|XP_003016834.1|  hypothetical protein ARB_05127                     660   0.0     
ref|XP_003644419.1|  hypothetical protein Ecym_1369                     654   0.0     
ref|XP_002499080.1|  ZYRO0E03190p                                       655   0.0     Zygosaccharomyces rouxii CBS 732
gb|EDK39551.2|  hypothetical protein PGUG_03649                         656   0.0     Meyerozyma guilliermondii
ref|XP_004336014.1|  SNF2 family Nterminal domain containing protein    661   0.0     
ref|XP_001484268.1|  hypothetical protein PGUG_03649                    655   0.0     Meyerozyma guilliermondii ATCC 6260
ref|XP_001523570.1|  DNA repair and recombination protein RAD26         656   0.0     Lodderomyces elongisporus NRRL YB-4239
emb|CEI91751.1|  hypothetical protein RMCBS344292_06032                 647   0.0     
ref|NP_984796.2|  AEL065Cp                                              652   0.0     Eremothecium gossypii ATCC 10895
gb|ESX01880.1|  DNA excision repair protein ERCC-6                      650   0.0     
ref|XP_001598010.1|  hypothetical protein SS1G_00096                    654   0.0     Sclerotinia sclerotiorum 1980 UF-70
gb|KFH66590.1|  hypothetical protein MVEG_07115                         657   0.0     
ref|XP_002791752.1|  DNA repair and recombination protein RAD26         655   0.0     Paracoccidioides lutzii Pb01
ref|XP_640679.1|  SNF2-related domain-containing protein                665   0.0     Dictyostelium discoideum AX4
emb|CCK71833.1|  hypothetical protein KNAG_0I00420                      649   0.0     
ref|XP_003980143.1|  hypothetical protein NDAI_0G04840                  648   0.0     
ref|XP_001400735.2|  DNA repair protein Rhp26/Rad26                     652   0.0     Aspergillus niger CBS 513.88
gb|KEF59697.1|  DNA excision repair protein ERCC-6                      651   0.0     
gb|EEH20648.1|  hypothetical protein PABG_02879                         651   0.0     Paracoccidioides brasiliensis Pb03
ref|XP_003843573.1|  similar to DNA repair protein Rhp26/Rad26          651   0.0     
ref|XP_003655891.1|  hypothetical protein THITE_2120135                 647   0.0     
ref|XP_003673777.1|  hypothetical protein NCAS_0A08380                  645   0.0     
ref|XP_002847054.1|  DNA repair and recombination protein RAD26         649   0.0     Microsporum canis CBS 113480
gb|EEH03967.1|  DNA dependent ATPase                                    650   0.0     Histoplasma capsulatum G186AR
gb|EIT82758.1|  transcription-coupled repair protein CSB/RAD26          648   0.0     
gb|EHA27605.1|  hypothetical protein ASPNIDRAFT_184433                  647   0.0     
emb|CAK46446.1|  unnamed protein product                                649   0.0     Aspergillus niger CBS 513.88
ref|XP_001825991.2|  DNA repair protein Rhp26/Rad26                     647   0.0     Aspergillus oryzae RIB40
ref|XP_010757434.1|  hypothetical protein PADG_01391                    648   0.0     
ref|XP_002377637.1|  DNA repair protein Rhp26/Rad26, putative           643   0.0     Aspergillus flavus NRRL3357
gb|KEQ88996.1|  hypothetical protein M438DRAFT_342516                   649   0.0     
ref|XP_008714463.1|  hypothetical protein HMPREF1541_01885              646   0.0     
dbj|BAE64858.1|  unnamed protein product                                636   0.0     Aspergillus oryzae
ref|XP_005714998.1|  unnamed protein product                            626   0.0     
gb|EPZ33654.1|  Helicase, superfamily 1/2, ATP-binding domain-con...    634   0.0     
gb|KEQ65921.1|  hypothetical protein M437DRAFT_40897                    644   0.0     
ref|XP_454975.1|  hypothetical protein                                  637   0.0     Kluyveromyces lactis NRRL Y-1140
gb|EGE09461.1|  DNA repair and recombination protein RAD26              635   0.0     
ref|XP_003303771.1|  hypothetical protein PTT_16121                     642   0.0     
dbj|BAO38347.1|  DNA repair and recombination protein RAD26             635   0.0     
dbj|BAP69907.1|  DNA repair and recombination protein RAD26             635   0.0     
gb|KHJ33195.1|  putative dna repair protein rhp26 rad26                 639   0.0     
ref|XP_006686459.1|  hypothetical protein CANTEDRAFT_122352             633   0.0     
gb|KEQ69942.1|  hypothetical protein M436DRAFT_54827                    640   0.0     
ref|XP_007291538.1|  DNA repair protein rhp26                           638   0.0     
gb|EME41736.1|  hypothetical protein DOTSEDRAFT_73948                   640   0.0     
ref|XP_002155441.2|  PREDICTED: DNA excision repair protein ERCC-...    631   0.0     
ref|XP_008029689.1|  hypothetical protein SETTUDRAFT_140809             637   0.0     
ref|XP_002620434.1|  DNA repair and recombination protein RAD26         638   0.0     Blastomyces gilchristii SLH14081
ref|XP_001938770.1|  DNA repair and recombination protein RAD26         638   0.0     Pyrenophora tritici-repentis Pt-1C-BFP
gb|ELU03433.1|  hypothetical protein CAPTEDRAFT_20149                   622   0.0     
gb|KGK37494.1|  hypothetical protein JL09_g3350                         635   0.0     
gb|ERS97327.1|  hypothetical protein HMPREF1624_06659                   637   0.0     
gb|KEQ90401.1|  hypothetical protein AUEXF2481DRAFT_71438               636   0.0     
gb|EEQ92014.1|  DNA repair and recombination protein RAD26              636   0.0     Blastomyces dermatitidis ER-3
ref|XP_007703389.1|  hypothetical protein COCSADRAFT_124441             635   0.0     
ref|XP_001908514.1|  hypothetical protein                               634   0.0     Podospora anserina S mat+
gb|EMD89287.1|  hypothetical protein COCHEDRAFT_1180734                 635   0.0     
ref|XP_007684244.1|  hypothetical protein COCMIDRAFT_85184              635   0.0     
gb|EPE06897.1|  dna repair and recombination protein rad26              634   0.0     
ref|XP_007714607.1|  hypothetical protein COCCADRAFT_102197             634   0.0     
gb|KIH90496.1|  DNA excision repair protein ERCC-6                      635   0.0     
ref|XP_003957866.1|  hypothetical protein KAFR_0F01350                  629   0.0     
emb|CBJ29096.1|  SNF2 family protein                                    635   0.0     
ref|XP_003684506.1|  hypothetical protein TPHA_0B04000                  629   0.0     
gb|EUN25506.1|  hypothetical protein COCVIDRAFT_103407                  633   0.0     
emb|CDO95114.1|  unnamed protein product                                627   0.0     
ref|XP_007914603.1|  putative dna repair and recombination protei...    631   0.0     
gb|KFY44417.1|  hypothetical protein V495_03474                         632   0.0     
ref|XP_007583623.1|  putative dna repair and recombination protei...    633   0.0     
ref|XP_009075454.1|  PREDICTED: DNA excision repair protein ERCC-...    639   0.0     
emb|CCA14266.1|  hypothetical protein SORBIDRAFT_03g009030              622   0.0     
emb|CCI40583.1|  unnamed protein product                                621   0.0     
dbj|GAA87171.1|  DNA repair protein Rhp26/Rad26                         630   0.0     
gb|KFX99402.1|  hypothetical protein O988_03881                         631   0.0     
gb|EKG19957.1|  SNF2-related protein                                    631   0.0     
ref|XP_005481307.1|  PREDICTED: DNA excision repair protein ERCC-6      637   0.0     
ref|XP_008928068.1|  PREDICTED: DNA excision repair protein ERCC-6      637   0.0     
gb|KFX90429.1|  hypothetical protein V490_06465                         629   0.0     
ref|XP_005048418.1|  PREDICTED: DNA excision repair protein ERCC-...    635   0.0     
gb|KFP82644.1|  DNA excision repair protein ERCC-6                      636   0.0     
ref|XP_008869867.1|  hypothetical protein H310_06536                    615   0.0     
ref|XP_005416531.1|  PREDICTED: DNA excision repair protein ERCC-6      635   0.0     
ref|XP_008083837.1|  P-loop containing nucleoside triphosphate hy...    627   0.0     
ref|XP_688972.2|  PREDICTED: DNA excision repair protein ERCC-6         632   0.0     
ref|XP_008642001.1|  PREDICTED: DNA excision repair protein ERCC-6      635   0.0     
ref|XP_005048417.1|  PREDICTED: DNA excision repair protein ERCC-...    635   0.0     
ref|XP_002188227.1|  PREDICTED: DNA excision repair protein ERCC-6      634   0.0     
ref|XP_010409299.1|  PREDICTED: DNA excision repair protein ERCC-6      634   0.0     
ref|XP_009876532.1|  PREDICTED: DNA excision repair protein ERCC-6      621   0.0     
ref|XP_009085572.1|  PREDICTED: DNA excision repair protein ERCC-6      634   0.0     
gb|KFW85930.1|  DNA excision repair protein ERCC-6                      634   0.0     
gb|KFY34594.1|  hypothetical protein V494_06637                         626   0.0     
ref|XP_010561771.1|  PREDICTED: DNA excision repair protein ERCC-...    627   0.0     
ref|XP_001508174.2|  PREDICTED: DNA excision repair protein ERCC-6      615   0.0     
ref|XP_009910315.1|  PREDICTED: DNA excision repair protein ERCC-...    627   0.0     
ref|XP_005433789.1|  PREDICTED: DNA excision repair protein ERCC-6      633   0.0     
ref|XP_009814108.1|  PREDICTED: DNA excision repair protein ERCC-...    630   0.0     
ref|XP_005238967.1|  PREDICTED: DNA excision repair protein ERCC-6      632   0.0     
gb|KFY08500.1|  hypothetical protein V492_06174                         625   0.0     
gb|KFO54269.1|  DNA excision repair protein ERCC-6                      632   0.0     
ref|XP_009896017.1|  PREDICTED: DNA excision repair protein ERCC-6      631   0.0     
gb|KFP73338.1|  DNA excision repair protein ERCC-6                      618   0.0     
ref|XP_003738014.1|  PREDICTED: DNA excision repair protein ERCC-...    623   0.0     
ref|XP_007478683.1|  PREDICTED: DNA excision repair protein ERCC-...    624   0.0     
gb|EPB88004.1|  hypothetical protein HMPREF1544_05182                   622   0.0     
ref|XP_007799454.1|  putative dna repair and recombination protei...    622   0.0     
ref|XP_005520649.1|  PREDICTED: DNA excision repair protein ERCC-6      629   0.0     
ref|XP_010279803.1|  PREDICTED: DNA excision repair protein ERCC-...    629   0.0     
ref|XP_009887114.1|  PREDICTED: DNA excision repair protein ERCC-6      629   0.0     
gb|KFV44404.1|  DNA excision repair protein ERCC-6                      629   0.0     
gb|KFV65211.1|  DNA excision repair protein ERCC-6                      628   0.0     
ref|XP_008500251.1|  PREDICTED: DNA excision repair protein ERCC-6      628   0.0     
ref|XP_421656.2|  PREDICTED: DNA excision repair protein ERCC-6 i...    628   0.0     
ref|XP_007902758.1|  PREDICTED: DNA excision repair protein ERCC-6      629   0.0     
ref|XP_009318523.1|  PREDICTED: DNA excision repair protein ERCC-6      628   0.0     
ref|XP_010561769.1|  PREDICTED: DNA excision repair protein ERCC-...    627   0.0     
ref|XP_009910312.1|  PREDICTED: DNA excision repair protein ERCC-...    627   0.0     
ref|XP_004942194.1|  PREDICTED: DNA excision repair protein ERCC-...    628   0.0     
ref|XP_009572394.1|  PREDICTED: LOW QUALITY PROTEIN: DNA excision...    627   0.0     
ref|XP_005022246.1|  PREDICTED: DNA excision repair protein ERCC-6      626   0.0     
ref|XP_006167482.1|  PREDICTED: DNA excision repair protein ERCC-...    612   0.0     
ref|XP_001366076.1|  PREDICTED: DNA excision repair protein ERCC-...    627   0.0     
ref|XP_009640195.1|  PREDICTED: DNA excision repair protein ERCC-6      627   0.0     
ref|XP_009998650.1|  PREDICTED: DNA excision repair protein ERCC-6      627   0.0     
ref|XP_009979542.1|  PREDICTED: DNA excision repair protein ERCC-...    626   0.0     
gb|KFQ90314.1|  DNA excision repair protein ERCC-6                      626   0.0     
gb|KFZ62302.1|  DNA excision repair protein ERCC-6                      626   0.0     
gb|KGL96282.1|  DNA excision repair protein ERCC-6                      626   0.0     
gb|KFQ70947.1|  DNA excision repair protein ERCC-6                      626   0.0     
gb|KFY47762.1|  hypothetical protein V496_10465                         619   0.0     
ref|XP_382716.1|  hypothetical protein FG02540.1                        616   0.0     
ref|XP_009276018.1|  PREDICTED: DNA excision repair protein ERCC-6      625   0.0     
ref|XP_010120948.1|  PREDICTED: DNA excision repair protein ERCC-...    625   0.0     
ref|XP_005565199.1|  PREDICTED: piggyBac transposable element-der...    619   0.0     
ref|XP_006630380.1|  PREDICTED: DNA excision repair protein ERCC-...    624   0.0     
gb|KFZ17344.1|  hypothetical protein V502_04629                         618   0.0     
gb|KFP07189.1|  DNA excision repair protein ERCC-6                      625   0.0     
ref|XP_009706162.1|  PREDICTED: DNA excision repair protein ERCC-...    625   0.0     
gb|KFP18652.1|  DNA excision repair protein ERCC-6                      625   0.0     
ref|XP_009438634.1|  PREDICTED: DNA excision repair protein ERCC-...    618   0.0     
ref|XP_009960987.1|  PREDICTED: DNA excision repair protein ERCC-...    625   0.0     
gb|KFW60990.1|  DNA excision repair protein ERCC-6                      625   0.0     
gb|KFY86244.1|  hypothetical protein V498_07567                         617   0.0     
gb|KFY86674.1|  hypothetical protein V500_07470                         617   0.0     
gb|KFP98775.1|  DNA excision repair protein ERCC-6                      625   0.0     
ref|XP_007780578.1|  hypothetical protein W97_04499                     618   0.0     
ref|XP_010712786.1|  PREDICTED: LOW QUALITY PROTEIN: DNA excision...    624   0.0     
ref|XP_007832637.1|  hypothetical protein PFICI_05865                   616   0.0     
ref|XP_009463949.1|  PREDICTED: DNA excision repair protein ERCC-6      624   0.0     
ref|XP_005153972.1|  PREDICTED: DNA excision repair protein ERCC-6      624   0.0     
gb|KFU91673.1|  DNA excision repair protein ERCC-6                      624   0.0     
ref|XP_009958078.1|  PREDICTED: DNA excision repair protein ERCC-...    624   0.0     
gb|KFV00507.1|  DNA excision repair protein ERCC-6                      624   0.0     
gb|EOA99371.1|  DNA excision repair protein ERCC-6                      624   0.0     
gb|EFW99946.1|  DNA repair protein rhp26                                615   0.0     
ref|XP_010216991.1|  PREDICTED: DNA excision repair protein ERCC-6      624   0.0     
ref|XP_005815483.1|  PREDICTED: DNA excision repair protein ERCC-...    621   0.0     
ref|XP_004077453.1|  PREDICTED: DNA excision repair protein ERCC-...    621   0.0     
ref|XP_009933983.1|  PREDICTED: DNA excision repair protein ERCC-6      623   0.0     
ref|XP_006897762.1|  PREDICTED: DNA excision repair protein ERCC-6      623   0.0     
ref|XP_003350402.1|  hypothetical protein SMAC_02114                    614   0.0     
gb|EAW93099.1|  hCG32740, isoform CRA_e                                 619   0.0     
ref|XP_009212649.1|  PREDICTED: DNA excision repair protein ERCC-...    617   0.0     
ref|XP_004465832.1|  PREDICTED: DNA excision repair protein ERCC-...    622   0.0     
ref|XP_005498060.1|  PREDICTED: LOW QUALITY PROTEIN: DNA excision...    622   0.0     
gb|KHE84664.1|  hypothetical protein GE21DRAFT_3963                     613   0.0     
ref|XP_008520212.1|  PREDICTED: DNA excision repair protein ERCC-...    616   0.0     
ref|XP_007249595.1|  PREDICTED: DNA excision repair protein ERCC-6      620   0.0     
gb|KFV39174.1|  DNA excision repair protein ERCC-6                      622   0.0     
ref|XP_004583378.1|  PREDICTED: DNA excision repair protein ERCC-6      622   0.0     
gb|KFP43029.1|  DNA excision repair protein ERCC-6                      622   0.0     
ref|XP_009676141.1|  PREDICTED: DNA excision repair protein ERCC-...    622   0.0     
gb|KFM06464.1|  DNA excision repair protein ERCC-6                      622   0.0     
gb|KFP61313.1|  DNA excision repair protein ERCC-6                      622   0.0     
ref|XP_008427952.1|  PREDICTED: DNA excision repair protein ERCC-...    621   0.0     
ref|XP_003801707.1|  PREDICTED: DNA excision repair protein ERCC-6      622   0.0     
ref|XP_004180222.1|  hypothetical protein TBLA_0D01950                  613   0.0     
gb|KDO29148.1|  hypothetical protein SPRG_05391                         602   0.0     
ref|XP_010961800.1|  PREDICTED: DNA excision repair protein ERCC-6      617   0.0     
ref|XP_003409139.1|  PREDICTED: DNA excision repair protein ERCC-6      622   0.0     
ref|XP_009500928.1|  PREDICTED: DNA excision repair protein ERCC-...    619   0.0     
emb|CDQ81646.1|  unnamed protein product                                618   0.0     
ref|XP_006272444.1|  PREDICTED: DNA excision repair protein ERCC-...    622   0.0     
ref|XP_005077762.1|  PREDICTED: DNA excision repair protein ERCC-6      615   0.0     
ref|XP_010130977.1|  PREDICTED: DNA excision repair protein ERCC-...    621   0.0     
ref|XP_009676139.1|  PREDICTED: DNA excision repair protein ERCC-...    622   0.0     
ref|XP_009568976.1|  PREDICTED: DNA excision repair protein ERCC-6      621   0.0     
ref|XP_009260053.1|  hypothetical protein FPSE_08660                    611   0.0     
gb|KFQ91270.1|  DNA excision repair protein ERCC-6                      621   0.0     
gb|KGL80053.1|  DNA excision repair protein ERCC-6                      620   0.0     
ref|XP_007446300.1|  PREDICTED: DNA excision repair protein ERCC-6      620   0.0     
ref|XP_009438631.1|  PREDICTED: DNA excision repair protein ERCC-...    620   0.0     
ref|XP_002736872.2|  PREDICTED: DNA excision repair protein ERCC-...    618   0.0     
gb|KFQ16455.1|  DNA excision repair protein ERCC-6                      620   0.0     
ref|XP_005002108.1|  PREDICTED: DNA excision repair protein ERCC-...    619   0.0     
ref|XP_006031406.1|  PREDICTED: DNA excision repair protein ERCC-6      620   0.0     
ref|XP_006216170.1|  PREDICTED: LOW QUALITY PROTEIN: DNA excision...    618   0.0     
ref|XP_003466177.1|  PREDICTED: DNA excision repair protein ERCC-...    619   0.0     
ref|XP_007546137.1|  PREDICTED: DNA excision repair protein ERCC-...    619   0.0     
gb|KFV82828.1|  DNA excision repair protein ERCC-6                      620   0.0     
ref|XP_003809078.1|  PREDICTED: DNA excision repair protein ERCC-...    620   0.0     
ref|XP_003930033.1|  PREDICTED: DNA excision repair protein ERCC-...    620   0.0     
ref|XP_005565195.1|  PREDICTED: piggyBac transposable element-der...    620   0.0     
emb|CDH59745.1|  dna repair and recombination protein rad26             609   0.0     
ref|XP_006519187.1|  PREDICTED: DNA excision repair protein ERCC-...    612   0.0     
ref|XP_010172927.1|  PREDICTED: DNA excision repair protein ERCC-6      605   0.0     
ref|XP_002595633.1|  hypothetical protein BRAFLDRAFT_200949             619   0.0     
gb|EKC21121.1|  DNA excision repair protein ERCC-6                      617   0.0     
gb|EAA33722.2|  DNA repair protein Rhp26/Rad26                          610   0.0     
ref|XP_004049439.1|  PREDICTED: piggyBac transposable element-der...    619   0.0     
ref|XP_004021608.1|  PREDICTED: DNA excision repair protein ERCC-6      619   0.0     
gb|AAI32448.1|  Ercc6 protein                                           610   0.0     
ref|NP_000115.1|  DNA excision repair protein ERCC-6                    619   0.0     
ref|XP_008115961.1|  PREDICTED: DNA excision repair protein ERCC-6      617   0.0     
ref|XP_010852746.1|  PREDICTED: DNA excision repair protein ERCC-6      619   0.0     
gb|EHH64681.1|  hypothetical protein EGM_17967                          619   0.0     
gb|KFZ00941.1|  hypothetical protein V501_10333                         612   0.0     
ref|XP_007960768.1|  PREDICTED: DNA excision repair protein ERCC-...    619   0.0     
gb|KFZ48531.1|  DNA excision repair protein ERCC-6                      604   0.0     
ref|NP_001178272.1|  DNA excision repair protein ERCC-6                 618   0.0     
ref|XP_006188835.1|  PREDICTED: DNA excision repair protein ERCC-6      618   0.0     
ref|XP_005900675.1|  PREDICTED: DNA excision repair protein ERCC-6      618   0.0     
ref|XP_006061922.1|  PREDICTED: DNA excision repair protein ERCC-...    618   0.0     
ref|XP_007130550.1|  PREDICTED: DNA excision repair protein ERCC-6      618   0.0     
ref|XP_005699407.1|  PREDICTED: DNA excision repair protein ERCC-...    618   0.0     
gb|EHH19005.1|  hypothetical protein EGK_19625                          619   0.0     
ref|XP_001107536.1|  PREDICTED: DNA excision repair protein ERCC-6      619   0.0     
ref|XP_010983623.1|  PREDICTED: DNA excision repair protein ERCC-6      619   0.0     
ref|XP_005699406.1|  PREDICTED: DNA excision repair protein ERCC-...    618   0.0     
ref|XP_007178784.1|  PREDICTED: DNA excision repair protein ERCC-...    616   0.0     
ref|XP_006519185.1|  PREDICTED: DNA excision repair protein ERCC-...    612   0.0     
ref|XP_008520209.1|  PREDICTED: DNA excision repair protein ERCC-...    618   0.0     
ref|XP_010381150.1|  PREDICTED: DNA excision repair protein ERCC-...    618   0.0     
ref|XP_003903675.1|  PREDICTED: DNA excision repair protein ERCC-...    618   0.0     
ref|XP_006519184.1|  PREDICTED: DNA excision repair protein ERCC-...    613   0.0     
ref|XP_004607450.1|  PREDICTED: DNA excision repair protein ERCC-6      618   0.0     
gb|KFO71011.1|  DNA excision repair protein ERCC-6                      618   0.0     
ref|XP_004091168.1|  PREDICTED: piggyBac transposable element-der...    618   0.0     
ref|XP_007178780.1|  PREDICTED: DNA excision repair protein ERCC-...    617   0.0     
ref|XP_004286433.1|  PREDICTED: DNA excision repair protein ERCC-...    617   0.0     
ref|XP_004286434.1|  PREDICTED: DNA excision repair protein ERCC-...    617   0.0     
gb|KFO84504.1|  DNA excision repair protein ERCC-6                      618   0.0     
ref|XP_007069628.1|  PREDICTED: DNA excision repair protein ERCC-6      617   0.0     
ref|XP_005671276.1|  PREDICTED: DNA excision repair protein ERCC-6      617   0.0     
ref|XP_008268053.1|  PREDICTED: LOW QUALITY PROTEIN: DNA excision...    617   0.0     
gb|AAI27105.1|  Excision repair cross-complementing rodent repair...    617   0.0     
ref|XP_004388006.1|  PREDICTED: DNA excision repair protein ERCC-6      617   0.0     
ref|XP_534944.2|  PREDICTED: DNA excision repair protein ERCC-6 i...    617   0.0     
ref|XP_007960767.1|  PREDICTED: DNA excision repair protein ERCC-...    618   0.0     
ref|XP_007526545.1|  PREDICTED: DNA excision repair protein ERCC-6      616   0.0     
ref|XP_010789252.1|  PREDICTED: DNA excision repair protein ERCC-...    615   0.0     
ref|XP_003964192.1|  PREDICTED: DNA excision repair protein ERCC-...    615   0.0     
ref|XP_008617547.1|  hypothetical protein SDRG_13248                    597   0.0     
gb|KFY18853.1|  hypothetical protein V493_08299                         609   0.0     
gb|KFW89922.1|  DNA excision repair protein ERCC-6                      617   0.0     
ref|XP_002756186.1|  PREDICTED: DNA excision repair protein ERCC-...    616   0.0     
ref|XP_006118230.1|  PREDICTED: DNA excision repair protein ERCC-6      613   0.0     
ref|XP_007080089.1|  PREDICTED: DNA excision repair protein ERCC-6      616   0.0     
ref|XP_001798712.1|  hypothetical protein SNOG_08399                    608   0.0     
ref|XP_007936801.1|  PREDICTED: DNA excision repair protein ERCC-6      616   0.0     
gb|ELR52884.1|  DNA excision repair protein ERCC-6                      615   0.0     
ref|XP_006976785.1|  PREDICTED: DNA excision repair protein ERCC-6      615   0.0     
ref|XP_010620813.1|  PREDICTED: DNA excision repair protein ERCC-...    614   0.0     
emb|CAG09381.1|  unnamed protein product                                610   0.0     
ref|XP_004432502.1|  PREDICTED: DNA excision repair protein ERCC-6      615   0.0     
ref|XP_001500332.2|  PREDICTED: DNA excision repair protein ERCC-6      615   0.0     
ref|XP_009243657.1|  PREDICTED: LOW QUALITY PROTEIN: DNA excision...    615   0.0     
ref|XP_005853261.1|  PREDICTED: DNA excision repair protein ERCC-...    615   0.0     
ref|XP_005339123.1|  PREDICTED: DNA excision repair protein ERCC-6      615   0.0     
ref|XP_004555941.1|  PREDICTED: DNA excision repair protein ERCC-...    609   0.0     
ref|XP_006916990.1|  PREDICTED: DNA excision repair protein ERCC-6      615   0.0     
ref|XP_008289607.1|  PREDICTED: DNA excision repair protein ERCC-...    613   0.0     
ref|XP_002435939.1|  DNA excision repair protein ERCC-6, putative       600   0.0     
ref|XP_007614026.1|  PREDICTED: DNA excision repair protein ERCC-...    614   0.0     
ref|XP_008694394.1|  PREDICTED: DNA excision repair protein ERCC-6      614   0.0     
ref|XP_010620811.1|  PREDICTED: DNA excision repair protein ERCC-...    614   0.0     
ref|XP_005412626.1|  PREDICTED: DNA excision repair protein ERCC-6      614   0.0     
ref|XP_010735853.1|  PREDICTED: DNA excision repair protein ERCC-6      613   0.0     
ref|XP_003495358.1|  PREDICTED: DNA excision repair protein ERCC-...    614   0.0     
ref|XP_006252800.1|  PREDICTED: DNA excision repair protein ERCC-...    607   0.0     
ref|XP_005961003.1|  PREDICTED: DNA excision repair protein ERCC-...    614   0.0     
gb|KFY73615.1|  hypothetical protein V499_06305                         607   0.0     
ref|XP_004680719.1|  PREDICTED: DNA excision repair protein ERCC-6      614   0.0     
ref|XP_006808061.1|  PREDICTED: DNA excision repair protein ERCC-...    612   0.0     
ref|XP_008574801.1|  PREDICTED: DNA excision repair protein ERCC-6      613   0.0     
ref|XP_005348700.1|  PREDICTED: DNA excision repair protein ERCC-6      613   0.0     
ref|NP_001074690.1|  DNA excision repair protein ERCC-6                 613   0.0     
ref|XP_005961004.1|  PREDICTED: DNA excision repair protein ERCC-...    613   0.0     
ref|XP_002927161.1|  PREDICTED: DNA excision repair protein ERCC-...    613   0.0     
ref|XP_008171284.1|  PREDICTED: DNA excision repair protein ERCC-6      614   0.0     
ref|XP_008050949.1|  PREDICTED: DNA excision repair protein ERCC-6      612   0.0     
ref|XP_004658099.1|  PREDICTED: DNA excision repair protein ERCC-6      612   0.0     
ref|XP_006757194.1|  PREDICTED: DNA excision repair protein ERCC-...    612   0.0     
ref|XP_006097621.1|  PREDICTED: LOW QUALITY PROTEIN: DNA excision...    612   0.0     
ref|XP_004884654.1|  PREDICTED: DNA excision repair protein ERCC-...    612   0.0     
ref|XP_008320173.1|  PREDICTED: DNA excision repair protein ERCC-6      611   0.0     
ref|XP_004884652.1|  PREDICTED: DNA excision repair protein ERCC-...    612   0.0     
gb|ELK08347.1|  DNA excision repair protein ERCC-6                      612   0.0     
ref|XP_010897534.1|  PREDICTED: DNA excision repair protein ERCC-...    612   0.0     
ref|XP_008147306.1|  PREDICTED: DNA excision repair protein ERCC-...    612   0.0     
ref|XP_009230197.1|  DNA repair and recombination protein RAD26         600   0.0     



>ref|XP_009800493.1| PREDICTED: DNA repair protein rhp26 [Nicotiana sylvestris]
Length=1212

 Score =  1628 bits (4216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 873/1235 (71%), Positives = 1001/1235 (81%), Gaps = 39/1235 (3%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEH---NATS  325
             MEE+EED++L SSLGVTSANPEDIE +I  +       SNEA  S E E  E    N   
Sbjct  1     MEEEEEDKILLSSLGVTSANPEDIEHDILEKATRHPGESNEAMGSAEEEIVERKKGNEEG  60

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
               KK D+YNKLRAVE EI A+KSGFE LE FRR++E+VPD +   E +  E+EQS  QAP
Sbjct  61    QDKKLDLYNKLRAVEVEIDAIKSGFEHLERFRRHEEEVPDTDGSSEAKQTESEQSVIQAP  120

Query  506   lndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVV  685
             L+D +LQ ALA DRL+SLLKTKAQLKKE+SD ++D++ D              A++RD+V
Sbjct  121   LDDSNLQHALADDRLRSLLKTKAQLKKELSDFTDDTSSD--------------ALIRDLV  166

Query  686   KGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGIL  865
             K QP+ KR++KE +  S  K KR KT  LDDDDDFDAVL AASSGFVETE+D LVRKG+L
Sbjct  167   KDQPEFKRKVKEVQKSSNKKSKRRKTTLLDDDDDFDAVLTAASSGFVETERDALVRKGML  226

Query  866   TPFHKLKGFERQIQEPGQSSRHSM-----QDNGDLVSTSLANAIQSISEAAQSRPTTKLL  1030
             TPFH+LKGFER++Q+     R S       ++ DL STS+A A+QSIS+AAQ+RPTTKLL
Sbjct  227   TPFHQLKGFERRVQDSESFGRQSTAADINSNDNDLASTSIAKAVQSISQAAQARPTTKLL  286

Query  1031  DSSLLPKLEPPTYPFQTPRKHVKISQSAE-----NGRNDKRKRRPTPGKKWRVKVSRENK  1195
             DS+ LPKLE PT+PFQ  RK +KI QS E     NG   ++K+RP P KKWR   SRE +
Sbjct  287   DSASLPKLEAPTHPFQRLRKPLKIPQSLETTPEKNGDGTRKKKRPLPSKKWRKLASREQR  346

Query  1196  -DEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELH  1372
              +EG DV  SS+ED + D +  +  PPFV LEGG +IPE IF+ LFDYQKVGVQWLWELH
Sbjct  347   QNEGSDVNTSSHEDNQGDIEDVE--PPFVALEGGFRIPEAIFNSLFDYQKVGVQWLWELH  404

Query  1373  CQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFH  1552
             CQ+AGGIIGDEMGLGKTVQVL+FLGSLHFSN YKPSII+CP+TLL+QWKREAKKWYPSFH
Sbjct  405   CQRAGGIIGDEMGLGKTVQVLSFLGSLHFSNMYKPSIIICPVTLLRQWKREAKKWYPSFH  464

Query  1553  VEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSG  1732
             VEILHDS +D   KKK + S       + L       N S R +KKWD +I  V+ S+SG
Sbjct  465   VEILHDSAHDLSSKKKQADSESDYESEDLLDSETEG-NTSSRTSKKWDPVIARVVRSNSG  523

Query  1733  LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQ  1912
             LLITTYEQLR+LGEKLLDIEWGYAVLDEGHRIRNPN +VTLVCKQLQTVHRIIMTG+PIQ
Sbjct  524   LLITTYEQLRILGEKLLDIEWGYAVLDEGHRIRNPNAEVTLVCKQLQTVHRIIMTGAPIQ  583

Query  1913  NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIM  2092
             NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRDLIM
Sbjct  584   NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRDLIM  643

Query  2093  PYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDV  2272
             PYLLRRMKADVNA L KKTEHV+FCSLT  QRS+Y+AFLAS++VEQIFDG++N+LYGIDV
Sbjct  644   PYLLRRMKADVNAHLTKKTEHVLFCSLTPEQRSVYRAFLASSEVEQIFDGNRNSLYGIDV  703

Query  2273  MRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDI  2452
             MRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLK+WK+QGHRVL FSQTQQMLDI
Sbjct  704   MRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKVWKEQGHRVLLFSQTQQMLDI  763

Query  2453  LENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVI  2632
              E FLVT  Y YRRMDG TPVKQRMALIDEFNNT +IFIFILTT+VGGLGTNLTGANRVI
Sbjct  764   FERFLVTCEYNYRRMDGVTPVKQRMALIDEFNNTDDIFIFILTTKVGGLGTNLTGANRVI  823

Query  2633  IFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNP  2812
             IFDPDWNPS DMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKH LTNKILKNP
Sbjct  824   IFDPDWNPSTDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLTNKILKNP  883

Query  2813  QQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITG-PQHPDQEKDKSIKTNP  2989
             QQRR FKARD+KDLF LNDD   GSTE+SSIFSQ+SEDVNI G P + D++  K+  T  
Sbjct  884   QQRRFFKARDMKDLFTLNDDENGGSTETSSIFSQVSEDVNIVGVPGNQDKQSFKA--TAE  941

Query  2990  ADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEE  3169
              D  + +   NNS + G+    N+NG++D + SILR+LFDAHGIHSAM+HDAI+NAHDEE
Sbjct  942   KDDDSNIGGGNNSKTKGKAGDGNSNGELDGEASILRSLFDAHGIHSAMNHDAIMNAHDEE  1001

Query  3170  KLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQ  3349
             KLKLEEQAS+VAQRAAEALRQSRMLRS+E+VA+PTWTG+SG AG P S+K+KFGST+NPQ
Sbjct  1002  KLKLEEQASQVAQRAAEALRQSRMLRSRENVAVPTWTGKSGAAGGPSSVKRKFGSTVNPQ  1061

Query  3350  LVTSSKPLEES-SMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFN  3526
             L  +SK  EES +  +SR N  AAGASAGKALSSAELLA+IRGNQE+A+SDGL HQ    
Sbjct  1062  L--TSKSSEESLNDSASRANAFAAGASAGKALSSAELLARIRGNQEKAVSDGLVHQFGM-  1118

Query  3527  SGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVP  3706
             S S+SN R   + N   R +  S  +QPEVL+RQ+CTFIQ++GG T+SASIV+HFR RVP
Sbjct  1119  SASTSNGRA-GSLNSGHRSASSSYVVQPEVLVRQICTFIQQRGGKTNSASIVDHFRDRVP  1177

Query  3707  SKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             SKDL LFKNLLKEIATL KNP+GSFW+LKPEYQ++
Sbjct  1178  SKDLPLFKNLLKEIATLDKNPSGSFWVLKPEYQDQ  1212



>ref|XP_009608324.1| PREDICTED: DNA repair protein rhp26 [Nicotiana tomentosiformis]
Length=1212

 Score =  1611 bits (4171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 867/1235 (70%), Positives = 997/1235 (81%), Gaps = 39/1235 (3%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEH---NATS  325
             MEE+EED++L SSLGVTSANPEDIE +I  +       SNEA  S E E  E    N   
Sbjct  1     MEEEEEDKILLSSLGVTSANPEDIEHDILEKATRHPGESNEATGSAEEEIVERKKGNEEG  60

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
               KK D+YNKLRAVE EI A+KSGF  LE FRR++E+VPD +   E +  E+EQS  QAP
Sbjct  61    QDKKLDLYNKLRAVEVEIDAIKSGFGHLERFRRHEEEVPDTDGRSEAKQTESEQSVIQAP  120

Query  506   lndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVV  685
             L+D +LQ ALA DRL+SLLKTKAQLKKE+ D ++D++ D              A++RD+V
Sbjct  121   LDDSNLQHALADDRLRSLLKTKAQLKKELLDFTDDTSRD--------------ALIRDLV  166

Query  686   KGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGIL  865
             K QP+ KR++KE +  S  K KR KT  LDDDDDFDAVL AASSGFVETE+D LVRKG+L
Sbjct  167   KDQPEFKRKVKEVQKSSNKKSKRRKTTLLDDDDDFDAVLTAASSGFVETERDALVRKGML  226

Query  866   TPFHKLKGFERQIQEPGQSSRHSM-----QDNGDLVSTSLANAIQSISEAAQSRPTTKLL  1030
             TPFH+LKGFER++Q+     R S       ++ DL STS+  A+QSIS+AAQ+RPTTKLL
Sbjct  227   TPFHQLKGFERRVQDSESFGRQSTAADINSNDNDLASTSIDKAVQSISQAAQARPTTKLL  286

Query  1031  DSSLLPKLEPPTYPFQTPRKHVKISQSAE-----NGRNDKRKRRPTPGKKWRVKVSRE-N  1192
             DS+ LPKLE PT+PFQ  RK +KI QS E     NG   ++K+RP P KKWR   SRE +
Sbjct  287   DSASLPKLEAPTHPFQRLRKPLKIPQSLETTPEKNGDGTRKKKRPLPSKKWRKLASREQS  346

Query  1193  KDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELH  1372
             ++EG DV  SS+ED + D +  +  PPFV LEGG +IPETIF+ LFDYQKVGVQWLWELH
Sbjct  347   QNEGSDVNTSSHEDNQGDIEDVE--PPFVALEGGFRIPETIFNSLFDYQKVGVQWLWELH  404

Query  1373  CQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFH  1552
             CQ+AGGIIGDEMGLGKTVQVL+FLGSLHFSN YKPSII+CP+TLL+QWKREAKKWYPSFH
Sbjct  405   CQRAGGIIGDEMGLGKTVQVLSFLGSLHFSNMYKPSIIICPVTLLRQWKREAKKWYPSFH  464

Query  1553  VEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSG  1732
             VEILHDS +D   KKK + S       + L       + S R +KKWD +I  V+ S+SG
Sbjct  465   VEILHDSAHDLSSKKKQADSESDYESEDLLDSETEG-HTSSRTSKKWDPVIARVVRSNSG  523

Query  1733  LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQ  1912
             LLITTYEQLR+LGEKLLDIEWGYAVLDEGHRIRNPN +VTLVCKQLQTVHRIIMTG+PIQ
Sbjct  524   LLITTYEQLRILGEKLLDIEWGYAVLDEGHRIRNPNAEVTLVCKQLQTVHRIIMTGAPIQ  583

Query  1913  NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIM  2092
             NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRDLIM
Sbjct  584   NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRDLIM  643

Query  2093  PYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDV  2272
             PYLLRRMKADVNA L KKTEHV+FCSLT  QRS+Y+AFLAS++VEQIFDG++N+LYGIDV
Sbjct  644   PYLLRRMKADVNAHLTKKTEHVLFCSLTPEQRSVYRAFLASSEVEQIFDGNRNSLYGIDV  703

Query  2273  MRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDI  2452
             MRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLK+WK+QGHRVL FSQTQQMLDI
Sbjct  704   MRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKVWKEQGHRVLLFSQTQQMLDI  763

Query  2453  LENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVI  2632
              E FLVT  Y YRRMDG TPVKQRMALIDEFNNT +IFIFILTT+VGGLGTNLTGANRVI
Sbjct  764   FERFLVTCEYNYRRMDGVTPVKQRMALIDEFNNTDDIFIFILTTKVGGLGTNLTGANRVI  823

Query  2633  IFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNP  2812
             IFDPDWNPS DMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKH LTNKILKNP
Sbjct  824   IFDPDWNPSTDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLTNKILKNP  883

Query  2813  QQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIK-TNP  2989
             QQRR FKARD+KDLF LNDD   GSTE+SSIFSQ+SEDVNI G   PD +  +S K T+ 
Sbjct  884   QQRRFFKARDMKDLFTLNDDENGGSTETSSIFSQVSEDVNIVGA--PDNQDKRSFKATSE  941

Query  2990  ADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEE  3169
              D  + +   NNS + G     N+NG++D + SIL++LFDAHGIHSAM+HDAI+NAHDEE
Sbjct  942   KDGDSNIGGGNNSKTKGNVGDGNSNGELDGEASILQSLFDAHGIHSAMNHDAIMNAHDEE  1001

Query  3170  KLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQ  3349
             KLKLEEQAS+VAQRAAEALRQSRMLRS+E+VA+PTWTG+SG AG P S+K+KFGST+NPQ
Sbjct  1002  KLKLEEQASQVAQRAAEALRQSRMLRSRENVAVPTWTGKSGAAGGPSSVKRKFGSTVNPQ  1061

Query  3350  LVTSSKPLEES-SMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFN  3526
             L  +SK  EES +  +SR N  AAGASAGKALSSAELLA+IRGNQE+A+SDGL HQ    
Sbjct  1062  L--TSKLSEESLNDSASRANAFAAGASAGKALSSAELLARIRGNQEKAVSDGLVHQFGM-  1118

Query  3527  SGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVP  3706
             S S+SN R   + N   R +  S  +QPEVL+ Q+CTFIQ++GG T+SASIV+HFR RVP
Sbjct  1119  SASTSNGRA-GSLNSGHRSASCSYVVQPEVLVLQICTFIQQRGGKTNSASIVDHFRDRVP  1177

Query  3707  SKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             SKDL LFK+LLKEIATL K P+GSFW+LKPEYQ++
Sbjct  1178  SKDLPLFKDLLKEIATLDKQPSGSFWVLKPEYQDQ  1212



>ref|XP_006351663.1| PREDICTED: DNA repair protein rhp26-like [Solanum tuberosum]
Length=1213

 Score =  1609 bits (4166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 870/1235 (70%), Positives = 995/1235 (81%), Gaps = 38/1235 (3%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEA---ARSMELEATEHNATS  325
             MEE+EED++L SSLGVTSANPEDIER++  Q       SNEA   A     E  E     
Sbjct  1     MEEEEEDKILLSSLGVTSANPEDIERDVLDQATRHVGESNEATGIAEEEIEERKEVKEEG  60

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
               KK D++NKLRAVE EI A+K GF  LE FRRN+E+VPD +   E +  E+EQ T QAP
Sbjct  61    HDKKLDLFNKLRAVEVEIDAIKDGFGHLERFRRNEEEVPDTDGCSEAKHTESEQRTIQAP  120

Query  506   lndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVV  685
             L+D +LQ ALA DRL+SLL+TKAQL++E+S  +N+++              P+A++R +V
Sbjct  121   LDDSNLQHALADDRLRSLLETKAQLREELSIFANETS--------------PDALIRALV  166

Query  686   KGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGIL  865
             K QPK KR++KE +  S  K KR KTA L DDDDFDAVL AASSGFVETE+D LVRKG+L
Sbjct  167   KDQPKSKRKVKEVQKSSNKKSKRRKTALLVDDDDFDAVLAAASSGFVETERDALVRKGML  226

Query  866   TPFHKLKGFERQIQEPGQSSRHSM-----QDNGDLVSTSLANAIQSISEAAQSRPTTKLL  1030
             TPFHKLKGFER+I     S R S       ++ DL STS+A A+QSIS+AAQ+RPTTKLL
Sbjct  227   TPFHKLKGFERRIDGAESSGRQSAAADTNSNDNDLASTSIAKAVQSISQAAQARPTTKLL  286

Query  1031  DSSLLPKLEPPTYPFQTPRKHVKISQSAE-----NGRNDKRKRRPTPGKKWRVKVSRENK  1195
             DS+ LPKL+ P +PFQ  RK +KI QS E     NG   ++K+RP P KKWR   SRE +
Sbjct  287   DSASLPKLDAPAHPFQRLRKPLKIPQSLEITTEKNGEFTRKKKRPLPSKKWRKLASREQR  346

Query  1196  -DEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELH  1372
              DEG DV  SS+ED  +D +  +    FV LEGG KIPETIF+KLFDYQKVGVQWLWELH
Sbjct  347   QDEGSDVNTSSHEDNTEDTEDVESS--FVALEGGFKIPETIFNKLFDYQKVGVQWLWELH  404

Query  1373  CQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFH  1552
             CQ+AGGIIGDEMGLGKT+QVL+FLGSLHFS+ YKPSII+CP+TLL+QWKREAK WYPSFH
Sbjct  405   CQRAGGIIGDEMGLGKTIQVLSFLGSLHFSDMYKPSIIICPVTLLRQWKREAKTWYPSFH  464

Query  1553  VEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSG  1732
             VEILHDS +D    KK     ESD ESE+LLD + E   S R +KKWD +I  V+ S+SG
Sbjct  465   VEILHDSAHD-SSSKKKQADSESDYESEDLLDSETEGKTSSRTSKKWDPVIARVVRSNSG  523

Query  1733  LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQ  1912
             LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPN +VTLVCKQLQTVHRIIMTG+PIQ
Sbjct  524   LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNAEVTLVCKQLQTVHRIIMTGAPIQ  583

Query  1913  NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIM  2092
             NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRDLIM
Sbjct  584   NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRDLIM  643

Query  2093  PYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDV  2272
             PYLLRRMKADVNA LPKKTEHV+FCSLT  QRS+Y+AFLAS++VEQIFDGS+N+L GIDV
Sbjct  644   PYLLRRMKADVNANLPKKTEHVLFCSLTKEQRSVYRAFLASSEVEQIFDGSRNSLSGIDV  703

Query  2273  MRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDI  2452
             MRKICNHPDLLEREHS RDPDYGNPERSGKMKVVAEVLK+WK+QGHRVL FSQTQQMLDI
Sbjct  704   MRKICNHPDLLEREHSSRDPDYGNPERSGKMKVVAEVLKVWKEQGHRVLLFSQTQQMLDI  763

Query  2453  LENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVI  2632
             LE FLVT  Y YRRMDG TPVKQRM LIDEFNNT +IFIFILTT+VGGLGTNLTGANRVI
Sbjct  764   LERFLVTCEYNYRRMDGLTPVKQRMVLIDEFNNTDDIFIFILTTKVGGLGTNLTGANRVI  823

Query  2633  IFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNP  2812
             IFDPDWNPS DMQARERAWRIGQKKDVTVYRLITRG IEEKVYHRQIYKH LTNKILKNP
Sbjct  824   IFDPDWNPSTDMQARERAWRIGQKKDVTVYRLITRGAIEEKVYHRQIYKHFLTNKILKNP  883

Query  2813  QQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPA  2992
             QQRR FKARD+KDLF LNDDG  GSTE+SSIFSQ+SEDVNI G   PD ++  S +  PA
Sbjct  884   QQRRFFKARDMKDLFTLNDDGNGGSTETSSIFSQVSEDVNIVGA--PDSQEKPSFQA-PA  940

Query  2993  --DHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDE  3166
               D  + +   +NS   G+   DNNNG++DE+TSILR LFDAHGIHSAM+HDAI+NAHDE
Sbjct  941   VKDDDSKIGEADNSDPRGKAGDDNNNGELDEETSILRGLFDAHGIHSAMNHDAIMNAHDE  1000

Query  3167  EKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNP  3346
             EKLKLEE+AS+VAQRAAEAL+QSRMLRS+ESVA+PTWTG+SG AG P S KKKFGST+NP
Sbjct  1001  EKLKLEEKASQVAQRAAEALQQSRMLRSRESVAVPTWTGKSGAAGGPSSAKKKFGSTVNP  1060

Query  3347  QLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFN  3526
             QL + S     +   + R N   AGASAGKALSSAELLAKIRGN+E+A+SDGL HQ    
Sbjct  1061  QLTSKSSEESLNGYDAIRGNAFPAGASAGKALSSAELLAKIRGNREKAVSDGLGHQFGM-  1119

Query  3527  SGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVP  3706
               SSSNSR  +  NG  R +  S+ +QPEVL+RQ+CTFIQ++GG T+SASIV++FR RVP
Sbjct  1120  PASSSNSRAESVSNG-HRSASSSSVVQPEVLVRQICTFIQQRGGKTNSASIVDYFRDRVP  1178

Query  3707  SKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             SKDL LFKNLLKEIA L+KNP+GSFW+LKPEYQ++
Sbjct  1179  SKDLPLFKNLLKEIAILEKNPSGSFWVLKPEYQDQ  1213



>ref|XP_004247239.1| PREDICTED: protein CHROMATIN REMODELING 8 [Solanum lycopersicum]
Length=1213

 Score =  1593 bits (4124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 858/1234 (70%), Positives = 978/1234 (79%), Gaps = 36/1234 (3%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEA---ARSMELEATEHNATS  325
             MEE+EED++L SSLGVTSANPEDIER++  Q        NEA   A     E  E     
Sbjct  1     MEEEEEDKILLSSLGVTSANPEDIERDVLDQATRHVGEGNEATGIAEEEIEERKEEKEEG  60

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
               KK D++NKLRAVE EI A+K GFE LE FRRN+E+  D +D  E    E EQ T QAP
Sbjct  61    HDKKLDLFNKLRAVEVEIDAIKDGFEHLERFRRNEEEFSDTDDCSEATHTENEQRTIQAP  120

Query  506   lndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVV  685
             L+D +LQ ALA DRL+SLL+TKAQL++E+S  +ND++ D              A++R +V
Sbjct  121   LDDSNLQHALADDRLRSLLETKAQLREELSIFANDTSSD--------------ALIRALV  166

Query  686   KGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGIL  865
             K QPK KR++KE +  S  K KR KTA L DDDDFDAVL AASSGFVETE+D LVRKGIL
Sbjct  167   KDQPKSKRKVKEVQKSSNKKSKRRKTALLVDDDDFDAVLAAASSGFVETERDALVRKGIL  226

Query  866   TPFHKLKGFERQIQEPGQSSRHSM-----QDNGDLVSTSLANAIQSISEAAQSRPTTKLL  1030
             TPFHKLKGFER+I     S R S        + DL STS+A A+QSIS+AAQ+RP+TKLL
Sbjct  227   TPFHKLKGFERRIDGAESSGRQSAAADTNSKDDDLASTSIAKAVQSISQAAQARPSTKLL  286

Query  1031  DSSLLPKLEPPTYPFQTPRKHVKISQSAE-----NGRNDKRKRRPTPGKKWRVKVSRENK  1195
             DS+ LPKL+ P +PFQ  RK +KI Q  E     NG   ++K+RP P KKWR   SRE +
Sbjct  287   DSASLPKLDAPAHPFQRLRKPLKIPQWLEITTEKNGEFTRKKKRPLPSKKWRKLASREQR  346

Query  1196  -DEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELH  1372
              +EG DV  SS+ED  +D +  +    FV LEGG +IPETIF+KLFDYQKVGVQWLWELH
Sbjct  347   QEEGSDVNTSSHEDNTEDTEDVESS--FVALEGGFRIPETIFNKLFDYQKVGVQWLWELH  404

Query  1373  CQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFH  1552
             CQ+AGGIIGDEMGLGKT+QVL+FLGSLHFS  YKPSII+CP+TLL+QWKREAK W PSFH
Sbjct  405   CQRAGGIIGDEMGLGKTIQVLSFLGSLHFSEMYKPSIIICPVTLLRQWKREAKTWCPSFH  464

Query  1553  VEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSG  1732
             VEILHDS +D   KKK S S       + L      K  S R +KKWD +I  V+ S+SG
Sbjct  465   VEILHDSAHDLSSKKKQSDSESDYESEDLLDSETEGKK-SSRTSKKWDPVIARVVRSNSG  523

Query  1733  LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQ  1912
             LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPN +VTLVCKQLQTVHRIIMTG+PIQ
Sbjct  524   LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNAEVTLVCKQLQTVHRIIMTGAPIQ  583

Query  1913  NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIM  2092
             NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRDLIM
Sbjct  584   NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRDLIM  643

Query  2093  PYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDV  2272
             PYLLRRMKADVNA LPKK EHV+FCSLT  QRS+Y+AFLAS++VEQIFDGS+N+L GIDV
Sbjct  644   PYLLRRMKADVNANLPKKAEHVLFCSLTKEQRSVYRAFLASSEVEQIFDGSRNSLSGIDV  703

Query  2273  MRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDI  2452
             MRKICNHPDLLEREHS  DPDYGNPERSGKMKVVAEVLK+WK+QGHRVL FSQTQQMLDI
Sbjct  704   MRKICNHPDLLEREHSSTDPDYGNPERSGKMKVVAEVLKVWKEQGHRVLLFSQTQQMLDI  763

Query  2453  LENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVI  2632
             LE FLVT  Y YRRMDG TPVKQRM LIDEFNNT +IFIFILTT+VGGLGTNLTGANRVI
Sbjct  764   LERFLVTCEYNYRRMDGVTPVKQRMVLIDEFNNTDDIFIFILTTKVGGLGTNLTGANRVI  823

Query  2633  IFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNP  2812
             IFDPDWNPS DMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKH LTNKILKNP
Sbjct  824   IFDPDWNPSTDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLTNKILKNP  883

Query  2813  QQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPA  2992
             QQRR FKARD+KDLF LNDDG  GSTE+SSIFSQ+S DVNI G   PD ++  S +   A
Sbjct  884   QQRRFFKARDMKDLFTLNDDGNGGSTETSSIFSQVSVDVNIVGA--PDSQERLSFQAPVA  941

Query  2993  -DHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEE  3169
              D  + +   +NS   G+   DNNNG++DE+TSILR LFDAHGIHSAM+HDAI+NAHDEE
Sbjct  942   KDDNSKIGEADNSDPKGKAGDDNNNGELDEETSILRGLFDAHGIHSAMNHDAIMNAHDEE  1001

Query  3170  KLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQ  3349
             KLKLEEQAS+VAQRAAEALRQSRMLRS+E VA+PTWTG+SG AG P S KKKFGST+NPQ
Sbjct  1002  KLKLEEQASQVAQRAAEALRQSRMLRSREGVAVPTWTGKSGAAGGPSSAKKKFGSTVNPQ  1061

Query  3350  LVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNS  3529
             L + S     +   + R N   AGASAGKALSSAELLAKIRGNQE+A+SDGL HQ     
Sbjct  1062  LTSKSSEESLNGYDAIRGNAFPAGASAGKALSSAELLAKIRGNQEKAVSDGLVHQFG-TP  1120

Query  3530  GSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS  3709
              S+SNSR  +  NG +R +  S+ +QPEVL+RQ+CTFIQ++GG T+SASIV++FR R+PS
Sbjct  1121  ASTSNSRAGSVSNG-NRSASSSSVVQPEVLVRQICTFIQQRGGKTTSASIVDYFRDRIPS  1179

Query  3710  KDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             KDL LFKNLLKEIA L+KNP+GSFW+LKPEYQ++
Sbjct  1180  KDLPLFKNLLKEIAILEKNPSGSFWVLKPEYQDQ  1213



>ref|XP_011083038.1| PREDICTED: protein CHROMATIN REMODELING 8 [Sesamum indicum]
 ref|XP_011083039.1| PREDICTED: protein CHROMATIN REMODELING 8 [Sesamum indicum]
Length=1221

 Score =  1580 bits (4092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 853/1243 (69%), Positives = 1013/1243 (81%), Gaps = 46/1243 (4%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEA---TEHNATS  325
             M+E+EEDRVL S+LGVTSANPEDIERNI  +        NEA+ + E E    T+   TS
Sbjct  1     MDEEEEDRVLLSTLGVTSANPEDIERNILEKARKDAGDYNEASGAREEETVGRTKSTETS  60

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
             S+   ++ NKLRAV+ EI AV S  EQLENF+R+++ +PD +D  E+ + E E++  QA 
Sbjct  61    SSSNENLVNKLRAVQVEIDAVTSAVEQLENFKRDEDHLPDGDDEIEQGNAEAERNILQAS  120

Query  506   lndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAV--LRD  679
              NDL LQ ALA DRL+SL+KT+AQL+KEISD   +S HD    LR++VKE+P +   L++
Sbjct  121   SNDLTLQHALAVDRLQSLIKTRAQLEKEISDSPRNSQHDRF--LRNLVKEEPRSKRWLKE  178

Query  680   VVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKG  859
             V K     K+RLK                S  +DDDFDAVLNAAS+GFVETE+D+LVRKG
Sbjct  179   VEKTSQNQKKRLKR--------------VSFSEDDDFDAVLNAASAGFVETERDELVRKG  224

Query  860   ILTPFHKLKGFERQIQEPGQSSRHSMQD----NGDLVSTSLANAIQSISEAAQSRPTTKL  1027
             ILTPFHKLKG+ER+IQEPG SSRH   +    N DL S+S+A A+Q ISEA+Q+RPTTK+
Sbjct  225   ILTPFHKLKGYERRIQEPGSSSRHVASEDAVENNDLASSSIARAVQLISEASQARPTTKM  284

Query  1028  LDSSLLPKLEPPTYPFQTPRKHVKISQS----AENGRNDKRK-RRPTPGKKWRVKVSREN  1192
             LD   +PKL+ P+ PF+  RK  K+ +S    +E G++ KRK RRP PGKKWR  VSRE 
Sbjct  285   LDPESVPKLDAPSIPFRRLRKSYKVPRSLELESEKGKDTKRKKRRPQPGKKWRKLVSREE  344

Query  1193  K-DEGPDVEISSYedekddedmdd--eGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLW  1363
             K  E  D + SS ED+  ++  D   EGPPF+ LEGGLKIPETIF  LFDYQKVGVQWLW
Sbjct  345   KFQEELDGKTSSNEDDSLEDVEDVDDEGPPFLTLEGGLKIPETIFSNLFDYQKVGVQWLW  404

Query  1364  ELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYP  1543
             ELHCQ+AGGIIGDEMGLGKTVQ+LAFLGSLHFS  YKPSII+CP+TLL+QW+REA+KWYP
Sbjct  405   ELHCQRAGGIIGDEMGLGKTVQILAFLGSLHFSGMYKPSIIICPVTLLRQWRREARKWYP  464

Query  1544  SFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGS  1723
              FHVE+LHDS  +   +KK S+S++SD +SE+  +   E+  S +NTKKWD LIN VL S
Sbjct  465   GFHVELLHDSAQEIPIRKKRSRSNDSDCDSEDSTNSGSEEKSSSKNTKKWDSLINRVLRS  524

Query  1724  DSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGS  1903
             +SGLLITTYEQLRL G+KLLDIEWGYAVLDEGHRIRNPN +VTLVCKQLQTVHRIIMTGS
Sbjct  525   ESGLLITTYEQLRLQGDKLLDIEWGYAVLDEGHRIRNPNAEVTLVCKQLQTVHRIIMTGS  584

Query  1904  PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRD  2083
             PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRD
Sbjct  585   PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRD  644

Query  2084  LIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYG  2263
             LIMPYLLRRMKADV+AQLPKKTEHV+FCSLT  QRS+Y+AFLAS++VEQIFDGS+N+LYG
Sbjct  645   LIMPYLLRRMKADVDAQLPKKTEHVLFCSLTPEQRSLYRAFLASSEVEQIFDGSRNSLYG  704

Query  2264  IDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQM  2443
             IDVMRKICNHPDLLEREHS  +PDYGNP+RSGKMKVVAEVL +WK+QGHRVL F+QTQQM
Sbjct  705   IDVMRKICNHPDLLEREHSHGNPDYGNPKRSGKMKVVAEVLNVWKEQGHRVLLFAQTQQM  764

Query  2444  LDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGAN  2623
             LDI+ENFL+ GGY YRRMDG TPVKQRMALIDEFNN  ++FIFILTT+VGGLGTNLTGAN
Sbjct  765   LDIIENFLIAGGYNYRRMDGLTPVKQRMALIDEFNNLDDVFIFILTTKVGGLGTNLTGAN  824

Query  2624  RVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKIL  2803
             RVIIFDPDWNPS DMQARERAWRIGQKKDVTVYRLITRGTIEEKVY RQIYKH LTNKIL
Sbjct  825   RVIIFDPDWNPSTDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYQRQIYKHFLTNKIL  884

Query  2804  KNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKT  2983
             KNPQQRR FKARD+KDLF LNDDG+ GSTE+SSIFSQ+SE+VN+ G    +Q++ K +K 
Sbjct  885   KNPQQRRFFKARDMKDLFTLNDDGDGGSTETSSIFSQVSEEVNVVGACKDEQDESKVMKP  944

Query  2984  NPADHGTAMERDNNSGSN------GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDA  3145
                  G +     ++G N       EEK ++ +   DE+TS L++LFDAHGIHSA++HDA
Sbjct  945   GRLVTGGSA---TDAGCNLVNKNMDEEKVNHGDKKADEETSFLQSLFDAHGIHSAVNHDA  1001

Query  3146  IVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK  3325
             I+NAHDE+K+KLEE ASRVAQRAAEALRQSR+LRSQES+ +PTWTG+SGTAGAP S+++K
Sbjct  1002  IMNAHDEDKIKLEEHASRVAQRAAEALRQSRILRSQESITVPTWTGKSGTAGAPSSLRRK  1061

Query  3326  FGSTLNPQLVTSSKPLEE-SSMISSRRNgiaagasagkalssaellakiRGNQERAISDG  3502
             FGST+N QLV++S+PLEE  +  +SR N  AAGAS+GKALSSAELLA+I+GNQ+RA+SDG
Sbjct  1062  FGSTINSQLVSTSRPLEEVQNNETSRPNSFAAGASSGKALSSAELLARIKGNQQRAVSDG  1121

Query  3503  LEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIV  3682
             LE  HQF  G+ S +  R+A NG S+ S  S+G+QPE+LIRQ+CTFIQR+GGSTSSASIV
Sbjct  1122  LE--HQFVLGAPSTAGERSAVNGHSK-SSSSSGVQPELLIRQICTFIQRRGGSTSSASIV  1178

Query  3683  EHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             +HF+ R+PSKDL LFKNLLKEIATL+K+P+GS WILKPEY+++
Sbjct  1179  DHFKERIPSKDLPLFKNLLKEIATLEKSPDGSSWILKPEYRDQ  1221



>ref|XP_010262355.1| PREDICTED: protein CHROMATIN REMODELING 8 isoform X4 [Nelumbo 
nucifera]
Length=1228

 Score =  1546 bits (4004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 839/1243 (67%), Positives = 988/1243 (79%), Gaps = 40/1243 (3%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSME---LEATEHNATS  325
             MEE+EEDR+L SSLGVTSANPEDIER IF + +N     +EA  S E   L+  +    S
Sbjct  1     MEEEEEDRILLSSLGVTSANPEDIERGIFTEVKNDVGNGSEAEESTEEQLLQEEKDIGPS  60

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
             ST++  +YNKLRAVE EI AV +  E      RN   V D  D  EK D + + +  QA 
Sbjct  61    STRRAKLYNKLRAVEVEINAVAASVEHA----RNAASVLDSIDNEEKEDFQDDGNVVQAS  116

Query  506   lndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVV  685
              N L L RALAADRL SL KTKAQL+K++S+L  + T  T S+  D        ++ D++
Sbjct  117   PNGLTLHRALAADRLNSLKKTKAQLEKQLSELDKNDT--TTSIAHD-------KLIHDLI  167

Query  686   KGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGIL  865
             K  P+PKR+LKE K  SK+ KKR KT    +D DFDAVL+AAS+G VETE+D+LVRKGIL
Sbjct  168   KEDPRPKRKLKEVKHSSKDSKKRQKTVMFSEDVDFDAVLDAASAGLVETERDKLVRKGIL  227

Query  866   TPFHKLKGFERQIQEPGQSSRHSM----QDNGDLVSTSLANAIQSISEAAQSRPTTKLLD  1033
             TPFHKLKGFER++Q PG S   ++    +++ +L   S+A   QSISEA Q+RPTTKLLD
Sbjct  228   TPFHKLKGFERRLQPPGPSDAQNLPPEEENSQNLALASVARVAQSISEAVQTRPTTKLLD  287

Query  1034  SSLLPKLEPPTYPFQTPRKHVKISQSAENGRN-DKRKR--RPTPGKKWRVKVSRENK-DE  1201
             +  LPKL+ PT PF   +K +K+S    + +N DKRK+  RP P KKWR  +SRE K  E
Sbjct  288   AKDLPKLDAPTRPFYRLKKPLKLSPDTNSEKNNDKRKKQKRPLPDKKWRKVISREEKLYE  347

Query  1202  GPDVE-----ISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWE  1366
             G D +      S YE+E  D + DD  PP VMLEGGLKIPE IF KLFDYQKVGVQWLWE
Sbjct  348   GSDDQRDSFVTSDYEEENQDVEDDDREPPSVMLEGGLKIPEAIFSKLFDYQKVGVQWLWE  407

Query  1367  LHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPS  1546
             LHCQ+AGGIIGDEMGLGKT+QV++FLG+LHFS  YK SI++CP+TLL QW+RE KKWYPS
Sbjct  408   LHCQRAGGIIGDEMGLGKTIQVISFLGALHFSKMYKSSIVICPVTLLHQWRREVKKWYPS  467

Query  1547  FHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSD  1726
             FHVEILHDS      KKK   S ++D  SE   D D E  L  ++TKKWD LI  VLGS+
Sbjct  468   FHVEILHDSAQVPIKKKKRVNSDKTDEASEGSPDSDNEMPLLTKSTKKWDFLIERVLGSE  527

Query  1727  SGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSP  1906
             SGLLITTYEQLRLLGEKLLD+EWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+P
Sbjct  528   SGLLITTYEQLRLLGEKLLDVEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAP  587

Query  1907  IQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDL  2086
             IQNKL+ELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRDL
Sbjct  588   IQNKLAELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRDL  647

Query  2087  IMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGI  2266
             IMPYLLRRMK DVNA LPKKTEHV+FCSLT+ QRS+Y+AFLAS++VEQIFDGS+N+LYGI
Sbjct  648   IMPYLLRRMKVDVNAHLPKKTEHVLFCSLTAEQRSVYRAFLASSEVEQIFDGSRNSLYGI  707

Query  2267  DVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQML  2446
             DVMRKICNHPDLLEREHS R+PDYGNPERSGKMKVV++VLK+WKDQGHRVL F+QTQQML
Sbjct  708   DVMRKICNHPDLLEREHSSRNPDYGNPERSGKMKVVSQVLKVWKDQGHRVLLFTQTQQML  767

Query  2447  DILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANR  2626
             DILENFL++GGY YRRMDG TPVKQRMALIDEFNN+ ++FIFILTT+VGGLGTNLTGANR
Sbjct  768   DILENFLISGGYSYRRMDGLTPVKQRMALIDEFNNSNDVFIFILTTKVGGLGTNLTGANR  827

Query  2627  VIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILK  2806
             VIIFDPDWNPS DMQARERAWRIGQ KDVTVYRLITRGTIEEKVYHRQIYKH LTNKILK
Sbjct  828   VIIFDPDWNPSTDMQARERAWRIGQTKDVTVYRLITRGTIEEKVYHRQIYKHFLTNKILK  887

Query  2807  NPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTN  2986
             NPQQRR FKARD+KDLF L D  ENG+TE+S+IFSQLS DVNI G    +Q+K ++   N
Sbjct  888   NPQQRRFFKARDMKDLFTLQDHEENGTTETSNIFSQLSGDVNILGIHKDNQDKQRT--PN  945

Query  2987  PADHGT---AMERDNNSGSN-----GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHD  3142
              A+  T   A++R NNS +      G+EK D ++G+VDE+TS+LR+LFDAHGIHSA++HD
Sbjct  946   AAEAFTDDAAVDRANNSANGPSPRKGKEKIDQSDGEVDEETSVLRSLFDAHGIHSAVNHD  1005

Query  3143  AIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKK  3322
              I+NA+DEEK++LEE+AS+VAQRAAEALR+SRMLRS++S+++PTWTGRSG AG PP  +K
Sbjct  1006  VIMNANDEEKMRLEEKASQVAQRAAEALRKSRMLRSKDSISVPTWTGRSGAAGGPPEARK  1065

Query  3323  KFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDG  3502
             +FGSTLN QLV S      S    SR NG AAG+SAGKALSSA+LLAKIRGNQE+A+SDG
Sbjct  1066  RFGSTLNSQLVNSRSSEGTSGSGESRINGFAAGSSAGKALSSADLLAKIRGNQEKAVSDG  1125

Query  3503  LEHQHQFNSGSSSNSRTRAAENGASRPSHGS-AGMQPEVLIRQVCTFIQRKGGSTSSASI  3679
             LEHQ    SGSS+N++  +    +S       A +QPE+LIRQ+CTFIQ++GGST+S+SI
Sbjct  1126  LEHQFGLVSGSSNNTQHLSDSGPSSSRPSSKLAAVQPEILIRQICTFIQQRGGSTTSSSI  1185

Query  3680  VEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
             VEHF+ R+P KDLALFKNLLKEIATL+KNPNGS W+LKPEYQ+
Sbjct  1186  VEHFKDRIPYKDLALFKNLLKEIATLEKNPNGSSWVLKPEYQQ  1228



>ref|XP_010262354.1| PREDICTED: protein CHROMATIN REMODELING 8 isoform X3 [Nelumbo 
nucifera]
Length=1229

 Score =  1546 bits (4003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 837/1244 (67%), Positives = 986/1244 (79%), Gaps = 41/1244 (3%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSME---LEATEHNATS  325
             MEE+EEDR+L SSLGVTSANPEDIER IF + +N     +EA  S E   L+  +    S
Sbjct  1     MEEEEEDRILLSSLGVTSANPEDIERGIFTEVKNDVGNGSEAEESTEEQLLQEEKDIGPS  60

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
             ST++  +YNKLRAVE EI AV +  E      RN   V D  D  EK D + + +  QA 
Sbjct  61    STRRAKLYNKLRAVEVEINAVAASVEHA----RNAASVLDSIDNEEKEDFQDDGNVVQAS  116

Query  506   lndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVV  685
              N L L RALAADRL SL KTKAQL+K++S+L  + T  T S+  D        ++ D++
Sbjct  117   PNGLTLHRALAADRLNSLKKTKAQLEKQLSELDKNDT--TTSIAHD-------KLIHDLI  167

Query  686   KGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGIL  865
             K  P+PKR+LKE K  SK+ KKR KT    +D DFDAVL+AAS+G VETE+D+LVRKGIL
Sbjct  168   KEDPRPKRKLKEVKHSSKDSKKRQKTVMFSEDVDFDAVLDAASAGLVETERDKLVRKGIL  227

Query  866   TPFHKLKGFERQIQEPGQSSRHSM----QDNGDLVSTSLANAIQSISEAAQSRPTTKLLD  1033
             TPFHKLKGFER++Q PG S   ++    +++ +L   S+A   QSISEA Q+RPTTKLLD
Sbjct  228   TPFHKLKGFERRLQPPGPSDAQNLPPEEENSQNLALASVARVAQSISEAVQTRPTTKLLD  287

Query  1034  SSLLPKLEPPTYPFQTPRKHVKISQSAENGRN-DKRKR--RPTPGKKWRVKVSRENK---  1195
             +  LPKL+ PT PF   +K +K+S    + +N DKRK+  RP P KKWR  +SRE K   
Sbjct  288   AKDLPKLDAPTRPFYRLKKPLKLSPDTNSEKNNDKRKKQKRPLPDKKWRKVISREEKLYE  347

Query  1196  ----DEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLW  1363
                 D+      S YE+E  D + DD  PP VMLEGGLKIPE IF KLFDYQKVGVQWLW
Sbjct  348   GSEDDQRDSFVTSDYEEENQDVEDDDREPPSVMLEGGLKIPEAIFSKLFDYQKVGVQWLW  407

Query  1364  ELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYP  1543
             ELHCQ+AGGIIGDEMGLGKT+QV++FLG+LHFS  YK SI++CP+TLL QW+RE KKWYP
Sbjct  408   ELHCQRAGGIIGDEMGLGKTIQVISFLGALHFSKMYKSSIVICPVTLLHQWRREVKKWYP  467

Query  1544  SFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGS  1723
             SFHVEILHDS      KKK   S ++D  SE   D D E  L  ++TKKWD LI  VLGS
Sbjct  468   SFHVEILHDSAQVPIKKKKRVNSDKTDEASEGSPDSDNEMPLLTKSTKKWDFLIERVLGS  527

Query  1724  DSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGS  1903
             +SGLLITTYEQLRLLGEKLLD+EWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+
Sbjct  528   ESGLLITTYEQLRLLGEKLLDVEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGA  587

Query  1904  PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRD  2083
             PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRD
Sbjct  588   PIQNKLAELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRD  647

Query  2084  LIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYG  2263
             LIMPYLLRRMK DVNA LPKKTEHV+FCSLT+ QRS+Y+AFLAS++VEQIFDGS+N+LYG
Sbjct  648   LIMPYLLRRMKVDVNAHLPKKTEHVLFCSLTAEQRSVYRAFLASSEVEQIFDGSRNSLYG  707

Query  2264  IDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQM  2443
             IDVMRKICNHPDLLEREHS R+PDYGNPERSGKMKVV++VLK+WKDQGHRVL F+QTQQM
Sbjct  708   IDVMRKICNHPDLLEREHSSRNPDYGNPERSGKMKVVSQVLKVWKDQGHRVLLFTQTQQM  767

Query  2444  LDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGAN  2623
             LDILENFL++GGY YRRMDG TPVKQRMALIDEFNN+ ++FIFILTT+VGGLGTNLTGAN
Sbjct  768   LDILENFLISGGYSYRRMDGLTPVKQRMALIDEFNNSNDVFIFILTTKVGGLGTNLTGAN  827

Query  2624  RVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKIL  2803
             RVIIFDPDWNPS DMQARERAWRIGQ KDVTVYRLITRGTIEEKVYHRQIYKH LTNKIL
Sbjct  828   RVIIFDPDWNPSTDMQARERAWRIGQTKDVTVYRLITRGTIEEKVYHRQIYKHFLTNKIL  887

Query  2804  KNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKT  2983
             KNPQQRR FKARD+KDLF L D  ENG+TE+S+IFSQLS DVNI G    +Q+K ++   
Sbjct  888   KNPQQRRFFKARDMKDLFTLQDHEENGTTETSNIFSQLSGDVNILGIHKDNQDKQRT--P  945

Query  2984  NPADHGT---AMERDNNSGSN-----GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDH  3139
             N A+  T   A++R NNS +      G+EK D ++G+VDE+TS+LR+LFDAHGIHSA++H
Sbjct  946   NAAEAFTDDAAVDRANNSANGPSPRKGKEKIDQSDGEVDEETSVLRSLFDAHGIHSAVNH  1005

Query  3140  DAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIK  3319
             D I+NA+DEEK++LEE+AS+VAQRAAEALR+SRMLRS++S+++PTWTGRSG AG PP  +
Sbjct  1006  DVIMNANDEEKMRLEEKASQVAQRAAEALRKSRMLRSKDSISVPTWTGRSGAAGGPPEAR  1065

Query  3320  KKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISD  3499
             K+FGSTLN QLV S      S    SR NG AAG+SAGKALSSA+LLAKIRGNQE+A+SD
Sbjct  1066  KRFGSTLNSQLVNSRSSEGTSGSGESRINGFAAGSSAGKALSSADLLAKIRGNQEKAVSD  1125

Query  3500  GLEHQHQFNSGSSSNSRTRAAENGASRPSHGS-AGMQPEVLIRQVCTFIQRKGGSTSSAS  3676
             GLEHQ    SGSS+N++  +    +S       A +QPE+LIRQ+CTFIQ++GGST+S+S
Sbjct  1126  GLEHQFGLVSGSSNNTQHLSDSGPSSSRPSSKLAAVQPEILIRQICTFIQQRGGSTTSSS  1185

Query  3677  IVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
             IVEHF+ R+P KDLALFKNLLKEIATL+KNPNGS W+LKPEYQ+
Sbjct  1186  IVEHFKDRIPYKDLALFKNLLKEIATLEKNPNGSSWVLKPEYQQ  1229



>gb|KHG13918.1| DNA repair rhp26 [Gossypium arboreum]
Length=1225

 Score =  1521 bits (3938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 828/1242 (67%), Positives = 994/1242 (80%), Gaps = 43/1242 (3%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATE----HNATSS  328
             E+EEDR+L SSLGVTSANPEDIER++  + EN     +E   S E E  +    +N +SS
Sbjct  2     EEEEDRILLSSLGVTSANPEDIERDVLAKAENNALDGSEVGGSTEEEPADKLEGNNPSSS  61

Query  329   TKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPl  508
               +  + NKLRAVE EI AV S  E+ ++    D    D      KR+ + ++S  Q   
Sbjct  62    ASQVKLLNKLRAVEFEIDAVASTVEERKDVTSGDHDAKDEHVEEGKRE-DDDESAMQLRS  120

Query  509   ndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVK  688
              D  LQRALA DRLKSL  TKAQL+KE+S L  +S+ + +         + + ++ D+VK
Sbjct  121   RDSTLQRALATDRLKSLKNTKAQLEKELSGLLKESSSEGV---------KHDKLIEDLVK  171

Query  689   GQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILT  868
              +P+ KR+ KE + PSK K+KR K+ S +DD DFDAVL+AAS+GFVETE+D+LVRKGILT
Sbjct  172   EEPRLKRKSKEIQKPSKTKQKRKKSVSFNDDVDFDAVLDAASAGFVETERDELVRKGILT  231

Query  869   PFHKLKGFERQIQEPGQSSRHSM----QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDS  1036
             PFHKLKGFER++Q+PG S+ H++     +  D+VS S+A A +SISEAAQ RP+TKLLD 
Sbjct  232   PFHKLKGFERRLQQPGTSNEHNVPYEEDEKDDIVSASVARAAKSISEAAQVRPSTKLLDP  291

Query  1037  SLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRKRR---PTPGKKWRVKVSRENKDE--  1201
               LPKL+ PT+PFQ  +K +K SQS E G N   KR+   P P KKWR ++SRE +D   
Sbjct  292   DALPKLDAPTFPFQRQKKSLKFSQSKEVGENKSSKRKKKRPLPDKKWRKRISREERDMEV  351

Query  1202  GPDVE--ISSYedekddedmdd---eGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWE  1366
             G DV   ++S+++E+D +  +D     P +V LEGGLKIPETIF KLFDYQKVGVQW+WE
Sbjct  352   GEDVRDNLTSHDEEEDQKGTEDVDDNDPVYVTLEGGLKIPETIFSKLFDYQKVGVQWMWE  411

Query  1367  LHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPS  1546
             LHCQ+AGGIIGDEMGLGKTVQVL+FLG+LHFSN Y+PSI+VCP+TLL+QWKREA++WYP 
Sbjct  412   LHCQRAGGIIGDEMGLGKTVQVLSFLGALHFSNMYEPSIVVCPVTLLRQWKREARRWYPK  471

Query  1547  FHVEILHDSVND-FhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGS  1723
             FHVEILHDS  D  + K +   + ESD ESE  +D D E NL  +++KKW+ LIN VL S
Sbjct  472   FHVEILHDSAQDPAYKKNQAKSNEESDYESEGSVDSDYEGNLCSKSSKKWESLINRVLRS  531

Query  1724  DSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGS  1903
              SGLLITTYEQLRL+GEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+
Sbjct  532   KSGLLITTYEQLRLIGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGA  591

Query  1904  PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRD  2083
             PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANA+PLQVSTAYRCAVVLRD
Sbjct  592   PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANASPLQVSTAYRCAVVLRD  651

Query  2084  LIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYG  2263
             L+MPYLLRRMKADVNA LPKK EHV+FCSLT+ QRS+Y+AFLAS+DVEQI DG +N+LYG
Sbjct  652   LVMPYLLRRMKADVNAHLPKKAEHVLFCSLTAEQRSVYRAFLASSDVEQILDGGRNSLYG  711

Query  2264  IDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQM  2443
             IDVMRKICNHPDLLEREHSC++PDYGNPERSGKMKVVA+VL++WKDQGHRVL F+QTQQM
Sbjct  712   IDVMRKICNHPDLLEREHSCQNPDYGNPERSGKMKVVAQVLQVWKDQGHRVLLFAQTQQM  771

Query  2444  LDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGAN  2623
             LDILENFL T GY YRRMDG TPVKQRMALIDEFNN+ +IFIFILTT+VGGLGTNLTGAN
Sbjct  772   LDILENFLTTSGYCYRRMDGHTPVKQRMALIDEFNNSDDIFIFILTTKVGGLGTNLTGAN  831

Query  2624  RVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKIL  2803
             RVIIFDPDWNPS DMQARERAWRIGQ +DVTVYRLITRGTIEEKVYHRQIYKH LTNKIL
Sbjct  832   RVIIFDPDWNPSTDMQARERAWRIGQNRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKIL  891

Query  2804  KNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKT  2983
             KNPQQRR FKARD+KDLFVLND+GENGSTE+S+IFSQLSEDVNI   Q   + K +  + 
Sbjct  892   KNPQQRRFFKARDMKDLFVLNDEGENGSTETSNIFSQLSEDVNIVVMQKDKRHKQEHSRA  951

Query  2984  --NPADHGTAMERDNNSGSN----GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDA  3145
               + +DHG     ++++GS+    G+EK D+++G+VDE+ +ILR+LFDA GIHSA++HDA
Sbjct  952   AGSHSDHGAGRNGNSSNGSHSKRKGKEKDDHSDGEVDEEKNILRSLFDAQGIHSAVNHDA  1011

Query  3146  IVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK  3325
             IVNA+DEEK++LEEQAS+VAQRAAEALRQSRMLRS +S+++PTWTG+SG AGAP +++KK
Sbjct  1012  IVNANDEEKVRLEEQASQVAQRAAEALRQSRMLRSHDSISVPTWTGKSGAAGAPSAVRKK  1071

Query  3326  FGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGL  3505
             FGS LN QLV   KP  ESS         AAGA+AGKALSSAELLA+IRGNQE+AI  GL
Sbjct  1072  FGSALNTQLV---KPSGESSSTGI-----AAGAAAGKALSSAELLARIRGNQEQAIGAGL  1123

Query  3506  EHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVE  3685
             EHQ    S SS+ +R   +    SR S  S+ +QPEVLIRQ+CTFIQ+KGGST SASIV+
Sbjct  1124  EHQFGSVSSSSNTTRPTISRTSRSRSSSNSSSVQPEVLIRQICTFIQQKGGSTDSASIVD  1183

Query  3686  HFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             HF+ R+PS +L LFKNLLKEIA L+K+PNGS W+LKPEY+++
Sbjct  1184  HFKDRIPSNNLPLFKNLLKEIAKLEKDPNGSRWVLKPEYRQQ  1225



>gb|KDP26514.1| hypothetical protein JCGZ_17672 [Jatropha curcas]
Length=1227

 Score =  1514 bits (3921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 826/1243 (66%), Positives = 992/1243 (80%), Gaps = 42/1243 (3%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNAT---S  325
             MEEDE D+VL SSLGVTSANPEDIER++  +  N  + + EA  S E E  E +     +
Sbjct  1     MEEDE-DKVLLSSLGVTSANPEDIERDVLAEVTNDAENNGEARGSTEEELPEISKNIDPA  59

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
             ST +  +YN+LRAVE EI AV S F+Q++N   +++   D  DG E  D + ++S  Q  
Sbjct  60    STSQAKLYNRLRAVEYEIDAVASTFKQVKNVAGSEDHAYDDVDGVEGGDRKDDESGVQVS  119

Query  506   lndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVV  685
              +   LQ+ALAADRLKSL +TKAQL++E SD+  D     ++  +         +L ++V
Sbjct  120   PSGFTLQQALAADRLKSLKRTKAQLEQEFSDMCKDDMTKGVNYEK---------MLANLV  170

Query  686   KGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGIL  865
             K + +PKR++KE + P K K K  K  S  DD DFDA+L+AAS GFVETE+D+LVRKGIL
Sbjct  171   KEESRPKRKMKEIQKPGKKKGKSEKVVSFSDDTDFDAMLDAASGGFVETERDELVRKGIL  230

Query  866   TPFHKLKGFERQIQEPGQSSRHSMQDNGD----LVSTSLANAIQSISEAAQSRPTTKLLD  1033
             TPFHKLKGFER++Q PG SSR+S+ +  D    L S S+A A +SISEA ++RP TKLLD
Sbjct  231   TPFHKLKGFERRLQHPGPSSRYSVSEEEDKSDELASDSIARAAKSISEAVKARPVTKLLD  290

Query  1034  SSLLPKLEPPTYPFQTPRKHVKISQSAENG-----RNDKRKRRPTPGKKWRVKVSRE---  1189
             S  LPKL+ PT PFQ  +K ++I+QS E+         K+++RP PG+KWR ++SRE   
Sbjct  291   SDDLPKLDGPTRPFQRLKKPLQINQSPESDAEKRKSFKKKRKRPLPGQKWRRRLSREEIH  350

Query  1190  ---NKDEGPDVEISSYede--kddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQ  1354
                +   G  V  SSYE+E  +D ED++D+  PFV LEGGLKIPE IF KLF+YQKVGVQ
Sbjct  351   LEESNARGSSV-TSSYEEERLEDSEDVEDDDSPFVTLEGGLKIPEAIFSKLFEYQKVGVQ  409

Query  1355  WLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKK  1534
             WLWELHCQ+AGGIIGDEMGLGKT+QVL+FLG+LHFSN YKPSI+VCP+TLL+QWKREA+K
Sbjct  410   WLWELHCQRAGGIIGDEMGLGKTIQVLSFLGALHFSNMYKPSIVVCPVTLLRQWKREAQK  469

Query  1535  WYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHV  1714
             WYP FHVE+LHDS  D H +KK + SH SD ESE  LD + E  LS +   KWD LIN V
Sbjct  470   WYPCFHVELLHDSAEDLHHRKKQADSHNSDDESEGSLDSNYEGKLSSK-ANKWDSLINRV  528

Query  1715  LGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIM  1894
             L S+SGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIM
Sbjct  529   LKSESGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIM  588

Query  1895  TGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVV  2074
             TG+PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANA+PLQVSTAYRCAVV
Sbjct  589   TGAPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANASPLQVSTAYRCAVV  648

Query  2075  LRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNA  2254
             LRDLIMPYLLRRMK DVNAQLPKKTEHV+FCSLT  QRS Y+AFLAST+VEQI DG++N+
Sbjct  649   LRDLIMPYLLRRMKVDVNAQLPKKTEHVLFCSLTEDQRSAYRAFLASTEVEQILDGNRNS  708

Query  2255  LYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQT  2434
             LYGIDVMRKICNHPDLLEREH+C++PDYGNPERSGKMKVVA+VLK+W++QGHRVL F+QT
Sbjct  709   LYGIDVMRKICNHPDLLEREHACQNPDYGNPERSGKMKVVAQVLKVWQEQGHRVLLFAQT  768

Query  2435  QQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLT  2614
             QQMLDILENFL++GGY YRRMDG TPVKQRMALIDEFNN  ++FIFILTT+VGGLGTNLT
Sbjct  769   QQMLDILENFLISGGYNYRRMDGMTPVKQRMALIDEFNNCDDVFIFILTTKVGGLGTNLT  828

Query  2615  GANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTN  2794
             GANRVIIFDPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH LTN
Sbjct  829   GANRVIIFDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQIYKHFLTN  888

Query  2795  KILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKS  2974
             KILKNPQQ+R FKARD+KDLF LND+ E G TE+S+IFSQLSEDV++ G +   ++K KS
Sbjct  889   KILKNPQQKRFFKARDMKDLFALNDEEETGMTETSNIFSQLSEDVSVVGSKKEKKDKQKS  948

Query  2975  IKTNPADHGTAMERDNN------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMD  3136
              +   +      + + N      S   G+E ADN++G+VDE+T+ILR+LFDA GIHSA++
Sbjct  949   CRGTASHAYDDSDDEENKAEVRPSRRKGKEMADNSDGEVDEETNILRSLFDAQGIHSAVN  1008

Query  3137  HDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSI  3316
             HDAIVNAHDEEK++LEEQAS+VAQRAAEALRQSR+LRS++SV++PTWTG+SGTAGAP S+
Sbjct  1009  HDAIVNAHDEEKIRLEEQASQVAQRAAEALRQSRLLRSRDSVSVPTWTGKSGTAGAPSSV  1068

Query  3317  KKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAIS  3496
             ++KFGST+N QL+ SS   E S    S  NG++AGASAGKALSSAELLA+IRGNQERA+ 
Sbjct  1069  RQKFGSTVNSQLIRSSD--ESSGNKISNLNGLSAGASAGKALSSAELLARIRGNQERAVG  1126

Query  3497  DGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSAS  3676
               L+   QF   SSS +R  +  NG S+PS   + +QPE+LIRQ+CTFIQ +GG+T SA+
Sbjct  1127  AALD--QQFGLASSSANRAVSENNGVSKPSKNLSSVQPEILIRQICTFIQERGGTTDSAT  1184

Query  3677  IVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             IVEHF+ R+PSKDL LFKNLLKEIATL+K+  G  W+LKPEY+
Sbjct  1185  IVEHFKDRIPSKDLPLFKNLLKEIATLEKDSTGKLWVLKPEYR  1227



>ref|XP_007050253.1| DNA excision repair protein E [Theobroma cacao]
 gb|EOX94410.1| DNA excision repair protein E [Theobroma cacao]
Length=1228

 Score =  1511 bits (3913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 836/1251 (67%), Positives = 996/1251 (80%), Gaps = 58/1251 (5%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEAT---EHNATSS-  328
             E+EEDR+L SSLGVTSANPEDIER+I  + EN     +E   S E E T   E N  SS 
Sbjct  2     EEEEDRILLSSLGVTSANPEDIERDILAKAENNAGDGSEVGGSTEEEPTGKSESNDPSSL  61

Query  329   TKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDRED--GHEKRDIETEQSTTQA  502
               +  + NKLRA+E EI AV S  E+  N    D++     D    EK +IE ++S    
Sbjct  62    ANQAKLLNKLRAIEFEIDAVASTVEEGTNVVSGDDRADHDADDDSTEKGNIEDDESVMHV  121

Query  503   PlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDV  682
                +L LQ ALA DRLKSL KTKAQL+KE+S L  +S+ + +         + + +++D+
Sbjct  122   SSLELTLQHALATDRLKSLKKTKAQLEKELSGLLVESSSEGI---------KHDKLIKDL  172

Query  683   VKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGI  862
             VK +P+PKR+ KE + PSKN++KR KT S +DD DFDAVL+AAS+GFVETE+DQLVRKGI
Sbjct  173   VKEEPRPKRKSKEIQRPSKNQEKRKKTVSFNDDVDFDAVLDAASAGFVETERDQLVRKGI  232

Query  863   LTPFHKLKGFERQIQEPGQSSRHSM----QDNGDLVSTSLANAIQSISEAAQSRPTTKLL  1030
             LTPFHKLKGFER++Q+PG S  HS      +N  LVS+S+A A +SISEAAQ+RP+TKLL
Sbjct  233   LTPFHKLKGFERRLQQPGTSDGHSTPVEEDENDTLVSSSVARAAKSISEAAQARPSTKLL  292

Query  1031  DSSLLPKLEPPTYPFQTPRKHVKISQSAENGRND---KRKRRPTPGKKWRVKVSRENKD-  1198
             D+  LPKL+ PT+PFQ  RK +K  Q+ E   N    ++K+RP P KKWR  +SRE +D 
Sbjct  293   DTEALPKLDAPTFPFQRLRKPLKFPQTKEVEENKGLKRKKKRPLPDKKWRKHISREERDL  352

Query  1199  -EGPDV--EISSYedekddedmddeG---PPFVMLEGGLKIPETIFDKLFDYQKVGVQWL  1360
              EG D   +++S+++E++ ED +D     PP+V LEGGLKIPETIF KLFDYQKVGVQWL
Sbjct  353   EEGEDERDKLTSHDEEENQEDREDMDDSEPPYVTLEGGLKIPETIFSKLFDYQKVGVQWL  412

Query  1361  WELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWY  1540
             WELHCQ+AGGIIGDEMGLGKT+QVL+FLG+LHFSN Y+PSI+VCP+TLL+QWKREA++WY
Sbjct  413   WELHCQRAGGIIGDEMGLGKTIQVLSFLGALHFSNMYEPSIVVCPVTLLRQWKREARRWY  472

Query  1541  PSFHVEILHDSVND-FhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVL  1717
               FH+EILHDS  D  ++K +     ESD ESE  LD D E N S +++KKWD LIN VL
Sbjct  473   SKFHIEILHDSAQDPAYEKSQAKSHGESDHESEGSLDSDYEGNFSSKSSKKWDSLINRVL  532

Query  1718  GSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMT  1897
              S SGLLITTYEQLRLLG KLLDI+WGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMT
Sbjct  533   RSKSGLLITTYEQLRLLGGKLLDIQWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMT  592

Query  1898  GSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVL  2077
             G+PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANA+PLQVSTAYRCAVVL
Sbjct  593   GAPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANASPLQVSTAYRCAVVL  652

Query  2078  RDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNAL  2257
             RDLIMPYLLRRMKADVN QLPKKTEHV+FCSLT+ QRS+Y+AFLAS++VEQI DGS+N+L
Sbjct  653   RDLIMPYLLRRMKADVNVQLPKKTEHVLFCSLTADQRSVYRAFLASSEVEQILDGSRNSL  712

Query  2258  YGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQ  2437
             YGIDVMRKICNHPDLLER+HSC++ DYGNPERSGKMKVVA+VLK+WK+QGHRVL F+QTQ
Sbjct  713   YGIDVMRKICNHPDLLERDHSCQNQDYGNPERSGKMKVVAQVLKVWKEQGHRVLLFAQTQ  772

Query  2438  QMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTG  2617
             QMLDILENFL+T  Y YRRMDG TPVKQRMALIDEFNN+ +IFIFILTT+VGGLGTNLTG
Sbjct  773   QMLDILENFLITSDYDYRRMDGHTPVKQRMALIDEFNNSDDIFIFILTTKVGGLGTNLTG  832

Query  2618  ANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNK  2797
             A+RVIIFDPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH LTNK
Sbjct  833   ADRVIIFDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQIYKHFLTNK  892

Query  2798  ILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQH---------  2950
             ILKNPQQRR FKARD+KDLF LNDDGENGSTE+S+IFSQLS DVNI G Q          
Sbjct  893   ILKNPQQRRFFKARDMKDLFTLNDDGENGSTETSNIFSQLSADVNIVGAQKDKQHKQKQL  952

Query  2951  ----PDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHG  3118
                 PD +   S K N ++ G +  +        +EK D+ +G+VDE+ +ILR+LFDA G
Sbjct  953   KAAVPDADPTASGKGNYSNTGLSKRKGKE-----KEKDDHGDGEVDEEKNILRSLFDAQG  1007

Query  3119  IHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTA  3298
             IHSA++HDAI++AHDEEK++LEEQAS+VAQRAAEALRQSRMLRS +S+++PTWTG+SG A
Sbjct  1008  IHSAVNHDAIMSAHDEEKVRLEEQASQVAQRAAEALRQSRMLRSHDSISVPTWTGKSGAA  1067

Query  3299  GAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGN  3478
             GAP +++KKFGSTLN QLV   KP  ESS      NGIAAGA+AGKALSSAELLA+IRGN
Sbjct  1068  GAPSAVRKKFGSTLNSQLV---KPPGESS-----SNGIAAGAAAGKALSSAELLARIRGN  1119

Query  3479  QERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGG  3658
             QE A+  GLE   QF   SSS +R R+  NGA+R S   + +QPEVLIRQ+CTF+Q++GG
Sbjct  1120  QEEAVGAGLE--QQFGLSSSSFNRARSVVNGATRSSSYVSSVQPEVLIRQICTFLQQRGG  1177

Query  3659  STSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             ST SASIV+HF+ R+P  +L LFKNLLKEIA L+K+PNGS WILKPEY ++
Sbjct  1178  STDSASIVDHFKDRIPPSNLPLFKNLLKEIAILEKDPNGSVWILKPEYGQQ  1228



>ref|XP_010101407.1| DNA repair and recombination protein RAD26 [Morus notabilis]
 gb|EXB88373.1| DNA repair and recombination protein RAD26 [Morus notabilis]
Length=1218

 Score =  1506 bits (3899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 819/1236 (66%), Positives = 991/1236 (80%), Gaps = 44/1236 (4%)
 Frame = +2

Query  167   EEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNAT---SSTKK  337
             +EDR+L  SLGVTSANPEDIERNI  Q  +    S+E    +E  A E + T   S+  +
Sbjct  4     DEDRILLRSLGVTSANPEDIERNILSQATSNV-GSSEVGEDIEENALEQSETVDPSTASQ  62

Query  338   TDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlndl  517
               +YNKLRAVE EI AV S  +      +N++   D +   E+     E+   Q   N+L
Sbjct  63    ARLYNKLRAVEFEIDAVASTVKPERKILQNEDNAYDGDGSTEQ---GAEEDGPQDSSNEL  119

Query  518   dlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQP  697
             DL  ALA DRL+SL KTKAQ++KE+S L        +   R I          D+VK +P
Sbjct  120   DLHHALATDRLRSLKKTKAQIEKELSGLRKSKPSKGVEHDRSIF---------DIVKEEP  170

Query  698   KPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFH  877
             +PKR+LKE K   K+ +KR KT S D+DDDF+A L+AAS+GFVETE+D+L+RKGILTPFH
Sbjct  171   RPKRKLKEVKKTGKSSEKRHKTVSFDEDDDFNAALDAASTGFVETERDELIRKGILTPFH  230

Query  878   KLKGFERQIQEPGQSSRHSM----QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSSLL  1045
             KLKGFER+IQEPG S RH++    + N D  S S+A A ++++EAAQ RPTTKLLDS  L
Sbjct  231   KLKGFERRIQEPGPSQRHNISSEKERNDDFASLSVARAAKAMAEAAQGRPTTKLLDSDAL  290

Query  1046  PKLEPPTYPFQTPRKHVKISQSAEN----GRNDKRK-RRPTPGKKWRVKVSRE------N  1192
             PKL+ PT+PF   +  VK+ QS EN     +N +RK +RP P K+W+  +SRE      N
Sbjct  291   PKLDAPTHPFHRLKTSVKVCQSPENEEEKKKNSRRKTKRPLPDKRWQKLISREDNHFEEN  350

Query  1193  KDEGPDVEISS----YedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWL  1360
             +D G D+  S+     ++++D ED DD  PP+++LEGGLKIPE I+++LFDYQKVGVQWL
Sbjct  351   EDIGGDLPTSTGEEEEQEQEDIEDEDDSAPPYIILEGGLKIPEKIYNQLFDYQKVGVQWL  410

Query  1361  WELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWY  1540
             WELHCQ+ GGIIGDEMGLGKT+QVL+FLGSLHFS  YKPSI+VCP+TLL+QWKREA+KWY
Sbjct  411   WELHCQRGGGIIGDEMGLGKTIQVLSFLGSLHFSGMYKPSIVVCPVTLLRQWKREARKWY  470

Query  1541  PSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLG  1720
             PSF VEILHDS  D  ++KK SKS+ESD ESE  LD D E NLS + + KWD LIN VLG
Sbjct  471   PSFKVEILHDSAQDLDNRKKRSKSYESDYESEGSLDSDYEGNLSSKTSNKWDSLINRVLG  530

Query  1721  SDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTG  1900
             S+SGLLITTYEQLR+LGEKLLDIEWGYAVLDEGHRIRNPN +VTLVCKQLQTVHRIIMTG
Sbjct  531   SESGLLITTYEQLRILGEKLLDIEWGYAVLDEGHRIRNPNAEVTLVCKQLQTVHRIIMTG  590

Query  1901  SPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLR  2080
             +PIQNKLSELWSLFDFVFPGKLGVLPVFEA FAVPIS+GGYANA+PLQVSTAYRCAVVLR
Sbjct  591   APIQNKLSELWSLFDFVFPGKLGVLPVFEAAFAVPISVGGYANASPLQVSTAYRCAVVLR  650

Query  2081  DLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALY  2260
             DLIMPYLLRRMKADVNA LPKKTEHV+FCSLT+ QRS+Y+AFLAS++VEQIFDG +N+LY
Sbjct  651   DLIMPYLLRRMKADVNAHLPKKTEHVLFCSLTTEQRSVYRAFLASSEVEQIFDGGRNSLY  710

Query  2261  GIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQ  2440
             GIDVMRKICNHPDLLERE +C +PDYGNPERSGKMKVV +VLK+WK+QGHRVL F+QTQQ
Sbjct  711   GIDVMRKICNHPDLLEREQACWNPDYGNPERSGKMKVVGQVLKVWKEQGHRVLLFTQTQQ  770

Query  2441  MLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGA  2620
             MLDI+E FL + GY YRRMDG TP+KQRMALIDEFNN+ ++F+FILTT+VGG+GTNLTGA
Sbjct  771   MLDIMETFLTSDGYSYRRMDGLTPIKQRMALIDEFNNSNDVFVFILTTKVGGIGTNLTGA  830

Query  2621  NRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKI  2800
             NRVIIFDPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH LTNKI
Sbjct  831   NRVIIFDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKI  890

Query  2801  LKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIK  2980
             LKNPQQ+R FKARD+KDLF L D+GE G+TE+S+IFSQL+EDVN  G Q  +Q+K  ++ 
Sbjct  891   LKNPQQKRFFKARDMKDLFTLKDEGETGTTETSNIFSQLAEDVNFVGLQKDEQDKQGALA  950

Query  2981  TNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH  3160
                 + GT       S   G+EKAD+++G+VDE+T+IL++LFDAHGIHSA++HD I+NAH
Sbjct  951   YKGNNAGTV-----PSKRKGKEKADSSDGEVDEETNILKSLFDAHGIHSAVNHDLIMNAH  1005

Query  3161  DEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTL  3340
             DEE+++LEE+ASRVAQRAAEALRQSRMLRS+E++++PTWTG+SGTAGAP S+++KFGST+
Sbjct  1006  DEERMRLEEEASRVAQRAAEALRQSRMLRSRENISVPTWTGKSGTAGAPSSVRRKFGSTV  1065

Query  3341  NPQLVTSSKPLEESSMI-SSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQH  3517
             N +L+ SSKP +ESS   +S  NGIAAGASAGKALSSAELLA+IRGNQERA + G++  H
Sbjct  1066  NSKLINSSKPSDESSRNGASNLNGIAAGASAGKALSSAELLARIRGNQERATNAGID--H  1123

Query  3518  QFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRS  3697
             QF + S+ N R ++A  G+SR S   + + PEVLIRQ+CTFIQ+KGG   SA+IV+HFR 
Sbjct  1124  QFGNASNPN-RGKSANIGSSRTSQNLSRVPPEVLIRQICTFIQQKGGRADSATIVQHFRD  1182

Query  3698  RVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             R+PS+DL LFKNLLKEIATL+KN +GS W+LKP+YQ
Sbjct  1183  RIPSEDLPLFKNLLKEIATLEKNRDGSVWVLKPDYQ  1218



>ref|XP_010262353.1| PREDICTED: protein CHROMATIN REMODELING 8 isoform X2 [Nelumbo 
nucifera]
Length=1230

 Score =  1497 bits (3876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 818/1224 (67%), Positives = 965/1224 (79%), Gaps = 46/1224 (4%)
 Frame = +2

Query  230   RNIFG------QTENGFDASNEAARSME---LEATEHNATSSTKKTDMYNKLRAVETEIQ  382
             +NIF       Q +N     +EA  S E   L+  +    SST++  +YNKLRAVE EI 
Sbjct  22    KNIFTKAVLSWQVKNDVGNGSEAEESTEEQLLQEEKDIGPSSTRRAKLYNKLRAVEVEIN  81

Query  383   AVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlndldlqralaadrlKSLL  562
             AV +  E      RN   V D  D  EK D + + +  QA  N L L RALAADRL SL 
Sbjct  82    AVAASVEHA----RNAASVLDSIDNEEKEDFQDDGNVVQASPNGLTLHRALAADRLNSLK  137

Query  563   KTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQPKPKRRLkeakspskn  742
             KTKAQL+K++S+L  + T  T S+  D        ++ D++K  P+PKR+LKE K  SK+
Sbjct  138   KTKAQLEKQLSELDKNDT--TTSIAHD-------KLIHDLIKEDPRPKRKLKEVKHSSKD  188

Query  743   kkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFHKLKGFERQIQEPGQS  922
              KKR KT    +D DFDAVL+AAS+G VETE+D+LVRKGILTPFHKLKGFER++Q PG S
Sbjct  189   SKKRQKTVMFSEDVDFDAVLDAASAGLVETERDKLVRKGILTPFHKLKGFERRLQPPGPS  248

Query  923   SRHSM----QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRK  1090
                ++    +++ +L   S+A   QSISEA Q+RPTTKLLD+  LPKL+ PT PF   +K
Sbjct  249   DAQNLPPEEENSQNLALASVARVAQSISEAVQTRPTTKLLDAKDLPKLDAPTRPFYRLKK  308

Query  1091  HVKISQSAENGRN-DKRKR--RPTPGKKWRVKVSRENK-DEGPDVE-----ISSYedekd  1243
              +K+S    + +N DKRK+  RP P KKWR  +SRE K  EG D +      S YE+E  
Sbjct  309   PLKLSPDTNSEKNNDKRKKQKRPLPDKKWRKVISREEKLYEGSDDQRDSFVTSDYEEENQ  368

Query  1244  dedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKT  1423
             D + DD  PP VMLEGGLKIPE IF KLFDYQKVGVQWLWELHCQ+AGGIIGDEMGLGKT
Sbjct  369   DVEDDDREPPSVMLEGGLKIPEAIFSKLFDYQKVGVQWLWELHCQRAGGIIGDEMGLGKT  428

Query  1424  VQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkg  1603
             +QV++FLG+LHFS  YK SI++CP+TLL QW+RE KKWYPSFHVEILHDS      KKK 
Sbjct  429   IQVISFLGALHFSKMYKSSIVICPVTLLHQWRREVKKWYPSFHVEILHDSAQVPIKKKKR  488

Query  1604  skshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLL  1783
               S ++D  SE   D D E  L  ++TKKWD LI  VLGS+SGLLITTYEQLRLLGEKLL
Sbjct  489   VNSDKTDEASEGSPDSDNEMPLLTKSTKKWDFLIERVLGSESGLLITTYEQLRLLGEKLL  548

Query  1784  DIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGK  1963
             D+EWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PIQNKL+ELWSLFDFVFPGK
Sbjct  549   DVEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQNKLAELWSLFDFVFPGK  608

Query  1964  LGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPK  2143
             LGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMK DVNA LPK
Sbjct  609   LGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKVDVNAHLPK  668

Query  2144  KTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSC  2323
             KTEHV+FCSLT+ QRS+Y+AFLAS++VEQIFDGS+N+LYGIDVMRKICNHPDLLEREHS 
Sbjct  669   KTEHVLFCSLTAEQRSVYRAFLASSEVEQIFDGSRNSLYGIDVMRKICNHPDLLEREHSS  728

Query  2324  RDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDG  2503
             R+PDYGNPERSGKMKVV++VLK+WKDQGHRVL F+QTQQMLDILENFL++GGY YRRMDG
Sbjct  729   RNPDYGNPERSGKMKVVSQVLKVWKDQGHRVLLFTQTQQMLDILENFLISGGYSYRRMDG  788

Query  2504  ATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARER  2683
              TPVKQRMALIDEFNN+ ++FIFILTT+VGGLGTNLTGANRVIIFDPDWNPS DMQARER
Sbjct  789   LTPVKQRMALIDEFNNSNDVFIFILTTKVGGLGTNLTGANRVIIFDPDWNPSTDMQARER  848

Query  2684  AWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVL  2863
             AWRIGQ KDVTVYRLITRGTIEEKVYHRQIYKH LTNKILKNPQQRR FKARD+KDLF L
Sbjct  849   AWRIGQTKDVTVYRLITRGTIEEKVYHRQIYKHFLTNKILKNPQQRRFFKARDMKDLFTL  908

Query  2864  NDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGT---AMERDNNSGS  3034
              D  ENG+TE+S+IFSQLS DVNI G    +Q+K ++   N A+  T   A++R NNS +
Sbjct  909   QDHEENGTTETSNIFSQLSGDVNILGIHKDNQDKQRT--PNAAEAFTDDAAVDRANNSAN  966

Query  3035  N-----GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASR  3199
                   G+EK D ++G+VDE+TS+LR+LFDAHGIHSA++HD I+NA+DEEK++LEE+AS+
Sbjct  967   GPSPRKGKEKIDQSDGEVDEETSVLRSLFDAHGIHSAVNHDVIMNANDEEKMRLEEKASQ  1026

Query  3200  VAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEE  3379
             VAQRAAEALR+SRMLRS++S+++PTWTGRSG AG PP  +K+FGSTLN QLV S      
Sbjct  1027  VAQRAAEALRKSRMLRSKDSISVPTWTGRSGAAGGPPEARKRFGSTLNSQLVNSRSSEGT  1086

Query  3380  SSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRA  3559
             S    SR NG AAG+SAGKALSSA+LLAKIRGNQE+A+SDGLEHQ    SGSS+N++  +
Sbjct  1087  SGSGESRINGFAAGSSAGKALSSADLLAKIRGNQEKAVSDGLEHQFGLVSGSSNNTQHLS  1146

Query  3560  AENGASRPSHGS-AGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNL  3736
                 +S       A +QPE+LIRQ+CTFIQ++GGST+S+SIVEHF+ R+P KDLALFKNL
Sbjct  1147  DSGPSSSRPSSKLAAVQPEILIRQICTFIQQRGGSTTSSSIVEHFKDRIPYKDLALFKNL  1206

Query  3737  LKEIATLKKNPNGSFWILKPEYQE  3808
             LKEIATL+KNPNGS W+LKPEYQ+
Sbjct  1207  LKEIATLEKNPNGSSWVLKPEYQQ  1230



>ref|XP_006443810.1| hypothetical protein CICLE_v10018548mg [Citrus clementina]
 ref|XP_006443811.1| hypothetical protein CICLE_v10018548mg [Citrus clementina]
 ref|XP_006479509.1| PREDICTED: DNA repair and recombination protein RAD26-like isoform 
X1 [Citrus sinensis]
 gb|ESR57050.1| hypothetical protein CICLE_v10018548mg [Citrus clementina]
 gb|ESR57051.1| hypothetical protein CICLE_v10018548mg [Citrus clementina]
Length=1232

 Score =  1497 bits (3876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 819/1249 (66%), Positives = 993/1249 (80%), Gaps = 47/1249 (4%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNAT----  322
             MEEDE DR+L SSLGVTSANPEDIER++    EN   A N        E   H+ +    
Sbjct  1     MEEDE-DRLLLSSLGVTSANPEDIERDVLAAAENV--AGNSNETEESNEEKPHDKSESID  57

Query  323   -SSTKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQ  499
              SST +  +YNKLRAVE EI AV S  + L      ++   D  D  E+   E E+S  Q
Sbjct  58    PSSTSQEKLYNKLRAVEFEIGAVASTVDHLRRVSTKEDNDIDDGDSTEQDGREDEKSAVQ  117

Query  500   APlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRD  679
             A  ND+ LQ AL ADRLKSL KTKAQL KE+S      T   +         + +  ++D
Sbjct  118   ASPNDMTLQHALTADRLKSLKKTKAQLVKELSHFPKGITSKGI---------EHDKFIQD  168

Query  680   VVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKG  859
             +VK + +PKR+ KEA+ P K++ K+ KT S+DDD DFD+ L+AAS+GFVET++D+LVRKG
Sbjct  169   LVKEEHRPKRKSKEAQKPGKDRSKQQKTVSVDDDFDFDSALDAASAGFVETKRDELVRKG  228

Query  860   ILTPFHKLKGFERQIQEPGQSSRHSMQD-----NGDLVSTSLANAIQSISEAAQSRPTTK  1024
             ILTPFHKLKGFER IQ+PG S++ ++ D     + D  S S+  A++ +SEAAQ+RP+TK
Sbjct  229   ILTPFHKLKGFERCIQQPGPSNKQNVPDEREARSNDPFSASVDRALRMMSEAAQARPSTK  288

Query  1025  LLDSSLLPKLEPPTYPFQTPRKHVKISQSAEN-----GRNDKRKRRPTPGKKWRVKVSRE  1189
             LLD   LPKL+ PT PFQ  +   ++ QS E+      R+ ++K+RP P KKWR +++RE
Sbjct  289   LLDPESLPKLDGPTRPFQRLKTPFRMPQSEESEVEKKKRSKRKKKRPLPDKKWRKRIARE  348

Query  1190  ------NKDEGPDVEISSYedekddedmddeG--PPFVMLEGGLKIPETIFDKLFDYQKV  1345
                   N+D    +++SSYE+EK ++D D +   PPFV LEGGLKIPE+IF+ LFDYQKV
Sbjct  349   DTRLEENEDSRDSLDMSSYEEEKQEDDEDSDNNEPPFVTLEGGLKIPESIFNNLFDYQKV  408

Query  1346  GVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKRE  1525
             GVQWLWELHCQ+AGGIIGDEMGLGKT+QVL+FLG+LHFSN YKPSI+VCP+TLL+QWKRE
Sbjct  409   GVQWLWELHCQRAGGIIGDEMGLGKTIQVLSFLGALHFSNMYKPSIVVCPVTLLRQWKRE  468

Query  1526  AKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLI  1705
             A+KWYPSF VE+LHDS  D   +KK +KS ++D++SE   D D E NLS RN KKWD LI
Sbjct  469   AEKWYPSFRVELLHDSAQDLGFRKKRAKSSDTDNDSEGSHDSDYEGNLSSRNPKKWDLLI  528

Query  1706  NHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHR  1885
             N VL S+SGLLITTYEQLRLLGEKLLD+EWGYAVLDEGHRIRNPN +++LVCKQLQTVHR
Sbjct  529   NRVLRSESGLLITTYEQLRLLGEKLLDVEWGYAVLDEGHRIRNPNAEISLVCKQLQTVHR  588

Query  1886  IIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRC  2065
             IIMTG+PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPI++GGYANA+PLQVSTAYRC
Sbjct  589   IIMTGAPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPITVGGYANASPLQVSTAYRC  648

Query  2066  AVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGS  2245
             AVVLRDLIMPYLLRRMKADVNAQLPKKTEHV+FCSLT  QR++Y+AFLAS++VEQI DGS
Sbjct  649   AVVLRDLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTEEQRAVYRAFLASSEVEQILDGS  708

Query  2246  KNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFF  2425
             +N+LYGIDVMRKICNHPDLLERE SC++PDYGNPERS KMKVVA+VLK+WKDQGHRVL F
Sbjct  709   RNSLYGIDVMRKICNHPDLLEREQSCQNPDYGNPERSEKMKVVAQVLKVWKDQGHRVLLF  768

Query  2426  SQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGT  2605
             +QTQQMLDILE+FL+  GY+YRRMDG TPVKQRMALIDE+NN+ ++FIFILTT+VGGLGT
Sbjct  769   AQTQQMLDILESFLIASGYEYRRMDGLTPVKQRMALIDEYNNSSDVFIFILTTKVGGLGT  828

Query  2606  NLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHS  2785
             NLTGANRVIIFDPDWNPS D+QARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH 
Sbjct  829   NLTGANRVIIFDPDWNPSTDVQARERAWRIGQKQDVTVYRLITRGTIEEKVYHRQIYKHF  888

Query  2786  LTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEK  2965
             LTNKILKNPQQRR FKAR++KDLF LNDDG  GSTE+S+IFSQLSEDVN+ G Q   ++K
Sbjct  889   LTNKILKNPQQRRFFKARNMKDLFTLNDDGNGGSTETSNIFSQLSEDVNVVGDQKDKEDK  948

Query  2966  DKSIKTNPADHGTAM-ERDNN-----SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHS  3127
              K  K   A+   A+ +++NN     S   G+EK DN   +VDE+T+IL++LFDA+GIHS
Sbjct  949   QKHKKAASANADDAVGDKENNLEIGSSRRKGKEKVDNIGDEVDEETNILKSLFDANGIHS  1008

Query  3128  AMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
             AM+HDAI+NAHDEEK++LEEQAS+VAQRAAEALRQSRMLRS++ +++PTWTG+SGTAGAP
Sbjct  1009  AMNHDAIMNAHDEEKMRLEEQASQVAQRAAEALRQSRMLRSRDDISVPTWTGKSGTAGAP  1068

Query  3308  PSIKKKFGSTLNPQLVTSSKPLE-ESSMISSRRNgiaagasagkalssaellakiRGNQE  3484
              S++KKFGST++ QL+   KPLE  SS  +   N   AGASAGK LSS+ELLA+IRGN E
Sbjct  1069  SSVRKKFGSTVSSQLI---KPLEGSSSNKTGEFNSFGAGASAGKVLSSSELLARIRGNLE  1125

Query  3485  RAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGST  3664
              A+  GLE   QF   SSS +  R A+   SR S  ++ +QPE+LIRQ+CTF+Q++GGS+
Sbjct  1126  NAVGAGLE--RQFEVASSSANVARFADTRTSRSSKNASDVQPEILIRQICTFMQQRGGSS  1183

Query  3665  SSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             +SA IVEHF+ RVPSKDL LFKNLLKEIATL+K+P+GS W+LKPE+ ++
Sbjct  1184  NSACIVEHFKDRVPSKDLPLFKNLLKEIATLQKDPSGSRWVLKPEFVQQ  1232



>ref|XP_010262352.1| PREDICTED: protein CHROMATIN REMODELING 8 isoform X1 [Nelumbo 
nucifera]
Length=1231

 Score =  1497 bits (3875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 816/1225 (67%), Positives = 963/1225 (79%), Gaps = 47/1225 (4%)
 Frame = +2

Query  230   RNIFG------QTENGFDASNEAARSME---LEATEHNATSSTKKTDMYNKLRAVETEIQ  382
             +NIF       Q +N     +EA  S E   L+  +    SST++  +YNKLRAVE EI 
Sbjct  22    KNIFTKAVLSWQVKNDVGNGSEAEESTEEQLLQEEKDIGPSSTRRAKLYNKLRAVEVEIN  81

Query  383   AVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlndldlqralaadrlKSLL  562
             AV +  E      RN   V D  D  EK D + + +  QA  N L L RALAADRL SL 
Sbjct  82    AVAASVEHA----RNAASVLDSIDNEEKEDFQDDGNVVQASPNGLTLHRALAADRLNSLK  137

Query  563   KTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQPKPKRRLkeakspskn  742
             KTKAQL+K++S+L  + T  T S+  D        ++ D++K  P+PKR+LKE K  SK+
Sbjct  138   KTKAQLEKQLSELDKNDT--TTSIAHD-------KLIHDLIKEDPRPKRKLKEVKHSSKD  188

Query  743   kkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFHKLKGFERQIQEPGQS  922
              KKR KT    +D DFDAVL+AAS+G VETE+D+LVRKGILTPFHKLKGFER++Q PG S
Sbjct  189   SKKRQKTVMFSEDVDFDAVLDAASAGLVETERDKLVRKGILTPFHKLKGFERRLQPPGPS  248

Query  923   SRHSM----QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRK  1090
                ++    +++ +L   S+A   QSISEA Q+RPTTKLLD+  LPKL+ PT PF   +K
Sbjct  249   DAQNLPPEEENSQNLALASVARVAQSISEAVQTRPTTKLLDAKDLPKLDAPTRPFYRLKK  308

Query  1091  HVKISQSAENGRN-DKRKR--RPTPGKKWRVKVSRENK-------DEGPDVEISSYedek  1240
              +K+S    + +N DKRK+  RP P KKWR  +SRE K       D+      S YE+E 
Sbjct  309   PLKLSPDTNSEKNNDKRKKQKRPLPDKKWRKVISREEKLYEGSEDDQRDSFVTSDYEEEN  368

Query  1241  ddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGK  1420
              D + DD  PP VMLEGGLKIPE IF KLFDYQKVGVQWLWELHCQ+AGGIIGDEMGLGK
Sbjct  369   QDVEDDDREPPSVMLEGGLKIPEAIFSKLFDYQKVGVQWLWELHCQRAGGIIGDEMGLGK  428

Query  1421  TVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkk  1600
             T+QV++FLG+LHFS  YK SI++CP+TLL QW+RE KKWYPSFHVEILHDS      KKK
Sbjct  429   TIQVISFLGALHFSKMYKSSIVICPVTLLHQWRREVKKWYPSFHVEILHDSAQVPIKKKK  488

Query  1601  gskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKL  1780
                S ++D  SE   D D E  L  ++TKKWD LI  VLGS+SGLLITTYEQLRLLGEKL
Sbjct  489   RVNSDKTDEASEGSPDSDNEMPLLTKSTKKWDFLIERVLGSESGLLITTYEQLRLLGEKL  548

Query  1781  LDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPG  1960
             LD+EWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PIQNKL+ELWSLFDFVFPG
Sbjct  549   LDVEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQNKLAELWSLFDFVFPG  608

Query  1961  KLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLP  2140
             KLGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMK DVNA LP
Sbjct  609   KLGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKVDVNAHLP  668

Query  2141  KKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHS  2320
             KKTEHV+FCSLT+ QRS+Y+AFLAS++VEQIFDGS+N+LYGIDVMRKICNHPDLLEREHS
Sbjct  669   KKTEHVLFCSLTAEQRSVYRAFLASSEVEQIFDGSRNSLYGIDVMRKICNHPDLLEREHS  728

Query  2321  CRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMD  2500
              R+PDYGNPERSGKMKVV++VLK+WKDQGHRVL F+QTQQMLDILENFL++GGY YRRMD
Sbjct  729   SRNPDYGNPERSGKMKVVSQVLKVWKDQGHRVLLFTQTQQMLDILENFLISGGYSYRRMD  788

Query  2501  GATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARE  2680
             G TPVKQRMALIDEFNN+ ++FIFILTT+VGGLGTNLTGANRVIIFDPDWNPS DMQARE
Sbjct  789   GLTPVKQRMALIDEFNNSNDVFIFILTTKVGGLGTNLTGANRVIIFDPDWNPSTDMQARE  848

Query  2681  RAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFV  2860
             RAWRIGQ KDVTVYRLITRGTIEEKVYHRQIYKH LTNKILKNPQQRR FKARD+KDLF 
Sbjct  849   RAWRIGQTKDVTVYRLITRGTIEEKVYHRQIYKHFLTNKILKNPQQRRFFKARDMKDLFT  908

Query  2861  LNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGT---AMERDNNSG  3031
             L D  ENG+TE+S+IFSQLS DVNI G    +Q+K ++   N A+  T   A++R NNS 
Sbjct  909   LQDHEENGTTETSNIFSQLSGDVNILGIHKDNQDKQRT--PNAAEAFTDDAAVDRANNSA  966

Query  3032  SN-----GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQAS  3196
             +      G+EK D ++G+VDE+TS+LR+LFDAHGIHSA++HD I+NA+DEEK++LEE+AS
Sbjct  967   NGPSPRKGKEKIDQSDGEVDEETSVLRSLFDAHGIHSAVNHDVIMNANDEEKMRLEEKAS  1026

Query  3197  RVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             +VAQRAAEALR+SRMLRS++S+++PTWTGRSG AG PP  +K+FGSTLN QLV S     
Sbjct  1027  QVAQRAAEALRKSRMLRSKDSISVPTWTGRSGAAGGPPEARKRFGSTLNSQLVNSRSSEG  1086

Query  3377  ESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTR  3556
              S    SR NG AAG+SAGKALSSA+LLAKIRGNQE+A+SDGLEHQ    SGSS+N++  
Sbjct  1087  TSGSGESRINGFAAGSSAGKALSSADLLAKIRGNQEKAVSDGLEHQFGLVSGSSNNTQHL  1146

Query  3557  AAENGASRPSHGS-AGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKN  3733
             +    +S       A +QPE+LIRQ+CTFIQ++GGST+S+SIVEHF+ R+P KDLALFKN
Sbjct  1147  SDSGPSSSRPSSKLAAVQPEILIRQICTFIQQRGGSTTSSSIVEHFKDRIPYKDLALFKN  1206

Query  3734  LLKEIATLKKNPNGSFWILKPEYQE  3808
             LLKEIATL+KNPNGS W+LKPEYQ+
Sbjct  1207  LLKEIATLEKNPNGSSWVLKPEYQQ  1231



>ref|XP_010262356.1| PREDICTED: protein CHROMATIN REMODELING 8 isoform X5 [Nelumbo 
nucifera]
Length=1206

 Score =  1496 bits (3873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 811/1208 (67%), Positives = 957/1208 (79%), Gaps = 39/1208 (3%)
 Frame = +2

Query  254   NGFDASNEAARSMELEATEHNATSSTKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDE  433
             NG +A  E+     L+  +    SST++  +YNKLRAVE EI AV +  E      RN  
Sbjct  15    NGSEAE-ESTEEQLLQEEKDIGPSSTRRAKLYNKLRAVEVEINAVAASVEHA----RNAA  69

Query  434   QVPDREDGHEKRDIETEQSTTQAPlndldlqralaadrlKSLLKTKAQLKKEISDLSNDS  613
              V D  D  EK D + + +  QA  N L L RALAADRL SL KTKAQL+K++S+L  + 
Sbjct  70    SVLDSIDNEEKEDFQDDGNVVQASPNGLTLHRALAADRLNSLKKTKAQLEKQLSELDKND  129

Query  614   THDTLSVLRDIVKEQPNAVLRDVVKGQPKPKRRLkeakspsknkkkrikTASLdddddfd  793
             T  T S+  D        ++ D++K  P+PKR+LKE K  SK+ KKR KT    +D DFD
Sbjct  130   T--TTSIAHD-------KLIHDLIKEDPRPKRKLKEVKHSSKDSKKRQKTVMFSEDVDFD  180

Query  794   AVLNAASSGFVETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSM----QDNGDLVS  961
             AVL+AAS+G VETE+D+LVRKGILTPFHKLKGFER++Q PG S   ++    +++ +L  
Sbjct  181   AVLDAASAGLVETERDKLVRKGILTPFHKLKGFERRLQPPGPSDAQNLPPEEENSQNLAL  240

Query  962   TSLANAIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRN-DKR  1138
              S+A   QSISEA Q+RPTTKLLD+  LPKL+ PT PF   +K +K+S    + +N DKR
Sbjct  241   ASVARVAQSISEAVQTRPTTKLLDAKDLPKLDAPTRPFYRLKKPLKLSPDTNSEKNNDKR  300

Query  1139  KR--RPTPGKKWRVKVSRENK-------DEGPDVEISSYedekddedmddeGPPFVMLEG  1291
             K+  RP P KKWR  +SRE K       D+      S YE+E  D + DD  PP VMLEG
Sbjct  301   KKQKRPLPDKKWRKVISREEKLYEGSEDDQRDSFVTSDYEEENQDVEDDDREPPSVMLEG  360

Query  1292  GLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAY  1471
             GLKIPE IF KLFDYQKVGVQWLWELHCQ+AGGIIGDEMGLGKT+QV++FLG+LHFS  Y
Sbjct  361   GLKIPEAIFSKLFDYQKVGVQWLWELHCQRAGGIIGDEMGLGKTIQVISFLGALHFSKMY  420

Query  1472  KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldv  1651
             K SI++CP+TLL QW+RE KKWYPSFHVEILHDS      KKK   S ++D  SE   D 
Sbjct  421   KSSIVICPVTLLHQWRREVKKWYPSFHVEILHDSAQVPIKKKKRVNSDKTDEASEGSPDS  480

Query  1652  dvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIR  1831
             D E  L  ++TKKWD LI  VLGS+SGLLITTYEQLRLLGEKLLD+EWGYAVLDEGHRIR
Sbjct  481   DNEMPLLTKSTKKWDFLIERVLGSESGLLITTYEQLRLLGEKLLDVEWGYAVLDEGHRIR  540

Query  1832  NPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS  2011
             NPN ++TLVCKQLQTVHRIIMTG+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEFAVPIS
Sbjct  541   NPNAEITLVCKQLQTVHRIIMTGAPIQNKLAELWSLFDFVFPGKLGVLPVFEAEFAVPIS  600

Query  2012  IGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRS  2191
             +GGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMK DVNA LPKKTEHV+FCSLT+ QRS
Sbjct  601   VGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKVDVNAHLPKKTEHVLFCSLTAEQRS  660

Query  2192  IYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKV  2371
             +Y+AFLAS++VEQIFDGS+N+LYGIDVMRKICNHPDLLEREHS R+PDYGNPERSGKMKV
Sbjct  661   VYRAFLASSEVEQIFDGSRNSLYGIDVMRKICNHPDLLEREHSSRNPDYGNPERSGKMKV  720

Query  2372  VAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNN  2551
             V++VLK+WKDQGHRVL F+QTQQMLDILENFL++GGY YRRMDG TPVKQRMALIDEFNN
Sbjct  721   VSQVLKVWKDQGHRVLLFTQTQQMLDILENFLISGGYSYRRMDGLTPVKQRMALIDEFNN  780

Query  2552  TVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLI  2731
             + ++FIFILTT+VGGLGTNLTGANRVIIFDPDWNPS DMQARERAWRIGQ KDVTVYRLI
Sbjct  781   SNDVFIFILTTKVGGLGTNLTGANRVIIFDPDWNPSTDMQARERAWRIGQTKDVTVYRLI  840

Query  2732  TRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFS  2911
             TRGTIEEKVYHRQIYKH LTNKILKNPQQRR FKARD+KDLF L D  ENG+TE+S+IFS
Sbjct  841   TRGTIEEKVYHRQIYKHFLTNKILKNPQQRRFFKARDMKDLFTLQDHEENGTTETSNIFS  900

Query  2912  QLSEDVNITGPQHPDQEKDKSIKTNPADHGT---AMERDNNSGSN-----GEEKADNNNG  3067
             QLS DVNI G    +Q+K ++   N A+  T   A++R NNS +      G+EK D ++G
Sbjct  901   QLSGDVNILGIHKDNQDKQRT--PNAAEAFTDDAAVDRANNSANGPSPRKGKEKIDQSDG  958

Query  3068  DVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLR  3247
             +VDE+TS+LR+LFDAHGIHSA++HD I+NA+DEEK++LEE+AS+VAQRAAEALR+SRMLR
Sbjct  959   EVDEETSVLRSLFDAHGIHSAVNHDVIMNANDEEKMRLEEKASQVAQRAAEALRKSRMLR  1018

Query  3248  SQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagas  3427
             S++S+++PTWTGRSG AG PP  +K+FGSTLN QLV S      S    SR NG AAG+S
Sbjct  1019  SKDSISVPTWTGRSGAAGGPPEARKRFGSTLNSQLVNSRSSEGTSGSGESRINGFAAGSS  1078

Query  3428  agkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGS-AGM  3604
             AGKALSSA+LLAKIRGNQE+A+SDGLEHQ    SGSS+N++  +    +S       A +
Sbjct  1079  AGKALSSADLLAKIRGNQEKAVSDGLEHQFGLVSGSSNNTQHLSDSGPSSSRPSSKLAAV  1138

Query  3605  QPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFW  3784
             QPE+LIRQ+CTFIQ++GGST+S+SIVEHF+ R+P KDLALFKNLLKEIATL+KNPNGS W
Sbjct  1139  QPEILIRQICTFIQQRGGSTTSSSIVEHFKDRIPYKDLALFKNLLKEIATLEKNPNGSSW  1198

Query  3785  ILKPEYQE  3808
             +LKPEYQ+
Sbjct  1199  VLKPEYQQ  1206



>ref|XP_006479510.1| PREDICTED: DNA repair and recombination protein RAD26-like isoform 
X2 [Citrus sinensis]
Length=1231

 Score =  1496 bits (3872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 818/1248 (66%), Positives = 992/1248 (79%), Gaps = 46/1248 (4%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNAT----  322
             MEEDE DR+L SSLGVTSANPEDIER++    EN   A N        E   H+ +    
Sbjct  1     MEEDE-DRLLLSSLGVTSANPEDIERDVLAAAENV--AGNSNETEESNEEKPHDKSESID  57

Query  323   -SSTKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQ  499
              SST +  +YNKLRAVE EI AV S  + L      ++   D  D  E+   E E+S  Q
Sbjct  58    PSSTSQEKLYNKLRAVEFEIGAVASTVDHLRRVSTKEDNDIDDGDSTEQDGREDEKSAVQ  117

Query  500   APlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRD  679
             A  ND+ LQ AL ADRLKSL KTKAQL KE+S      T   +         + +  ++D
Sbjct  118   ASPNDMTLQHALTADRLKSLKKTKAQLVKELSHFPKGITSKGI---------EHDKFIQD  168

Query  680   VVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKG  859
             +VK + +PKR+ KEA+ P K++ K+ KT S+DDD DFD+ L+AAS+GFVET++D+LVRKG
Sbjct  169   LVKEEHRPKRKSKEAQKPGKDRSKQQKTVSVDDDFDFDSALDAASAGFVETKRDELVRKG  228

Query  860   ILTPFHKLKGFERQIQEPGQSSRHSMQD-----NGDLVSTSLANAIQSISEAAQSRPTTK  1024
             ILTPFHKLKGFER IQ+PG S++ ++ D     + D  S S+  A++ +SEAAQ+RP+TK
Sbjct  229   ILTPFHKLKGFERCIQQPGPSNKQNVPDEREARSNDPFSASVDRALRMMSEAAQARPSTK  288

Query  1025  LLDSSLLPKLEPPTYPFQTPRKHVKISQSAEN-----GRNDKRKRRPTPGKKWRVKVSRE  1189
             LLD   LPKL+ PT PFQ  +   ++ QS E+      R+ ++K+RP P KKWR +++RE
Sbjct  289   LLDPESLPKLDGPTRPFQRLKTPFRMPQSEESEVEKKKRSKRKKKRPLPDKKWRKRIARE  348

Query  1190  N-----KDEGPDVEISSYedekddedmddeG--PPFVMLEGGLKIPETIFDKLFDYQKVG  1348
             +      D    +++SSYE+EK ++D D +   PPFV LEGGLKIPE+IF+ LFDYQKVG
Sbjct  349   DTRLEENDSRDSLDMSSYEEEKQEDDEDSDNNEPPFVTLEGGLKIPESIFNNLFDYQKVG  408

Query  1349  VQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREA  1528
             VQWLWELHCQ+AGGIIGDEMGLGKT+QVL+FLG+LHFSN YKPSI+VCP+TLL+QWKREA
Sbjct  409   VQWLWELHCQRAGGIIGDEMGLGKTIQVLSFLGALHFSNMYKPSIVVCPVTLLRQWKREA  468

Query  1529  KKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLIN  1708
             +KWYPSF VE+LHDS  D   +KK +KS ++D++SE   D D E NLS RN KKWD LIN
Sbjct  469   EKWYPSFRVELLHDSAQDLGFRKKRAKSSDTDNDSEGSHDSDYEGNLSSRNPKKWDLLIN  528

Query  1709  HVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRI  1888
              VL S+SGLLITTYEQLRLLGEKLLD+EWGYAVLDEGHRIRNPN +++LVCKQLQTVHRI
Sbjct  529   RVLRSESGLLITTYEQLRLLGEKLLDVEWGYAVLDEGHRIRNPNAEISLVCKQLQTVHRI  588

Query  1889  IMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCA  2068
             IMTG+PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPI++GGYANA+PLQVSTAYRCA
Sbjct  589   IMTGAPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPITVGGYANASPLQVSTAYRCA  648

Query  2069  VVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSK  2248
             VVLRDLIMPYLLRRMKADVNAQLPKKTEHV+FCSLT  QR++Y+AFLAS++VEQI DGS+
Sbjct  649   VVLRDLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTEEQRAVYRAFLASSEVEQILDGSR  708

Query  2249  NALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFS  2428
             N+LYGIDVMRKICNHPDLLERE SC++PDYGNPERS KMKVVA+VLK+WKDQGHRVL F+
Sbjct  709   NSLYGIDVMRKICNHPDLLEREQSCQNPDYGNPERSEKMKVVAQVLKVWKDQGHRVLLFA  768

Query  2429  QTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTN  2608
             QTQQMLDILE+FL+  GY+YRRMDG TPVKQRMALIDE+NN+ ++FIFILTT+VGGLGTN
Sbjct  769   QTQQMLDILESFLIASGYEYRRMDGLTPVKQRMALIDEYNNSSDVFIFILTTKVGGLGTN  828

Query  2609  LTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSL  2788
             LTGANRVIIFDPDWNPS D+QARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH L
Sbjct  829   LTGANRVIIFDPDWNPSTDVQARERAWRIGQKQDVTVYRLITRGTIEEKVYHRQIYKHFL  888

Query  2789  TNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKD  2968
             TNKILKNPQQRR FKAR++KDLF LNDDG  GSTE+S+IFSQLSEDVN+ G Q   ++K 
Sbjct  889   TNKILKNPQQRRFFKARNMKDLFTLNDDGNGGSTETSNIFSQLSEDVNVVGDQKDKEDKQ  948

Query  2969  KSIKTNPADHGTAM-ERDNN-----SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSA  3130
             K  K   A+   A+ +++NN     S   G+EK DN   +VDE+T+IL++LFDA+GIHSA
Sbjct  949   KHKKAASANADDAVGDKENNLEIGSSRRKGKEKVDNIGDEVDEETNILKSLFDANGIHSA  1008

Query  3131  MDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPP  3310
             M+HDAI+NAHDEEK++LEEQAS+VAQRAAEALRQSRMLRS++ +++PTWTG+SGTAGAP 
Sbjct  1009  MNHDAIMNAHDEEKMRLEEQASQVAQRAAEALRQSRMLRSRDDISVPTWTGKSGTAGAPS  1068

Query  3311  SIKKKFGSTLNPQLVTSSKPLE-ESSMISSRRNgiaagasagkalssaellakiRGNQER  3487
             S++KKFGST++ QL+   KPLE  SS  +   N   AGASAGK LSS+ELLA+IRGN E 
Sbjct  1069  SVRKKFGSTVSSQLI---KPLEGSSSNKTGEFNSFGAGASAGKVLSSSELLARIRGNLEN  1125

Query  3488  AISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTS  3667
             A+  GLE   QF   SSS +  R A+   SR S  ++ +QPE+LIRQ+CTF+Q++GGS++
Sbjct  1126  AVGAGLE--RQFEVASSSANVARFADTRTSRSSKNASDVQPEILIRQICTFMQQRGGSSN  1183

Query  3668  SASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             SA IVEHF+ RVPSKDL LFKNLLKEIATL+K+P+GS W+LKPE+ ++
Sbjct  1184  SACIVEHFKDRVPSKDLPLFKNLLKEIATLQKDPSGSRWVLKPEFVQQ  1231



>emb|CDP03758.1| unnamed protein product [Coffea canephora]
Length=1184

 Score =  1495 bits (3870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 806/1238 (65%), Positives = 970/1238 (78%), Gaps = 74/1238 (6%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELE---ATEHNATS  325
             MEE+EEDRVL + LGVTSANP+DIER+IFGQ +     S+ A  S   E     E N  S
Sbjct  1     MEEEEEDRVLLNRLGVTSANPDDIERHIFGQAKTSAADSSAAGGSDGEELVVGAESNGAS  60

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVP--DREDGHEKRDIETEQSTTQ  499
             ST   D+YNKLRAVE EI AVKS FE +++F ++D  V   D E GHE   +E E++ ++
Sbjct  61    STSLPDLYNKLRAVELEIDAVKSAFE-VKSFAKDDAHVSEGDSEKGHES--VEAEENNSR  117

Query  500   APlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRD  679
             A  ND  LQ ALA+DRLKSL+KTKAQL+K+ISD S D  +  L  +++IVKE+ N+    
Sbjct  118   ASPNDTTLQHALASDRLKSLIKTKAQLEKKISDGSPDLEYRNL--IKNIVKEERNS----  171

Query  680   VVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKG  859
               K +PK  ++L + +S    +      AS  +DDDFDAVLNAAS+GFVETE+D+LVR+G
Sbjct  172   --KRKPKDVKKLIKNQSKRLKR------ASFSEDDDFDAVLNAASAGFVETERDELVRRG  223

Query  860   ILTPFHKLKGFERQIQEPGQSSRHSMQDNGD----LVSTSLANAIQSISEAAQSRPTTKL  1027
             I TPFHKL+GFER+IQEPG SSRH + +N D    + S+SLA A++SI+EAAQ+RPTTKL
Sbjct  224   IFTPFHKLRGFERRIQEPGSSSRHDVTENADESDQVASSSLARAVRSITEAAQARPTTKL  283

Query  1028  LDSSLLPKLEPPTYPFQTPRKHVKISQSAENG-----RNDKRKRRPTPGKKWRVKVSREN  1192
             LDS  LPKL+ PT+PFQ  R  ++I  S +N         ++K+RP P K WR K+SRE 
Sbjct  284   LDSEALPKLDAPTHPFQRLRVPLRIKHSLDNDVEKNKDTKRKKKRPLPAKIWRKKISREE  343

Query  1193  KD-EGPDVEISSYedekddedmdd--eGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLW  1363
             K  EG D   S  ED+  ++ +D   EGP FV LEGGL+IPE IF KLFDYQ+VGVQWLW
Sbjct  344   KTFEGNDARNSGNEDDDGEDAVDLDGEGPGFVALEGGLRIPEAIFSKLFDYQRVGVQWLW  403

Query  1364  ELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYP  1543
             ELHCQ+AGGIIGDEMGLGKT+QV+AFLGSLHFS  YKPSII+CP+TLL+QW+RE +K   
Sbjct  404   ELHCQRAGGIIGDEMGLGKTIQVIAFLGSLHFSFMYKPSIIICPVTLLRQWRREVQKCDD  463

Query  1544  SFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGS  1723
                 E L   + +                            L  + TKKWD LIN VL S
Sbjct  464   E---EFLGSDIEE---------------------------TLPSKTTKKWDSLINRVLRS  493

Query  1724  DSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGS  1903
             D+GLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+
Sbjct  494   DAGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGA  553

Query  1904  PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRD  2083
             PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANATP QVSTAYRCAVVLRD
Sbjct  554   PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANATPFQVSTAYRCAVVLRD  613

Query  2084  LIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYG  2263
             LIMPYLLRRMKADVNAQL KKTEHV+FCSLT+ QRS+Y+AFLAS+DVEQI DGS+N+LYG
Sbjct  614   LIMPYLLRRMKADVNAQLTKKTEHVLFCSLTAEQRSVYRAFLASSDVEQILDGSRNSLYG  673

Query  2264  IDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQM  2443
             IDVMRKICNHPDLLEREHSC++PDYGNP RSGKMKVVA+VLK+WK+QGHRVL F+QTQQM
Sbjct  674   IDVMRKICNHPDLLEREHSCKNPDYGNPVRSGKMKVVAQVLKVWKEQGHRVLLFTQTQQM  733

Query  2444  LDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGAN  2623
             LDILENF+V  GY YRRMDG TP+KQRMALIDEFNN+ ++FIFILTT+VGGLGTNLTGA+
Sbjct  734   LDILENFVVAVGYTYRRMDGLTPIKQRMALIDEFNNSDDVFIFILTTKVGGLGTNLTGAD  793

Query  2624  RVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKIL  2803
             RVIIFDPDWNPS DMQARERAWRIGQ KDVTVYRLITRGTIEEKVYHRQIYKH LTNKIL
Sbjct  794   RVIIFDPDWNPSTDMQARERAWRIGQTKDVTVYRLITRGTIEEKVYHRQIYKHFLTNKIL  853

Query  2804  KNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKT  2983
              NPQQRR F++RD+KDLF LNDD ++GSTE+S+IFSQLSE +N+ G    D  K+K   T
Sbjct  854   NNPQQRRFFRSRDMKDLFTLNDDEKDGSTETSNIFSQLSEAINVVGVH--DDNKNKLSLT  911

Query  2984  NPADHGTAMERDNNSGSN-GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH  3160
               A    + +R+ +   N G+E  D+++G+VDE+ +ILR+LFDAHGIHSAM+HDA++NAH
Sbjct  912   ESAPSAASDKRNGSDTENKGKEMDDHSDGEVDEERNILRSLFDAHGIHSAMNHDALMNAH  971

Query  3161  DEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTL  3340
             DEEK+KLEEQAS+VAQRAAEALRQSRMLR QE++A+PTWTG+SG AGAP +  ++FGS +
Sbjct  972   DEEKMKLEEQASQVAQRAAEALRQSRMLRRQENIAVPTWTGKSGAAGAPSASGRRFGSAM  1031

Query  3341  NPQLVTSSKPLEE-SSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQH  3517
             N  +++ ++  +E  +  ++R NG+ AGAS+GK LSSAELLAKIRGN++RA++ GLE  H
Sbjct  1032  NSHMISKTRSSDELVNREANRPNGLVAGASSGKVLSSAELLAKIRGNRQRAVNQGLE--H  1089

Query  3518  QFNSGSSSNSRTRAAENGASRPSHG-SAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFR  3694
             QF   SSSN+  R+A+   +RP    ++  QPEVLIRQ+ TFIQ+ GGS+S+ASIV+HF+
Sbjct  1090  QFGLASSSNNFGRSAD---TRPRESKNSATQPEVLIRQLYTFIQQNGGSSSTASIVDHFK  1146

Query  3695  SRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
              R+PSKDL LFKNLLKEIATL+KN  GS W+LKPEYQE
Sbjct  1147  DRIPSKDLPLFKNLLKEIATLEKNSGGSSWVLKPEYQE  1184



>gb|KDO60453.1| hypothetical protein CISIN_1g0447982mg, partial [Citrus sinensis]
Length=1225

 Score =  1492 bits (3862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 817/1242 (66%), Positives = 986/1242 (79%), Gaps = 47/1242 (4%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNAT----  322
             MEEDE DR+L SSLGVTSANPEDIER++    EN   A N        E   H+ +    
Sbjct  1     MEEDE-DRLLLSSLGVTSANPEDIERDVLAAAENV--AGNSNETEESNEEKPHDKSESID  57

Query  323   -SSTKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQ  499
              SST +  +YNKLRAVE EI AV S  + L      ++   D  D  E+   E E+S  Q
Sbjct  58    PSSTSQEKLYNKLRAVEFEIGAVASTVDHLRRVSTKEDNDIDDGDSTEQDGREDEKSAVQ  117

Query  500   APlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRD  679
             A  ND+ LQ AL ADRLKSL KTKAQL KE+S      T   +         + +  ++D
Sbjct  118   ASPNDMTLQHALTADRLKSLKKTKAQLVKELSHFPKGITSKGI---------EHDKFIQD  168

Query  680   VVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKG  859
             +VK + +PKR+ KEA+ P K++ K+ KT S+DDD DFD+ L+AAS+GFVET++D+LVRKG
Sbjct  169   LVKEEHRPKRKSKEAQKPGKDRSKQQKTVSVDDDFDFDSALDAASAGFVETKRDELVRKG  228

Query  860   ILTPFHKLKGFERQIQEPGQSSRHSMQD-----NGDLVSTSLANAIQSISEAAQSRPTTK  1024
             ILTPFHKLKGFER IQ+PG S++ ++ D     + D  S S+  A++ +SEAAQ+RP+TK
Sbjct  229   ILTPFHKLKGFERCIQQPGPSNKQNVPDEQEARSNDPFSASVDRALRMMSEAAQARPSTK  288

Query  1025  LLDSSLLPKLEPPTYPFQTPRKHVKISQSAEN-----GRNDKRKRRPTPGKKWRVKVSRE  1189
             LLD   LPKL+ PT PFQ  +   ++ QS E+      R+ ++K+RP P KKWR +++RE
Sbjct  289   LLDPESLPKLDGPTRPFQRLKTPFRMPQSEESEVEKKKRSKRKKKRPLPDKKWRKRIARE  348

Query  1190  ------NKDEGPDVEISSYedekddedmddeG--PPFVMLEGGLKIPETIFDKLFDYQKV  1345
                   N+D    +++SSYE+EK ++D D +   PPFV LEGGLKIPE+IF+ LFDYQKV
Sbjct  349   DTRLEENEDSRDSLDMSSYEEEKQEDDEDSDNNEPPFVTLEGGLKIPESIFNNLFDYQKV  408

Query  1346  GVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKRE  1525
             GVQWLWELHCQ+AGGIIGDEMGLGKT+QVL+FLG+LHFSN YKPSI+VCP+TLL+QWKRE
Sbjct  409   GVQWLWELHCQRAGGIIGDEMGLGKTIQVLSFLGALHFSNMYKPSIVVCPVTLLRQWKRE  468

Query  1526  AKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLI  1705
             A+KWYPSFHVE+LHDS  D   +KK +KS ++D++ E   D D E NLS RN KKWD LI
Sbjct  469   AEKWYPSFHVELLHDSAQDLGFRKKRAKSSDTDNDGEGSHDSDYEGNLSSRNPKKWDLLI  528

Query  1706  NHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHR  1885
             N VL S+SGLLITTYEQLRLLGEKLLD+EWGYAVLDEGHRIRNPN +++LVCKQLQTVHR
Sbjct  529   NRVLRSESGLLITTYEQLRLLGEKLLDVEWGYAVLDEGHRIRNPNAEISLVCKQLQTVHR  588

Query  1886  IIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRC  2065
             IIMTG+PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPI++GGYANA+PLQVSTAYRC
Sbjct  589   IIMTGAPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPITVGGYANASPLQVSTAYRC  648

Query  2066  AVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGS  2245
             AVVLRDLIMPYLLRRMKADVNAQLPKKTEHV+FCSLT  QR++Y+AFLAS++VEQI DGS
Sbjct  649   AVVLRDLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTEEQRAVYRAFLASSEVEQILDGS  708

Query  2246  KNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFF  2425
             +N+LYGIDVMRKICNHPDLLERE SC+ PDYGNPERS KMKVVA+VLK+WKDQGHRVL F
Sbjct  709   RNSLYGIDVMRKICNHPDLLEREQSCQIPDYGNPERSEKMKVVAQVLKVWKDQGHRVLLF  768

Query  2426  SQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGT  2605
             +QTQQMLDILE+FL+  GY+YRRMDG TPVKQRMALIDE+NN+ ++FIFILTT+VGGLGT
Sbjct  769   AQTQQMLDILESFLIASGYEYRRMDGLTPVKQRMALIDEYNNSSDVFIFILTTKVGGLGT  828

Query  2606  NLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHS  2785
             NLTGANRVIIFDPDWNPS D+QARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH 
Sbjct  829   NLTGANRVIIFDPDWNPSTDVQARERAWRIGQKQDVTVYRLITRGTIEEKVYHRQIYKHF  888

Query  2786  LTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEK  2965
             LTNKILKNPQQRR FKAR++KDLF LNDDG  GSTE+S+IFSQLSEDVN+ G Q   ++K
Sbjct  889   LTNKILKNPQQRRFFKARNMKDLFTLNDDGNGGSTETSNIFSQLSEDVNVVGDQKDKEDK  948

Query  2966  DKSIKTNPADHGTAM-ERDNN-----SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHS  3127
              K  K   A+   A+ +++NN     S   G+EK DN   +VDE+T+IL++LFDA+GIHS
Sbjct  949   QKHKKAASANADDAVGDKENNLEIGSSRRKGKEKVDNIGDEVDEETNILKSLFDANGIHS  1008

Query  3128  AMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
             AM+HDAI+NAHDEEK++LEEQAS+VAQRAAEALRQSRMLRS++ +++PTWTG+SGTAGAP
Sbjct  1009  AMNHDAIMNAHDEEKMRLEEQASQVAQRAAEALRQSRMLRSRDDISVPTWTGKSGTAGAP  1068

Query  3308  PSIKKKFGSTLNPQLVTSSKPLE-ESSMISSRRNgiaagasagkalssaellakiRGNQE  3484
              S++KKFGST+  QL+   KPLE  SS  +   N   AGASAGK LSS+ELLA+IRGNQE
Sbjct  1069  SSVRKKFGSTVGSQLI---KPLEGSSSNKTGEFNSFGAGASAGKVLSSSELLARIRGNQE  1125

Query  3485  RAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGST  3664
              A+  GLE   QF   SSS +  R A+   SR S  ++ +QPE+LIRQ+CTF+Q++GGS+
Sbjct  1126  NAVGAGLE--RQFEVASSSANVARFADTRTSRSSKNASDVQPEILIRQICTFMQQRGGSS  1183

Query  3665  SSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWIL  3790
             +SA IVEHF+ RVPSKDL LFKNLLKEIATL+K+P+GS W+L
Sbjct  1184  NSACIVEHFKDRVPSKDLPLFKNLLKEIATLQKDPSGSRWVL  1225



>gb|EYU17927.1| hypothetical protein MIMGU_mgv1a000355mg [Erythranthe guttata]
Length=1221

 Score =  1491 bits (3861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 821/1253 (66%), Positives = 985/1253 (79%), Gaps = 66/1253 (5%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSME---LEATEHNATS  325
             M+E+EEDRVL S+LGVTSANPEDIER+I  +       +N+ A   E   L+ T++N TS
Sbjct  1     MDEEEEDRVLLSALGVTSANPEDIERDILEKARKNAGDNNKDAGGREEETLDRTKNNETS  60

Query  326   STK-KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQA  502
             S+  K D+ +KLRAV+ EI AVKS  EQ +N++ ++    D E   E+ +   E++   +
Sbjct  61    SSNGKADLVSKLRAVKLEIDAVKSAVEQFDNYKGDE---ADGEVKIEEENDGVERNGIHS  117

Query  503   PlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDV  682
               NDL+LQ ALAADRLKSL+KT+  L+KEISD + +S  D L              +RD+
Sbjct  118   SPNDLNLQHALAADRLKSLIKTRVHLEKEISDSAENSKQDRL--------------IRDL  163

Query  683   VKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGI  862
             +K +PK KRRLK     S N+ KR+K  SLD+DDDFDAVLNAAS+GFVETE+D+LVRKGI
Sbjct  164   IKEEPKSKRRLKGVDKTSHNQNKRLKRVSLDEDDDFDAVLNAASAGFVETERDELVRKGI  223

Query  863   LTPFHKLKGFERQIQEPGQSSRHSMQDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSSL  1042
              TPFHKLKG+ER+IQEPG S RH + +N DL S+S+A   + +SEA+++RP+TK+LD   
Sbjct  224   FTPFHKLKGYERRIQEPGSSRRHDVVENNDLASSSIARVSRLMSEASKARPSTKMLDPES  283

Query  1043  LPKLEPPTYPFQTPRKHVKIS-----QSAENGRNDKRKRRPTPGKKWRVKVSRENKDEGP  1207
             +P+L+ P+ PFQ  RK +KI      +SA++    K+KRRP PGKKWR  VSRE  DEG 
Sbjct  284   IPRLDAPSIPFQRLRKPLKIPRSLEMESAKDKDQKKKKRRPQPGKKWRRLVSRE--DEGL  341

Query  1208  D-----VEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELH  1372
             D        +  +  +D ED D+EG  FV LEGGLKIPETIF KLF+YQKVGVQWLWELH
Sbjct  342   DESDGKTSSNEDDSLEDVEDADEEGSDFVTLEGGLKIPETIFSKLFEYQKVGVQWLWELH  401

Query  1373  CQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFH  1552
             CQ+AGGIIGDEMGLGKT+Q+LAFLGSLH S  YKPSII+CP+TLL+QWKREA KWYP FH
Sbjct  402   CQRAGGIIGDEMGLGKTIQILAFLGSLHSSGMYKPSIIICPVTLLRQWKREANKWYPGFH  461

Query  1553  VEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSG  1732
             VE+LHDSV +   +KK SKS +SD +SE+  D D E+  S +NTK WD LIN VL S+SG
Sbjct  462   VELLHDSVQEPSSRKKRSKSDDSDCDSEDFTDSDCEEKPSSKNTK-WDSLINRVLRSESG  520

Query  1733  LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQ  1912
             LLITTYEQLRL G+KLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PIQ
Sbjct  521   LLITTYEQLRLQGDKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQ  580

Query  1913  NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIM  2092
             NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRD+IM
Sbjct  581   NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRDMIM  640

Query  2093  PYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDV  2272
             PYLLRRMK DV+AQLPKKTEHV+FCSLT  QRS+Y+AFLAS++VEQIFDGS+N+LYGIDV
Sbjct  641   PYLLRRMKVDVDAQLPKKTEHVLFCSLTPEQRSVYRAFLASSEVEQIFDGSRNSLYGIDV  700

Query  2273  MRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDI  2452
             MRKICNHPDLLEREHS  +PDYGN +RSGKM VVAEVL +WK+QGHRVL FSQTQQMLDI
Sbjct  701   MRKICNHPDLLEREHSHGNPDYGNLKRSGKMTVVAEVLNVWKEQGHRVLLFSQTQQMLDI  760

Query  2453  LENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVI  2632
             +ENFLV  GY YRRMDG TPVKQRMALIDEFNN+ E+FIFILTT+VGGLGTNL GANRVI
Sbjct  761   MENFLVAVGYSYRRMDGQTPVKQRMALIDEFNNSDEVFIFILTTKVGGLGTNLIGANRVI  820

Query  2633  IFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNP  2812
             IFDPDWNPS DMQARERAWRIGQKKDVT+YRLITRGTIEEKVY RQIYKH LT+KILKNP
Sbjct  821   IFDPDWNPSTDMQARERAWRIGQKKDVTIYRLITRGTIEEKVYQRQIYKHFLTDKILKNP  880

Query  2813  QQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPA  2992
             QQRR FKARD+KDLF LNDDG  GSTE+SSIF QLS+ VN+ G +   Q+  + +  NP+
Sbjct  881   QQRRFFKARDMKDLFTLNDDGHGGSTETSSIFGQLSDAVNVVGDRKGKQDAPEHV--NPS  938

Query  2993  DHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEK  3172
                T       + S  EEK +N +  VDE+T+IL+ LFDAHGIHSA++HDAI+NA+DEEK
Sbjct  939   TSSTVFSA-TETESMDEEKTNNTDNKVDEETNILQNLFDAHGIHSAVNHDAIMNANDEEK  997

Query  3173  LKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQL  3352
             +KLEE AS+VAQRAAEALRQSRMLRS+ES+++PTWTG+SG AGAP S+++KFGST+NPQL
Sbjct  998   IKLEEHASQVAQRAAEALRQSRMLRSRESISVPTWTGKSGAAGAPSSVRRKFGSTINPQL  1057

Query  3353  VTSSK---------PLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGL  3505
               +S          P  +++  + R NG++AGAS+GKALSSAELLA+I+GN++ A SDGL
Sbjct  1058  AGTSTSSTRQSDEIPNNDNNNNTRRLNGLSAGASSGKALSSAELLARIKGNRQSAASDGL  1117

Query  3506  EHQHQFNSGSSSNSRTRAAENGASRPSHGSAG-----------MQPEVLIRQVCTFIQRK  3652
             EHQ      SS         NG       SAG           +QPE+LIRQ+CTFIQR+
Sbjct  1118  EHQFVLGGPSS---------NGGGEGLSSSAGPSRRTSSSSGGVQPELLIRQICTFIQRR  1168

Query  3653  GGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             GG+TSS+SIV+HF+ ++PSKDL LFKNLLKEIATL+KNP+GS+W+LKPEY ++
Sbjct  1169  GGNTSSSSIVDHFKDKIPSKDLPLFKNLLKEIATLEKNPSGSYWVLKPEYGDQ  1221



>ref|XP_002272543.1| PREDICTED: protein CHROMATIN REMODELING 8 [Vitis vinifera]
Length=1227

 Score =  1491 bits (3859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 815/1241 (66%), Positives = 986/1241 (79%), Gaps = 44/1241 (4%)
 Frame = +2

Query  164   DEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSME---LEATEHNATSSTK  334
             +EEDR+L SSLGVTSANPED+ER I     N  +  +EA RS E   L+ ++    SST 
Sbjct  3     EEEDRILLSSLGVTSANPEDVEREILAAATNEAENGSEAGRSTEEEFLDKSKATELSSTS  62

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
             +  +Y+KLRA+E EI AV    +Q  N  RN+  V    D   + D E ++   QA  N+
Sbjct  63    QAKLYSKLRALEVEIDAVAYTVQQARNTERNENHVSHGNDNRAQGDAEDDKLVIQASPNN  122

Query  515   ldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQ  694
             L LQ ALAADRL+SL KTKAQL+ E+SD   +    T+         + + V++++VK +
Sbjct  123   LTLQHALAADRLRSLKKTKAQLEIELSDWQKEKPSKTV---------EHDKVIQNLVKEE  173

Query  695   PKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPF  874
              +PK+RLKE     K+ KKR KT S DDD DFDAVL+AAS+GFVETE+D+LVRKGILTPF
Sbjct  174   ARPKKRLKEIPKSGKDLKKRKKTISFDDDVDFDAVLDAASAGFVETERDKLVRKGILTPF  233

Query  875   HKLKGFERQIQEPGQSSRHSMQDNGD----LVSTSLANAIQSISEAAQSRPTTKLLDSSL  1042
             HKLKGFER++Q+PG SSR ++ + GD    L S S+A A+QSISE+AQ+RPTTKLLDS  
Sbjct  234   HKLKGFERRLQQPGPSSRDNLPEEGDKIDDLASASIARAVQSISESAQARPTTKLLDSET  293

Query  1043  LPKLEPPTYPFQTPRKHVKI-----SQSAENGRNDKRKRRPTPGKKWRVKVSRENK----  1195
             LPKL+ P++PF   +K +K      S+  +N    ++K+RP P KKWR  +S E +    
Sbjct  294   LPKLDAPSHPFHRLKKPLKYPLPLDSEVEKNKDKKRKKKRPLPSKKWRKIISHEEELLEE  353

Query  1196  --DEGPDVEISSYedekddedmddeG--PPFVMLEGGLKIPETIFDKLFDYQKVGVQWLW  1363
               D   ++  SS E+   ++  D +   PP V LEGGL+IPE+IF KLFDYQKVGVQWLW
Sbjct  354   SEDTSDNLVTSSNEEVNREDIEDADDNEPPCVTLEGGLRIPESIFSKLFDYQKVGVQWLW  413

Query  1364  ELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYP  1543
             ELHCQ+ GGIIGDEMGLGKT+QVL+FLG+LHFSN YKPSI++CP+TLL+QWKREAKKWY 
Sbjct  414   ELHCQQVGGIIGDEMGLGKTIQVLSFLGALHFSNMYKPSIVICPVTLLRQWKREAKKWYQ  473

Query  1544  SFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGS  1723
             SFHVEILHDS  D        K      ESE+ LD D E+NLS ++TKKWD LIN VL S
Sbjct  474   SFHVEILHDSAQD----PASRKKRAKSYESEDSLDSDDEENLSSKDTKKWDSLINRVLRS  529

Query  1724  DSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGS  1903
              SGLLITTYEQ+RL   KLLDI+WGYA+LDEGHRIRNPN +VT++CKQLQTVHRIIMTG+
Sbjct  530   QSGLLITTYEQIRLQAGKLLDIKWGYAILDEGHRIRNPNAEVTILCKQLQTVHRIIMTGA  589

Query  1904  PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRD  2083
             PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRD
Sbjct  590   PIQNKLAELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRD  649

Query  2084  LIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYG  2263
             LIMPYLLRRMKADVNAQLP KTEHV+FCSLT+ QRS+Y+AFLAS++VEQIFDGS+N+LYG
Sbjct  650   LIMPYLLRRMKADVNAQLPNKTEHVLFCSLTTEQRSVYRAFLASSEVEQIFDGSRNSLYG  709

Query  2264  IDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQM  2443
             IDVMRKICNHPDLLEREH+ ++PDYGNPERSGKMKVVA VLK WK+QGHRVL F+QTQQM
Sbjct  710   IDVMRKICNHPDLLEREHAYQNPDYGNPERSGKMKVVAHVLKGWKEQGHRVLLFAQTQQM  769

Query  2444  LDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGAN  2623
             LDILENFL+ GGY YRRMDG TP+K RMALIDEFN++ ++FIFILTT+VGGLGTNLTGAN
Sbjct  770   LDILENFLIAGGYVYRRMDGFTPIKHRMALIDEFNDSDDVFIFILTTKVGGLGTNLTGAN  829

Query  2624  RVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKIL  2803
             RVII+DPDWNPS DMQARERAWRIGQ +DVTVYRLITRGTIEEKVY RQIYKH LTNKIL
Sbjct  830   RVIIYDPDWNPSTDMQARERAWRIGQTRDVTVYRLITRGTIEEKVYQRQIYKHFLTNKIL  889

Query  2804  KNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKT  2983
             KNPQQ+R FKARD+KDLFVLNDDGE+ STE+S+IFSQLSEDVN+ G     Q+K KSI  
Sbjct  890   KNPQQKRFFKARDMKDLFVLNDDGEDASTETSNIFSQLSEDVNVVGKHKDSQDKQKSIIP  949

Query  2984  NPADHGTAMERDNNS----GSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIV  3151
               +    A++  NNS      +GE + D+ + ++D++T+ILR+LFDAH +HSA++HDAI+
Sbjct  950   VSSHACGAVDEGNNSTIGPSRSGENEKDDQSDEMDKETNILRSLFDAHRLHSAVNHDAIM  1009

Query  3152  NAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFG  3331
             NAH +EK++LEE+ASRVA+RA+EALRQS+MLRS+ES+++PTWTGRSG AGAP S+ +KFG
Sbjct  1010  NAHGDEKMRLEEEASRVAKRASEALRQSQMLRSRESISVPTWTGRSGAAGAPSSVSRKFG  1069

Query  3332  STLNPQLVTSSKPLEESSMIS-SRRNgiaagasagkalssaellakiRGNQERAISDGLE  3508
             ST++ QL+  SK  EESS    S+ NGIAAGASAGKALSSAELLA+IRGNQERA  DGLE
Sbjct  1070  STVSSQLINRSKSSEESSSNGMSKPNGIAAGASAGKALSSAELLARIRGNQERATDDGLE  1129

Query  3509  HQHQFNSGSSSNSRTRAAENG--ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIV  3682
             HQ     GSSS +R R+ ++G  +SR +H  + +QPEVLIR++CTFIQ+KGGST+S SIV
Sbjct  1130  HQ----LGSSSANRARSTDSGPSSSRSTHNLSSVQPEVLIRKICTFIQQKGGSTNSTSIV  1185

Query  3683  EHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             +HF+ R+PSKDL LFKNLLKEIATL+K+PNGS W+LKPEY+
Sbjct  1186  QHFKDRIPSKDLPLFKNLLKEIATLEKDPNGSSWVLKPEYR  1226



>ref|XP_008235652.1| PREDICTED: DNA repair protein rhp26 [Prunus mume]
Length=1218

 Score =  1488 bits (3853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 816/1252 (65%), Positives = 978/1252 (78%), Gaps = 67/1252 (5%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSME--LEATEHNATSS  328
             MEEDE DR+L  SLGVTSANPEDIER+I    +N  +AS     + E  LE +E     +
Sbjct  1     MEEDE-DRILLDSLGVTSANPEDIERDILSGAQNNGNASEVGGSTEEEPLERSESIDPLA  59

Query  329   TKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPl  508
               +  +YNKLRAVE EI AV S  E  E            +DG E  D E      QA  
Sbjct  60    ASQAKLYNKLRAVEFEIDAVASTVEP-EQAGNEGAACDSDDDGVEPGDKE---DLDQASA  115

Query  509   ndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVK  688
               L+LQ ALA DRL+SL +TKA+L+KE+SDL            R    +Q + VL D+VK
Sbjct  116   TGLNLQHALATDRLRSLKETKAKLEKELSDLDKQ---------RPSKGKQRDKVLSDIVK  166

Query  689   GQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILT  868
              +P PKR+LK+ K   KN +KR+KT S D+DDDFDAVL+AAS+GFVETE+D+LVRKGILT
Sbjct  167   EKPAPKRKLKQVKKSGKNLEKRLKTVSFDEDDDFDAVLDAASAGFVETERDELVRKGILT  226

Query  869   PFHKLKGFERQIQEPGQSSRHSM----QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDS  1036
             PFHKL GFER++QE G S R ++      + D  S S+A A+QSISEAAQ+RP+TKLLD 
Sbjct  227   PFHKLNGFERRLQELGPSQRRNVPAEEHRSNDFASASVARAVQSISEAAQARPSTKLLDP  286

Query  1037  SLLPKLEPPTYPFQTPRKHVKISQSAENGRNDK-----RKRRPTPGKKWRV---------  1174
               LPKL PPTYPF+  +K +KI QS EN  +       R++RP P K+WR          
Sbjct  287   EALPKLNPPTYPFKRLKKPLKIPQSLENDTHKNKSSRLRRKRPLPDKRWRKLSNLEETHV  346

Query  1175  -------KVSRENKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFD  1333
                        EN+++  DV+ + Y               +V LEGGLKIPE IF++LFD
Sbjct  347   HENEDTPSCEEENQEDVGDVDDNEYT--------------YVTLEGGLKIPEHIFNQLFD  392

Query  1334  YQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQ  1513
             YQKVGVQWLWELHCQKAGGIIGDEMGLGKT+QVL+FLG+LHFS  YKPSI+VCP+TLL+Q
Sbjct  393   YQKVGVQWLWELHCQKAGGIIGDEMGLGKTIQVLSFLGALHFSGMYKPSIVVCPVTLLRQ  452

Query  1514  WKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKW  1693
             WKRE++KWYPSFHVE+LHDS  D   +KK SKS+ESDS+SE  LD D EK    ++TKKW
Sbjct  453   WKRESQKWYPSFHVELLHDSAQDPAGRKKRSKSNESDSDSEGSLDSDYEKPALSKSTKKW  512

Query  1694  DKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQ  1873
             D LIN VL S+SGLLITTYEQLR++GE LLDI+WGYAVLDEGHRIRNPN ++TLVCKQLQ
Sbjct  513   DSLINRVLRSESGLLITTYEQLRIVGESLLDIDWGYAVLDEGHRIRNPNAEITLVCKQLQ  572

Query  1874  TVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVST  2053
             TVHRIIMTG+PIQNKL+ELWSLFDFVFPGKLGVLP+FEAEF+VPIS+GGYANA+PLQVST
Sbjct  573   TVHRIIMTGAPIQNKLTELWSLFDFVFPGKLGVLPIFEAEFSVPISVGGYANASPLQVST  632

Query  2054  AYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQI  2233
             AYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSL + QRS Y+AFLAS+DVEQI
Sbjct  633   AYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLAAEQRSAYRAFLASSDVEQI  692

Query  2234  FDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHR  2413
              DG++N+LYGIDVMRKICNHPDLLEREHS ++PDYGN ERSGK+KVV++VLK+WKDQGHR
Sbjct  693   MDGNRNSLYGIDVMRKICNHPDLLEREHSGQNPDYGNLERSGKLKVVSQVLKVWKDQGHR  752

Query  2414  VLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVG  2593
             VL F+QTQQMLDI+E+FLV+GGY YRRMDG TP++QRMALIDEFNN+ ++F+FILTT+VG
Sbjct  753   VLLFTQTQQMLDIIESFLVSGGYSYRRMDGLTPIRQRMALIDEFNNSSDVFVFILTTKVG  812

Query  2594  GLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQI  2773
             GLGTNLTGANRVIIFDPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQI
Sbjct  813   GLGTNLTGANRVIIFDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQI  872

Query  2774  YKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHP  2953
             YKH LTNKILKNPQQRR FKARD+KDLF LND+GE+G+TE++++F QLSED N+ G Q+ 
Sbjct  873   YKHFLTNKILKNPQQRRFFKARDMKDLFTLNDEGESGTTETANLFGQLSEDANVVGTQND  932

Query  2954  DQEKDKSIKTN-PADHGTAMERDNNSG-----SNGEEKADNNNGDVDEDTSILRTLFDAH  3115
                K +S K + P  +G   ++  NS       NG+EKAD++N +VDE+T+ILR LFDA 
Sbjct  933   KHNKQESQKVSVPLANGAGADKGKNSEVGPSRRNGKEKADHSNDEVDEETNILRCLFDAQ  992

Query  3116  GIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGT  3295
             GIHSAM+HD I+NAHDEEK+KL+EQASRVAQRAAEALRQSRMLRS++SV++PTWTG+SG 
Sbjct  993   GIHSAMNHDMIMNAHDEEKMKLDEQASRVAQRAAEALRQSRMLRSRDSVSVPTWTGKSGM  1052

Query  3296  AGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRG  3475
             AGAP S++ KFGST+N QL+ ++K  +E   +S+      AGASAGKALSSAELLA+IRG
Sbjct  1053  AGAPSSVRGKFGSTVNSQLINNTKRSDE---VSNNGTNGVAGASAGKALSSAELLARIRG  1109

Query  3476  NQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKG  3655
              +E+A+  G+E  HQF   SSSN R ++ + G SR SH   G+QPEVLIRQ+CTFIQ+ G
Sbjct  1110  KEEKAVEAGIE--HQFGLASSSN-RAKSVDVGPSRSSHKLGGVQPEVLIRQICTFIQQSG  1166

Query  3656  GSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             GSTSS+SIV+HF+ R+PSKDL LFKNLLKEIA L+K PNGS W+LKPE+ ++
Sbjct  1167  GSTSSSSIVQHFKDRIPSKDLPLFKNLLKEIAKLEKTPNGSVWVLKPEFHQQ  1218



>emb|CAN67815.1| hypothetical protein VITISV_002502 [Vitis vinifera]
Length=1249

 Score =  1478 bits (3827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 816/1263 (65%), Positives = 990/1263 (78%), Gaps = 66/1263 (5%)
 Frame = +2

Query  164   DEEDRVLFSSLGVTSANPEDIERNIFG----------------------QTENGFDASNE  277
             +EEDR+L SSLGVTSANPED+ER I                        +  N  +  +E
Sbjct  3     EEEDRILLSSLGVTSANPEDVEREILAAYIDHIVPLGCRSVRVSFSNEPEATNEAENGSE  62

Query  278   AARSME---LEATEHNATSSTKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDR  448
             A RS E   L+ ++    SST +  +Y+KL A+E EI AV    +Q  N  RN+  V   
Sbjct  63    AGRSTEEEFLDKSKATELSSTSQAKLYSKLXALEVEIDAVAYTVQQARNTERNENHVSHG  122

Query  449   EDGHEKRDIETEQSTTQAPlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTL  628
              D   + D E ++   QA  N+L LQ ALAADRL+SL KTKAQL+ E+SD   +    T+
Sbjct  123   NDNRAQGDAEDDKLVIQASPNNLTLQHALAADRLRSLKKTKAQLEIELSDWQKEKPSKTV  182

Query  629   SVLRDIVKEQPNAVLRDVVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNA  808
                      + + V++++VK + +PK+RLKE     K+ KKR KT S DDD DFDAVL+A
Sbjct  183   ---------EHDKVIQNLVKEEARPKKRLKEIPKSGKDLKKRKKTISFDDDVDFDAVLDA  233

Query  809   ASSGFVETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQDNGD----LVSTSLAN  976
             AS+GFVETE+D+LVRKGILTPFHKLKGFER++Q+PG SSR ++ + GD    L S S+A 
Sbjct  234   ASAGFVETERDKLVRKGILTPFHKLKGFERRLQQPGPSSRGNLPEEGDKIDDLASASIAR  293

Query  977   AIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKI-----SQSAENGRNDKRK  1141
             A+QSISE+AQ+RPTTK+LDS  LPKL+ P++PF   +K +K      S+  +N    ++K
Sbjct  294   AVQSISESAQARPTTKMLDSETLPKLDAPSHPFHRLKKPLKYPLPLDSEVEKNKDKKRKK  353

Query  1142  RRPTPGKKWRVKVSRENK------DEGPDVEISSYedekddedmddeG--PPFVMLEGGL  1297
             +RP PGKKWR  +S E +      D   ++  SS E+   ++  D +   PP V LEGGL
Sbjct  354   KRPLPGKKWRKIISHEEELLEESEDTSDNLVTSSNEEVNREDIEDADDNEPPCVTLEGGL  413

Query  1298  KIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKP  1477
             +IPE+IF KLFDYQKVGVQWLWELHCQ+ GGIIGDEMGLGKT+QVL+FLG+LHFSN YKP
Sbjct  414   RIPESIFSKLFDYQKVGVQWLWELHCQQVGGIIGDEMGLGKTIQVLSFLGALHFSNMYKP  473

Query  1478  SIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdv  1657
             SI++CP+TLL+QWKREAKKWY SFHVEILHDS  D        K      ESE+ LD D 
Sbjct  474   SIVICPVTLLRQWKREAKKWYQSFHVEILHDSAQD----PASRKKRAKSYESEDSLDSDD  529

Query  1658  ekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNP  1837
             E+NLS ++TKKWD LIN VL S SGLLITTYEQ+RL   KLLDI+WGYA+LDEGHRIRNP
Sbjct  530   EENLSSKDTKKWDSLINRVLRSQSGLLITTYEQIRLQAGKLLDIKWGYAILDEGHRIRNP  589

Query  1838  NTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIG  2017
             N +VT++CKQLQTVHRIIMTG+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEFAVPIS+G
Sbjct  590   NAEVTILCKQLQTVHRIIMTGAPIQNKLAELWSLFDFVFPGKLGVLPVFEAEFAVPISVG  649

Query  2018  GYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIY  2197
             GYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLP KTEHV+FCSLT+ QRS+Y
Sbjct  650   GYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPNKTEHVLFCSLTTEQRSVY  709

Query  2198  QAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVA  2377
             +AFLAS++VEQIFDGS+N+LYGIDVMRKICNHPDLLEREH+ ++PDYGNPERSGKMKVVA
Sbjct  710   RAFLASSEVEQIFDGSRNSLYGIDVMRKICNHPDLLEREHAYQNPDYGNPERSGKMKVVA  769

Query  2378  EVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTV  2557
              VLK WK+QGHRVL F+QTQQMLDILENFL+ GGY YRRMDG TP+K RMALIDEFN++ 
Sbjct  770   HVLKGWKEQGHRVLLFAQTQQMLDILENFLIAGGYVYRRMDGFTPIKHRMALIDEFNDSD  829

Query  2558  EIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITR  2737
             ++FIFILTT+VGGLGTNLTGANRVII+DPDWNPS DMQARERAWRIGQ +DVTVYRLITR
Sbjct  830   DVFIFILTTKVGGLGTNLTGANRVIIYDPDWNPSTDMQARERAWRIGQTRDVTVYRLITR  889

Query  2738  GTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQL  2917
             GTIEEKVY RQIYKH LTNKILKNPQQ+R FKARD+KDLFVLNDDGE+ STE+S+IFSQL
Sbjct  890   GTIEEKVYQRQIYKHFLTNKILKNPQQKRFFKARDMKDLFVLNDDGEDASTETSNIFSQL  949

Query  2918  SEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNS--GS--NGEEKADNNNGDVDEDT  3085
             SEDVN+ G    +Q+K KSI    +    A++  NNS  GS  +GE + D+ + ++D++T
Sbjct  950   SEDVNVVGKHKDNQDKQKSIIPVSSHACGAVDEGNNSTIGSSRSGENEKDDQSDEMDKET  1009

Query  3086  SILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVA  3265
             +ILR+LFDAH +HSA++HDAI+NAH +EK++LEE+ASRVA+RA+EALRQS+MLRS+ES++
Sbjct  1010  NILRSLFDAHRLHSAVNHDAIMNAHGDEKMRLEEEASRVAKRASEALRQSQMLRSRESIS  1069

Query  3266  IPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMIS-SRRNgiaagasagkal  3442
             +PTWTGRSG AGAP S+ +KFGST++ QL+  SK  EESS    S+ NGIAAGASAGKAL
Sbjct  1070  VPTWTGRSGAAGAPSSVSRKFGSTVSSQLINRSKSSEESSSNGMSKPNGIAAGASAGKAL  1129

Query  3443  ssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENG--ASRPSHGSAGMQPEV  3616
             SSAELLA+IRGNQERA  DGLEHQ     GSSS +R R+ ++G  +SR +H  + +QPEV
Sbjct  1130  SSAELLARIRGNQERATDDGLEHQ----LGSSSANRARSTDSGPSSSRSTHNLSSVQPEV  1185

Query  3617  LIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKP  3796
             LIR++CTFIQ+KGGST+S SIV+HF+ R+PSKDL LFKNLLKEIATL+K+PNGS W+LKP
Sbjct  1186  LIRKICTFIQQKGGSTNSTSIVQHFKDRIPSKDLPLFKNLLKEIATLEKDPNGSSWVLKP  1245

Query  3797  EYQ  3805
             EY+
Sbjct  1246  EYR  1248



>ref|XP_004289961.1| PREDICTED: DNA excision repair protein ERCC-6-like [Fragaria 
vesca subsp. vesca]
Length=1208

 Score =  1476 bits (3821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 803/1249 (64%), Positives = 971/1249 (78%), Gaps = 71/1249 (6%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             MEEDE DR+L SSLGVTSANPEDIER+I  + +N  +A        E E       S   
Sbjct  1     MEEDE-DRILLSSLGVTSANPEDIERDILSEAKNNGNAGGIGEVEEE-EEEGEKPESIDP  58

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
              T +YNKLRAVE EI AV S  E  +    + +     E G ++ ++E   S   A    
Sbjct  59    STALYNKLRAVEFEIDAVASTVEHEQGGVGDGDDG--EEPGDKEDNVEASDSLQHA----  112

Query  515   ldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQ  694
                   LA DRL+SL KTKAQL+KE+SDL            R   + + + VL ++VK +
Sbjct  113   ------LATDRLRSLKKTKAQLEKELSDLGKQ---------RPSKRIEHDKVLLNIVKDK  157

Query  695   PKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPF  874
             P PKR+ K+ + P K ++KR+KT S D+DD FDAVL+AAS+GFVETE+D+LVRKGILTPF
Sbjct  158   PAPKRKSKQVEKPGKKQEKRVKTVSFDEDDGFDAVLDAASTGFVETERDELVRKGILTPF  217

Query  875   HKLKGFERQIQEPGQSSRH---SMQD-NGDLVSTSLANAIQSISEAAQSRPTTKLLDSSL  1042
             HKLKGFER++Q+ G S R    + +D N DL S S+A A QSIS+AAQ+RPTTKLLDS  
Sbjct  218   HKLKGFERRLQDVGPSQRQNDPAEEDRNDDLFSASVARAAQSISKAAQARPTTKLLDSEA  277

Query  1043  LPKLEPPTYPFQTPRKHVKISQSAENGRNDKR-----KRRPTPGKKWRVKVSRE------  1189
             LPKLE PTY FQ  RK +KI QS EN    K+     ++RP P K+WR ++S E      
Sbjct  278   LPKLEAPTYSFQRLRKPLKIPQSLENDAQKKKNSGMKRKRPLPEKRWRKRISHEEMNVNG  337

Query  1190  ----------NKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQ  1339
                       N+++  DV+   Y              P V LEGGLKIPE IF++LFDYQ
Sbjct  338   NGITPSCEEGNQEDTRDVDDDEY--------------PHVTLEGGLKIPEYIFEQLFDYQ  383

Query  1340  KVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWK  1519
             KVGVQWLWELHCQKAGGIIGDEMGLGKT+QVL+FLG+LHFS  YKPSII+CP+TLL+QW+
Sbjct  384   KVGVQWLWELHCQKAGGIIGDEMGLGKTIQVLSFLGALHFSRMYKPSIIICPVTLLRQWR  443

Query  1520  REAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDK  1699
             REAKKWYPSFHVE+LHDS  D  ++KK  KS  SDS+SE   D D E+ +S +  KKWD 
Sbjct  444   REAKKWYPSFHVELLHDSAQDSTNRKKQYKSSGSDSDSEGSPDSDYERPVSSKGAKKWDS  503

Query  1700  LINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTV  1879
             LIN VL S+SGLLITTYEQLR++GEKLLDI+WGYAVLDEGHRIRNPN ++TLV KQLQTV
Sbjct  504   LINRVLRSESGLLITTYEQLRIVGEKLLDIDWGYAVLDEGHRIRNPNAEITLVSKQLQTV  563

Query  1880  HRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAY  2059
             HRIIMTG+PIQNKL+ELWSLFDFVFPGKLGVLP+FEAEFAVPIS+GGYANA+PLQVSTAY
Sbjct  564   HRIIMTGAPIQNKLTELWSLFDFVFPGKLGVLPIFEAEFAVPISVGGYANASPLQVSTAY  623

Query  2060  RCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFD  2239
             RCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLT+ QRS Y+AFLAS+DVEQI D
Sbjct  624   RCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTTEQRSAYRAFLASSDVEQILD  683

Query  2240  GSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVL  2419
             G++N+LYGIDVMRKICNHPDLLEREH+ +DPDYGNPERSGKMKV+A+VLK WK+QGHRVL
Sbjct  684   GNRNSLYGIDVMRKICNHPDLLEREHAGQDPDYGNPERSGKMKVIAQVLKAWKEQGHRVL  743

Query  2420  FFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGL  2599
              F+QTQQMLDI+E+FLV   Y YRRMDG T +K RMALIDEFNN+ ++FIFILTT+VGGL
Sbjct  744   LFTQTQQMLDIIESFLVASEYSYRRMDGLTAIKHRMALIDEFNNSDDVFIFILTTKVGGL  803

Query  2600  GTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYK  2779
             GTNLTGANRVIIFDPDWNPS DMQARERAWRIGQK+DVT+YRLITRGTIEEKVYHRQIYK
Sbjct  804   GTNLTGANRVIIFDPDWNPSTDMQARERAWRIGQKRDVTIYRLITRGTIEEKVYHRQIYK  863

Query  2780  HSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQ  2959
             H LTNKILKNPQQRR FKARD+KDLF+LN++G++G+TE++++F QLSED N+   Q  D 
Sbjct  864   HFLTNKILKNPQQRRFFKARDMKDLFILNEEGDSGATETANLFGQLSEDANVVSAQKDDH  923

Query  2960  EKDKSIK-TNPADHGTAMERDNN----SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIH  3124
              K KS K T P     A +  N+    S +NG+EK D++ GDVDE+T+IL+ LFD  GIH
Sbjct  924   SKRKSKKVTVPCADAYAGKGKNSEIETSRTNGKEKDDHSEGDVDEETNILKCLFDTQGIH  983

Query  3125  SAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGA  3304
             SAM+HD I+NAHDEEK++LEEQAS+VAQRAAEALR SRMLRS++SV++PTWTG+SG AGA
Sbjct  984   SAMNHDVIMNAHDEEKMRLEEQASQVAQRAAEALRLSRMLRSRDSVSVPTWTGKSGMAGA  1043

Query  3305  PPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQE  3484
             P +++ KFGST+N +L++++KP   S + ++R NG  AGASAGKALSSAELLA+IRGN+E
Sbjct  1044  PSAVRGKFGSTVNSRLISNAKP--SSELSNNRTNGFVAGASAGKALSSAELLARIRGNEE  1101

Query  3485  RAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGST  3664
             +A+  G+E  HQ    SSS+SR RA + G SR SH   G+QPE+LIR++CTF++ +GGST
Sbjct  1102  KAVEAGIE--HQLGMASSSSSRARAMDAGPSRQSHNLGGVQPEILIRKICTFLEERGGST  1159

Query  3665  SSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             +SA+IV+HF+ R+PSKDL LFKNLLKEIA L+K P+GS W+LKPE+ ++
Sbjct  1160  NSATIVQHFKDRIPSKDLPLFKNLLKEIAKLEKTPSGSVWVLKPEFDQQ  1208



>ref|XP_002529848.1| DNA repair and recombination protein RAD26, putative [Ricinus 
communis]
 gb|EEF32549.1| DNA repair and recombination protein RAD26, putative [Ricinus 
communis]
Length=1230

 Score =  1474 bits (3815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/1248 (64%), Positives = 971/1248 (78%), Gaps = 47/1248 (4%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATS---  325
             MEEDE D+ L S+LGVTS NPEDIER+I  +  N  +   EA  S E E  + + ++   
Sbjct  1     MEEDE-DKFLLSTLGVTSVNPEDIERDILAEVRNNTENDGEAGVSTEEEPPDKSISTNLA  59

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
             S  +  +YNKLRAV+ EI AV S  EQ++N    ++   D     + RD + ++ST    
Sbjct  60    SASEAKLYNKLRAVKFEIDAVASTVEQVKNVVNGEDHAYDDSVKLQPRDGD-DKSTDLVS  118

Query  506   lndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVV  685
              ND  LQ+ALAADRLKSL +TKA ++KEIS L  D T   +         +   +L ++V
Sbjct  119   PNDFTLQQALAADRLKSLKRTKADIEKEISGLHKDDTTKGM---------EHEKLLAEMV  169

Query  686   KGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGIL  865
             K +P+ KR+ KE + P KNK+K  +T S  DD DFD +L+AAS+GFVETE+D+LVRKGIL
Sbjct  170   KEEPRCKRKSKEVQKPGKNKEKNQRTVSFSDDTDFDTMLDAASAGFVETERDELVRKGIL  229

Query  866   TPFHKLKGFERQIQEPGQSSRHSMQD----NGDLVSTSLANAIQSISEAAQSRPTTKLLD  1033
             TPFH+LKGFER +Q+ G SS  +  +    + DL S S+A A QS+ EAA++RP TKLLD
Sbjct  230   TPFHQLKGFERCLQQLGPSSGCNASEEEDRSHDLASDSIARAAQSMLEAAKARPVTKLLD  289

Query  1034  SSLLPKLEPPTYPFQTPRKHVKISQSAENG----RNDKRK-RRPTPGKKWRVKVSRENK-  1195
             S  +PKL+ PT PFQ  +  ++   S EN     +  KRK +RP PG+KWR +++RE   
Sbjct  290   SDAVPKLDAPTRPFQRLKTPLQFPHSLENASDKTKGSKRKTKRPLPGQKWRKRITREENH  349

Query  1196  -DEGPDVEISSYedekddedmddeG------PPFVMLEGGLKIPETIFDKLFDYQKVGVQ  1354
              +E    + +S     ++E ++DE          + LEGGLKIPE IF KLF+YQKVGVQ
Sbjct  350   LEESECTKNNSVTSSTEEEKLEDEEDVDGDDTSLIELEGGLKIPEAIFSKLFEYQKVGVQ  409

Query  1355  WLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKK  1534
             WLWELHCQ+AGGIIGDEMGLGKT+QVL+FLG+LHFSN YKPSI++CP+TLL+QWKREA+K
Sbjct  410   WLWELHCQRAGGIIGDEMGLGKTIQVLSFLGALHFSNMYKPSIVICPVTLLRQWKREAEK  469

Query  1535  WYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHV  1714
             WYP FHVE+LHDS  D    K+       +     L       N+S +   KWD LIN V
Sbjct  470   WYPRFHVELLHDSAQDLPHGKRAKSFDSDNESEGSLDSDYEG-NISSKKANKWDSLINRV  528

Query  1715  LGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIM  1894
             L S++GLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPN +VTL+CKQLQTVHRIIM
Sbjct  529   LKSEAGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNAEVTLICKQLQTVHRIIM  588

Query  1895  TGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVV  2074
             TG+PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANA+PLQVSTAYRCAVV
Sbjct  589   TGAPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANASPLQVSTAYRCAVV  648

Query  2075  LRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNA  2254
             LRDLIMPYLLRRMK DVNAQLPKKTEHV+FCSLT+ QRS+Y+AFLAST+VEQI DGS+N+
Sbjct  649   LRDLIMPYLLRRMKVDVNAQLPKKTEHVLFCSLTAEQRSVYRAFLASTEVEQIIDGSRNS  708

Query  2255  LYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQT  2434
             LYGIDVMRKICNHPDLLEREHSC++PDYGNP+RSGKM+VVA+VLK+W++QGHRVL F+QT
Sbjct  709   LYGIDVMRKICNHPDLLEREHSCQNPDYGNPDRSGKMRVVAQVLKVWREQGHRVLLFAQT  768

Query  2435  QQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLT  2614
             QQMLDILE FL +GGY YRRMDG TP+KQRMALIDEFNN+ ++FIFILTT+VGGLGTNLT
Sbjct  769   QQMLDILEIFLNSGGYSYRRMDGLTPIKQRMALIDEFNNSNDVFIFILTTKVGGLGTNLT  828

Query  2615  GANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTN  2794
             GANRVIIFDPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH LTN
Sbjct  829   GANRVIIFDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQIYKHFLTN  888

Query  2795  KILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKS  2974
             KILKNPQQRR FKARD+KDLF LNDDG +G TE+S+IFSQLSE+VN+ G +   ++K K 
Sbjct  889   KILKNPQQRRFFKARDMKDLFTLNDDGGSGLTETSNIFSQLSEEVNVVGAKKEKEDKKKH  948

Query  2975  IKTNPADHG--TAMERDN-------NSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHS  3127
              K + A H    A++++N       +    G+EKA++++G+VDE+T+ILR+L DA GIHS
Sbjct  949   YKGS-ASHADDAALDKENSPEIGPSHRKGKGKEKANHSDGEVDEETNILRSLIDAQGIHS  1007

Query  3128  AMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
             A++HDAI+NAHDEEK +LEEQAS+VAQRAAEALRQSRMLRS +SV++PTWTG+SGTAGAP
Sbjct  1008  AVNHDAIMNAHDEEKTRLEEQASQVAQRAAEALRQSRMLRSHDSVSVPTWTGKSGTAGAP  1067

Query  3308  PSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQER  3487
              S+++KFGST+N QL+ SS   + SS  +S  NG+  GASAGKALSSAELLA+IRGNQER
Sbjct  1068  SSVRRKFGSTVNSQLIRSS---DVSSNKTSSMNGMGVGASAGKALSSAELLARIRGNQER  1124

Query  3488  AISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTS  3667
             A+  GLE   QF   S+S +R  +  NG SRPS   +G+QPE+LIR++CTFIQ++GG T 
Sbjct  1125  AVGAGLE--QQFGLASTSANRAGSENNGVSRPSKNLSGVQPEILIRKICTFIQQRGGITD  1182

Query  3668  SASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             SA+IV HF+ R+  KD+ LFKNLLKEIATL+K+PNG  W+LKPEY+++
Sbjct  1183  SATIVNHFKDRILEKDMPLFKNLLKEIATLEKDPNGKVWVLKPEYRQQ  1230



>ref|XP_007199683.1| hypothetical protein PRUPE_ppa000387mg [Prunus persica]
 gb|EMJ00882.1| hypothetical protein PRUPE_ppa000387mg [Prunus persica]
Length=1218

 Score =  1472 bits (3811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 809/1259 (64%), Positives = 971/1259 (77%), Gaps = 81/1259 (6%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSME--LEATEHNATSS  328
             MEEDE DR+L  SLGVTSANPEDIER+I    +N  +AS     + E  LE +E     +
Sbjct  1     MEEDE-DRILLDSLGVTSANPEDIERDILSGAQNNGNASEVGGSTEEEPLERSESIDPLA  59

Query  329   TKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPl  508
               +  +YNKLRAVE EI AV S  E  E            +DG E  D E      QA  
Sbjct  60    ASQAKLYNKLRAVEFEIDAVASTVEP-EQAGNEGAACDGDDDGVEPGDKE---DLDQASA  115

Query  509   ndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVK  688
               L+LQ ALA DRL+SL +TKA+L+KE+SDL            R    +Q + VL D+VK
Sbjct  116   TGLNLQHALATDRLRSLKETKAKLEKELSDLDKQ---------RPSKGKQRDKVLSDIVK  166

Query  689   GQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILT  868
              +P PKR+LK+ K   KN +KR+KT S D+DDDFDAVL+AAS+GFVETE+D+LVRKGILT
Sbjct  167   EKPAPKRKLKQVKKSGKNLEKRLKTVSFDEDDDFDAVLDAASAGFVETERDELVRKGILT  226

Query  869   PFHKLKGFERQIQEPGQSSRHSM----QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDS  1036
             PFHKL GFER++QE G S R ++      + D  S S+A A+QSISEAAQ+RP+TKLLD 
Sbjct  227   PFHKLNGFERRLQELGPSQRRNIPAEQHRSNDFASASVARAVQSISEAAQARPSTKLLDP  286

Query  1037  SLLPKLEPPTYPFQTPRKHVKISQSAENGRNDK-----RKRRPTPGKKWR----------  1171
               LPKL PPTYPF+  +K +KI QS EN  +       R++RP P K+WR          
Sbjct  287   EALPKLNPPTYPFKRLKKPLKIPQSLENDTHKNKSSRLRRKRPLPDKRWRKLSNLEEKHV  346

Query  1172  -------------VKVSRENKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPET  1312
                          V    EN+++  DV+ + Y               +V LEGGLKIPE 
Sbjct  347   HENGMFNVVLDSGVNCEEENQEDVGDVDDNEYT--------------YVTLEGGLKIPEH  392

Query  1313  IFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVC  1492
             IF++LFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKT+QVL+FLG+LHFS  YKPSI+VC
Sbjct  393   IFNQLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTIQVLSFLGALHFSGMYKPSIVVC  452

Query  1493  PLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLS  1672
             P+TLL+QWKREA+KWYPSFHVE+LHDS  D   +KK SKS+ESDS+SE  LD D EK   
Sbjct  453   PVTLLRQWKREAQKWYPSFHVELLHDSAQDPVGRKKRSKSNESDSDSEGSLDSDYEKPAL  512

Query  1673  FRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVT  1852
              ++TKKWD LIN VL S+SGLLITTYEQLR++GE LLDI+WGYAVLDEGHRIRNPN ++T
Sbjct  513   SKSTKKWDSLINRVLRSESGLLITTYEQLRIVGESLLDIDWGYAVLDEGHRIRNPNAEIT  572

Query  1853  LVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANA  2032
             LVCKQLQTVHRIIMTG+PIQNKL+ELWSLFDFVFPGKLGVLP+FEAEF+VPIS+GGYANA
Sbjct  573   LVCKQLQTVHRIIMTGAPIQNKLTELWSLFDFVFPGKLGVLPIFEAEFSVPISVGGYANA  632

Query  2033  TPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLA  2212
             +PLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLT+ QRS Y+AFLA
Sbjct  633   SPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTAEQRSAYRAFLA  692

Query  2213  STDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKL  2392
             S+DVEQI DG++N+LYGIDVMRKICNHPDLLEREHS ++PDYGN +RSGK+KVV++VLK+
Sbjct  693   SSDVEQIMDGNRNSLYGIDVMRKICNHPDLLEREHSGQNPDYGNLKRSGKLKVVSQVLKV  752

Query  2393  WKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIF  2572
             WKDQGHRVL F+QTQQMLDI+E+FLV+GGY YRRMDG TP++QRMALIDEFNN+ ++F+F
Sbjct  753   WKDQGHRVLLFTQTQQMLDIIESFLVSGGYGYRRMDGLTPIRQRMALIDEFNNSSDVFVF  812

Query  2573  ILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEE  2752
             ILTT+VGGLGTNLTGANRVIIFDPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEE
Sbjct  813   ILTTKVGGLGTNLTGANRVIIFDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEE  872

Query  2753  KVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVN  2932
             KVYHRQIYKH LTNKILKNPQQ+R FKARD+KDLF LND+GE+G+TE++++F QLSE  N
Sbjct  873   KVYHRQIYKHFLTNKILKNPQQKRFFKARDMKDLFTLNDEGESGATETANLFGQLSEAAN  932

Query  2933  ITGPQHPDQEKDKSIKTN-PADHGTAMERDNNSG-----SNGEEKADNNNGDVDEDTSIL  3094
             + G Q+    K +S K + P  +G   ++  NS       NG+EKAD +N +VDE+T+IL
Sbjct  933   VVGTQNDKHNKQESQKVSVPLANGAGADKGKNSEVGPSRRNGKEKADQSNDEVDEETNIL  992

Query  3095  RTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPT  3274
             R LFDA GIHSAM+HD I+NAHDEEK+KL+EQASRVAQRAAEALRQSRMLRS++SV++PT
Sbjct  993   RCLFDAQGIHSAMNHDMIMNAHDEEKMKLDEQASRVAQRAAEALRQSRMLRSRDSVSVPT  1052

Query  3275  WTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssae  3454
             WTG+SG AGAP S++ KFGST+N QL+ ++K  +E   +S+      AGASAGKALSSAE
Sbjct  1053  WTGKSGMAGAPSSVRGKFGSTVNSQLINNTKRSDE---VSNNGTNGVAGASAGKALSSAE  1109

Query  3455  llakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVC  3634
             LLA+IRG +E+A+  G+EHQ             ++ + G SR SH   G+QPEVLIRQ+C
Sbjct  1110  LLARIRGKEEKAVEAGIEHQFG----------AKSLDVGPSRSSHNLGGVQPEVLIRQIC  1159

Query  3635  TFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             TFIQ+ GGSTSS+SIV+HF+ R+PS DL LFKNLLKEIA L+K PNGS W+LKPE+ ++
Sbjct  1160  TFIQQSGGSTSSSSIVQHFKDRIPSNDLPLFKNLLKEIAKLEKTPNGSVWVLKPEFHQQ  1218



>ref|XP_009336130.1| PREDICTED: DNA repair protein rhp26 [Pyrus x bretschneideri]
Length=1208

 Score =  1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 808/1244 (65%), Positives = 970/1244 (78%), Gaps = 61/1244 (5%)
 Frame = +2

Query  155   MEEDEEDRVLFSSL-GVTSANPEDIERNIFGQTENGFDASN--EAARSMELEATEHNATS  325
             MEEDE D +L +SL G T+ANPEDIER+I     N  + SN  E   S E E     + S
Sbjct  1     MEEDE-DAILLNSLKGATAANPEDIERDILSGVHNNGNGSNVGEVGGSNEEEERLEKSES  59

Query  326   ----STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQST  493
                       +YNKLRAVE EI AV+S  E  +    ++E   D  DG E  + E     
Sbjct  60    IDPSVASGVKLYNKLRAVEFEIDAVESTVEPEQA--GSEEGDRDGGDGAEAGNKEDNLQH  117

Query  494   TQAPlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVL  673
               A             DRL+SL KTKAQL+K++SDL       +  + RD        VL
Sbjct  118   ALA------------TDRLRSLKKTKAQLEKKLSDLGK--GRPSKGIARD-------KVL  156

Query  674   RDVVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVR  853
              D+VK +P PKR+ K+ +   K  +KRIKT S D+DDDFDAVL+AAS+GFVETE+D+LVR
Sbjct  157   LDIVKDKPAPKRKSKQVQISGKKLEKRIKTVSFDEDDDFDAVLDAASAGFVETERDELVR  216

Query  854   KGILTPFHKLKGFERQIQEPGQSSRHSMQDNG----DLVSTSLANAIQSISEAAQSRPTT  1021
             KGILTPFHKLKGFER +QE G S  H++   G    D VS S+A A+QS+SEAAQ+RP T
Sbjct  217   KGILTPFHKLKGFERGLQEQGPSRGHNVPAEGGRSDDFVSASVARAVQSLSEAAQARPAT  276

Query  1022  KLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENG-----RNDKRKRRPTPGKKWRVKVSR  1186
             KLLD   LPKL+PPT+PF+  RK +KI QS ENG      + K+++RP P K+WR ++S 
Sbjct  277   KLLDPEALPKLDPPTHPFKRLRKPLKIPQSLENGTQRTKSSGKKRKRPLPDKRWRKRISL  336

Query  1187  ENKD--EGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWL  1360
             E  +  E  +      E++ D  D+DD+  P V LEGGLKIPE IF+ LFDYQKVGVQWL
Sbjct  337   EENNLLESENTPSCEEENKDDVGDVDDDEYPHVTLEGGLKIPEYIFNGLFDYQKVGVQWL  396

Query  1361  WELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWY  1540
             WELHCQ+AGGIIGDEMGLGKT+QVL+FLG+LHFS+ YKPSIIVCP+TLL+QWKREAKKWY
Sbjct  397   WELHCQRAGGIIGDEMGLGKTIQVLSFLGALHFSHMYKPSIIVCPVTLLRQWKREAKKWY  456

Query  1541  PSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLG  1720
             PSFHVE+LHDS  +   K KGSKS ESDS+SE   D D E+  S ++TKKWD LIN VL 
Sbjct  457   PSFHVELLHDSAREPAIKNKGSKSDESDSDSEGSSDSDYERPESSKSTKKWDSLINRVLR  516

Query  1721  SDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTG  1900
             S+SGLLITTYEQLR++GE LLD++WGYAVLDEGHRIRNPN +VTLVCKQLQTVHRIIMTG
Sbjct  517   SESGLLITTYEQLRIVGESLLDVDWGYAVLDEGHRIRNPNAEVTLVCKQLQTVHRIIMTG  576

Query  1901  SPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLR  2080
             +PIQNKL+ELWSLFDFVFPGKLGVLP+FEAEFAVPIS+GGYANA+PLQVSTAYRCAVVLR
Sbjct  577   APIQNKLTELWSLFDFVFPGKLGVLPIFEAEFAVPISVGGYANASPLQVSTAYRCAVVLR  636

Query  2081  DLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALY  2260
             DLIMPYLLRRMKADV+AQLPKKTEHVIFCSLT  QRS Y+AFLAS++VEQI DG++N+LY
Sbjct  637   DLIMPYLLRRMKADVDAQLPKKTEHVIFCSLTDEQRSAYRAFLASSEVEQIMDGNRNSLY  696

Query  2261  GIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQ  2440
             GIDVMRKICNHPDLLEREH  ++PDYGN ERSGK+KVV++VLK+WKDQGHRVL F+QTQQ
Sbjct  697   GIDVMRKICNHPDLLEREHCGQNPDYGNLERSGKLKVVSQVLKVWKDQGHRVLLFTQTQQ  756

Query  2441  MLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGA  2620
             MLDI+E+FLV  GY YRRMDG TP+KQRMALIDEFNN+ ++F+FILTT+VGGLGTNLTGA
Sbjct  757   MLDIIESFLVADGYSYRRMDGLTPIKQRMALIDEFNNSSDVFVFILTTKVGGLGTNLTGA  816

Query  2621  NRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKI  2800
             NRVIIFDPDWNPS D+QARERAWRIGQK+DVT+YRLITRGTIEEKVYHRQIYKH LTNKI
Sbjct  817   NRVIIFDPDWNPSTDIQARERAWRIGQKRDVTIYRLITRGTIEEKVYHRQIYKHFLTNKI  876

Query  2801  LKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQH--PDQEKDKS  2974
             LKNPQQRR+FKARD+KDLF L+DD ENGSTE++++F QLSED N+ G Q+  PD++ D  
Sbjct  877   LKNPQQRRIFKARDMKDLFTLSDDRENGSTETANLFGQLSEDANVVGVQNDKPDKQ-DSQ  935

Query  2975  IKTNPADHGTAMERDNNSGS-----NGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDH  3139
               +  + +G   ++ NNS +     NG+EKAD ++G+VDE+T+ILR LFDA GIHSAM+H
Sbjct  936   RGSVRSTNGVVADKANNSEAGPSRRNGKEKADQSDGEVDEETNILRCLFDAQGIHSAMNH  995

Query  3140  DAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIK  3319
             D I+NAHDEEK+KL++QASRVAQ AAEALRQSRMLRS++ V++PTWTG+SG AGAP +++
Sbjct  996   DVIMNAHDEEKMKLDKQASRVAQSAAEALRQSRMLRSRDGVSVPTWTGKSGMAGAPSAVR  1055

Query  3320  KKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISD  3499
              KFGSTLN QLV ++K  +E    S+  NG  AGA AGKALSSAELLAKIRGNQERA+  
Sbjct  1056  GKFGSTLNSQLVKNTKRSDEGP--SNGTNGFVAGAPAGKALSSAELLAKIRGNQERAVEA  1113

Query  3500  GLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASI  3679
             G+E  HQFN       R ++ + G SR  H   G+QPEV+IRQ+CTFIQ++GGST S+SI
Sbjct  1114  GIE--HQFN-------RAKSLDVGPSRTGHNLGGVQPEVVIRQICTFIQQRGGSTDSSSI  1164

Query  3680  VEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             V+HF+ R+PSKDL LFKNLLKEIA L+KN NG+ W+LKPE+  +
Sbjct  1165  VQHFKDRIPSKDLPLFKNLLKEIAKLEKNQNGAVWVLKPEFDRQ  1208



>ref|XP_008372358.1| PREDICTED: DNA repair protein rhp26 [Malus domestica]
Length=1207

 Score =  1462 bits (3784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 812/1239 (66%), Positives = 969/1239 (78%), Gaps = 58/1239 (5%)
 Frame = +2

Query  155   MEEDEEDRVLFSSL-GVTSANPEDIERNIFGQTENGFDASN--EAARSMELEATEHNATS  325
             MEEDE D +L +SL G T+ANPEDIER+I     N  + SN  E   S E E     + S
Sbjct  1     MEEDE-DAILLNSLKGATAANPEDIERDILSGVHNNGNGSNVSEVGGSNEEEERLEKSES  59

Query  326   ----STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQST  493
                       +Y+KLRAVE EI AV+S  E  +   R++E   D  DG E          
Sbjct  60    IDPSVASGVKLYSKLRAVEFEIDAVESTVEPEQT--RSEEGDRDGGDGAE----------  107

Query  494   TQAPlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVL  673
               A     +LQ ALA DRL+SL KTKAQL+KE+SDL       +  + RD        VL
Sbjct  108   --AGNKADNLQHALATDRLRSLKKTKAQLEKELSDLGK--GRPSKGIARD-------KVL  156

Query  674   RDVVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVR  853
              D+VK +P PKR+ K+ +   K  +KRIKT S D+DDDFDAVL+AAS+GFVETE+D+LVR
Sbjct  157   LDIVKDKPAPKRKSKQVQISGKKLEKRIKTVSFDEDDDFDAVLDAASAGFVETERDELVR  216

Query  854   KGILTPFHKLKGFERQIQEPGQSSRHSMQDNG----DLVSTSLANAIQSISEAAQSRPTT  1021
             KGILTPFHKLKGFER +QE G S   ++   G    D VS S+A A+QS+S+AAQ+RP T
Sbjct  217   KGILTPFHKLKGFERGLQEQGPSRGRNIPAEGGRSDDFVSASVARAVQSLSDAAQARPAT  276

Query  1022  KLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENG--RND---KRKRRPTPGKKWRVKVSR  1186
             KLLD   LPKL+PPT+PF+  RK +KI QS ENG  RN    K+++RP P K+WR ++S 
Sbjct  277   KLLDPEALPKLDPPTHPFKRLRKPLKIPQSLENGTQRNKSSGKKRKRPLPDKRWRKRISL  336

Query  1187  E--NKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWL  1360
             E  N  E  +      E++ D  D+DD+  P V LEGGLKIPE IF +LFDYQKVGVQWL
Sbjct  337   EENNLHESENTPSCEEENQDDVGDVDDDEYPHVTLEGGLKIPEYIFKQLFDYQKVGVQWL  396

Query  1361  WELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWY  1540
             WELHCQ+AGGIIGDEMGLGKT+QVL+FLG+LHFS+ YKPSIIVCP+TLL+QWKREAKKWY
Sbjct  397   WELHCQRAGGIIGDEMGLGKTIQVLSFLGALHFSHMYKPSIIVCPVTLLRQWKREAKKWY  456

Query  1541  PSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLG  1720
             PSFHVE+LHDS  +   KKKGSKS ESDS+SE   D D E+  S ++TKKWD LIN VL 
Sbjct  457   PSFHVELLHDSAREPAIKKKGSKSDESDSDSEGSSDSDYERPESSKSTKKWDSLINRVLR  516

Query  1721  SDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTG  1900
             S+SGLLITTYEQLR++GE LLD++WGYAVLDEGHRIRNPN +VTLVCKQLQTVHRIIMTG
Sbjct  517   SESGLLITTYEQLRIVGESLLDVDWGYAVLDEGHRIRNPNAEVTLVCKQLQTVHRIIMTG  576

Query  1901  SPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLR  2080
             +PIQNKL+ELWSLFDFVFPGKLGVLP+FEAEFAVPIS+GGYANA+PLQVSTAYRCAVVLR
Sbjct  577   APIQNKLTELWSLFDFVFPGKLGVLPIFEAEFAVPISVGGYANASPLQVSTAYRCAVVLR  636

Query  2081  DLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALY  2260
             DLIMPYLLRRMKADV+AQL KKTEHVIFCSLT  QRS Y+AFLAS++VEQI DG++N+LY
Sbjct  637   DLIMPYLLRRMKADVDAQLTKKTEHVIFCSLTDEQRSAYRAFLASSEVEQIMDGNRNSLY  696

Query  2261  GIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQ  2440
             GIDVMRKICNHPDLLEREH  ++PDYGN ERSGK+KVV++VLK+WKDQGHRVL F+QTQQ
Sbjct  697   GIDVMRKICNHPDLLEREHCGQNPDYGNLERSGKLKVVSQVLKVWKDQGHRVLLFTQTQQ  756

Query  2441  MLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGA  2620
             MLDI+E++LV+ GY YRRMDG TP+KQRMALIDEFNN+ ++F+FILTT+VGGLGTNLTGA
Sbjct  757   MLDIIESYLVSDGYSYRRMDGLTPIKQRMALIDEFNNSSDVFVFILTTKVGGLGTNLTGA  816

Query  2621  NRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKI  2800
             NRVIIFDPDWNPS DMQARERAWRIGQK+DVT+YRLITRGTIEEKVYHRQIYKH LTNKI
Sbjct  817   NRVIIFDPDWNPSTDMQARERAWRIGQKRDVTIYRLITRGTIEEKVYHRQIYKHFLTNKI  876

Query  2801  LKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIK  2980
             LKNPQQRR FKARD+KDLF L+DD ENGSTE++ +F QLSED N+ G Q+    +     
Sbjct  877   LKNPQQRRFFKARDMKDLFTLSDDRENGSTETAHLFGQLSEDANVIGVQNEPDTQYSQRG  936

Query  2981  TNPADHGTAMERDNNSGS-----NGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDA  3145
             +  + +G   +  NNS +     NG+EKAD ++G+VDE+T+ILR LFDA GIHSAM+HD 
Sbjct  937   SVQSTNGVVADNANNSEAGPSRRNGKEKADQSDGEVDEETNILRCLFDAQGIHSAMNHDV  996

Query  3146  IVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK  3325
             I+NAHDEEK+KL+EQASRVAQRAAEALRQSRMLRS++ V++PTWTG+SG AGAP +++ K
Sbjct  997   IMNAHDEEKMKLDEQASRVAQRAAEALRQSRMLRSRDGVSVPTWTGKSGMAGAPSAVRGK  1056

Query  3326  FGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGL  3505
             FGSTLN QLV ++K  +E    S+  NG  AGA AGKALSSAELLAKIRGNQERA+  G+
Sbjct  1057  FGSTLNSQLVKNTKRSDEGP--SNGTNGFVAGAPAGKALSSAELLAKIRGNQERAVEAGI  1114

Query  3506  EHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVE  3685
             E  HQFN       R ++ + G SR  H   G+QPEV+IRQ+CTFIQ++GGST S+SIV+
Sbjct  1115  E--HQFN-------RAKSFDVGPSRTGHNLGGVQPEVVIRQICTFIQQRGGSTDSSSIVQ  1165

Query  3686  HFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEY  3802
             HF+ R+PS+DL LFKNLLKEIA L+KN NG+ W+LKPE+
Sbjct  1166  HFKDRIPSRDLPLFKNLLKEIAKLEKNQNGAVWVLKPEF  1204



>ref|XP_006594029.1| PREDICTED: DNA repair and recombination protein RAD26-like [Glycine 
max]
Length=1225

 Score =  1459 bits (3777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 807/1253 (64%), Positives = 970/1253 (77%), Gaps = 68/1253 (5%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQ-TENGFDASNEAARSMELEAT---EHNATSS  328
             E+EEDR+L SSLGV SANPEDIER++  + T N      E   S + E +   E+   S+
Sbjct  2     EEEEDRILLSSLGVKSANPEDIERDVLEKATRNDLVTVTEVEGSAKEERSDLPENVDPSA  61

Query  329   TKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPl  508
               K ++  KLRAV+ EI AV S  E+L N   N+E     EDG  +   E E        
Sbjct  62    NDKAEIRQKLRAVQFEIDAVASAVERLSNVEDNEECSDAGEDGPGRGTAEGESDGN----  117

Query  509   ndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVK  688
                +LQRALAADRL+SL KTKAQL+KE+ DL  D   D+ S       E    VL  +VK
Sbjct  118   --SNLQRALAADRLRSLEKTKAQLEKELLDLFKDD--DSKSA------EHEELVL-SLVK  166

Query  689   GQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILT  868
              + K KR++KE K  +K+  KR K  S D+D DFDAVL+AAS+GFVETE+D+LVRKGILT
Sbjct  167   EERKSKRKVKEDKKLNKSAGKRPKKVSFDEDADFDAVLDAASAGFVETERDELVRKGILT  226

Query  869   PFHKLKGFERQIQEPGQSSRHSM---QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSS  1039
             PFHKL+GFER+ Q+P  S+ H+    +++GDL S S+  A +S+SEAA+SRPTTKLL+  
Sbjct  227   PFHKLEGFERRFQQPETSTSHNAAEEENDGDLASASIERAARSMSEAARSRPTTKLLEPE  286

Query  1040  LLPKLEPPTYPFQTPRKHVKISQSAE---NGRNDKRKRRPTPGKKWRVKVSRENKD----  1198
               PKL+ PT PF+  +K +K S+  +   N  + ++KRRP PG+KW  +VS E+      
Sbjct  287   AAPKLDAPTIPFRRLKKPLKSSKPLDVELNKDSKRKKRRPLPGRKWTKRVSCEDSHPEES  346

Query  1199  ---------------EGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFD  1333
                            E  DVE+   E              +V LEGGLKIP+ IF+ LFD
Sbjct  347   ENTNGCLDSSSCENLEEQDVELDDQESS------------YVTLEGGLKIPDNIFEALFD  394

Query  1334  YQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQ  1513
             YQKVGVQWLWELHCQ+AGGIIGDEMGLGKTVQVL+FLG+LHFS  YKPSIIVCP+TLL+Q
Sbjct  395   YQKVGVQWLWELHCQRAGGIIGDEMGLGKTVQVLSFLGALHFSGMYKPSIIVCPVTLLRQ  454

Query  1514  WKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKW  1693
             WKREAKKWYP FHVE+LHDS  D   +KK +KS E+D ES    D D EK+++ ++T+KW
Sbjct  455   WKREAKKWYPKFHVELLHDSAQDSAPRKKRAKSEETDYESNSKSDSDYEKSVASKSTRKW  514

Query  1694  DKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQ  1873
             + LIN V+ S+SGLLITTYEQLR+LGE+LLDI+WGYAVLDEGHRIRNPN +VTLVCKQLQ
Sbjct  515   ESLINRVMRSESGLLITTYEQLRILGEQLLDIQWGYAVLDEGHRIRNPNAEVTLVCKQLQ  574

Query  1874  TVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVST  2053
             TVHRIIMTG+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPIS+GGYANA+PLQVST
Sbjct  575   TVHRIIMTGAPIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPISVGGYANASPLQVST  634

Query  2054  AYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQI  2233
             AYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHV+FCSLTS Q S Y+AFLASTDVEQI
Sbjct  635   AYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTSEQVSAYRAFLASTDVEQI  694

Query  2234  FDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHR  2413
              DG +N+LYGIDVMRKICNHPDLLER+H+  DPDYGNPERSGKMKVVA+VL +WK+QGHR
Sbjct  695   LDGHRNSLYGIDVMRKICNHPDLLERDHAFNDPDYGNPERSGKMKVVAQVLNVWKEQGHR  754

Query  2414  VLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVG  2593
             VL F+QTQQML+I ENFL T G+ YRRMDG TPVKQRMALIDEFN++ EIFIFILTT+VG
Sbjct  755   VLLFTQTQQMLNIFENFLTTSGHIYRRMDGLTPVKQRMALIDEFNDSSEIFIFILTTKVG  814

Query  2594  GLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQI  2773
             GLGTNLTGANRVIIFDPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQI
Sbjct  815   GLGTNLTGANRVIIFDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQI  874

Query  2774  YKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHP  2953
             YKH LTNKILKNPQQ+R FKARD+KDLF LN DGE GSTE+S+IFSQ+SE+VN+ G    
Sbjct  875   YKHFLTNKILKNPQQKRFFKARDMKDLFTLNVDGETGSTETSNIFSQISEEVNVIGTYKE  934

Query  2954  DQEKDKSIKTNP-ADHGTAMERDNNS--GS---NGEEKADNNNGD-VDEDTSILRTLFDA  3112
             +++K K  +T        A+  D+ S  GS    G+EK ++ + + V E+T+IL++LFDA
Sbjct  935   NKDKYKHSQTAELVSEDVAVGNDDKSERGSLRGKGKEKVEHEHSNGVGEETNILKSLFDA  994

Query  3113  HGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSG  3292
             +GIHSAM+HD I+NAHDEEK++LEEQAS+VAQRAAEALRQSRMLRS +SV++PTWTGRSG
Sbjct  995   NGIHSAMNHDLIMNAHDEEKIRLEEQASQVAQRAAEALRQSRMLRSHDSVSVPTWTGRSG  1054

Query  3293  TAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRR--Ngiaagasagkalssaellak  3466
             TAGAP S+K+KFGST+NPQLV +SK  +E     + +     AAGASAGKALSSAELLA+
Sbjct  1055  TAGAPSSVKRKFGSTVNPQLVNNSKASDELPNKGTNKINGFAAAGASAGKALSSAELLAQ  1114

Query  3467  iRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQ  3646
             IRGNQE+AI  GLE  HQF   SSS ++ R+ +  +SR +  S+ +QPEVLIR++CTFIQ
Sbjct  1115  IRGNQEKAIGAGLE--HQFGVSSSSTNQPRSGDVRSSRATENSS-VQPEVLIRKICTFIQ  1171

Query  3647  RKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             ++GGS+ SASIV++F+ R+PSKDLALFKNLLKEIATL K  NGS+W+LKP+YQ
Sbjct  1172  QRGGSSDSASIVQYFKDRIPSKDLALFKNLLKEIATLHKGSNGSYWVLKPDYQ  1224



>ref|XP_002307656.2| hypothetical protein POPTR_0005s24820g [Populus trichocarpa]
 gb|EEE94652.2| hypothetical protein POPTR_0005s24820g [Populus trichocarpa]
Length=1206

 Score =  1447 bits (3745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/1230 (64%), Positives = 951/1230 (77%), Gaps = 44/1230 (4%)
 Frame = +2

Query  167   EEDRVLFSSLGVTSANPEDIERNIFGQTENGFD--ASNEAARSMELEATEHNATSSTKKT  340
             +ED VL SSLGVTSANPEDIER +  +  N  D   S E     +LE  +    SS  + 
Sbjct  4     DEDSVLLSSLGVTSANPEDIERVVLEEARNNADKGGSTEEEPPDKLENVD---PSSANQA  60

Query  341   DMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlndld  520
              +Y+KLRAV+ EI AV S  E++ +    + Q  D   G +KRD   ++S  Q   +D  
Sbjct  61    KLYSKLRAVKFEIDAVASTVEEVTDVVSGEHQTYDDGGGTKKRDKGDDESGVQVSPDDFT  120

Query  521   lqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQPK  700
             LQ+ALAADRL+SL +TK +L+KE+ DL  D     +         + + +L ++VK  P+
Sbjct  121   LQQALAADRLRSLKRTKVKLEKELLDLRKDDATKAV---------EHDKLLANLVKEDPR  171

Query  701   PKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFHK  880
             PK++ K+     KNK+K+ KT S  DD DFD +L+ ASSGFVETE+D+LVRKGILTPFH+
Sbjct  172   PKKKSKKVLKSGKNKEKQQKTVSFADDADFDLMLDGASSGFVETERDELVRKGILTPFHQ  231

Query  881   LKGFERQIQEPGQSSRHSM---QDNGD-LVSTSLANAIQSISEAAQSRPTTKLLDSSLLP  1048
             LKGFER++Q+PG SS  +    +D  D L S S+  A  S+ EAA++RPTTKLLDS  LP
Sbjct  232   LKGFERRLQQPGSSSGKNESIEEDKTDGLDSDSVVRAAHSMLEAAKARPTTKLLDSEALP  291

Query  1049  KLEPPTYPFQTPRKHVKISQS----AENGRNDKRKR-RPTPGKKWRVKVSRENKDEGPDV  1213
             KL+ PT PFQ  +  +K  QS    AE  +  +RKR RP PGKKWR   S E+  E  D 
Sbjct  292   KLDAPTRPFQRLKTPLKACQSPERDAEKRKGSERKRKRPLPGKKWRKSASWEDMGESEDS  351

Query  1214  --EISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAG  1387
                + +   E+D +D  D   PF+ LEGGLKIPE IF KLFDYQKVGVQWLWELHCQ+AG
Sbjct  352   GRNLVTSISEEDVDDGYDNDSPFITLEGGLKIPEAIFSKLFDYQKVGVQWLWELHCQRAG  411

Query  1388  GIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILH  1567
             GIIGDEMGLGKT+QVL+FLG+LHFSN YKPSI+VCP+TLL+QWKREA+KWYP FHVE+LH
Sbjct  412   GIIGDEMGLGKTIQVLSFLGALHFSNMYKPSIVVCPVTLLRQWKREAQKWYPRFHVELLH  471

Query  1568  DSVNDFhdkkkgskshesdseseelldvdvekN----LSFRNTKKWDKLINHVLGSDSGL  1735
             DS  D   +    K      ES+   +  ++ +    +S R   KWD LIN V  SDSGL
Sbjct  472   DSAQDVSCRDPLKKKRAQSYESDCETEDSLDSDYEGSISCRKANKWDSLINRVFESDSGL  531

Query  1736  LITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQN  1915
             LITTYEQLRLLGEKLLD EWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PIQN
Sbjct  532   LITTYEQLRLLGEKLLDFEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQN  591

Query  1916  KLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMP  2095
             KL+ELWSLFDFVFPGKLGV+PVFEAEFAVPIS+GGYANA+PLQVSTAYRCAVVLRDLIMP
Sbjct  592   KLTELWSLFDFVFPGKLGVMPVFEAEFAVPISVGGYANASPLQVSTAYRCAVVLRDLIMP  651

Query  2096  YLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVM  2275
             YLLRRMK DVNA LPKKTEHV+FCSLTS QRS+Y+AFLAST+VE I DGS+N+LYGIDVM
Sbjct  652   YLLRRMKMDVNAHLPKKTEHVLFCSLTSEQRSVYRAFLASTEVENILDGSRNSLYGIDVM  711

Query  2276  RKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDIL  2455
             RKICNHPDLLEREHS  +PDYGNPERSGKMKVVA+VLK+W++QGHRVL F+QTQQMLDI 
Sbjct  712   RKICNHPDLLEREHSYHNPDYGNPERSGKMKVVAQVLKVWQEQGHRVLLFTQTQQMLDIF  771

Query  2456  ENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVII  2635
             ENFL +GGY YRRMDG+TP+K RM++IDEFNN+ +IFIFILTT+VGGLGTNLTGANRVII
Sbjct  772   ENFLNSGGYNYRRMDGSTPIKLRMSIIDEFNNSGDIFIFILTTKVGGLGTNLTGANRVII  831

Query  2636  FDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQ  2815
             FDPDWNPS DMQARERAWRIGQKKDVTVYRLIT GTIEEKVYHRQIYKH LTNKILKNPQ
Sbjct  832   FDPDWNPSTDMQARERAWRIGQKKDVTVYRLITGGTIEEKVYHRQIYKHFLTNKILKNPQ  891

Query  2816  QRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPAD  2995
             QRR F+ARD+KDLF LNDDGE GSTE+S+IFSQLSEDVN+ G +         +K    +
Sbjct  892   QRRFFRARDMKDLFTLNDDGEGGSTETSNIFSQLSEDVNVVGTKK------DKLKKRKKN  945

Query  2996  HGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKL  3175
              G A   D+      +EKAD ++G+VDE+T+IL++LFDA+GIHSA++HD I+NAHD EK+
Sbjct  946   KGIAQHADDAI----KEKADCSDGEVDEETNILKSLFDANGIHSAVNHDVIMNAHDGEKM  1001

Query  3176  KLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLV  3355
             +LEEQAS+VAQRAAEALRQSRMLRS++S+++PTWTG+SGTAGAP S+++KFGST+N QL+
Sbjct  1002  RLEEQASQVAQRAAEALRQSRMLRSRDSISVPTWTGKSGTAGAPSSVRQKFGSTVNSQLI  1061

Query  3356  TSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGS  3535
              SS     SS   S   GIAAG SAGKALSSAELLA+IRGNQERA+  GL+   QF   S
Sbjct  1062  KSSD---SSSSNKSNLKGIAAGTSAGKALSSAELLARIRGNQERAVGAGLD--QQFGFAS  1116

Query  3536  SSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKD  3715
             SS +   +  +GAS+P    + +QPE+LIRQ+CTFIQR+GGS+ S+SIV+HF+ R+PSKD
Sbjct  1117  SSGTSAMSENSGASKPPQTLSSVQPEILIRQICTFIQRRGGSSDSSSIVQHFKDRIPSKD  1176

Query  3716  LALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             L LFKNLLKEIA+L+++ NG  W+LKPEYQ
Sbjct  1177  LPLFKNLLKEIASLREDANGKQWVLKPEYQ  1206



>ref|XP_010679320.1| PREDICTED: protein CHROMATIN REMODELING 8 [Beta vulgaris subsp. 
vulgaris]
Length=1215

 Score =  1443 bits (3736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/1237 (64%), Positives = 954/1237 (77%), Gaps = 49/1237 (4%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATS----S  328
             E+EED    +SLGVTSANPEDIER+I  +  N  ++S+ A R    E    + T     S
Sbjct  2     EEEEDAFFLNSLGVTSANPEDIERDILEKARNNAESSSHAGRGTTEEEVCTDVTETQHLS  61

Query  329   TKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPl  508
             + + ++  KL+A++ EI AV S  EQ ++    +E   +   G +    E +Q   +A  
Sbjct  62    SSQVELLKKLKAIDVEIDAVTSAVEQSKSGITREELDNESYGGKD----EDDQGIEEAMP  117

Query  509   ndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVK  688
             +D  LQ ALAADRL+SL KT+A+L+KE+S++ ND   D L           + +L+ +V+
Sbjct  118   SDSILQHALAADRLRSLKKTRAELRKELSNICNDGKADELE----------DRLLKYMVR  167

Query  689   GQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILT  868
              + K KR+LKE K   K  KK+  T S  +DD+FDAVLNAAS GFVETE+D+LVRKGILT
Sbjct  168   EEVKSKRKLKEVKDVKKESKKQKTTVSYQEDDEFDAVLNAASGGFVETERDELVRKGILT  227

Query  869   PFHKLKGFERQIQEPGQSSRHSMQDNGDLV----STSLANAIQSISEAAQSRPTTKLLDS  1036
             PFHKLKGFER+IQ+P  S    +Q+N +++    S S+A   +S+SEA+Q+RPTT+LL+ 
Sbjct  228   PFHKLKGFERRIQKPEPSG---LQENENVIVDRASESVARMARSLSEASQARPTTRLLEP  284

Query  1037  SLLPKLEPPTYPFQTPRKHVKISQSAENG---RND--KRKRRPTPGKKWRVKVSRENKDE  1201
               LP+L+ P++ F   ++  KI +S ++     ND  ++KRRP PG++WR ++++E    
Sbjct  285   KDLPRLDAPSHAFNRLKRPFKIPKSLDSDGEKSNDTNRKKRRPLPGRRWRKRIAKEE---  341

Query  1202  GPDVEISSYedekddedmddeGPPF--VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHC  1375
                 E S   D+   E  D EG     V LEGGLKIPETIF+ LFDYQKVGVQW+WELHC
Sbjct  342   -IAAEESDLHDDLVTETQDVEGEELLSVTLEGGLKIPETIFNNLFDYQKVGVQWMWELHC  400

Query  1376  QKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHV  1555
             Q+AGGIIGDEMGLGKT+QVLAFLGSLHFSN YKPSIIVCP+TLL+QWKREA+KWYP FHV
Sbjct  401   QRAGGIIGDEMGLGKTIQVLAFLGSLHFSNMYKPSIIVCPVTLLRQWKREAQKWYPGFHV  460

Query  1556  EILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGL  1735
             EILHDS  D   KKK S   ESDSESE L + D E  L  R+ KKWD +I  VL  +SGL
Sbjct  461   EILHDSGVDSVRKKKQSGPGESDSESEGLFESDRESVLPSRSAKKWDSMIKRVLRLESGL  520

Query  1736  LITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQN  1915
             LITTYEQLR+LGEKLLDIEWGYAVLDEGHRIRNPN +VT+VCKQLQTVHRIIMTG+PIQN
Sbjct  521   LITTYEQLRILGEKLLDIEWGYAVLDEGHRIRNPNAEVTIVCKQLQTVHRIIMTGAPIQN  580

Query  1916  KLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMP  2095
             +LSELWSLFDFVFPGKLGVLPVFEAEFAVPI +GGYANA+PLQVSTAYRCAVVLRDLIMP
Sbjct  581   RLSELWSLFDFVFPGKLGVLPVFEAEFAVPIQVGGYANASPLQVSTAYRCAVVLRDLIMP  640

Query  2096  YLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVM  2275
             YLLRRMKADVNAQLPKKTEHV+FCSLT  QRSIY+AFLAS++VEQIFDGS+N+LYGIDVM
Sbjct  641   YLLRRMKADVNAQLPKKTEHVLFCSLTPEQRSIYRAFLASSEVEQIFDGSRNSLYGIDVM  700

Query  2276  RKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDIL  2455
             RKICNHPDLLEREHS  +PDYGNPERSGKMKVV ++LK WK+QGHRVL FSQTQQMLDIL
Sbjct  701   RKICNHPDLLEREHSQYNPDYGNPERSGKMKVVIQILKTWKEQGHRVLLFSQTQQMLDIL  760

Query  2456  ENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVII  2635
             ENFL+   Y YRRMDG T VKQRMALIDEFNN+ ++FIFILTT+VGGLGTNLTGANRVII
Sbjct  761   ENFLIANKYSYRRMDGLTAVKQRMALIDEFNNSTDVFIFILTTKVGGLGTNLTGANRVII  820

Query  2636  FDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQ  2815
             FDPDWNPS DMQARERAWRIGQ +DVTV+RLITRGTIEEKVYHRQIYKH LTNKILKNPQ
Sbjct  821   FDPDWNPSTDMQARERAWRIGQTRDVTVFRLITRGTIEEKVYHRQIYKHFLTNKILKNPQ  880

Query  2816  QRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPA-  2992
             QRR FKARDLKDLF L D+   GSTE+S+IF Q SE VN+ G +  D+ K  S +     
Sbjct  881   QRRFFKARDLKDLFTLTDEEHAGSTETSNIFGQFSEQVNLIGTEKDDERKSNSSREGAGY  940

Query  2993  ------DHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVN  3154
                   D  + + +DN+   N E++ D + G  DE+T+ L+ LF+A GIHSA+DHDAI+N
Sbjct  941   ANGRVLDGESGLPQDNS--GNEEKEGDEDGGKADEETNFLKNLFEAQGIHSAVDHDAIMN  998

Query  3155  AHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGS  3334
             AHDEEKL+LEE+ASRVAQRAAEALRQSRMLRS+ES+++PTWTG+SG AGAP S+ +KFGS
Sbjct  999   AHDEEKLRLEEEASRVAQRAAEALRQSRMLRSKESISVPTWTGKSGAAGAPSSVPRKFGS  1058

Query  3335  TLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQ  3514
             ++N QLVT S+   E  +  +  NG +AGA++GKALSSAELLAKIRGNQ  A+ DGLE  
Sbjct  1059  SVNSQLVTKSRS--EDEVPGNGINGFSAGAASGKALSSAELLAKIRGNQASAVGDGLE--  1114

Query  3515  HQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFR  3694
             HQF   SSS++RT + + G SR S   +G QPEV+IR +CTFIQ +GGSTSS  IVEHF+
Sbjct  1115  HQFGLSSSSSNRTSSNDAGPSRASRNLSGAQPEVIIRNICTFIQNRGGSTSSTIIVEHFK  1174

Query  3695  SRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
              R+PSKDL LFKNLLKEIA L+K+PNGS W+LKPEYQ
Sbjct  1175  DRIPSKDLPLFKNLLKEIALLEKHPNGSVWVLKPEYQ  1211



>ref|XP_011004030.1| PREDICTED: protein CHROMATIN REMODELING 8 [Populus euphratica]
 ref|XP_011004031.1| PREDICTED: protein CHROMATIN REMODELING 8 [Populus euphratica]
 ref|XP_011004032.1| PREDICTED: protein CHROMATIN REMODELING 8 [Populus euphratica]
 ref|XP_011004033.1| PREDICTED: protein CHROMATIN REMODELING 8 [Populus euphratica]
Length=1223

 Score =  1442 bits (3733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 799/1238 (65%), Positives = 965/1238 (78%), Gaps = 43/1238 (3%)
 Frame = +2

Query  167   EEDRVLFSSLGVTSANPEDIERNIFGQTENGFD--ASNEAARSMELEATEHNATSSTKKT  340
             +ED VL SSLGVTSANPEDIER +  +  N  D   S E     +LE  +    SST + 
Sbjct  4     DEDSVLLSSLGVTSANPEDIERVVLEEARNKADKGGSTEEEPPDKLENVD---PSSTNQA  60

Query  341   DMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlndld  520
              +Y+KLRAV+ EI AV S  E++      + Q  D   G +K D   ++S  Q   +D  
Sbjct  61    KLYSKLRAVKFEIDAVASTVEEVTGVVSGEHQTYDDGGGTKKMDNGDDESGVQVSPDDFS  120

Query  521   lqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQPK  700
             LQ+ALAADRL+SL +TK +L+KE+ +L  D     +         + + +L ++VK  P+
Sbjct  121   LQQALAADRLRSLKRTKVKLEKELLELRKDDATKAV---------EHDKLLANLVKEDPR  171

Query  701   PKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFHK  880
             PK++ K+     KNK+K+ KT S  DD DFD +L+ ASSGFVETE+D+LVRKGILTPFH+
Sbjct  172   PKKKSKKVLKSGKNKEKQQKTVSFADDADFDLMLDGASSGFVETERDELVRKGILTPFHQ  231

Query  881   LKGFERQIQEPGQSSRHSMQDNGD-----LVSTSLANAIQSISEAAQSRPTTKLLDSSLL  1045
             LKGFER++Q+PG SSR   + N +     L S S+  A  S+ EAA++RPTTKLLDS  L
Sbjct  232   LKGFERRLQQPG-SSRGKNESNEEDKTDGLDSDSVVRAAHSMLEAAKARPTTKLLDSEDL  290

Query  1046  PKLEPPTYPFQTPRKHVKISQSAENGR-----NDKRKRRPTPGKKWRVKVSRENKDEGPD  1210
             PKL+ PT PFQ  +  +K  QS E        ++++++RP PGKKWR   S E+  E  D
Sbjct  291   PKLDAPTRPFQRLKTPLKACQSPERDTEKRKGSERKRKRPLPGKKWRKSASWEDMGESED  350

Query  1211  V--EISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKA  1384
                 + +   E+D +D  D   PF+ LEGGLKIPE IF KLFDYQKVGVQWLWELHCQ+A
Sbjct  351   SGRNLVTSISEEDVDDGYDNDSPFITLEGGLKIPEAIFSKLFDYQKVGVQWLWELHCQRA  410

Query  1385  GGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEIL  1564
             GGIIGDEMGLGKT+QVL+FLG+LHFSN YKPSI+VCP+TLL+QWKREA+KWYP FHVE+L
Sbjct  411   GGIIGDEMGLGKTIQVLSFLGALHFSNMYKPSIVVCPVTLLRQWKREARKWYPRFHVELL  470

Query  1565  HDSVND----FhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSG  1732
             HDS  D    +  KKK ++S+ESD E E+ LD D E ++S R   KWD LIN V  SDSG
Sbjct  471   HDSAQDVSCRYPLKKKRARSYESDCEPEDSLDSDYEGSISCRKANKWDSLINRVFESDSG  530

Query  1733  LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQ  1912
             LLITTYEQLRLLGEKLLD EWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PIQ
Sbjct  531   LLITTYEQLRLLGEKLLDFEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQ  590

Query  1913  NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIM  2092
             NKL+ELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANA+PLQVSTAYRCAVVLRDLIM
Sbjct  591   NKLTELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANASPLQVSTAYRCAVVLRDLIM  650

Query  2093  PYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDV  2272
             PYLLRRMK DVNA LPKKTE+V+FCSLTS QRS+Y+AFLAST+VE I DGS+N+LYGIDV
Sbjct  651   PYLLRRMKMDVNAHLPKKTENVLFCSLTSEQRSVYRAFLASTEVENILDGSRNSLYGIDV  710

Query  2273  MRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDI  2452
             MRKICNHPDLLEREHS  +PDYGNPERSGKMKVVA+VLK+W++QGHRVL F+QTQQMLDI
Sbjct  711   MRKICNHPDLLEREHSYHNPDYGNPERSGKMKVVAQVLKVWQEQGHRVLLFTQTQQMLDI  770

Query  2453  LENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVI  2632
              ENFL +GGY YRRMDG+TP+K RM++IDEFNN+ ++FIFILTT+VGGLGTNLTGANRVI
Sbjct  771   FENFLNSGGYNYRRMDGSTPIKLRMSIIDEFNNSGDVFIFILTTKVGGLGTNLTGANRVI  830

Query  2633  IFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNP  2812
             IFDPDWNPS DMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKH LTNKILKNP
Sbjct  831   IFDPDWNPSTDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLTNKILKNP  890

Query  2813  QQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPA  2992
             QQRR F+ARD+KDLF LNDDGE GSTE+S+IFSQLSEDVN+ G +    +K K  K   A
Sbjct  891   QQRRFFRARDMKDLFTLNDDGEGGSTETSNIFSQLSEDVNVVGTKKEKLKKRKKNKA-IA  949

Query  2993  DHG--TAMERDNNSGSNG-----EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIV  3151
              H   T ++ +NNS         +EKAD ++G+VDE+T+IL++LFDA+GIHSA++HD I+
Sbjct  950   QHADDTIVDNENNSEIRALRREEKEKADCSDGEVDEETNILKSLFDANGIHSAVNHDVIM  1009

Query  3152  NAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFG  3331
             NAHD EK++LEEQAS+VAQRAAEALRQSRMLRS++S+++PTWTG+SGTAGAP S+ +KFG
Sbjct  1010  NAHDGEKMRLEEQASQVAQRAAEALRQSRMLRSRDSISVPTWTGKSGTAGAPSSVHQKFG  1069

Query  3332  STLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEH  3511
             ST+N QL+ SS     +   + +  GIAAG SAGKALSSAELLA+IRGNQERA+  GL+ 
Sbjct  1070  STVNSQLIKSSDSSSSNKTSNLK--GIAAGTSAGKALSSAELLARIRGNQERAVGAGLD-  1126

Query  3512  QHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF  3691
               QF   SSS +   +  +GASRP    + +QPE LIRQ+CTFIQR+GGS+ S+SIV+HF
Sbjct  1127  -QQFGFASSSGTSAMSENSGASRPPQTLSSVQPETLIRQICTFIQRRGGSSDSSSIVQHF  1185

Query  3692  RSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             + R+PSKDL LFKNLLKEIA+L+++ NG  W+LKPEYQ
Sbjct  1186  KDRIPSKDLPLFKNLLKEIASLREDANGKQWVLKPEYQ  1223



>gb|KHN48923.1| DNA repair and recombination protein RAD26 [Glycine soja]
Length=1225

 Score =  1441 bits (3729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 806/1253 (64%), Positives = 967/1253 (77%), Gaps = 68/1253 (5%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQ-TENGFDASNEAARSMELEAT---EHNATSS  328
             E+EEDR+L SSLGV SANPEDIER++  + T N      E   S + E +   E+   S+
Sbjct  2     EEEEDRILLSSLGVKSANPEDIERDVLEKATRNDLVTVTEVEGSAKEERSDLPENVDPSA  61

Query  329   TKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPl  508
               K ++  KLRAV+ EI AV S  E+L N   N+E     ED   +   E E        
Sbjct  62    NDKAELRQKLRAVQFEIDAVASAVERLSNVEDNEECSDAGEDSPGRGTAEGESDGN----  117

Query  509   ndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVK  688
                +LQRALAADRL+SL KTKAQL+KE+ DL  D   D+ S       E    VL  +VK
Sbjct  118   --SNLQRALAADRLRSLEKTKAQLEKELLDLFKDD--DSKSA------EHEELVL-SLVK  166

Query  689   GQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILT  868
              + K KR++KE K  +K+  KR K  S DDD DFDAVL+AAS+GFVETE+D+LVRKGILT
Sbjct  167   EERKSKRKVKEDKKLNKSAGKRPKKVSFDDDADFDAVLDAASAGFVETERDELVRKGILT  226

Query  869   PFHKLKGFERQIQEPGQSSRHSM---QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSS  1039
             PFHKL+GFER+ Q+P  S+ H+    +++ DL S S+  A +S+SEAA+SRPTTKLL+  
Sbjct  227   PFHKLEGFERRFQQPETSTSHNAAEEENDSDLASASIERAARSMSEAARSRPTTKLLEPE  286

Query  1040  LLPKLEPPTYPFQTPRKHVKISQSAE---NGRNDKRKRRPTPGKKWRVKVSRENKD----  1198
               PKL+ PT PF+  +K +K S+  +   N  + ++KRRP PG+KW  +VS E+      
Sbjct  287   AAPKLDAPTIPFRRLKKPLKSSKPLDVELNKDSKRKKRRPLPGRKWTKRVSCEDSHPEES  346

Query  1199  ---------------EGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFD  1333
                            E  DVE+   E              +V LEGGLKIP+ IF+ LFD
Sbjct  347   ENTNGCLDSSSCENLEEQDVELDDQESS------------YVTLEGGLKIPDNIFEALFD  394

Query  1334  YQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQ  1513
             YQKVGVQWLWELHCQ+AGGIIGDEMGLGKTVQVL+FLG+LHFS  YKPSIIVCP+TLL+Q
Sbjct  395   YQKVGVQWLWELHCQRAGGIIGDEMGLGKTVQVLSFLGALHFSGMYKPSIIVCPVTLLRQ  454

Query  1514  WKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKW  1693
             WKREAKKWYP FHVE+LHDS  D   +KK +KS E+D ES    D D EK+++ ++T+KW
Sbjct  455   WKREAKKWYPKFHVELLHDSAQDSAPRKKRAKSEETDYESNSKSDSDYEKSVASKSTRKW  514

Query  1694  DKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQ  1873
             + LIN V+ S+SGLLITTYEQLR+LGE+LLDI+WGYAVLDEGHRIRNPN +VTLVCKQLQ
Sbjct  515   ESLINRVMRSESGLLITTYEQLRILGEQLLDIQWGYAVLDEGHRIRNPNAEVTLVCKQLQ  574

Query  1874  TVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVST  2053
             TVHRIIMTG+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPIS+GGYANA+PLQVST
Sbjct  575   TVHRIIMTGAPIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPISVGGYANASPLQVST  634

Query  2054  AYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQI  2233
             AYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHV+FCSLTS Q S Y+AFLASTDVEQI
Sbjct  635   AYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTSEQVSAYRAFLASTDVEQI  694

Query  2234  FDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHR  2413
              DG +N+LYGIDVMRKICNHPDLLER+H+  DPDYGNPERSGKMKVVA+VL +WK+QGHR
Sbjct  695   LDGHRNSLYGIDVMRKICNHPDLLERDHAFNDPDYGNPERSGKMKVVAQVLNVWKEQGHR  754

Query  2414  VLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVG  2593
             VL F+QTQQML+I ENFL T G+ YRRMDG TPVKQRMALIDEFN++ EIFIFILTT+VG
Sbjct  755   VLLFTQTQQMLNIFENFLTTSGHIYRRMDGLTPVKQRMALIDEFNDSSEIFIFILTTKVG  814

Query  2594  GLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQI  2773
             GLGTNLTGANRVIIFDPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQI
Sbjct  815   GLGTNLTGANRVIIFDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQI  874

Query  2774  YKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHP  2953
             YKH LTNKILKNPQQ+R FKARD+KDLF LN DGE GSTE+S+IFSQ+SE+VN+ G    
Sbjct  875   YKHFLTNKILKNPQQKRFFKARDMKDLFTLNVDGETGSTETSNIFSQISEEVNVIGTYKE  934

Query  2954  DQEKDKSIKTNP-ADHGTAMERDNNS--GS---NGEEKADNNNGD-VDEDTSILRTLFDA  3112
             +++K K  +T        A+  D+ S  GS    G+EK ++ +   V E+T+IL++LFDA
Sbjct  935   NKDKYKHSQTAELVSEDVAVGNDDKSERGSLRGKGKEKVEHEHSKGVGEETNILKSLFDA  994

Query  3113  HGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSG  3292
             +GIHSAM+HD I+NAHDEEK++LEEQAS+VAQRAAEALRQSRMLRS +SV++PTWTGRSG
Sbjct  995   NGIHSAMNHDLIMNAHDEEKIRLEEQASQVAQRAAEALRQSRMLRSHDSVSVPTWTGRSG  1054

Query  3293  TAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRR--Ngiaagasagkalssaellak  3466
             TAGAP S+K+KFGST+NPQLV +SK  +E     + +     AAGASAGKALSSAELLA+
Sbjct  1055  TAGAPSSVKRKFGSTVNPQLVNNSKASDELPNKGTNKINGFAAAGASAGKALSSAELLAQ  1114

Query  3467  iRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQ  3646
             IRGNQE+AI  GLE  HQF   SSS ++ R+ +  +SR +  S+ +QPEVLIR++CTFIQ
Sbjct  1115  IRGNQEKAIGAGLE--HQFGVSSSSTNQPRSGDVRSSRATENSS-VQPEVLIRKICTFIQ  1171

Query  3647  RKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             ++GGS+ SASIV++F+ R+PSKDLALFKNLLKEIATL K  NGS+W+LKP+YQ
Sbjct  1172  QRGGSSDSASIVQYFKDRIPSKDLALFKNLLKEIATLHKGSNGSYWVLKPDYQ  1224



>ref|XP_007144880.1| hypothetical protein PHAVU_007G191600g [Phaseolus vulgaris]
 gb|ESW16874.1| hypothetical protein PHAVU_007G191600g [Phaseolus vulgaris]
Length=1221

 Score =  1439 bits (3726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/1241 (64%), Positives = 974/1241 (78%), Gaps = 48/1241 (4%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQ-TENGFDASNE---AARSMELEATEHNATSS  328
             E+EEDR+L SSLGV SANPEDIER++  + T+N      E   +A+    + TE+   S+
Sbjct  2     EEEEDRILLSSLGVKSANPEDIERDVLEKATKNDSVTVTEGEGSAKEERSDLTENVDPSA  61

Query  329   TKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPl  508
               + +++ KLRAV+ EI AV S  E+L N   N+E     EDG      E + S      
Sbjct  62    NARAELHQKLRAVQFEIDAVASTVERLRNVENNEECCDAGEDGLVPGTAEGDSSNNS---  118

Query  509   ndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVK  688
                +LQ  LAADRL+SL KTKAQL+K + +LS D    ++         +   ++  +V+
Sbjct  119   ---NLQCVLAADRLRSLKKTKAQLEKNLVNLSKDDASKSV---------EDEQLILSLVR  166

Query  689   GQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILT  868
              + KPKR+++E KS  K  KK     S DDD DFD VL+AAS+GFVETE+D+LVRKGILT
Sbjct  167   EERKPKRKVEEDKSKGKRLKK----VSFDDDVDFDTVLDAASAGFVETERDELVRKGILT  222

Query  869   PFHKLKGFERQIQEPGQSSRHSMQD---NGDLVSTSLANAIQSISEAAQSRPTTKLLDSS  1039
             PFHKLKGFER+  +   S+ H+  +   +GDL + S+  A +S+ EAA+SRPTTKLL+  
Sbjct  223   PFHKLKGFERRFHQLETSTSHNADEEETDGDLAAASVERAAKSMYEAARSRPTTKLLEPQ  282

Query  1040  LLPKLEPPTYPFQTPRKHVKISQSAE-----NGRNDKRKRRPTPGKKWRVKVSREN----  1192
               PKL+ PT+PF+  +K ++ S+  +     N  + ++KRRP PG+KW  +VS E+    
Sbjct  283   DAPKLDAPTFPFRRLKKPLQSSKPLDREVELNKDSKRKKRRPAPGRKWTKRVSCEDTRLE  342

Query  1193  KDEGPD--VEISSYedekddedm-ddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLW  1363
             + E  D  ++ SS+E+ ++ +   DD    +V LEGGLKIP+ IF+ LFDYQKVGVQWLW
Sbjct  343   ESENADGCLDTSSFENLEEQDIEFDDHESSYVTLEGGLKIPDKIFEALFDYQKVGVQWLW  402

Query  1364  ELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYP  1543
             ELHCQ+AGGIIGDEMGLGKTVQVL+FLG+LHFS  YKPSIIVCP+TLL+QWKREA KWYP
Sbjct  403   ELHCQRAGGIIGDEMGLGKTVQVLSFLGALHFSGMYKPSIIVCPVTLLRQWKREANKWYP  462

Query  1544  SFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGS  1723
              FHVE+LHDS +D   +KK +KS E+D ES    D D EK++  RNTKKW+ LIN V+ S
Sbjct  463   KFHVELLHDSAHDCAPRKKQAKSEETDCESNSSSDNDYEKSVPSRNTKKWESLINRVMRS  522

Query  1724  DSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGS  1903
             +SGLLITT+EQLR+LG++LLDIEWGYAVLDEGH+IRNPN +VTLVCKQLQTVHRIIMTG+
Sbjct  523   ESGLLITTFEQLRILGDQLLDIEWGYAVLDEGHKIRNPNAEVTLVCKQLQTVHRIIMTGA  582

Query  1904  PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRD  2083
             PIQNKL+ELWSLFDFVFPGKLGVLPVFE EFAVPIS+GGYANA+PLQVSTAYRCAVVLRD
Sbjct  583   PIQNKLTELWSLFDFVFPGKLGVLPVFEVEFAVPISVGGYANASPLQVSTAYRCAVVLRD  642

Query  2084  LIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYG  2263
             LIMPYLLRRMKADVNAQLPKKTEHV+FCSLT  Q S Y+AFLASTDVEQI DG +N+LYG
Sbjct  643   LIMPYLLRRMKADVNAQLPKKTEHVLFCSLTPEQISAYRAFLASTDVEQILDGHRNSLYG  702

Query  2264  IDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQM  2443
             IDVMRKICNHPDLLER+H+  DPDYGNPERSGKMKVVA+VL +WK+QGHRVL F+QTQQM
Sbjct  703   IDVMRKICNHPDLLERDHAFSDPDYGNPERSGKMKVVAQVLNVWKEQGHRVLLFTQTQQM  762

Query  2444  LDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGAN  2623
             LDI ENFL T G+ YRRMDG TPVKQRMAL+DEFN + EIFIFILTT+VGGLGTNLTGA+
Sbjct  763   LDIFENFLTTSGHIYRRMDGLTPVKQRMALMDEFNASSEIFIFILTTKVGGLGTNLTGAD  822

Query  2624  RVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKIL  2803
             RVIIFDPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH LTNKIL
Sbjct  823   RVIIFDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKIL  882

Query  2804  KNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKT  2983
             KNPQQ+R FKARD+KDLF+LN DGE GSTE+S+IFSQ+SE++N+ G Q  ++++ +  +T
Sbjct  883   KNPQQKRFFKARDMKDLFILNVDGETGSTETSNIFSQISEEINVIGTQKKNKDEYEHSQT  942

Query  2984  NPAD-HGTAMERDNNSGSN-----GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDA  3145
                D    A+  D+ SG       G+EK +  NG +D++T+IL++LFDA+GIHSAM+HD 
Sbjct  943   AKLDSEDVAVSNDDKSGGGSLERKGKEKVEPKNG-IDDETNILKSLFDANGIHSAMNHDL  1001

Query  3146  IVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK  3325
             I+NAHDEEK++L+EQAS+VA+RAAEALRQSR+LRS +SV++PTWTGRSGTAGAP S+++K
Sbjct  1002  IMNAHDEEKMRLDEQASQVARRAAEALRQSRILRSHDSVSVPTWTGRSGTAGAPSSVRRK  1061

Query  3326  FGSTLNPQLVTSSKPLEE-SSMISSRRNgiaagasagkalssaellakiRGNQERAISDG  3502
             FGST+NP LV  SK  +E  S  +++ NG AAGAS+GKALSS ELLAKIRGNQE+AI  G
Sbjct  1062  FGSTMNPLLVNKSKVSDELPSKGATKLNGFAAGASSGKALSSVELLAKIRGNQEKAIGAG  1121

Query  3503  LEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIV  3682
             LEHQ    + SSS+S+ R+ +  +SR +  S+G+QPEVLIR++CTFIQ++GGS+ SASIV
Sbjct  1122  LEHQS--GTFSSSSSQARSIDVRSSRATATSSGLQPEVLIRKICTFIQQRGGSSDSASIV  1179

Query  3683  EHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             E+FR  +PS+DLALFKNLLKEIATL K  NGS+W+LKPEYQ
Sbjct  1180  EYFRKLIPSEDLALFKNLLKEIATLHKGSNGSYWVLKPEYQ  1220



>gb|KEH42504.1| DNA repair and recombination protein RAD26 [Medicago truncatula]
Length=1215

 Score =  1416 bits (3666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 770/1263 (61%), Positives = 952/1263 (75%), Gaps = 98/1263 (8%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQTEN-GFDASNEAARSMELEAT---EHNATSS  328
             E+E+DR+L S+LGV SANPEDIER+IF    N   + + +   ++E E     E+    S
Sbjct  2     EEEQDRILLSTLGVQSANPEDIERHIFDTARNDSVNVTEDKGNNVENECERLPENVDPLS  61

Query  329   TKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVP--------DREDGHEKRDIETE  484
               K +++ KLRA+E EI AV S  E+  +  +++E           D   G E + +   
Sbjct  62    KAKAELHQKLRAIEFEIGAVSSTIERPRDVVKSEECEENENLEEGIDEGGGSELQRV---  118

Query  485   QSTTQAPlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPN  664
                             LAADRL+SL KTKAQL+KE+  LS D          D+   +  
Sbjct  119   ----------------LAADRLRSLKKTKAQLEKELKSLSKDC---------DLKSTESK  153

Query  665   AVLRDVVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQ  844
              V+  +VK   KPK++L + K  SK   KR KT S DDDDDFDAVL+AAS+GFVETE+D+
Sbjct  154   KVIFSLVKEDRKPKKKLIDDKKVSKRPAKRFKTVSFDDDDDFDAVLDAASAGFVETERDE  213

Query  845   LVRKGILTPFHKLKGFERQIQEP-GQSSRHSMQ--DNGDLVSTSLANAIQSISEAAQSRP  1015
             LVRKG+ TPFHKLKGFER IQ+P   +SR++++  +  DL  +S+  A +S S+AA+ RP
Sbjct  214   LVRKGMFTPFHKLKGFERGIQQPEASTSRNAVEQENTNDLAYSSVERAARSFSQAAKVRP  273

Query  1016  TTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRND------KRKRRPTPGKKWRVK  1177
             T+KLL    +PKL+ PT PF+  +K +++ +  ++   D      ++K+RP PG+KW  +
Sbjct  274   TSKLLRPEEVPKLDAPTIPFRRLKKPMQLPKPLDDNEGDLNTDSKRKKKRPGPGRKWTKR  333

Query  1178  VSRENK--------------------DEGPDVEISSYedekddedmddeGPPFVMLEGGL  1297
             VS E++                    +E  DVE+S +E              +V LEGGL
Sbjct  334   VSSEDRQLGESENANGCLDNSSCESLEEANDVELSEHESS------------YVTLEGGL  381

Query  1298  KIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKP  1477
             KIP+ IF+ LFDYQKVGVQW+WELHCQ+AGGIIGDEMGLGKT+QVL+FLG+LHFS  YKP
Sbjct  382   KIPDNIFEALFDYQKVGVQWMWELHCQRAGGIIGDEMGLGKTIQVLSFLGALHFSGMYKP  441

Query  1478  SIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdv  1657
             SIIVCP+TLL+QWKREAKKWYP FHVE+LHDS  D   KKK ++S  +DSES    D D 
Sbjct  442   SIIVCPVTLLRQWKREAKKWYPKFHVELLHDSAQDLASKKKRAESDGTDSESNSSSDNDY  501

Query  1658  ekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNP  1837
             EK++  +NT+KW+ LIN V+ S+SGLLITTYEQLR+LG++LL+IEWGYAVLDEGH+IRNP
Sbjct  502   EKSVPSKNTRKWETLINRVMRSESGLLITTYEQLRILGDQLLNIEWGYAVLDEGHKIRNP  561

Query  1838  NTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIG  2017
             N +VTL CKQLQTVHRIIMTG+PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPI +G
Sbjct  562   NAEVTLACKQLQTVHRIIMTGAPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIRVG  621

Query  2018  GYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIY  2197
             GY+NA+PLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHV+FCSLTS Q S Y
Sbjct  622   GYSNASPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTSEQVSAY  681

Query  2198  QAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVA  2377
             +AFLAST+VE+I DG +N+LYGIDVMRKICNHPDLLERE +  +PDYGNPERSGKMKVVA
Sbjct  682   RAFLASTEVEEILDGGRNSLYGIDVMRKICNHPDLLEREQASSNPDYGNPERSGKMKVVA  741

Query  2378  EVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTV  2557
             +VL +WK+QGHRVL F+QTQQMLDI E +L T G+ YRRMDG TPVKQRMAL+DEFN + 
Sbjct  742   QVLNVWKEQGHRVLLFTQTQQMLDIFEKYLTTFGHIYRRMDGLTPVKQRMALMDEFNASS  801

Query  2558  EIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITR  2737
             EIF+FILTT+VGGLGTNLTGA+RVIIFDPDWNPS DMQARERAWRIGQK+DVT+YRLITR
Sbjct  802   EIFVFILTTKVGGLGTNLTGADRVIIFDPDWNPSTDMQARERAWRIGQKRDVTIYRLITR  861

Query  2738  GTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQL  2917
             GTIEEKVYHRQIYKH LTNKILKNPQQ+R FKARD+KDLFVLN DGE GSTE+++IFSQ+
Sbjct  862   GTIEEKVYHRQIYKHFLTNKILKNPQQKRFFKARDMKDLFVLNVDGETGSTETANIFSQI  921

Query  2918  SEDVNITGPQHPDQEKDKSIKTNP-ADHGTAMERDNNSG-----SNGEEKADNNNGDVDE  3079
             SEDVNI G    +Q+ ++  +T   A    A+  D  S        G+EK D +NG VDE
Sbjct  922   SEDVNIIGAHQENQDNNEYSQTAELASEDDAVGDDGKSCRTSSRGKGKEKVDKSNG-VDE  980

Query  3080  DTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQES  3259
             + ++L++LFDA+GIHSAM+HD I++AHDEEK++L+E+AS+VAQRAAEALRQSRM+R+ ES
Sbjct  981   EANVLKSLFDANGIHSAMNHDLIMDAHDEEKMRLDEEASKVAQRAAEALRQSRMIRNHES  1040

Query  3260  VAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEES-SMISSRRNgiaagasagk  3436
             V++PTWTGRSG AGAP S+++KFGST+ PQL+ +SK  +ES S  S++ NG AAGAS+GK
Sbjct  1041  VSVPTWTGRSGAAGAPSSVRRKFGSTVKPQLLNNSKASDESPSRGSNKFNGYAAGASSGK  1100

Query  3437  alssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEV  3616
             ALSSA++L+KIRGNQE+AIS GLE  HQF    S + RT       S+    S+G QPEV
Sbjct  1101  ALSSADILSKIRGNQEKAISAGLE--HQFGQSRSVDVRT-------SKAPENSSGFQPEV  1151

Query  3617  LIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKP  3796
             +IR++CTF Q+KGGS SS SIV+HF+ R+PSKDL LFKN+LKEIATL K  NG+ W+LKP
Sbjct  1152  MIRKICTFFQQKGGSCSSDSIVQHFKDRIPSKDLPLFKNMLKEIATLHKGSNGTHWVLKP  1211

Query  3797  EYQ  3805
             +YQ
Sbjct  1212  DYQ  1214



>ref|XP_004495082.1| PREDICTED: DNA repair protein rhp26-like [Cicer arietinum]
Length=1224

 Score =  1415 bits (3664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/1257 (62%), Positives = 952/1257 (76%), Gaps = 77/1257 (6%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEA-ARSMELEATEHNATSSTK-  334
             E+E+DR+L +SLGV SANPEDIER++  +  N      EA  ++ E E +        K 
Sbjct  2     EEEQDRILLTSLGVKSANPEDIERHVIEKARNDSVIVAEAEGKTDEKECSNLPEIVDPKF  61

Query  335   --KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPl  508
               K +++ KLRAVE EI AV S  +Q  +  +  E     E+  E+   E + S  Q   
Sbjct  62    SVKAELHQKLRAVEFEIGAVYSTIQQPRDVDKGGECGDVGEENLEEGIGEGDGSNLQ---  118

Query  509   ndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVK  688
                   R LAADRL+SL  TKAQL+KE+S L  D   D+ SV R+        ++   VK
Sbjct  119   ------RVLAADRLRSLKNTKAQLEKELSSLCKDG--DSKSVERE-------KLIFSFVK  163

Query  689   GQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILT  868
                +PK++LKE K   K   KR+K  S D D DFDAVL+AAS+GFVETE+D+LVRKGILT
Sbjct  164   EDRRPKKKLKEDKKLQKKTGKRLKKVSFDADTDFDAVLDAASAGFVETERDELVRKGILT  223

Query  869   PFHKLKGFERQIQEPGQSSRHS---MQDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSS  1039
             PFHKLKGFER+IQ+P  S+ H+    ++  DL  +S+  A +S SEAA++RP++KLL+  
Sbjct  224   PFHKLKGFERRIQQPEASTSHNAAEQENTDDLALSSVERAARSFSEAAKARPSSKLLEPE  283

Query  1040  LLPKLEPPTYPFQTPRKHVKISQSAE-----NGRNDKRKRRPTPGKKWRVKVSRENKD--  1198
              LPKL+ PT PF+  +K + +S+  +     N  + ++KRRP PG+KW  +VSRE++   
Sbjct  284   ELPKLDAPTIPFRRLKKPLILSKPIDSEVDLNTGSKRKKRRPLPGRKWTKRVSREDRQLE  343

Query  1199  -----------------EGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKL  1327
                              E  DVE+S +E              +V LEGGLKIP+ IF+ L
Sbjct  344   ESENANGGLDTSSCESLEVQDVELSEHESS------------YVTLEGGLKIPDNIFEAL  391

Query  1328  FDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLL  1507
             FDYQKVGVQWLWELHCQ+AGGIIGDEMGLGKT+QVL+FLG+LHFS  YKPSIIVCP+TLL
Sbjct  392   FDYQKVGVQWLWELHCQRAGGIIGDEMGLGKTIQVLSFLGALHFSGMYKPSIIVCPVTLL  451

Query  1508  QQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTK  1687
             +QWKREAKKWYP FHVEILHDS  D   KKK ++S  SD ES    D D E+++  +NT+
Sbjct  452   RQWKREAKKWYPQFHVEILHDSAQDLASKKKRAESDGSDYESNSSNDNDYERSVPSKNTR  511

Query  1688  KWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQ  1867
             KW+ LIN V+ S+ GLLITTYEQLR+LG++LLDIEWGYAVLDEGH+IRNPN ++TL CKQ
Sbjct  512   KWETLINRVMRSEFGLLITTYEQLRILGDQLLDIEWGYAVLDEGHKIRNPNAEITLACKQ  571

Query  1868  LQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQV  2047
             LQTVHRIIMTG+PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPI++GGYANA+PLQV
Sbjct  572   LQTVHRIIMTGAPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIAVGGYANASPLQV  631

Query  2048  STAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVE  2227
             STAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHV+FCSLT+ Q S Y+AFLAST+VE
Sbjct  632   STAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTAEQISAYRAFLASTEVE  691

Query  2228  QIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQG  2407
              I DG +N+LYGIDVMRKICNHPDLLEREH+  +PDYGNPERSGKMKVVA+VL +WK+QG
Sbjct  692   DILDGQRNSLYGIDVMRKICNHPDLLEREHAFSNPDYGNPERSGKMKVVAQVLNVWKEQG  751

Query  2408  HRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTR  2587
             HRVL F+QTQQMLDI E FL T G+ Y RMDG TPVKQRMAL+DEFN + EIF+FILTT+
Sbjct  752   HRVLLFTQTQQMLDIFEKFLTTSGHNYLRMDGLTPVKQRMALMDEFNASSEIFVFILTTK  811

Query  2588  VGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHR  2767
             VGGLGTNLTGA+RVIIFDPDWNPS DMQARERAWRIGQK+DVT+YRLITRGTIEEKVYHR
Sbjct  812   VGGLGTNLTGADRVIIFDPDWNPSTDMQARERAWRIGQKRDVTIYRLITRGTIEEKVYHR  871

Query  2768  QIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQ  2947
             QIYKH LTNKILKNPQQ+R FKARD+KDLFVLN DGE GSTE+S+IFSQ+SED+NI G  
Sbjct  872   QIYKHFLTNKILKNPQQKRFFKARDMKDLFVLNVDGETGSTETSNIFSQISEDINIIGTH  931

Query  2948  HPDQEKDKSIKTNPADHGTAMERDNNSGSN--------GEEKADNNNGDVDEDTSILRTL  3103
               +Q+++K  +T  A+ G+      N G +        G+EK D ++G  DE+ +IL++L
Sbjct  932   QDNQDRNKYSQT--AELGSEEAEVGNDGKSWKGSSRGKGKEKVDKSDG-ADEEANILKSL  988

Query  3104  FDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTG  3283
             FDA+GIHSAM+HD I+NAHDEEK++L+EQAS+VAQRAAEALRQSRMLRS ESV+IPTWTG
Sbjct  989   FDANGIHSAMNHDLIMNAHDEEKMRLDEQASQVAQRAAEALRQSRMLRSHESVSIPTWTG  1048

Query  3284  RSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEE-SSMISSRRNgiaagasagkalssaell  3460
             RSG AGAP S+++KFGST+N QL+ +SK   E  S  S++ NG AAGA A    + +   
Sbjct  1049  RSGAAGAPSSVRRKFGSTVNHQLLNNSKASNELPSSGSNKFNGYAAGAGASSGKALSSAE  1108

Query  3461  --akiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVC  3634
               AKIRG QE+AIS GLE  HQF   SSS +++R+ + G SR    S+G QPEVLIR++C
Sbjct  1109  ILAKIRGTQEKAISAGLE--HQFGISSSSTNQSRSTDVGNSRAPENSSGFQPEVLIRKLC  1166

Query  3635  TFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             TF+Q+ GGS+SS+SIV+HF+ R+PSKDLALFKN+LKEIATL+K  NGS+W+LKP+YQ
Sbjct  1167  TFLQQHGGSSSSSSIVQHFKDRIPSKDLALFKNMLKEIATLQKGSNGSYWVLKPDYQ  1223



>ref|XP_010929630.1| PREDICTED: protein CHROMATIN REMODELING 8 isoform X1 [Elaeis 
guineensis]
Length=1234

 Score =  1408 bits (3645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 761/1243 (61%), Positives = 944/1243 (76%), Gaps = 47/1243 (4%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEA---ARSMELEATEHNATS  325
             M+E++ED++L SSLG+TS  PEDIER I  + ++     +++   +   EL+       S
Sbjct  13    MDEEDEDKLLLSSLGITSVKPEDIERKILSEAKSDAKCGSQSEVCSEEHELDGEPETGPS  72

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
             ST +  +Y+KLRAVE EI AV S  E  ++   ++       D  E  D   +  + Q  
Sbjct  73    STSRIKLYDKLRAVEVEIDAVASSIEAAKDVAYSENDHTGNADIKEDNDRRNDDGSAQVT  132

Query  506   lndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLS---VLRDIVKEQPNAVLR  676
              N L LQ+ALA DRL+SL KTKAQL+ EIS L  ++T +      +L D+V+E       
Sbjct  133   SNGLTLQQALATDRLRSLKKTKAQLQNEISKLDENATPEDFGHEKLLADLVEE-------  185

Query  677   DVVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRK  856
                    K KR+ K  +  +++ K  +KT + ++D DFDAVL+AAS+GFVETE+D+L+RK
Sbjct  186   -------KCKRKSKAVEQSNRDSKSHLKTVAYNEDADFDAVLDAASTGFVETERDELIRK  238

Query  857   GILTPFHKLKGFERQIQEPGQSSRHSMQDNG--DLVSTSLANAIQSISEAAQSRPTTKLL  1030
             GILTPFHK+KGFER++Q+P  S+RH  +++   D  S S+A   Q IS+AAQ+RP TKLL
Sbjct  239   GILTPFHKIKGFERRVQQPAPSNRHVPEESAAEDHASASIAKVAQLISDAAQNRPATKLL  298

Query  1031  DSSLLPKLEPPTYPFQ---TPRKHV---KISQSAENGRNDKRKRRPTPGKKWRVKVSREN  1192
             D+  L  L+ PT+PFQ    P KH    K  +  +  R  +R +RP P KKWR   S+E 
Sbjct  299   DTVALSGLDAPTHPFQRLKAPLKHPVSPKGKELEKKTRKLRRTKRPLPSKKWRKVDSKEK  358

Query  1193  KDEGPDVE------ISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQ  1354
               +G D +       S Y + +++   D E  P V+LEGGLKIP +I+  LFDYQKVG++
Sbjct  359   LPDGSDEDSMGDSIASDYGETQEENTDDGEQSP-VILEGGLKIPASIYMNLFDYQKVGMK  417

Query  1355  WLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKK  1534
             WLWELHCQ+AGGIIGDEMGLGKTVQV++FLG+LHFS  YKPSI+VCP+TLL+QW+REA+K
Sbjct  418   WLWELHCQRAGGIIGDEMGLGKTVQVISFLGALHFSKMYKPSIVVCPVTLLRQWQREARK  477

Query  1535  WYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHV  1714
             WYP F VEILHDS +  + +     S       + L   +     + ++ K+W+ LI+ V
Sbjct  478   WYPDFRVEILHDSAHGLNKQTVAKSSESDYDSEDSLDSDNERPRPA-KSVKRWNDLIDRV  536

Query  1715  LGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIM  1894
             + S+SGLL+TTYEQLR+LGEKLLDIEWGYA+LDEGHRIRNPN +VTLVCKQLQTVHRIIM
Sbjct  537   VQSESGLLLTTYEQLRILGEKLLDIEWGYAILDEGHRIRNPNAEVTLVCKQLQTVHRIIM  596

Query  1895  TGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVV  2074
             TG+PIQNKLSELWSLFDFVFPGKLGVLPVFE EFAVPI++GGYANATPLQVSTAYRCAVV
Sbjct  597   TGAPIQNKLSELWSLFDFVFPGKLGVLPVFETEFAVPITVGGYANATPLQVSTAYRCAVV  656

Query  2075  LRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNA  2254
             LRDLI PYLLRRMKADVNAQLPKKTEHV+FCSLTS QRS+Y+AFLAS++VEQIF+GS+N+
Sbjct  657   LRDLITPYLLRRMKADVNAQLPKKTEHVLFCSLTSDQRSVYRAFLASSEVEQIFEGSRNS  716

Query  2255  LYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQT  2434
             LYGID+MRKICNHPDLLEREHS   PDYGNPERSGKMKVVA+VL++WK+Q HRVL F+QT
Sbjct  717   LYGIDIMRKICNHPDLLEREHSALHPDYGNPERSGKMKVVAQVLRVWKEQEHRVLLFAQT  776

Query  2435  QQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLT  2614
             QQMLDILENFL   GY YRRMDG TP+KQRMALIDEFNN+ ++FIFILTT+VGGLGTNLT
Sbjct  777   QQMLDILENFLAASGYSYRRMDGLTPIKQRMALIDEFNNSSDVFIFILTTKVGGLGTNLT  836

Query  2615  GANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTN  2794
             GA+RVII+DPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH LTN
Sbjct  837   GADRVIIYDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQIYKHFLTN  896

Query  2795  KILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNI-TGPQHPDQEKDK  2971
             KILKNPQQRR FKA+D+KDLF L DD E GSTE+S+IFSQLSE+VN+  G  + D++   
Sbjct  897   KILKNPQQRRFFKAKDMKDLFTLQDDREGGSTETSNIFSQLSEEVNVGVGNGYQDKQGSS  956

Query  2972  SIKTNPA----DHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDH  3139
             +  T P     +  +     ++S S G+E A   NG++DE+T+IL++LFDAHGIHSAM+H
Sbjct  957   AASTAPVVPAKETNSPGLGASSSNSKGKEIAGQRNGEIDEETNILKSLFDAHGIHSAMNH  1016

Query  3140  DAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIK  3319
             DAI+NA+D++K++LEEQASRVA+RAAEALR+SR LRS++S ++PTWTGRSG AGAP SI+
Sbjct  1017  DAILNANDDDKMRLEEQASRVARRAAEALRESRRLRSRDSFSVPTWTGRSGAAGAPSSIR  1076

Query  3320  KKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISD  3499
             +KFGST+N Q++  SKP E S   +SR  G+AAGAS GKALSSAELLA+IRG QERA+ D
Sbjct  1077  RKFGSTINTQMLGPSKPSEGS---ASRPPGLAAGASTGKALSSAELLARIRGTQERAVGD  1133

Query  3500  GLEHQHQFNSGSSSNSRTRAAENG-ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSAS  3676
              LE     +  SSSN R    EN  AS+PSH    +QPE+LIRQ+CTFIQ++GG T SAS
Sbjct  1134  ALE--QDLDLASSSNQRESIPENTVASKPSHRYMVVQPEILIRQLCTFIQQRGGQTDSAS  1191

Query  3677  IVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             I +HF+ R+ SKDL LFKNLLKEIA L+K+  GS W+LKPEYQ
Sbjct  1192  ITQHFKDRIQSKDLPLFKNLLKEIAALEKDAGGSRWVLKPEYQ  1234



>ref|XP_008447405.1| PREDICTED: DNA repair protein rhp26 isoform X1 [Cucumis melo]
 ref|XP_008447406.1| PREDICTED: DNA repair protein rhp26 isoform X1 [Cucumis melo]
 ref|XP_008447407.1| PREDICTED: DNA repair protein rhp26 isoform X1 [Cucumis melo]
Length=1223

 Score =  1407 bits (3642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 773/1250 (62%), Positives = 928/1250 (74%), Gaps = 62/1250 (5%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQ----TENGFDASN--EAARSMELEATEHNAT  322
             E+ EDR+  +SLGVTSANPEDIER++  +    +ENG +     E     +L+ T+   +
Sbjct  2     EEVEDRIFLNSLGVTSANPEDIERDLLNEAKKKSENGVEVGGIEEENVCDKLDTTD---S  58

Query  323   SSTKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQA  502
              S     +Y KLRAVE EI AV S     +   RN++      D  E    E   S +  
Sbjct  59    PSASHVQLYQKLRAVEYEIDAVASTVGPGKKLERNEQHSCISTDSQEHAREEDGVSAS--  116

Query  503   PlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDV  682
                   LQ ALA DRL+SL KT+ QLKKE+  L++      L                ++
Sbjct  117   ---GDGLQHALAVDRLRSLKKTQQQLKKELFHLNDKHAKTIL----------------EI  157

Query  683   VKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGI  862
             VK + KPKR+ KE K    +  KR+K  S D+D+DFDA L+AA+ GFVETE+D+LVRKGI
Sbjct  158   VKDRSKPKRKSKEVKKSGNDGGKRLKVVSFDEDNDFDAALDAATVGFVETERDELVRKGI  217

Query  863   LTPFHKLKGFERQIQEPGQSS-----------RHSMQDNGDLVSTSLANAIQSISEAAQS  1009
             LTPFHKLKGFER++Q  GQSS           +   ++N D  S S+A A++S+S AAQ+
Sbjct  218   LTPFHKLKGFERRLQSLGQSSLQNAGGSRGEVKEEEEENDDFASDSVARALRSMSVAAQA  277

Query  1010  RPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRK----RRPTPGKKWRVK  1177
             RPTTKLLD   LPKL+PPT PF   +   K+  SAE+    K K    RRP P KK+R +
Sbjct  278   RPTTKLLDPDALPKLDPPTRPFYRLKTPAKVPLSAEDKLTTKTKSKKTRRPLPDKKYRKQ  337

Query  1178  VSRENKDEGPDVEIS-------SYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDY  1336
             ++ E +D+     +S       S  ++  D + D     FV LEGGLKIP++IFD+LFDY
Sbjct  338   IAMEERDKEAAENMSDGLATSSSEREDSGDLEEDVNELSFVTLEGGLKIPQSIFDQLFDY  397

Query  1337  QKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQW  1516
             QKVGVQWLWELHCQ+AGGIIGDEMGLGKTVQVLAFLG+LHFSN YKPSIIVCP+TL++QW
Sbjct  398   QKVGVQWLWELHCQRAGGIIGDEMGLGKTVQVLAFLGALHFSNIYKPSIIVCPVTLVRQW  457

Query  1517  KREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWD  1696
             KREA+KW P    EILHDS +D    K   +  +   ESE+  + D  KN   + TK+WD
Sbjct  458   KREARKWCPGLLAEILHDSAHD-PTYKNMREKSDGSDESEDSEESDYRKNSQAKGTKRWD  516

Query  1697  KLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQT  1876
              LIN VL S+SGLLITTYEQLRLLG+KLLD+EWG AVLDEGHRIRNPN +VTLVCKQLQT
Sbjct  517   ALINRVLTSESGLLITTYEQLRLLGDKLLDVEWGCAVLDEGHRIRNPNAEVTLVCKQLQT  576

Query  1877  VHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTA  2056
             VHRIIMTGSPIQNKL ELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANA+PLQVSTA
Sbjct  577   VHRIIMTGSPIQNKLKELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANASPLQVSTA  636

Query  2057  YRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIF  2236
             YRCAVVLRDLIMPYLLRRMKADVNA LPKKTEHV+FCSLTS QRS+Y+AFLAS++VE I 
Sbjct  637   YRCAVVLRDLIMPYLLRRMKADVNAHLPKKTEHVLFCSLTSEQRSVYRAFLASSEVESIL  696

Query  2237  DGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRV  2416
             DG++N+L GIDVMRKICNHPDLLEREH+ ++PDYGNPERSGKMKVV +VLK+WK+QGHRV
Sbjct  697   DGNRNSLSGIDVMRKICNHPDLLEREHAFQNPDYGNPERSGKMKVVEQVLKVWKEQGHRV  756

Query  2417  LFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGG  2596
             L F+QTQQMLDILE FLV GGY YRRMDG TPVKQRMALIDEFNN+ E+F+FILTT+VGG
Sbjct  757   LLFAQTQQMLDILEKFLVGGGYSYRRMDGGTPVKQRMALIDEFNNSCEVFVFILTTKVGG  816

Query  2597  LGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIY  2776
             LGTNLTGA+RVIIFDPDWNPS DMQARERAWRIGQ++DVTVYRLITRGTIEEKVYHRQIY
Sbjct  817   LGTNLTGADRVIIFDPDWNPSTDMQARERAWRIGQQRDVTVYRLITRGTIEEKVYHRQIY  876

Query  2777  KHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPD  2956
             KH LTNKILKNPQQRR FKARD+KDLF LN+DG +GSTE+S+IF  L++ VN+ G Q  +
Sbjct  877   KHFLTNKILKNPQQRRFFKARDMKDLFTLNEDGMDGSTETSNIFGALTDSVNVVGVQKNE  936

Query  2957  QEKDKSIK-----TNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGI  3121
             ++  KS        + AD          SG NG    +   G  DEDTSIL++LFDAHGI
Sbjct  937   KDGQKSCSGSVSFADSADENLCKSETETSGRNG--SVEGQGGGADEDTSILKSLFDAHGI  994

Query  3122  HSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAG  3301
             HSA++HD I+NA D EK++LEEQAS+VA+RAAEALRQSR+LRS ES ++PTWTG++GTAG
Sbjct  995   HSAVNHDIIINADDGEKIRLEEQASQVARRAAEALRQSRILRSNESFSVPTWTGKAGTAG  1054

Query  3302  APPSIKKKFGSTLNPQLVTSSKPLEESSMISS-RRNgiaagasagkalssaellakiRGN  3478
             AP S+++KFGST+N  +  +SK   E S   +   NG AAG S GKALSSA+LLAKIRGN
Sbjct  1055  APSSVRRKFGSTINSLVTNNSKSSNEVSKNGTIHLNGHAAGTSCGKALSSADLLAKIRGN  1114

Query  3479  QERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGG  3658
             QERAIS GLE Q   ++ S++N RT       S   + S  +QPEVLIRQ+CTFI ++GG
Sbjct  1115  QERAISAGLERQSTPSTSSTNNVRTVGVSYSRSSSKNLSV-VQPEVLIRQICTFIHQRGG  1173

Query  3659  STSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
             +  SASIVEHF+ R+PS DL LFKNLLKEIA L+K+P+GSFW+LK EY++
Sbjct  1174  TADSASIVEHFKDRIPSNDLPLFKNLLKEIAMLEKSPSGSFWVLKAEYKQ  1223



>ref|XP_004151991.1| PREDICTED: DNA repair protein rhp26-like [Cucumis sativus]
 ref|XP_004168077.1| PREDICTED: DNA repair protein rhp26-like [Cucumis sativus]
Length=1221

 Score =  1403 bits (3632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 773/1253 (62%), Positives = 935/1253 (75%), Gaps = 70/1253 (6%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQ----TENGFDASN--EAARSMELEATEHNAT  322
             E+ EDR+  +SLGVTSANPEDIER++  +    +ENG +     E     +L+ T+   +
Sbjct  2     EEVEDRIFLNSLGVTSANPEDIERDLLNEAKKKSENGVEVGGIEEENVCDKLDTTD---S  58

Query  323   SSTKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQA  502
              S     +Y KLRAVE EI AV S  E  E   RN++      D  +    E   S +  
Sbjct  59    PSASHVQLYQKLRAVEYEIDAVASTVEPGEKLERNEQHSCVSTDSQKHAREEDSVSAS--  116

Query  503   PlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDV  682
                   LQ ALA DRL+SL KT+ QLK E+  L++      L                ++
Sbjct  117   ---GDGLQHALAVDRLRSLKKTQHQLKNELFHLNDKHAKTIL----------------EI  157

Query  683   VKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGI  862
             VK + KPKR+ KE K    +  KR+K  S D+D+DFDA L+AA+ GFVETE+D+LVRKGI
Sbjct  158   VKDRSKPKRKSKEVKKSGNDGGKRLKVVSFDEDNDFDAALDAATVGFVETERDELVRKGI  217

Query  863   LTPFHKLKGFERQIQEPGQSS-----------RHSMQDNGDLVSTSLANAIQSISEAAQS  1009
             LTPFHKLKGFER++Q PGQSS           +   ++N D  S S+A A++S+S AAQ+
Sbjct  218   LTPFHKLKGFERRLQSPGQSSLQNPRGSRDEVKEEEEENDDFASDSVARALRSMSVAAQA  277

Query  1010  RPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRK----RRPTPGKKWRVK  1177
             RPTTKLLD   LPKL+PPT PF   +   K+  SAE+    K K    RRP P KK+R +
Sbjct  278   RPTTKLLDPDALPKLDPPTRPFYRLKTPAKVPLSAEDKPTTKTKSKQTRRPLPDKKYRRQ  337

Query  1178  VSRENKDEGPDVEIS-------SYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDY  1336
             ++ E +D+     +S       S  ++  D + D     FV LEGGLKIP++IFD+LFDY
Sbjct  338   IAMEERDKEATENMSDGLATSSSEREDSGDLEDDVNELSFVTLEGGLKIPQSIFDELFDY  397

Query  1337  QKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQW  1516
             QKVGVQWLWELHCQ+AGGIIGDEMGLGKTVQVL+FLG+LHFSN YKPSIIVCP+TL++QW
Sbjct  398   QKVGVQWLWELHCQRAGGIIGDEMGLGKTVQVLSFLGALHFSNIYKPSIIVCPVTLVRQW  457

Query  1517  KREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWD  1696
             KREA+KW P    EILHDS +D    K   +  +   ESE+    D  KN   + TK+WD
Sbjct  458   KREARKWCPRLLAEILHDSAHD-PTYKNMREKSDGSDESEDSEGSDYRKNSQPKGTKRWD  516

Query  1697  KLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQT  1876
              LIN VL S+SGLLITTYEQLRLLG+KLLDIEWGYA+LDEGHRIRNPN +VTLVCKQLQT
Sbjct  517   ALINRVLRSESGLLITTYEQLRLLGDKLLDIEWGYAILDEGHRIRNPNAEVTLVCKQLQT  576

Query  1877  VHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTA  2056
             VHRIIMTGSPIQNKL ELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANA+PLQVSTA
Sbjct  577   VHRIIMTGSPIQNKLKELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANASPLQVSTA  636

Query  2057  YRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIF  2236
             YRCAVVLRDLIMPYLLRRMKADVNA LPKKTEHV+FCSLTS QRS+Y+AFLAS++V+ I 
Sbjct  637   YRCAVVLRDLIMPYLLRRMKADVNAHLPKKTEHVLFCSLTSEQRSVYRAFLASSEVKSIL  696

Query  2237  DGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRV  2416
             DG++N+L GIDVMRKICNHPDLLEREH+ ++PDYGNPERSGKMKVV +VLK+WK+QGHRV
Sbjct  697   DGNRNSLSGIDVMRKICNHPDLLEREHAFQNPDYGNPERSGKMKVVEQVLKVWKEQGHRV  756

Query  2417  LFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGG  2596
             L F+QTQQMLDILE FLV GGY YRRMDG TPVKQRMALIDEFNN+ E+F+FILTT+VGG
Sbjct  757   LLFAQTQQMLDILERFLVGGGYTYRRMDGGTPVKQRMALIDEFNNSCEVFVFILTTKVGG  816

Query  2597  LGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIY  2776
             LGTNLTGA+RVIIFDPDWNPS DMQARERAWRIGQ++DVTVYRLITRGTIEEKVYHRQIY
Sbjct  817   LGTNLTGADRVIIFDPDWNPSTDMQARERAWRIGQQRDVTVYRLITRGTIEEKVYHRQIY  876

Query  2777  KHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPD  2956
             KH LTNKILKNPQQ+R FKARD+KDLF LN+DG +GSTE+S+IFS L++ VN+ G Q  +
Sbjct  877   KHFLTNKILKNPQQKRFFKARDMKDLFTLNEDGMDGSTETSNIFSALTDSVNVVGVQKNE  936

Query  2957  QEKDKS-----IKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGI  3121
             ++  KS     +  + AD          SG +     +   G  DEDT+IL++LFDAHGI
Sbjct  937   KDGQKSSSGSVLFADSADENLCKSEIETSGRSS--SIEGQGGGADEDTNILKSLFDAHGI  994

Query  3122  HSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAG  3301
             HSA++HD I+NA D EK++LEEQAS+VA+RAAEALRQSRMLRS ESV++PTWTG++GTAG
Sbjct  995   HSAVNHDIIINADDGEKIRLEEQASQVARRAAEALRQSRMLRSNESVSVPTWTGKAGTAG  1054

Query  3302  APPSIKKKFGSTLNPQLVT----SSKPLEESSMISSRRNgiaagasagkalssaellaki  3469
             AP S+++KFGST+N  +VT    SS  + ++  I    NG AAG S GKALSSA+LLAKI
Sbjct  1055  APSSVRRKFGSTVNTLVVTNNSKSSNEVSKNGTI--HLNGHAAGTSCGKALSSADLLAKI  1112

Query  3470  RGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQR  3649
             RGNQERAIS GLEHQ   ++ S++N RT    +  S   + S  +QPEVLIRQ+CTFI +
Sbjct  1113  RGNQERAISAGLEHQ---STSSTNNVRTVGVGSSRSSSKNLSV-VQPEVLIRQICTFIHQ  1168

Query  3650  KGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
             +GG+ +SASIVEHF+ R+PS DL LFKNLLKEIA L+K+ +GSFW+LK EY++
Sbjct  1169  RGGAAASASIVEHFKDRIPSNDLPLFKNLLKEIAILEKSSSGSFWVLKAEYKQ  1221



>ref|XP_010526496.1| PREDICTED: protein CHROMATIN REMODELING 8 [Tarenaya hassleriana]
Length=1182

 Score =  1399 bits (3622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 776/1243 (62%), Positives = 947/1243 (76%), Gaps = 89/1243 (7%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQTEN------GFDASNEAARSMELEATEHNAT  322
             E+EED+ L SSLGVTSANPEDIE+ I  + +       G  A  E +  +ELE T+   T
Sbjct  2     EEEEDKFLLSSLGVTSANPEDIEQTILNEAKKKLEDGEGGSAVGEPSGQLELERTD---T  58

Query  323   SSTKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQA  502
               +  +++ +KLRAVE EI AV S    +E+  ++D    + ++ H            QA
Sbjct  59    LPSSHSELLSKLRAVEFEIDAVSS---TVEDVAKDDSLKKNGDEAH-----------IQA  104

Query  503   PlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDV  682
             P N   LQ ALA DRL+SL K KAQ +KE+S L  D   + +   RD        +LR++
Sbjct  105   PHNRSSLQHALATDRLRSLKKRKAQFEKELSGLHGDGVSEGID--RD-------NLLRNL  155

Query  683   VKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGI  862
             VK +P  KR+ KEA  P K ++K++KT S+ DD DFDAVL+AAS+GFVETE+D+LVRKGI
Sbjct  156   VKEEPSLKRKSKEALKPGKKERKKVKTVSIHDDPDFDAVLDAASAGFVETERDELVRKGI  215

Query  863   LTPFHKLKGFERQIQEPGQSSRHSMQDNGDLV-----STSLANAIQSISEAAQSRPTTKL  1027
             LTPFHKL+GFER++Q+PG S+ H++ +  D       S S+A A+QS+S AA++RP TKL
Sbjct  216   LTPFHKLEGFERRLQQPGPSNWHNIPEQDDENDNDEDSASIARAVQSMSLAAKARPATKL  275

Query  1028  LDSSLLPKLEPPTYPFQTPRK-----HVKISQSAENGRND-KRKRRPTPGKKWRVKVSRE  1189
             L++  LPKLE PT PF+  RK     H    +  ENG+    +K+RP P +KW+ ++SRE
Sbjct  276   LEAKELPKLEAPTIPFKRLRKPYKTHHDSPEKETENGKTAMAKKKRPLPERKWQKQISRE  335

Query  1190  N------KDEGPDVEISSYedekddedmdd--eGPPFVMLEGGLKIPETIFDKLFDYQKV  1345
             +      +D   +  ISS E+E+ DED D       FV+LEGGLKIPE IF KLF+YQ+V
Sbjct  336   DIDLQDSEDRQRNSTISSCEEEQLDEDDDRGHNETSFVLLEGGLKIPENIFSKLFEYQRV  395

Query  1346  GVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKRE  1525
             GVQWLWELHCQ+AGGIIGDEMGLGKTVQVL+FLGSLHFS  Y+PSI++CP+TL +QW+RE
Sbjct  396   GVQWLWELHCQRAGGIIGDEMGLGKTVQVLSFLGSLHFSKMYRPSIVICPVTLARQWRRE  455

Query  1526  AKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLI  1705
             A+KWYP FHVEILHDS  D    K   K+ +SD +SE  +D D E+N S +N KKWD LI
Sbjct  456   ARKWYPGFHVEILHDSAQDSGHGKGRGKASDSDYDSEGEVDSDNERN-SSKNIKKWDSLI  514

Query  1706  NHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHR  1885
               VL SDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHR
Sbjct  515   KRVLRSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHR  574

Query  1886  IIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRC  2065
             IIMTG+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEFAVPI++GGYANA+PLQVSTAYRC
Sbjct  575   IIMTGAPIQNKLTELWSLFDFVFPGKLGVLPVFEAEFAVPITVGGYANASPLQVSTAYRC  634

Query  2066  AVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGS  2245
             AVVLRDLIMPYLLRRMKADVNA LPKKTEHV+FCSLT+ QRS+Y+AFLAST+VEQI DG+
Sbjct  635   AVVLRDLIMPYLLRRMKADVNAHLPKKTEHVLFCSLTAEQRSVYRAFLASTEVEQILDGN  694

Query  2246  KNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFF  2425
             KN+LYGIDVMRKICNHPDLLEREHS ++PDYGNPERSGKMKVVAEVLK+W++QGHRVL F
Sbjct  695   KNSLYGIDVMRKICNHPDLLEREHSHQNPDYGNPERSGKMKVVAEVLKVWREQGHRVLLF  754

Query  2426  SQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGT  2605
             SQTQQMLDILE+ L   GY YRRMDG TPVKQRMA+IDEFNN+ ++F+FILTT+VGGLGT
Sbjct  755   SQTQQMLDILESILAGSGYSYRRMDGLTPVKQRMAMIDEFNNSDDVFVFILTTKVGGLGT  814

Query  2606  NLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHS  2785
             NLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKH 
Sbjct  815   NLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHF  874

Query  2786  LTNKILKNPQQRRLFKARDLKDLFVLNDDGEN--GSTESSSIFSQLSEDVNITGPQHPDQ  2959
             LTNKILKNPQQRR FKARD+KDLF LNDDG++  GSTE+S+IF QLS ++NI G Q   Q
Sbjct  875   LTNKILKNPQQRRFFKARDMKDLFSLNDDGDSNGGSTETSNIFGQLSGEINIVGAQTDKQ  934

Query  2960  EKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDH  3139
              K    + N  + G++  ++  +   G++  D      DE+T+IL++LFD HGIHS ++H
Sbjct  935   SK---AEENSPEEGSSGNKEMETRDKGDKATD------DEETNILKSLFDTHGIHSVVNH  985

Query  3140  DAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIK  3319
             DAIVNA DEEK+++E++AS VAQRAAEALRQSRMLRS+ES+++PTWTGRSG AGAP S++
Sbjct  986   DAIVNADDEEKMRMEQKASEVAQRAAEALRQSRMLRSRESISVPTWTGRSGCAGAPSSVR  1045

Query  3320  KKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISD  3499
              +FG       V  S   +++   S+ +NGI AG  +GKA SSAELLA+IRG++E+AI  
Sbjct  1046  TRFGR------VAHSATADDAP--SAGKNGIGAGLPSGKAPSSAELLARIRGSREQAIGA  1097

Query  3500  GLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASI  3679
             GLE +                     R S   +G+QPEVLIRQ+C+F+Q +GG T SASI
Sbjct  1098  GLEPRSSL------------------RSSREPSGLQPEVLIRQICSFLQERGGRTDSASI  1139

Query  3680  VEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
             VE F+ RVP  D+ LFKNLLKEIATL+++ NGSFW+LKPEY++
Sbjct  1140  VERFKDRVPPTDMPLFKNLLKEIATLQRDRNGSFWVLKPEYKD  1182



>ref|XP_010037970.1| PREDICTED: DNA repair protein rhp26 [Eucalyptus grandis]
Length=1218

 Score =  1384 bits (3581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 758/1240 (61%), Positives = 932/1240 (75%), Gaps = 49/1240 (4%)
 Frame = +2

Query  164   DEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEA--ARSMELEATEHNATSSTKK  337
             +++D +L SSLGV SANPEDIER+I     + F+A   A   +  E E  E+   SS+ +
Sbjct  2     EDQDGILLSSLGVVSANPEDIERDILA---HAFEAKGNARDGKDPEGEVPENPELSSSAQ  58

Query  338   TDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlndl  517
               +YNKL+A++ EI AV S  EQ+++ +  +    +   G    D E  ++  QA   D 
Sbjct  59    EKLYNKLKAIQFEIDAVASTVEQVKDVKSVEGGAHEGSHGGNDAD-EDPRNVFQASFGDS  117

Query  518   dlqralaadrlKSLLKTKAQLKKEISDLSN---DSTHDTLSVLRDIVKEQPNAVLRDVVK  688
              L  ALA+DRL+SL +T+AQL+KE+ +L     + ++D   +LR++VKE+P   L+   K
Sbjct  118   SLHHALASDRLRSLRETQAQLEKELVELREGNLNKSNDDYRLLRNLVKEKPR--LKRKSK  175

Query  689   GQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILT  868
                +P + L++ +             S  DDDDFDAVL+ AS+GF+ETE+D LVRKG+LT
Sbjct  176   AVLQPSKNLEKRQK----------IVSFRDDDDFDAVLDGASNGFIETERDALVRKGVLT  225

Query  869   PFHKLKGFERQIQEPGQSSRHSMQD----NGDLVSTSLANAIQSISEAAQSRPTTKLLDS  1036
             PFHKLKG+ER IQ+P  S R S+ +      DLV+ S+  A++S+ E AQ+RPTTKL+DS
Sbjct  226   PFHKLKGYERGIQDPEPSKRFSLSEQEASGNDLVTASVDRAVKSMLELAQARPTTKLVDS  285

Query  1037  SLLPKLEPPTYPFQTPRKHVKISQS----AENGRNDKRKRRPTPGKKWRVKVSRENK---  1195
               LPKLE PT PFQ  +K  K   S     E  R   +K+RP P KKWR  VSRE +   
Sbjct  286   QALPKLEGPTTPFQRLKKPPKALSSHESEGEKSRASGKKKRPLPSKKWRNIVSREERQST  345

Query  1196  ---DEGPDVEISSYedekddedmddeGP--PFVMLEGGLKIPETIFDKLFDYQKVGVQWL  1360
                D   ++  SSYE +  +E  + +    P V+L+ GLKIPE+IF  LFDYQKVGVQWL
Sbjct  346   DYDDASDNLVTSSYEGDVQEEGKEVDKSLSPCVVLKEGLKIPESIFTNLFDYQKVGVQWL  405

Query  1361  WELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWY  1540
             WELHCQKAGGIIGDEMGLGKT+QVL+FLG+LH S  YKPSI+VCP+TLL+QWKREAKKWY
Sbjct  406   WELHCQKAGGIIGDEMGLGKTIQVLSFLGALHVSGMYKPSIVVCPVTLLRQWKREAKKWY  465

Query  1541  PSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLG  1720
             P FHVEILHDS  D + KK  +     D     L     E + S +N+KKWD LI  VL 
Sbjct  466   PKFHVEILHDSSQDSYSKKSKNSYESDDESEGSLNRDYEETSQS-KNSKKWDPLIKRVLR  524

Query  1721  SDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTG  1900
             S+SGLLITTYE LRLLG+KLLDI WGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG
Sbjct  525   SESGLLITTYEHLRLLGDKLLDIVWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTG  584

Query  1901  SPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLR  2080
             +PIQN+L+ELWSLFDFVFPGKLGVLPVFEAEFAVPI++GGYANA+PLQV+TAYRCAVVLR
Sbjct  585   APIQNRLTELWSLFDFVFPGKLGVLPVFEAEFAVPITVGGYANASPLQVTTAYRCAVVLR  644

Query  2081  DLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALY  2260
             DL+MPYLLRRMKADVNA LPKKTEHV+FCSL + QRS+Y+AFLAS++VEQI  GSKN+LY
Sbjct  645   DLVMPYLLRRMKADVNAHLPKKTEHVLFCSLNAEQRSVYRAFLASSEVEQILGGSKNSLY  704

Query  2261  GIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQ  2440
             GIDVMRKICNHPDLLEREH+  +PDYGNPERSGKMKVVAEVLK+WK++GHRVL F+QTQQ
Sbjct  705   GIDVMRKICNHPDLLEREHAHHNPDYGNPERSGKMKVVAEVLKVWKEKGHRVLLFAQTQQ  764

Query  2441  MLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGA  2620
             MLDILE+FLV+G YKYRRMDG TPVKQRMALIDEFNN+ E+FIFILTT+VGGLGTNLTGA
Sbjct  765   MLDILESFLVSGEYKYRRMDGLTPVKQRMALIDEFNNSDEVFIFILTTKVGGLGTNLTGA  824

Query  2621  NRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKI  2800
             NRVIIFDPDWNPS DMQARERAWRIGQ +DVTVYRLITRGTIEEKVYHRQIYKH LTNKI
Sbjct  825   NRVIIFDPDWNPSTDMQARERAWRIGQTRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKI  884

Query  2801  LKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIK  2980
             LKNPQQRR+FKARD+KDLF  NDDGE+G+TE+S+IFSQLSEDV +   Q+  Q+K K + 
Sbjct  885   LKNPQQRRIFKARDMKDLFTFNDDGESGTTETSNIFSQLSEDVIVIAQQNARQDKGKGLN  944

Query  2981  TNPADHGTAM----ERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAI  3148
                +  G           +SG  G+E+ ++++ +VD +  IL+ L +A GIHSA++HD I
Sbjct  945   VAASKDGDCASSSKSYTGSSGKKGKERVNDDSEEVDGEADILKGLLEASGIHSAVNHDII  1004

Query  3149  VNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKF  3328
             +NAHDEEK++LEEQAS++A+RAAEALRQSRM+RS +SV++PTWTG+SG AGAP S KKKF
Sbjct  1005  MNAHDEEKIRLEEQASQIAKRAAEALRQSRMMRSHDSVSVPTWTGKSGMAGAPSSAKKKF  1064

Query  3329  GSTL-NPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGL  3505
             G+T+ +     SSK   + S  +   NGI AG  AGKALSSAELLAKIRG Q+RA+S   
Sbjct  1065  GATVSSKLSNNSSKRSSDESSSNGTSNGIVAGVQAGKALSSAELLAKIRGTQQRALSSA-  1123

Query  3506  EHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVE  3685
               +H   SGS      R  + G+S  SH S+ +QPE+L RQ+CTF+Q++GG T SA+I +
Sbjct  1124  --EHGSVSGSGD---LRRPDVGSSTSSHSSSHVQPEILTRQICTFLQQRGGITDSATISQ  1178

Query  3686  HFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             HFR R+   D +LF++ LK IATL+K+PNGS WILKPEYQ
Sbjct  1179  HFRDRISDDDSSLFRSQLKAIATLEKDPNGSVWILKPEYQ  1218



>gb|KCW49760.1| hypothetical protein EUGRSUZ_K03253 [Eucalyptus grandis]
Length=1205

 Score =  1383 bits (3579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 756/1241 (61%), Positives = 927/1241 (75%), Gaps = 64/1241 (5%)
 Frame = +2

Query  164   DEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEA--ARSMELEATEHNATSSTKK  337
             +++D +L SSLGV SANPEDIER+I     + F+A   A   +  E E  E+   SS+ +
Sbjct  2     EDQDGILLSSLGVVSANPEDIERDILA---HAFEAKGNARDGKDPEGEVPENPELSSSAQ  58

Query  338   TDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlndl  517
               +YNKL+A++ EI AV S  EQ+++ +  +    +   G    D E  ++  QA   D 
Sbjct  59    EKLYNKLKAIQFEIDAVASTVEQVKDVKSVEGGAHEGSHGGNDAD-EDPRNVFQASFGDS  117

Query  518   dlqralaadrlKSLLKTKAQLKKEISDLSN---DSTHDTLSVLRDIVKEQPNAVLRDVVK  688
              L  ALA+DRL+SL +T+AQL+KE+ +L     + ++D   +LR++VKE+P   L+   K
Sbjct  118   SLHHALASDRLRSLRETQAQLEKELVELREGNLNKSNDDYRLLRNLVKEKPR--LKRKSK  175

Query  689   GQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILT  868
                +P + L++ +             S  DDDDFDAVL+ AS+GF+ETE+D LVRKG+LT
Sbjct  176   AVLQPSKNLEKRQK----------IVSFRDDDDFDAVLDGASNGFIETERDALVRKGVLT  225

Query  869   PFHKLKGFERQIQEPGQSSRHSMQD----NGDLVSTSLANAIQSISEAAQSRPTTKLLDS  1036
             PFHKLKG+ER IQ+P  S R S+ +      DLV+ S+  A++S+ E AQ+RPTTKL+DS
Sbjct  226   PFHKLKGYERGIQDPEPSKRFSLSEQEASGNDLVTASVDRAVKSMLELAQARPTTKLVDS  285

Query  1037  SLLPKLEPPTYPFQTPRKHVKISQS----AENGRNDKRKRRPTPGKKWRVKVSRENK---  1195
               LPKLE PT PFQ  +K  K   S     E  R   +K+RP P KKWR  VSRE +   
Sbjct  286   QALPKLEGPTTPFQRLKKPPKALSSHESEGEKSRASGKKKRPLPSKKWRNIVSREERQST  345

Query  1196  ------DEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQW  1357
                   +EG +V+ S                P V+L+ GLKIPE+IF  LFDYQKVGVQW
Sbjct  346   DYGDVQEEGKEVDKSL--------------SPCVVLKEGLKIPESIFTNLFDYQKVGVQW  391

Query  1358  LWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKW  1537
             LWELHCQKAGGIIGDEMGLGKT+QVL+FLG+LH S  YKPSI+VCP+TLL+QWKREAKKW
Sbjct  392   LWELHCQKAGGIIGDEMGLGKTIQVLSFLGALHVSGMYKPSIVVCPVTLLRQWKREAKKW  451

Query  1538  YPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVL  1717
             YP FHVEILHDS  D + KK  +     D     L     E + S +N+KKWD LI  VL
Sbjct  452   YPKFHVEILHDSSQDSYSKKSKNSYESDDESEGSLNRDYEETSQS-KNSKKWDPLIKRVL  510

Query  1718  GSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMT  1897
              S+SGLLITTYE LRLLG+KLLDI WGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMT
Sbjct  511   RSESGLLITTYEHLRLLGDKLLDIVWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMT  570

Query  1898  GSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVL  2077
             G+PIQN+L+ELWSLFDFVFPGKLGVLPVFEAEFAVPI++GGYANA+PLQV+TAYRCAVVL
Sbjct  571   GAPIQNRLTELWSLFDFVFPGKLGVLPVFEAEFAVPITVGGYANASPLQVTTAYRCAVVL  630

Query  2078  RDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNAL  2257
             RDL+MPYLLRRMKADVNA LPKKTEHV+FCSL + QRS+Y+AFLAS++VEQI  GSKN+L
Sbjct  631   RDLVMPYLLRRMKADVNAHLPKKTEHVLFCSLNAEQRSVYRAFLASSEVEQILGGSKNSL  690

Query  2258  YGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQ  2437
             YGIDVMRKICNHPDLLEREH+  +PDYGNPERSGKMKVVAEVLK+WK++GHRVL F+QTQ
Sbjct  691   YGIDVMRKICNHPDLLEREHAHHNPDYGNPERSGKMKVVAEVLKVWKEKGHRVLLFAQTQ  750

Query  2438  QMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTG  2617
             QMLDILE+FLV+G YKYRRMDG TPVKQRMALIDEFNN+ E+FIFILTT+VGGLGTNLTG
Sbjct  751   QMLDILESFLVSGEYKYRRMDGLTPVKQRMALIDEFNNSDEVFIFILTTKVGGLGTNLTG  810

Query  2618  ANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNK  2797
             ANRVIIFDPDWNPS DMQARERAWRIGQ +DVTVYRLITRGTIEEKVYHRQIYKH LTNK
Sbjct  811   ANRVIIFDPDWNPSTDMQARERAWRIGQTRDVTVYRLITRGTIEEKVYHRQIYKHFLTNK  870

Query  2798  ILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSI  2977
             ILKNPQQRR+FKARD+KDLF  NDDGE+G+TE+S+IFSQLSEDV +   Q+  Q+K K +
Sbjct  871   ILKNPQQRRIFKARDMKDLFTFNDDGESGTTETSNIFSQLSEDVIVIAQQNARQDKGKGL  930

Query  2978  KTNPADHGTAM----ERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDA  3145
                 +  G           +SG  G+E+ ++++ +VD +  IL+ L +A GIHSA++HD 
Sbjct  931   NVAASKDGDCASSSKSYTGSSGKKGKERVNDDSEEVDGEADILKGLLEASGIHSAVNHDI  990

Query  3146  IVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK  3325
             I+NAHDEEK++LEEQAS++A+RAAEALRQSRM+RS +SV++PTWTG+SG AGAP S KKK
Sbjct  991   IMNAHDEEKIRLEEQASQIAKRAAEALRQSRMMRSHDSVSVPTWTGKSGMAGAPSSAKKK  1050

Query  3326  FGSTL-NPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDG  3502
             FG+T+ +     SSK   + S  +   NGI AG  AGKALSSAELLAKIRG Q+RA+S  
Sbjct  1051  FGATVSSKLSNNSSKRSSDESSSNGTSNGIVAGVQAGKALSSAELLAKIRGTQQRALSSA  1110

Query  3503  LEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIV  3682
                +H   SGS      R  + G+S  SH S+ +QPE+L RQ+CTF+Q++GG T SA+I 
Sbjct  1111  ---EHGSVSGSGD---LRRPDVGSSTSSHSSSHVQPEILTRQICTFLQQRGGITDSATIS  1164

Query  3683  EHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             +HFR R+   D +LF++ LK IATL+K+PNGS WILKPEYQ
Sbjct  1165  QHFRDRISDDDSSLFRSQLKAIATLEKDPNGSVWILKPEYQ  1205



>ref|XP_008791071.1| PREDICTED: DNA repair protein rhp26 isoform X1 [Phoenix dactylifera]
 ref|XP_008791072.1| PREDICTED: DNA repair protein rhp26 isoform X1 [Phoenix dactylifera]
Length=1227

 Score =  1380 bits (3572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 756/1247 (61%), Positives = 940/1247 (75%), Gaps = 50/1247 (4%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSME---LEATEHNATS  325
             MEE++ED++L SSLG+ SA PEDIER I  + ++     +E+    E   L+      TS
Sbjct  1     MEEEDEDKLLLSSLGIASAKPEDIERKILSEAKSDAKCGSESEVCSEEHGLDGEPETGTS  60

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
             ST +  +YN+LRAVE EI  V S  E +++   N+       D  E         + Q  
Sbjct  61    STGRVKLYNRLRAVEIEIDVVASSIEAVKDVADNENDHTGNTDIKEDNAKGNADGSGQVT  120

Query  506   lndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVV  685
              N L LQ+ALA DRL+SL KTKAQL +EIS L  ++  +      DI  E+   +L ++V
Sbjct  121   CNGLTLQQALATDRLRSLKKTKAQLHEEISKLDENAASE------DIGHEK---LLAELV  171

Query  686   KGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGIL  865
             +  PK KR+ K  +  +++ K  +KT + D+D DFDA L+ AS+GFVETE+D+L+RKGIL
Sbjct  172   EENPKRKRKSKAVEQSNRDSKSHLKTVAYDEDADFDAALDTASTGFVETERDELIRKGIL  231

Query  866   TPFHKLKGFERQIQEPGQSSRHSMQDNG--DLVSTSLANAIQSISEAAQSRPTTKLLDSS  1039
             TPFH++KGFER++Q+P  S+RH  +++   D  S S+A   QSIS+ A+SRPTTKLLD+ 
Sbjct  232   TPFHRIKGFERRVQQPAPSNRHVPEESAAEDHASASIAKVAQSISDIARSRPTTKLLDAE  291

Query  1040  LLPKLEPPTYPFQTPRKHVK------ISQSAENGRNDKRKRRPTPGKKWRVKVSRENKDE  1201
              LP L+ PT+PFQ  +  +K        +  +  R  +R +RP P KKWR   S+E   +
Sbjct  292   ALPGLDAPTHPFQRLKAPLKRPVSPKGKELEKKKRKLRRSKRPLPSKKWRNVDSKEKLPD  351

Query  1202  GPDVE------ISSYedekddedmddeGP-PFVMLEGGLKIPETIFDKLFDYQKVGVQWL  1360
             G D +       + Y +E  +E+  D+G    V+LEGGLKIP +I   LFDYQKVG+QWL
Sbjct  352   GSDEDSVGDLIATDYGEETQEEENADDGEQSSVILEGGLKIPASIHKNLFDYQKVGIQWL  411

Query  1361  WELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWY  1540
             WELHCQ+AGGIIGDEMGLGKTVQV++FLG+LHFS  YKPSI+VCP+TLL+QW+REA+KWY
Sbjct  412   WELHCQRAGGIIGDEMGLGKTVQVISFLGALHFSKMYKPSIVVCPVTLLRQWQREARKWY  471

Query  1541  PSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLG  1720
             P+F VEILHDS +  + +     S       + +   +     + ++ K+W+ LI+ V+ 
Sbjct  472   PNFKVEILHDSAHGLNKQMVAKSSESDYDSEDSMDTDNERPRPA-KSVKRWNDLIDRVVQ  530

Query  1721  SDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTG  1900
             S+S LL+TTYEQLRLLGEKLLDIEWGYA+LDEGHRIRNPN ++TLVCKQLQTVHRIIMTG
Sbjct  531   SESALLLTTYEQLRLLGEKLLDIEWGYAILDEGHRIRNPNAEITLVCKQLQTVHRIIMTG  590

Query  1901  SPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLR  2080
             +PIQNKLSELWSLFDFVFPGKLGVLPVFE EFAVPI++GGYANATPLQVSTAYRCAVVLR
Sbjct  591   APIQNKLSELWSLFDFVFPGKLGVLPVFETEFAVPITVGGYANATPLQVSTAYRCAVVLR  650

Query  2081  DLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALY  2260
             DLIMPYLLRRMKADVNAQLPKKTEHV+FCSLTS QRS+Y+AFLAS++VEQIF+G++N+LY
Sbjct  651   DLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTSDQRSVYRAFLASSEVEQIFEGNRNSLY  710

Query  2261  GIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQ  2440
             GID+MRKICNHPDLLEREHS + PDYGNPERSGKMKVVA+VL++WK+QGH VL F+QTQQ
Sbjct  711   GIDIMRKICNHPDLLEREHSAQHPDYGNPERSGKMKVVAQVLRVWKEQGHHVLLFTQTQQ  770

Query  2441  MLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGA  2620
             MLDI ENFL   GY YRRMDG TPVKQRMAL+DEFNN+ ++FIFILTT+VGGLGTNLTGA
Sbjct  771   MLDIFENFLAASGYSYRRMDGLTPVKQRMALMDEFNNSSDVFIFILTTKVGGLGTNLTGA  830

Query  2621  NRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKI  2800
             +RVII+DPDWNPS DMQARERAWRIGQK++VTVYRLITRGTIEEKVYHRQIYKH LTNKI
Sbjct  831   DRVIIYDPDWNPSTDMQARERAWRIGQKREVTVYRLITRGTIEEKVYHRQIYKHFLTNKI  890

Query  2801  LKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNI---TGPQHPDQEKDK  2971
             LKNPQQRR FKA+D+KDLF+L D  E GSTE+S IFSQL E+VN+    G QH  Q    
Sbjct  891   LKNPQQRRFFKAKDMKDLFMLQDGREGGSTETSDIFSQLFEEVNVGIGNGYQH-KQGSSS  949

Query  2972  SIKTNPADHGTAMERDNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHS  3127
             +  T P        R+ N        S S G++ A   NG++DE+T+IL++LFDAHGIHS
Sbjct  950   AASTCP----VVPARETNSPGLGASSSNSKGKDIAGQRNGEIDEETNILKSLFDAHGIHS  1005

Query  3128  AMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
             AM+HDAI+NA+D++KL+LEEQASRVA+RAAEALR+SR LRS++S ++PTWTGRSG AGAP
Sbjct  1006  AMNHDAIMNANDDDKLRLEEQASRVARRAAEALRESRRLRSRDSFSVPTWTGRSGAAGAP  1065

Query  3308  PSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQER  3487
              S+ +KFGS++N QL+  SKP + S   +SR  G+AAGAS GKALSSAELLA+I G QER
Sbjct  1066  SSVCRKFGSSVNTQLLGPSKPSQGS---ASRPPGLAAGASTGKALSSAELLARIHGTQER  1122

Query  3488  AISDGLEHQHQFNSGSSSNSRTRAAENG-ASRPSHGSAGMQPEVLIRQVCTFIQRKGGST  3664
             A+ D LE     +  SS N R R  E+  AS+PSH    +QPE+LIRQ+CTFIQ++GG T
Sbjct  1123  AVDDALE--QDLDLASSLNQRARIPEDTLASKPSHRYMVVQPEILIRQLCTFIQQRGGQT  1180

Query  3665  SSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
              SASI +HF+ R+ SKDL LFKNLLKEIATL+K+  GS W+LKPEY+
Sbjct  1181  DSASITQHFKDRIQSKDLPLFKNLLKEIATLQKDAGGSRWVLKPEYR  1227



>ref|NP_179466.1| chromatin remodeling 8 [Arabidopsis thaliana]
 sp|Q9ZV43.1|CHR8_ARATH RecName: Full=Protein CHROMATIN REMODELING 8; Short=AtCHR8; Short=AtCSB 
[Arabidopsis thaliana]
 gb|AAD08945.1| putative SNF2/RAD54 family DNA repair and recombination protein 
[Arabidopsis thaliana]
 gb|AEC06805.1| chromatin remodeling 8 [Arabidopsis thaliana]
Length=1187

 Score =  1373 bits (3554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 768/1242 (62%), Positives = 933/1242 (75%), Gaps = 79/1242 (6%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATS--S  328
             MEEDE D+ L SSLGVTSANPED+E+ I  +     D  N+   S+E ++T+   T+  S
Sbjct  1     MEEDE-DQFLLSSLGVTSANPEDLEQKILDEATKKPD--NDEGGSVEEKSTQLEGTNLLS  57

Query  329   TKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPl  508
             + + ++ NKLRAV+ EI AV S  E ++            E G +K D    +S  Q   
Sbjct  58    SSQNELLNKLRAVKFEIDAVASTVENVDEIAA--------EKGLKKDD----ESDLQGLH  105

Query  509   ndldlqralaadrlKSLLKTKAQLKKEISDL---SNDSTHDTLSVLRDIVKEQPNAVLRD  679
             +   LQ ALA DRL+SL K K QL+KE++ L   S  S+ D  ++LRD+VKE+P+  L+ 
Sbjct  106   SGSALQHALATDRLRSLKKRKIQLEKELTGLHGQSASSSADHGNLLRDLVKEKPS--LKR  163

Query  680   VVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKG  859
              +K   KP RR            K++K  S  +D DFDAV + AS+GFVETE+D+LVRKG
Sbjct  164   KLKEIRKPSRR----------DGKKVKVVSFREDTDFDAVFDGASAGFVETERDELVRKG  213

Query  860   ILTPFHKLKGFERQIQEPGQSSRHSMQ--DNGDLVSTSLANAIQSISEAAQSRPTTKLLD  1033
             ILTPFHKL GFER++Q+PG S+  ++   D+ +  S+ +  A+QS+S AA++RPTTKLLD
Sbjct  214   ILTPFHKLDGFERRLQQPGPSNSRNLPEGDDENEDSSIIDRAVQSMSLAAKARPTTKLLD  273

Query  1034  SSLLPKLEPPTYPFQTPRKHVKISQSAEN------GRNDKRKRRPTPGKKWRVKVSRENK  1195
             +  LPKLEPPT PF+  RK  K   S +N           +K RP P KKWR ++SRE+ 
Sbjct  274   AEDLPKLEPPTAPFRRLRKLYKTPNSPDNEAKKRKAGKKSKKTRPLPEKKWRKRISREDS  333

Query  1196  D-----EGPDVEISSYedekddedmddeGPPF---VMLEGGLKIPETIFDKLFDYQKVGV  1351
                   +G  +  +S  +E++ +D DD        V LEGGL IPE IF KLFDYQ+VGV
Sbjct  334   SLQGSGDGRRILTTSSCEEEELDDFDDADDNERSSVQLEGGLNIPECIFRKLFDYQRVGV  393

Query  1352  QWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAK  1531
             QWLWELHCQ+AGGIIGDEMGLGKT+QVL+FLGSLHFS  YKPSII+CP+TLL+QW+REA+
Sbjct  394   QWLWELHCQRAGGIIGDEMGLGKTIQVLSFLGSLHFSKMYKPSIIICPVTLLRQWRREAQ  453

Query  1532  KWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINH  1711
             KWYP FHVEILHDS  D        +   S+S+ +    VD +     +NTKKWD L+N 
Sbjct  454   KWYPDFHVEILHDSAQD--SGHGKGQGKASESDYDSESSVDSDHEPKSKNTKKWDSLLNR  511

Query  1712  VLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRII  1891
             VL S+SGLLITTYEQLRL GEKLL+IEWGYAVLDEGHRIRNPN+D+TLVCKQLQTVHRII
Sbjct  512   VLNSESGLLITTYEQLRLQGEKLLNIEWGYAVLDEGHRIRNPNSDITLVCKQLQTVHRII  571

Query  1892  MTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAV  2071
             MTG+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANA+PLQVSTAYRCAV
Sbjct  572   MTGAPIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCAV  631

Query  2072  VLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKN  2251
             VLRDLIMPYLLRRMKADVNA L KKTEHV+FCSLT  QRS Y+AFLAS++VEQIFDG++N
Sbjct  632   VLRDLIMPYLLRRMKADVNAHLTKKTEHVLFCSLTVEQRSTYRAFLASSEVEQIFDGNRN  691

Query  2252  ALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQ  2431
             +LYGIDVMRKICNHPDLLEREHS ++PDYGNPERSGKMKVVAEVLK+WK QGHRVL FSQ
Sbjct  692   SLYGIDVMRKICNHPDLLEREHSHQNPDYGNPERSGKMKVVAEVLKVWKQQGHRVLLFSQ  751

Query  2432  TQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNL  2611
             TQQMLDILE+FLV   Y YRRMDG TPVKQRMALIDEFNN+ ++F+F+LTT+VGGLGTNL
Sbjct  752   TQQMLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSEDMFVFVLTTKVGGLGTNL  811

Query  2612  TGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLT  2791
             TGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKH LT
Sbjct  812   TGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLT  871

Query  2792  NKILKNPQQRRLFKARDLKDLFVLNDDGE-NGSTESSSIFSQLSEDVNITGPQHPDQEKD  2968
             NKILKNPQQRR FKARD+KDLF+L DDG+ N STE+S+IFSQL+E++NI G Q    +K 
Sbjct  872   NKILKNPQQRRFFKARDMKDLFILKDDGDSNASTETSNIFSQLAEEINIVGVQ---SDKK  928

Query  2969  KSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAI  3148
                 T  A H TA   + +S     E  D     +DE+T+IL++LFDAHGIHSA++HDAI
Sbjct  929   PESDTQLALHKTA---EGSSEQTDVEMTDKTGEAMDEETNILKSLFDAHGIHSAVNHDAI  985

Query  3149  VNAHD-EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK  3325
             +NA+D EEK++LE QAS+VAQRAAEALRQSRMLRS+ES+++PTWTGRSG AGAP S++++
Sbjct  986   MNANDEEEKMRLEHQASQVAQRAAEALRQSRMLRSRESISVPTWTGRSGCAGAPSSVRRR  1045

Query  3326  FGSTLNPQLV-TSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDG  3502
             FGST+N +L  T  KP       S+ +NGI+AG S+GKA SSAELL +IRG++E+AI  G
Sbjct  1046  FGSTVNSRLTQTGDKP-------SAIKNGISAGLSSGKAPSSAELLNRIRGSREQAIGVG  1098

Query  3503  LEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIV  3682
             LE        SS +S    +             +QPEVLIR++C+F+Q+KGGS  + SIV
Sbjct  1099  LEQPQSSFPSSSGSSSRVGS-------------LQPEVLIRKICSFVQQKGGSADTTSIV  1145

Query  3683  EHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
              HFR  V   D  LFKNLLKEIATL+K+ N SFW+LK EY++
Sbjct  1146  NHFRDIVSFNDKQLFKNLLKEIATLEKDQNRSFWVLKSEYKD  1187



>ref|XP_004967914.1| PREDICTED: DNA repair protein rhp26-like isoform X2 [Setaria 
italica]
Length=1195

 Score =  1364 bits (3530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 750/1235 (61%), Positives = 917/1235 (74%), Gaps = 58/1235 (5%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             M+E+++D+ L  SLGVTSAN EDIE+ I  Q  N  +    A  + E +A    A +  K
Sbjct  1     MDEEDDDQRLLHSLGVTSANIEDIEKKILSQARNDTEQGTTANDNEESDAGVPEADTQAK  60

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
                ++ KLR+V+ EI AV S  ++ ++             G +K+  +    T Q   + 
Sbjct  61    ---LHQKLRSVQLEIDAVASTIKRAKH-----------AAGKQKQKQKHADHTAQDDPHG  106

Query  515   ldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQ  694
               LQ+ALA +RLKSL K KAQ++KEIS        D      D  K++  A+L   V+ +
Sbjct  107   GALQQALATERLKSLKKAKAQIQKEISQ------SDPCLSGSDKRKDKMLAML---VEEE  157

Query  695   PKPKRR-LkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTP  871
             PK K++ L  ++ P K    R+KT S +DDDDFDAVL+ AS+GF+ETE+++L+RKG+LTP
Sbjct  158   PKRKKKTLLPSRGPKKMSAPRLKTMSYNDDDDFDAVLDGASAGFMETEREELIRKGLLTP  217

Query  872   FHKLKGFERQIQEPGQSSRHSMQDNGDLV-----STSLANAIQSISEAAQSRPTTKLLDS  1036
             FHKLKGFE++++ PG S  H   D  D V     ++ +A   QS+ + AQSRPTTKLLD 
Sbjct  218   FHKLKGFEKRVELPGPS--HMQNDPTDQVEETMEASRIAKFAQSMQQIAQSRPTTKLLDP  275

Query  1037  SLLPKLEPPTYPFQTPRKHVK-----ISQSAENGRNDKRKRRPTPGKKWRVKVSR-----  1186
               LPKL+ PT PFQ   + +K      S+  E  R   + +RP P KKWR   S      
Sbjct  276   ESLPKLDAPTTPFQRLGRPLKRPVSPSSEEQEKKRRRNKTKRPLPDKKWRKANSNKESLL  335

Query  1187  ENKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWE  1366
             E  DE      +S  +++D      +G P V+LEGGL+IP T++D+LFDYQKVGVQWLWE
Sbjct  336   ETDDEDDGDIAASVSEDEDQAAEGFDGLPPVILEGGLRIPGTVYDQLFDYQKVGVQWLWE  395

Query  1367  LHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPS  1546
             LHCQ+AGGIIGDEMGLGKTVQVL FLGSLH S  YKPSI++CP+TLLQQWKREA +WYP 
Sbjct  396   LHCQRAGGIIGDEMGLGKTVQVLTFLGSLHNSGMYKPSIVICPVTLLQQWKREASRWYPK  455

Query  1547  FHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSD  1726
             F V+ILHDS N  + K K     +S++  +   +         +  KKWD LI+ V+ S 
Sbjct  456   FKVKILHDSANGSNKKSKAYSDSDSEASWDGDQEEIRRA----KPAKKWDDLISSVINSG  511

Query  1727  SGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSP  1906
             SGLL+TTYEQLR+LGEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+P
Sbjct  512   SGLLLTTYEQLRILGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAP  571

Query  1907  IQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDL  2086
             IQNKLSELWSLFDFVFPGKLGVLPVFE EF+VPI++GGYANATPLQVSTAYRCAVVLRD+
Sbjct  572   IQNKLSELWSLFDFVFPGKLGVLPVFETEFSVPITVGGYANATPLQVSTAYRCAVVLRDI  631

Query  2087  IMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGI  2266
             IMPYLLRRMKADVNAQLPKKTEHV+FCSLT  QR+ Y+AFLAS++VEQIFDG++N+LYGI
Sbjct  632   IMPYLLRRMKADVNAQLPKKTEHVLFCSLTPEQRATYRAFLASSEVEQIFDGNRNSLYGI  691

Query  2267  DVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQML  2446
             DV+RKICNHPDLLEREH+ ++PDYGNPERSGKMKVV +VL++WKDQGHRVL F+QTQQML
Sbjct  692   DVLRKICNHPDLLEREHAAQNPDYGNPERSGKMKVVEQVLRVWKDQGHRVLLFTQTQQML  751

Query  2447  DILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANR  2626
             DILENFL    Y+YRRMDG TP KQRMALIDEFNNT EIF+FILTT+VGGLGTNLTGANR
Sbjct  752   DILENFLTACDYQYRRMDGLTPAKQRMALIDEFNNTDEIFVFILTTKVGGLGTNLTGANR  811

Query  2627  VIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILK  2806
             +II+DPDWNPS DMQARERAWRIGQ +DVTVYRLITRGTIEEKVYHRQIYKH LTNK+LK
Sbjct  812   IIIYDPDWNPSTDMQARERAWRIGQTRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKVLK  871

Query  2807  NPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTN  2986
             NPQQRR FKARD+KDLF L DD  NGSTE+S+IFSQLSEDVNI  P    Q++     T 
Sbjct  872   NPQQRRFFKARDMKDLFTLQDDEGNGSTETSNIFSQLSEDVNIGVPSEGQQDQVHIALTM  931

Query  2987  PADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDE  3166
             P    +  E +  SG  G  K D N+   DE+++IL++LFDA GIHSA++HDAI+NA+D+
Sbjct  932   P----STSEAEPPSGVKG--KVDENSDQADEESNILKSLFDAQGIHSAINHDAIMNANDD  985

Query  3167  EKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNP  3346
             +K++LE +AS+VAQRAAEALRQSRMLRS++S A+PTWTGRSG AGAP S+++KFGST+N 
Sbjct  986   QKVRLEAEASQVAQRAAEALRQSRMLRSRDSFAVPTWTGRSGAAGAPSSVRRKFGSTVNS  1045

Query  3347  QLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFN  3526
             QL++SS+P E S   SSR   +  GA  GKA+SSAELLAKIRG +E A SD LE  HQ N
Sbjct  1046  QLISSSQPPETS---SSRSQSLPVGALNGKAMSSAELLAKIRGTREGAASDALE--HQLN  1100

Query  3527  SGSSSNSRTRAAENGASRPSHGSAGM--QPEVLIRQVCTFIQRKGGSTSSASIVEHFRSR  3700
              GS SN     + N     +  +  M  QPEVLIRQ+CTFIQ+ GGS SS SI EHF+SR
Sbjct  1101  GGSGSNHVLGPSGNSGRSSNSSNPSMIVQPEVLIRQLCTFIQQNGGSASSTSITEHFKSR  1160

Query  3701  VPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             + SKD+ LFKNLLKEIATL++  NG+ W+LKP+Y+
Sbjct  1161  IQSKDMLLFKNLLKEIATLQRGANGAMWVLKPDYE  1195



>ref|XP_002457538.1| hypothetical protein SORBIDRAFT_03g009030 [Sorghum bicolor]
 gb|EES02658.1| hypothetical protein SORBIDRAFT_03g009030 [Sorghum bicolor]
Length=1208

 Score =  1363 bits (3529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/1231 (61%), Positives = 917/1231 (74%), Gaps = 39/1231 (3%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             M+E+++D+ L  SLGVTSAN EDIE+ I  Q +      +E   +++  +  +    S  
Sbjct  1     MDEEDDDQRLLHSLGVTSANIEDIEKKILSQVQTEPKHDDEPGAAVDEPSRSNVVPESDV  60

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
             +  +++KLR+V+ EI AV S  ++ +N         D  DG +K+  +    T Q   + 
Sbjct  61    QAKLHHKLRSVQLEIDAVASTIKRAKNAAGKKIDSSDSGDGQDKKKQKQADRTAQDEPHG  120

Query  515   ldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQ  694
               LQ+ALA +RLKSL K KAQ++KEIS        D      D  K++  A+L   V+ +
Sbjct  121   GALQQALATERLKSLKKAKAQIQKEISQ------SDPYQSGSDNRKDKMLAML---VEDE  171

Query  695   PKPKRR-LkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTP  871
             P+ K++ L  A+ P K    R+KT S +DD+DFDAVL+ AS GF+ETE+++L+RKG+LTP
Sbjct  172   PRRKKKSLLPARDPKKMSAPRLKTMSYNDDEDFDAVLDGASVGFMETEREELIRKGLLTP  231

Query  872   FHKLKGFERQIQEPGQSSRH---SMQDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSSL  1042
             FHKLKGFE++++ PG S      S Q    + ++ +A   QS+ + AQSRPTTKLLD   
Sbjct  232   FHKLKGFEKRVELPGPSHWQNDPSEQAEETIEASRIARVAQSMQQIAQSRPTTKLLDPES  291

Query  1043  LPKLEPPTYPFQTPRKHVK--ISQSAENGRNDKRKR--RPTPGKKWRVKVSR-----ENK  1195
             LP+L+ PT PFQ   + +K  +S  +E  R  +R +  RP P KKWR   SR     E  
Sbjct  292   LPRLDAPTAPFQRLGRPLKRPVSPGSEQERKRQRNKTKRPLPDKKWRKANSRKESLLETD  351

Query  1196  DEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHC  1375
             DE      +S  +E D      +G   V+LEGGL+IP TI+++LFDYQKVGVQWLWELHC
Sbjct  352   DEDVGDFAASVSEEDDQAAEGFDGVSPVILEGGLRIPGTIYEQLFDYQKVGVQWLWELHC  411

Query  1376  QKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHV  1555
             Q+AGGIIGDEMGLGKTVQVL+FLGSLH S+ YKPSI++CP+TLLQQW+REA +WYP F V
Sbjct  412   QRAGGIIGDEMGLGKTVQVLSFLGSLHNSSMYKPSIVICPVTLLQQWQREASRWYPKFKV  471

Query  1556  EILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGL  1735
             EILHDS N    K K     +S+   +   +         +  KKWD LI+ V+ S SGL
Sbjct  472   EILHDSANGSSKKSKAYNDSDSEGSWDSDQEGVRRA----KPAKKWDDLISRVVNSGSGL  527

Query  1736  LITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQN  1915
             L+TTYEQLR+LGEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PIQN
Sbjct  528   LLTTYEQLRILGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQN  587

Query  1916  KLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMP  2095
             KLSELWSLFDFVFPGKLGVLPVFE EF+VPI++GGYANATPLQVSTAYRCAVVLRDLIMP
Sbjct  588   KLSELWSLFDFVFPGKLGVLPVFETEFSVPITVGGYANATPLQVSTAYRCAVVLRDLIMP  647

Query  2096  YLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVM  2275
             YLLRRMKADVNAQLPKKTEHV+FCSLT  QRS Y+AFLAS++VEQIFDG++N+LYGIDV+
Sbjct  648   YLLRRMKADVNAQLPKKTEHVLFCSLTPEQRSTYRAFLASSEVEQIFDGNRNSLYGIDVL  707

Query  2276  RKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDIL  2455
             RKICNHPDLLEREH+ ++PDYGNPERSGKMKVV +VLK+WKDQGHRVL F+QTQQMLDIL
Sbjct  708   RKICNHPDLLEREHAAQNPDYGNPERSGKMKVVEQVLKVWKDQGHRVLLFTQTQQMLDIL  767

Query  2456  ENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVII  2635
             ENFL    Y+YRRMDG TP KQRMALIDEFNNT EIF+FILTT+VGGLGTNLTGANR+II
Sbjct  768   ENFLTACDYQYRRMDGLTPAKQRMALIDEFNNTDEIFVFILTTKVGGLGTNLTGANRIII  827

Query  2636  FDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQ  2815
             +DPDWNPS DMQARERAWRIGQ +DVTVYRLITRGTIEEKVYHRQIYKH LTNK+LKNPQ
Sbjct  828   YDPDWNPSTDMQARERAWRIGQTRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKVLKNPQ  887

Query  2816  QRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPAD  2995
             Q+R FKARD+KDLF L DD  NGSTE+S+IFSQLSEDVNI  P   D ++D+    +   
Sbjct  888   QKRFFKARDMKDLFTLQDDEGNGSTETSNIFSQLSEDVNIGVPN--DGQQDQEHIASALS  945

Query  2996  HGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKL  3175
               +  E  N     GE + D N+   DE+++IL++LFDA GIHSA++HDAI+NA+D++K+
Sbjct  946   STSEAEPSN----GGEGRVDVNSDQADEESNILKSLFDAQGIHSAINHDAIMNANDDQKV  1001

Query  3176  KLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLV  3355
             +LE +AS+VAQRAAEALRQSRMLRS++S A+PTWTGRSG AGAP S+++KFGST+N QL 
Sbjct  1002  RLEAEASQVAQRAAEALRQSRMLRSRDSFAVPTWTGRSGAAGAPSSVRRKFGSTINSQL-  1060

Query  3356  TSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGS  3535
               ++  + S   SSR   +  GA  GKAL SAELLAKIRG +E A SD LE  HQ N GS
Sbjct  1061  --TRSSQPSETSSSRSQSLPVGALNGKALPSAELLAKIRGTREGAASDALE--HQLNVGS  1116

Query  3536  SSNSRTRAAENG--ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS  3709
             +SN  +  + NG  AS PS+ S  +QPEVLIRQ+CTFIQ  GG  SS SI EHF+SR+ S
Sbjct  1117  ASNHVSSPSGNGSRASHPSNRSMIVQPEVLIRQLCTFIQHNGGFASSTSITEHFKSRIQS  1176

Query  3710  KDLALFKNLLKEIATLKKNPNGSFWILKPEY  3802
             KD+ LFKNLLKEIATL++   GS W+LKP+Y
Sbjct  1177  KDMLLFKNLLKEIATLQRGLEGSMWVLKPDY  1207



>ref|XP_009137797.1| PREDICTED: DNA repair protein rhp26 [Brassica rapa]
 ref|XP_009137798.1| PREDICTED: DNA repair protein rhp26 [Brassica rapa]
Length=1161

 Score =  1361 bits (3523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 768/1239 (62%), Positives = 933/1239 (75%), Gaps = 99/1239 (8%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             MEEDE+  +  SSLGVTSANP DIE+ I  +     D  N+ +    LE +    +S   
Sbjct  1     MEEDED--MFLSSLGVTSANPADIEQTILDEATKKLD--NDESVEERLEGSNLLPSS---  53

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
             ++++ NKLRAV+ EI AV S  EQ E            EDG +   +             
Sbjct  54    QSEILNKLRAVKFEIDAVASTVEQAEE-----------EDGLQSGSV-------------  89

Query  515   ldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQ  694
               LQ ALA DRL+SL K K +L+KE+S L         +   DI        LRD+VKG+
Sbjct  90    --LQNALAKDRLRSLRKRKNELEKELSGLHGQGGTSGGADRGDI--------LRDLVKGE  139

Query  695   PKP-KRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTP  871
             P   KR+LKE + PSK + K++K  S  +D DFDAV +AAS+GFVETE+D+LVRKGILTP
Sbjct  140   PSSRKRKLKEVRKPSKREGKKVKVVSFHEDTDFDAVFDAASAGFVETERDELVRKGILTP  199

Query  872   FHKLKGFERQIQEPGQSSRHSM----QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSS  1039
             FHKL+GFER++Q+PG S+  ++     DN D  S+S+  A+QS+S AA++RPTTKLLD+ 
Sbjct  200   FHKLEGFERRLQQPGPSNTRNLPEGEDDNED--SSSIDRAVQSMSLAAKARPTTKLLDAQ  257

Query  1040  LLPKLEPPTYPFQTPRKHVKISQSAENG-----RNDKRKRRPTPGKKWRVKVSREN----  1192
              LPKLE    PF+  RK  K + S+++          +K+RP P +KW  ++S E+    
Sbjct  258   DLPKLEATPVPFRRLRKLYKTNDSSDSDAKKSKGGKSKKKRPLPKRKWTKRISNEDSSLQ  317

Query  1193  -KDEGPDVEISS---YedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWL  1360
               ++G  +  +S    E+  D +++DD     V LEGGL IPE IF KLFDYQ+VGVQWL
Sbjct  318   ENEDGRRISATSSCEEEELDDFDEVDDSEKSSVPLEGGLNIPEGIFIKLFDYQRVGVQWL  377

Query  1361  WELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWY  1540
             WELHCQKAGGIIGDEMGLGKTVQVL+FLGSLHFS  YKPSI++CP+TLL+QW+REA+ WY
Sbjct  378   WELHCQKAGGIIGDEMGLGKTVQVLSFLGSLHFSKMYKPSIVICPVTLLRQWRREARTWY  437

Query  1541  PSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLG  1720
             P FHVEILHDS  D + K +   S         +     +K+   ++TKKW  LIN VL 
Sbjct  438   PDFHVEILHDSAKDSNGKGRVDASESDYDSEVSVDGDHEQKS---KHTKKWSSLINRVLN  494

Query  1721  SDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTG  1900
             SDSGLLITTYEQLRL GEKLL+IEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG
Sbjct  495   SDSGLLITTYEQLRLHGEKLLNIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTG  554

Query  1901  SPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLR  2080
             +PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANA+PLQVSTAYRCAVVLR
Sbjct  555   APIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCAVVLR  614

Query  2081  DLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALY  2260
             DLIMPYLLRRMKADVNA L KKTEHV+FCSLT  QRS Y+AFLAS++VE IFDG+KN+LY
Sbjct  615   DLIMPYLLRRMKADVNAHLTKKTEHVLFCSLTVEQRSTYRAFLASSEVEDIFDGNKNSLY  674

Query  2261  GIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQ  2440
             GIDVMRKICNHPDLLEREHS ++PDYGNPERSGKMKVVAEVLK+WK QGHRVL FSQTQQ
Sbjct  675   GIDVMRKICNHPDLLEREHSHQNPDYGNPERSGKMKVVAEVLKVWKQQGHRVLLFSQTQQ  734

Query  2441  MLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGA  2620
             MLDILE+FLV   Y YRRMDG TPVKQRMALIDEFNN+ ++F+F+LTT+VGGLGTNLTGA
Sbjct  735   MLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSDDVFVFVLTTKVGGLGTNLTGA  794

Query  2621  NRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKI  2800
             NRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKH LTN+I
Sbjct  795   NRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLTNRI  854

Query  2801  LKNPQQRRLFKARDLKDLFVLNDDGE-NGSTESSSIFSQLSEDVNITGPQHPDQEKDKSI  2977
             LKNPQQRR FKARD+KDLF+LNDDG+ N STE+S+IFSQL+ED+NI G Q  +       
Sbjct  855   LKNPQQRRFFKARDMKDLFILNDDGDSNASTETSNIFSQLAEDINIIGAQTEN-------  907

Query  2978  KTNPADHGTAME-RDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVN  3154
              T+  D  T ++  D     +GE+ A+ N   VDE+T+IL++LFDAHGIHSA++HDAI+N
Sbjct  908   -TSTTDSTTQLDTHDAAEELSGEKDAETNGEPVDEETNILKSLFDAHGIHSAVNHDAIIN  966

Query  3155  AHD-EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFG  3331
             A+D EEK++LE QAS+VAQRAAEALRQSRMLRS+ES+++PTWTGRSG AGAP S++++FG
Sbjct  967   ANDEEEKMRLEHQASQVAQRAAEALRQSRMLRSRESISVPTWTGRSGCAGAPSSVRRRFG  1026

Query  3332  STLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEH  3511
             ST+N +L T+ K        S+ +NGI+AG S+GKA SSAELL KIRG++E+AI  GLE 
Sbjct  1027  STVNSRLTTADKS-------SAVKNGISAGLSSGKAPSSAELLNKIRGSREQAIGVGLE-  1078

Query  3512  QHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF  3691
               Q  + SSS+SR                 +QPEVLIRQ+C+F+QRKGGST ++SIV HF
Sbjct  1079  --QTQTSSSSSSRV--------------GSLQPEVLIRQICSFVQRKGGSTDTSSIVNHF  1122

Query  3692  RSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
               RVP+KD+ LFK+LLKEIATL+K+PNGS W+LK EY++
Sbjct  1123  SDRVPAKDVPLFKSLLKEIATLRKDPNGSVWVLKSEYKD  1161



>emb|CDY51705.1| BnaA03g58950D [Brassica napus]
Length=1159

 Score =  1361 bits (3522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 770/1239 (62%), Positives = 928/1239 (75%), Gaps = 101/1239 (8%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             MEEDE+  +  SSLGVTSANP DIE+ I  +     D  N  +    LE +    +S   
Sbjct  1     MEEDED--MFLSSLGVTSANPADIEQTILDEATKKLD--NYESVEERLEGSNLLPSS---  53

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
             ++++ NKLRAV+ EI AV S  EQ E            EDG +   +             
Sbjct  54    QSEILNKLRAVKFEIDAVASTVEQAEE-----------EDGLQSGSV-------------  89

Query  515   ldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQ  694
               LQ ALA DRL+SL K K +L+KE+S L         +   DI        LRD+VKG+
Sbjct  90    --LQNALAKDRLRSLRKRKNELEKELSGLHGQGGTSGGADRGDI--------LRDLVKGE  139

Query  695   PKP-KRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTP  871
             P   KR+LKE + PSK + K++K  S  +D DFDAV +AAS+GFVETE+D+LVRKGILTP
Sbjct  140   PSSRKRKLKEVRKPSKREGKKVKVVSFHEDTDFDAVFDAASAGFVETERDELVRKGILTP  199

Query  872   FHKLKGFERQIQEPGQSSRHSM----QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSS  1039
             FHKL+GFER++Q+PG S+  S+     DN D  S+S+  A+QS+S AA++RPTTKLLD+ 
Sbjct  200   FHKLEGFERRLQQPGPSNTRSLPEGEDDNED--SSSIDRAVQSMSLAAKARPTTKLLDAH  257

Query  1040  LLPKLEPPTYPFQTPRKHVKISQSAENG-----RNDKRKRRPTPGKKWRVKVSREN----  1192
              LPKLE    PF+  RK  K + S+++          +K+RP P +KW  ++S E+    
Sbjct  258   DLPKLEATPVPFRRLRKLYKTNDSSDSDAKKSKGGKGKKKRPLPKRKWTKRISNEDSSLQ  317

Query  1193  -KDEGPDVEISS---YedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWL  1360
               ++G  +  +S    E+  D +++DD     V LEGGL IPE IF KLFDYQ+VGVQWL
Sbjct  318   ENEDGRRISATSSCEEEELDDFDEVDDSEKSSVPLEGGLNIPEGIFIKLFDYQRVGVQWL  377

Query  1361  WELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWY  1540
             WELHCQKAGGIIGDEMGLGKTVQVL+FLGSLHFS  YKPSI++CP+TLL+QW+REA+ WY
Sbjct  378   WELHCQKAGGIIGDEMGLGKTVQVLSFLGSLHFSKMYKPSIVICPVTLLRQWRREARTWY  437

Query  1541  PSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLG  1720
             P FHVEILHDS  D + K +   S               +K+   +NTKKW  LIN VL 
Sbjct  438   PDFHVEILHDSAKDSNGKGRVDASESDYDSEVSADGDHEQKS---KNTKKWSSLINRVLN  494

Query  1721  SDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTG  1900
             SDSGLLITTYEQLRL GEKLL+IEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG
Sbjct  495   SDSGLLITTYEQLRLHGEKLLNIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTG  554

Query  1901  SPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLR  2080
             +PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANA+PLQVSTAYRCAVVLR
Sbjct  555   APIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCAVVLR  614

Query  2081  DLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALY  2260
             DLIMPYLLRRMKADVNA L KKTEHV+FCSLT  QRS Y+AFLAS++VE IFDG+KN+LY
Sbjct  615   DLIMPYLLRRMKADVNAHLTKKTEHVLFCSLTVEQRSTYRAFLASSEVEDIFDGNKNSLY  674

Query  2261  GIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQ  2440
             GIDVMRKICNHPDLLEREHS ++PDYGNPERSGKMKVVAEVLK+WK QGHRVL FSQTQQ
Sbjct  675   GIDVMRKICNHPDLLEREHSHQNPDYGNPERSGKMKVVAEVLKVWKQQGHRVLLFSQTQQ  734

Query  2441  MLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGA  2620
             MLDILE+FLV   Y YRRMDG TPVKQRMALIDEFNN+ ++F+F+LTT+VGGLGTNLTGA
Sbjct  735   MLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSDDVFVFVLTTKVGGLGTNLTGA  794

Query  2621  NRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKI  2800
             NRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKH LTN+I
Sbjct  795   NRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLTNRI  854

Query  2801  LKNPQQRRLFKARDLKDLFVLNDDGE-NGSTESSSIFSQLSEDVNITGPQHPDQEKDKSI  2977
             LKNPQQRR FKARD+KDLF+LNDDG+ N STE+S+IFSQLSED+NI G Q          
Sbjct  855   LKNPQQRRFFKARDMKDLFILNDDGDSNASTETSNIFSQLSEDINIVGAQ----------  904

Query  2978  KTNPADHGTAME-RDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVN  3154
               N  D  T ++  D     +GE+ A+ N   VDE+T+IL++LFDAHGIHSA++HDAI+N
Sbjct  905   TENTTDSTTQLDTHDAAEELSGEKDAETNGEPVDEETNILKSLFDAHGIHSAVNHDAIIN  964

Query  3155  AHD-EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFG  3331
             A+D EEK++LE QAS+VAQRAAEALRQSRMLRS+ES+++PTWTGRSG AGAP S++++FG
Sbjct  965   ANDEEEKMRLEHQASQVAQRAAEALRQSRMLRSRESISVPTWTGRSGCAGAPSSVRRRFG  1024

Query  3332  STLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEH  3511
             ST+N +L T+ K        S+ +NGI+AG S+GKA SSAELL KIRG++E+AI  GLE 
Sbjct  1025  STVNSRLTTADKS-------SAVKNGISAGLSSGKAPSSAELLNKIRGSREQAIGVGLE-  1076

Query  3512  QHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF  3691
               Q  + SSS+SR                 +QPEV IRQ+C+F+QRKGGST ++SIV HF
Sbjct  1077  --QTQTSSSSSSRV--------------GSLQPEVSIRQICSFVQRKGGSTDTSSIVNHF  1120

Query  3692  RSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
               RVP+KD+ LFK+LLKEIATL+K+PNGS W+LK EY++
Sbjct  1121  SDRVPAKDVPLFKSLLKEIATLRKDPNGSVWVLKSEYKD  1159



>ref|XP_006299332.1| hypothetical protein CARUB_v10015488mg [Capsella rubella]
 gb|EOA32230.1| hypothetical protein CARUB_v10015488mg [Capsella rubella]
Length=1182

 Score =  1360 bits (3521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 761/1241 (61%), Positives = 934/1241 (75%), Gaps = 82/1241 (7%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             MEEDE  ++L SSLGVTSANPED+E+ I  +     D  ++   S+E    E +    + 
Sbjct  1     MEEDEH-QLLLSSLGVTSANPEDLEQTILDEATKKPD--HDEGGSVE----EQSVQLPSS  53

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
             ++++ NKLRAV+ EI AV S    ++            EDG +K D    +S  Q   + 
Sbjct  54    QSELLNKLRAVKFEIDAVASTVGHVDEIAA--------EDGLQKDD----ESDVQGLHSS  101

Query  515   ldlqralaadrlKSLLKTKAQLKKEISDL---SNDSTHDTLSVLRDIVKEQPNAVLRDVV  685
               LQ ALA DRL+SL K K QL+KE++ L   S  ++ D   +LR++VKE+         
Sbjct  102   SVLQHALATDRLRSLEKRKIQLEKELTALHGQSASTSADRDKLLRELVKEK---------  152

Query  686   KGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGIL  865
               +P  KR+LKE + PS+ + K++K  S  +D DFDAV +AAS+GFVETE+D+LVRKGIL
Sbjct  153   --RPSHKRKLKEIRKPSRREGKKVKVVSFREDTDFDAVFDAASAGFVETERDELVRKGIL  210

Query  866   TPFHKLKGFERQIQEPGQSSRHSMQ--DNGDLVSTSLANAIQSISEAAQSRPTTKLLDSS  1039
             TPFHKL GFER++Q+PG S+  ++   D+G+  S S+   +QSIS AA++RPTTKLLD+ 
Sbjct  211   TPFHKLDGFERRLQQPGPSNSRNLPEGDHGNEDSVSIDRVVQSISLAAKARPTTKLLDAE  270

Query  1040  LLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRKR------RPTPGKKWRVKVSRENK--  1195
              LPKLEP   PF+  RK  K   S++N  N  +        RP P +KW  ++SRE+   
Sbjct  271   DLPKLEPNPAPFKRLRKLYKTHDSSDNEVNKSKAGKKSKKKRPLPERKWSKRISREDSSL  330

Query  1196  ---DEGPDVEISSYedekddedmddeGPPF---VMLEGGLKIPETIFDKLFDYQKVGVQW  1357
                ++G  +  +S  +E++ +D+DD        V LEGGL IPE IF KLF+YQ+VGVQW
Sbjct  331   QESEDGRRILATSSGEEEELDDLDDADDNETSPVQLEGGLNIPEFIFRKLFEYQRVGVQW  390

Query  1358  LWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKW  1537
             LWELHCQ+AGGIIGDEMGLGKTVQVL+FLGSLHFS  YKPSII+CP+TLL+QW+REA+KW
Sbjct  391   LWELHCQRAGGIIGDEMGLGKTVQVLSFLGSLHFSKMYKPSIIICPVTLLRQWRREAQKW  450

Query  1538  YPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVL  1717
             YP FHVE+LHDS  D        +   S+S+ +    VD +     +NTKKWD LIN VL
Sbjct  451   YPDFHVELLHDSAQD--SGNGKRQGKASESDDDSECSVDSDHEQKSKNTKKWDSLINRVL  508

Query  1718  GSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMT  1897
              S+SGLLITTYEQLRL GEKLL+IEWGYAVLDEGHRIRNPN+D+TLVCKQLQTVHRIIMT
Sbjct  509   NSESGLLITTYEQLRLQGEKLLNIEWGYAVLDEGHRIRNPNSDITLVCKQLQTVHRIIMT  568

Query  1898  GSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVL  2077
             G+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANA+PLQVSTAYRCAVVL
Sbjct  569   GAPIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCAVVL  628

Query  2078  RDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNAL  2257
             RD+IMPYLLRRMKADVNA L KKTEHV+FCSLT  QRS Y+AFLAS++VEQI DG+KN+L
Sbjct  629   RDMIMPYLLRRMKADVNAHLTKKTEHVLFCSLTIEQRSTYRAFLASSEVEQILDGNKNSL  688

Query  2258  YGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQ  2437
             YGIDVMRKICNHPDLLEREHS ++PDYGNPERSGKMKVVAEVLK+WK QGHRVL FSQTQ
Sbjct  689   YGIDVMRKICNHPDLLEREHSYQNPDYGNPERSGKMKVVAEVLKVWKQQGHRVLLFSQTQ  748

Query  2438  QMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTG  2617
             QMLDILE+FLV   Y YRRMDG TPVKQRMALIDEFNN+ ++F+F+LTT+VGGLGTNLTG
Sbjct  749   QMLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSDDVFVFVLTTKVGGLGTNLTG  808

Query  2618  ANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNK  2797
             ANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKH LTNK
Sbjct  809   ANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLTNK  868

Query  2798  ILKNPQQRRLFKARDLKDLFVLNDDGE-NGSTESSSIFSQLSEDVNITGPQHPDQEKDKS  2974
             ILKNPQQRR FKARD+KDLF+L DDG+ N STE+S+IFSQL+E++NI G Q    +K   
Sbjct  869   ILKNPQQRRFFKARDMKDLFILKDDGDSNASTETSNIFSQLAEEINIVGVQ---SDKKTE  925

Query  2975  IKTNPADHGTAMERDNNSGSNGEEKADNNNGD-VDEDTSILRTLFDAHGIHSAMDHDAIV  3151
               T  A H TA      S    +E   N  G+ VDE+T+IL++LFDAHGIHSA++HDAI+
Sbjct  926   STTQLALHNTA----EGSSEQADEDTTNKTGEAVDEETNILKSLFDAHGIHSAVNHDAII  981

Query  3152  NAHD-EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKF  3328
             NA+D EEK++LE QAS+VA+RAAEALRQSRMLRS+ES+++PTWTGRSG AGAP S++++F
Sbjct  982   NANDEEEKMRLEHQASQVARRAAEALRQSRMLRSRESISVPTWTGRSGCAGAPSSVRRRF  1041

Query  3329  GSTLNPQLV-TSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGL  3505
             GST+N +L  T  KP    S+I   +NGI+AG S+GKA SSAELL +IRG++E+AI  G 
Sbjct  1042  GSTVNSRLTQTGDKP----SVI---KNGISAGLSSGKAPSSAELLNRIRGSREQAIGVG-  1093

Query  3506  EHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVE  3685
                         N + +++   +S  S     +QPEVLIRQ+C+F+Q+KGGS  + SIV 
Sbjct  1094  ------------NEQLQSSLPSSSGSSSRVGSLQPEVLIRQICSFVQQKGGSADTTSIVN  1141

Query  3686  HFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
             HFR  V   D  LFKNLL+EIATL+K+ N SFW+LK EY++
Sbjct  1142  HFRDSVSYDDRPLFKNLLREIATLEKDQNRSFWVLKSEYKD  1182



>ref|XP_004967913.1| PREDICTED: DNA repair protein rhp26-like isoform X1 [Setaria 
italica]
Length=1212

 Score =  1357 bits (3512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/1240 (60%), Positives = 920/1240 (74%), Gaps = 51/1240 (4%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSM-ELEATEHNATSST  331
             M+E+++D+ L  SLGVTSAN EDIE+ I  Q +       E   +  + E ++     + 
Sbjct  1     MDEEDDDQRLLHSLGVTSANIEDIEKKILSQAQADLKNDTEQGTTANDNEESDAGVPEAD  60

Query  332   KKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQS----TTQ  499
              +  ++ KLR+V+ EI AV S  ++ ++     +QV   + G  K   + +Q     T Q
Sbjct  61    TQAKLHQKLRSVQLEIDAVASTIKRAKH--AAGKQVDSSDSGDAKDKKKQKQKHADHTAQ  118

Query  500   APlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRD  679
                +   LQ+ALA +RLKSL K KAQ++KEIS        D      D  K++  A+L  
Sbjct  119   DDPHGGALQQALATERLKSLKKAKAQIQKEISQ------SDPCLSGSDKRKDKMLAML--  170

Query  680   VVKGQPKPKRR-LkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRK  856
              V+ +PK K++ L  ++ P K    R+KT S +DDDDFDAVL+ AS+GF+ETE+++L+RK
Sbjct  171   -VEEEPKRKKKTLLPSRGPKKMSAPRLKTMSYNDDDDFDAVLDGASAGFMETEREELIRK  229

Query  857   GILTPFHKLKGFERQIQEPGQSSRHSMQDNGDLV-----STSLANAIQSISEAAQSRPTT  1021
             G+LTPFHKLKGFE++++ PG S  H   D  D V     ++ +A   QS+ + AQSRPTT
Sbjct  230   GLLTPFHKLKGFEKRVELPGPS--HMQNDPTDQVEETMEASRIAKFAQSMQQIAQSRPTT  287

Query  1022  KLLDSSLLPKLEPPTYPFQTPRKHVK-----ISQSAENGRNDKRKRRPTPGKKWRVKVSR  1186
             KLLD   LPKL+ PT PFQ   + +K      S+  E  R   + +RP P KKWR   S 
Sbjct  288   KLLDPESLPKLDAPTTPFQRLGRPLKRPVSPSSEEQEKKRRRNKTKRPLPDKKWRKANSN  347

Query  1187  -----ENKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGV  1351
                  E  DE      +S  +++D      +G P V+LEGGL+IP T++D+LFDYQKVGV
Sbjct  348   KESLLETDDEDDGDIAASVSEDEDQAAEGFDGLPPVILEGGLRIPGTVYDQLFDYQKVGV  407

Query  1352  QWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAK  1531
             QWLWELHCQ+AGGIIGDEMGLGKTVQVL FLGSLH S  YKPSI++CP+TLLQQWKREA 
Sbjct  408   QWLWELHCQRAGGIIGDEMGLGKTVQVLTFLGSLHNSGMYKPSIVICPVTLLQQWKREAS  467

Query  1532  KWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINH  1711
             +WYP F V+ILHDS N  + K K     +S++  +   +         +  KKWD LI+ 
Sbjct  468   RWYPKFKVKILHDSANGSNKKSKAYSDSDSEASWDGDQEEIRRA----KPAKKWDDLISS  523

Query  1712  VLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRII  1891
             V+ S SGLL+TTYEQLR+LGEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRII
Sbjct  524   VINSGSGLLLTTYEQLRILGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRII  583

Query  1892  MTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAV  2071
             MTG+PIQNKLSELWSLFDFVFPGKLGVLPVFE EF+VPI++GGYANATPLQVSTAYRCAV
Sbjct  584   MTGAPIQNKLSELWSLFDFVFPGKLGVLPVFETEFSVPITVGGYANATPLQVSTAYRCAV  643

Query  2072  VLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKN  2251
             VLRD+IMPYLLRRMKADVNAQLPKKTEHV+FCSLT  QR+ Y+AFLAS++VEQIFDG++N
Sbjct  644   VLRDIIMPYLLRRMKADVNAQLPKKTEHVLFCSLTPEQRATYRAFLASSEVEQIFDGNRN  703

Query  2252  ALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQ  2431
             +LYGIDV+RKICNHPDLLEREH+ ++PDYGNPERSGKMKVV +VL++WKDQGHRVL F+Q
Sbjct  704   SLYGIDVLRKICNHPDLLEREHAAQNPDYGNPERSGKMKVVEQVLRVWKDQGHRVLLFTQ  763

Query  2432  TQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNL  2611
             TQQMLDILENFL    Y+YRRMDG TP KQRMALIDEFNNT EIF+FILTT+VGGLGTNL
Sbjct  764   TQQMLDILENFLTACDYQYRRMDGLTPAKQRMALIDEFNNTDEIFVFILTTKVGGLGTNL  823

Query  2612  TGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLT  2791
             TGANR+II+DPDWNPS DMQARERAWRIGQ +DVTVYRLITRGTIEEKVYHRQIYKH LT
Sbjct  824   TGANRIIIYDPDWNPSTDMQARERAWRIGQTRDVTVYRLITRGTIEEKVYHRQIYKHFLT  883

Query  2792  NKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDK  2971
             NK+LKNPQQRR FKARD+KDLF L DD  NGSTE+S+IFSQLSEDVNI  P    Q++  
Sbjct  884   NKVLKNPQQRRFFKARDMKDLFTLQDDEGNGSTETSNIFSQLSEDVNIGVPSEGQQDQVH  943

Query  2972  SIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIV  3151
                T P    +  E +  SG  G  K D N+   DE+++IL++LFDA GIHSA++HDAI+
Sbjct  944   IALTMP----STSEAEPPSGVKG--KVDENSDQADEESNILKSLFDAQGIHSAINHDAIM  997

Query  3152  NAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFG  3331
             NA+D++K++LE +AS+VAQRAAEALRQSRMLRS++S A+PTWTGRSG AGAP S+++KFG
Sbjct  998   NANDDQKVRLEAEASQVAQRAAEALRQSRMLRSRDSFAVPTWTGRSGAAGAPSSVRRKFG  1057

Query  3332  STLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEH  3511
             ST+N QL++SS+P E S   SSR   +  GA  GKA+SSAELLAKIRG +E A SD LE 
Sbjct  1058  STVNSQLISSSQPPETS---SSRSQSLPVGALNGKAMSSAELLAKIRGTREGAASDALE-  1113

Query  3512  QHQFNSGSSSNSRTRAAENGASRPSHGSAGM--QPEVLIRQVCTFIQRKGGSTSSASIVE  3685
              HQ N GS SN     + N     +  +  M  QPEVLIRQ+CTFIQ+ GGS SS SI E
Sbjct  1114  -HQLNGGSGSNHVLGPSGNSGRSSNSSNPSMIVQPEVLIRQLCTFIQQNGGSASSTSITE  1172

Query  3686  HFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             HF+SR+ SKD+ LFKNLLKEIATL++  NG+ W+LKP+Y+
Sbjct  1173  HFKSRIQSKDMLLFKNLLKEIATLQRGANGAMWVLKPDYE  1212



>ref|XP_002886265.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62524.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1181

 Score =  1357 bits (3512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 758/1239 (61%), Positives = 924/1239 (75%), Gaps = 85/1239 (7%)
 Frame = +2

Query  170   EDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTKKTDMY  349
             ED+ L SSLGVTSANPED+E++I  +     D  N+   S+E E  E +   S+   ++ 
Sbjct  2     EDQFLLSSLGVTSANPEDLEQSILDEATKKLD--NDEGGSVE-EKLEGSNLLSSSLNELL  58

Query  350   NKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlndldlqr  529
             NKLRAV+ EI AV S  + ++            E+G + +D E+E        +   LQ 
Sbjct  59    NKLRAVKFEIDAVASTVDHVDEIAA--------ENGSKNKDDESE---VHGLHSGSALQH  107

Query  530   alaadrlKSLLKTKAQLKKEISDL-----SNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQ  694
             ALA DRL+SL K K QL+KE++ L     S+ + HD L  LRD+VKE+P+  L+  +K  
Sbjct  108   ALATDRLRSLKKRKIQLEKELTGLHGQSASSSADHDNL--LRDLVKEKPS--LKRKLKET  163

Query  695   PKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPF  874
              KP RR          + K++K  S  +D DFDAV +AAS+GFVETE+D+LVRKGILTPF
Sbjct  164   QKPSRR----------EGKKVKVVSFREDTDFDAVFDAASAGFVETERDELVRKGILTPF  213

Query  875   HKLKGFERQIQEPGQSSRHSMQDNGDLV-----STSLANAIQSISEAAQSRPTTKLLDSS  1039
             HKL GFER++Q+PG S+  ++ +  D       S S+  A+QS+S AA++RPTTKLLD+ 
Sbjct  214   HKLDGFERRLQQPGPSNSRNLPEGDDENDKSEDSNSIDRAVQSMSLAAKARPTTKLLDAE  273

Query  1040  LLPKLEPPTYPFQTPRKHVKISQSAEN------GRNDKRKRRPTPGKKWRVKVSRENK--  1195
              LPKLEPPT PF+  RK  K   S +N           +K+RP P K WR ++SRE+   
Sbjct  274   DLPKLEPPTAPFRRLRKLYKTPDSPDNEVKKSKAGKKSKKKRPLPEKIWRKRISREDSSL  333

Query  1196  ----DEGPDVEISSYedekddedmddeG--PPFVMLEGGLKIPETIFDKLFDYQKVGVQW  1357
                 DE   +  SS E+E+  +  D +      V LEGGL IPE IF KLF+YQ+VGVQW
Sbjct  334   QESGDERRILTTSSCEEEELADFDDADDNETSSVQLEGGLNIPECIFRKLFEYQRVGVQW  393

Query  1358  LWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKW  1537
             LWELHCQ+AGGIIGDEMGLGKT+QVL+FLGSLHFS  YKPSII+CP+TLL+QW+REA+KW
Sbjct  394   LWELHCQRAGGIIGDEMGLGKTIQVLSFLGSLHFSKMYKPSIIICPVTLLRQWRREAQKW  453

Query  1538  YPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVL  1717
             YP FHVEILHDS  D        +   ++S+ +    VD +     +NTKKWD LIN VL
Sbjct  454   YPDFHVEILHDSAQD--SGHGKGQGKANESDYDSECSVDSDHEQKSKNTKKWDSLINRVL  511

Query  1718  GSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMT  1897
              S+SGLLITTYEQLRL GEKLL+IEWGYAVLDEGHRIRNPN+D+TLVCKQLQTVHRIIMT
Sbjct  512   NSESGLLITTYEQLRLQGEKLLNIEWGYAVLDEGHRIRNPNSDITLVCKQLQTVHRIIMT  571

Query  1898  GSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVL  2077
             G+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANA+PLQVSTAYRCAVVL
Sbjct  572   GAPIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCAVVL  631

Query  2078  RDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNAL  2257
             RDLIMPYLLRRMKADVNA L KKTEHV+FCSLT  QRS Y+AFLAS++VEQI DG++N+L
Sbjct  632   RDLIMPYLLRRMKADVNAHLTKKTEHVLFCSLTVEQRSTYRAFLASSEVEQILDGNRNSL  691

Query  2258  YGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQ  2437
             YGIDVMRKICNHPDLLEREHS ++PDYGNPERSGKMKVVAEVLK+WK QGHRVL FSQTQ
Sbjct  692   YGIDVMRKICNHPDLLEREHSHQNPDYGNPERSGKMKVVAEVLKVWKQQGHRVLLFSQTQ  751

Query  2438  QMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTG  2617
             QMLDILE+FLV   Y YRRMDG TPVKQRMALIDEFNN+ ++F+F+LTT+VGGLGTNLTG
Sbjct  752   QMLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSDDVFVFVLTTKVGGLGTNLTG  811

Query  2618  ANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNK  2797
             ANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKH LTNK
Sbjct  812   ANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLTNK  871

Query  2798  ILKNPQQRRLFKARDLKDLFVLNDDGE-NGSTESSSIFSQLSEDVNITGPQHPDQEKDKS  2974
             ILKNPQQRR FKARD+KDLF+L DDG+ N STE+S+IFSQL+E++NI G Q    +K   
Sbjct  872   ILKNPQQRRFFKARDMKDLFILKDDGDSNASTETSNIFSQLAEEINIVGAQ---SDKKPE  928

Query  2975  IKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVN  3154
               T  A H TA   + +S     E  D     +DE+T+IL++LFDAHGIHSA++HD I+N
Sbjct  929   SATQLALHNTA---EGSSEQTDVETTDKTGEAMDEETNILKSLFDAHGIHSAVNHDTIMN  985

Query  3155  AHD-EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFG  3331
             A+D EEK++LE QAS+VA+RAAEALR+SRMLRS+ES+++PTWTGRSG AGAP S++++FG
Sbjct  986   ANDEEEKMRLEHQASQVARRAAEALRESRMLRSRESISVPTWTGRSGCAGAPSSVRRRFG  1045

Query  3332  STLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEH  3511
             ST+N +L  S    ++ S+I   +NGI+AG S+GKA SSAELL +IRG++E+AI  GLE 
Sbjct  1046  STVNSRLTQSG---DKPSVI---KNGISAGLSSGKAPSSAELLNRIRGSREQAIGVGLEQ  1099

Query  3512  QHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF  3691
                 +  SS                     +QPEVLIR++C+F+Q+KGGS  + SIV HF
Sbjct  1100  LPSSSGSSSR-----------------VGSLQPEVLIRKICSFVQQKGGSADTTSIVNHF  1142

Query  3692  RSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
             R  V   D  LFKNLL+EIATLKK+ N SFW+LK EY++
Sbjct  1143  RDIVSFNDKPLFKNLLREIATLKKDQNRSFWVLKTEYKD  1181



>ref|XP_008673826.1| PREDICTED: DNA repair protein rhp26 [Zea mays]
 ref|XP_008673827.1| PREDICTED: DNA repair protein rhp26 [Zea mays]
 tpg|DAA53885.1| TPA: hypothetical protein ZEAMMB73_561597 [Zea mays]
 gb|AIB04639.1| SNF2 transcription factor, partial [Zea mays]
Length=1198

 Score =  1353 bits (3502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/1236 (60%), Positives = 921/1236 (75%), Gaps = 59/1236 (5%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             M+E+++D+ L  SLGVTSAN EDIE+ I  Q +      +E   +++  +    A     
Sbjct  1     MDEEDDDQRLLHSLGVTSANIEDIEKKILSQVQTEPKRDDEPGAAVDDPSGSSVAPEFDA  60

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
             + +++ KLR+V+ EI AV S  ++ +N            DG +K+  +    T+Q   + 
Sbjct  61    QANLHQKLRSVQLEIDAVASTIKRAKNAS---------VDGQDKKKQKQANHTSQDEPHG  111

Query  515   ldlqralaadrlKSLLKTKAQLKKEI--SD---LSNDSTHDTLSVLRDIVKEQPNAVLRD  679
               LQ+ALA +RLKSL K KAQ++KEI  SD     +D+  D +  +  +V+E+P      
Sbjct  112   GALQQALATERLKSLKKAKAQIQKEILQSDPYPSGSDNRKDKMLAM--LVEEEPR-----  164

Query  680   VVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKG  859
                   + K+ L  A+ P K    R+KT S DDDDDFDAVL+ AS+GF+ETE+++L+RKG
Sbjct  165   ------RKKKSLMPARGPKKTSAPRLKTMSYDDDDDFDAVLDGASAGFMETEREELIRKG  218

Query  860   ILTPFHKLKGFERQIQEPGQSSRH---SMQDNGDLVSTSLANAIQSISEAAQSRPTTKLL  1030
             +LTPFHKLKGFE++++ PG S R    S Q    + ++ +A   QS+ + AQSRPTTKLL
Sbjct  219   LLTPFHKLKGFEKRVELPGPSHRQNDPSEQAEEAIEASRIARVAQSMQQIAQSRPTTKLL  278

Query  1031  DSSLLPKLEPPTYPFQTPRKHVK--ISQSAENGRNDKRKR----RPTPGKKWRVKVSREN  1192
             D   LP+L+ PT PFQ   + +K  +  S+E GR  KR+R    RP P KKWR   SR+ 
Sbjct  279   DPESLPRLDAPTAPFQRLGRPLKRPVPPSSE-GRERKRQRNKTKRPLPDKKWRKANSRKE  337

Query  1193  ---KDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLW  1363
                + +G DV   +    +DD+   + G   V+LEGGL+IP TI+++LFDYQKVGVQWLW
Sbjct  338   SLLETDGEDVGDFATSVSEDDDQAAEGGLSPVILEGGLRIPGTIYEQLFDYQKVGVQWLW  397

Query  1364  ELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYP  1543
             ELHCQ+AGGIIGDEMGLGKTVQVL+FLGSLH S  YKPSI+VCP+TLLQQW+REA +WYP
Sbjct  398   ELHCQRAGGIIGDEMGLGKTVQVLSFLGSLHNSGMYKPSIVVCPVTLLQQWQREASRWYP  457

Query  1544  SFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGS  1723
              F VEILHDS N    K K     +S+   +   +         +  KKWD LI+ V+ S
Sbjct  458   KFKVEILHDSANGSSKKSKAYSDSDSEGSWDSDQEEVRRA----KPAKKWDDLISRVVNS  513

Query  1724  DSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGS  1903
              SGLL+TTYEQLR+LGEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+
Sbjct  514   GSGLLLTTYEQLRILGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGA  573

Query  1904  PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRD  2083
             PIQNKLSELWSLFDFVFPGKLGVLPVFE EF+VPI++GGYANATPLQVSTAYRCA+VLRD
Sbjct  574   PIQNKLSELWSLFDFVFPGKLGVLPVFETEFSVPITVGGYANATPLQVSTAYRCAIVLRD  633

Query  2084  LIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYG  2263
             LIMPYLLRRMK DVNAQLPKKTEHV+FCSLT+ QRS Y+AFLAS++VEQIFDG++N+LYG
Sbjct  634   LIMPYLLRRMKVDVNAQLPKKTEHVLFCSLTAGQRSTYRAFLASSEVEQIFDGNRNSLYG  693

Query  2264  IDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQM  2443
             IDV+RKICNHPDLLEREH+ ++PDYGNPERSGKMKVV +VLK+WKDQGHRVL F+QTQQM
Sbjct  694   IDVLRKICNHPDLLEREHAAQNPDYGNPERSGKMKVVEQVLKVWKDQGHRVLLFTQTQQM  753

Query  2444  LDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGAN  2623
             LDILENFL    Y+YRRMDG TP KQRMALIDEFNNT EIF+FILTT+VGGLGTNLTGAN
Sbjct  754   LDILENFLTACDYQYRRMDGLTPAKQRMALIDEFNNTDEIFVFILTTKVGGLGTNLTGAN  813

Query  2624  RVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKIL  2803
             R+II+DPDWNPS DMQARERAWRIGQ +DV VYRLITRGTIEEKVYHRQIYKH LTNK+L
Sbjct  814   RIIIYDPDWNPSTDMQARERAWRIGQTRDVMVYRLITRGTIEEKVYHRQIYKHFLTNKVL  873

Query  2804  KNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKT  2983
             KNPQQRR FKARD+KDLF L DD  NGSTE+S+IF QLS+DVN+  P    Q +   +  
Sbjct  874   KNPQQRRFFKARDMKDLFTLQDDEGNGSTETSNIFGQLSKDVNVGVPNDGQQHQ---VHI  930

Query  2984  NPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHD  3163
               A   T+    +N G++   K D+N+   DE++SIL++LF A GIHSA++HDAI++A+D
Sbjct  931   ASALSSTSEAEPSNGGNS---KVDDNSDQADEESSILKSLFGAQGIHSAINHDAIMDAND  987

Query  3164  EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLN  3343
             ++K++LE +AS+VAQRAAEALRQSRMLRS +S A+PTWTGRSG AGAP S+++KFGST+N
Sbjct  988   DQKVRLEAEASQVAQRAAEALRQSRMLRSHDSFAVPTWTGRSGAAGAPSSVRRKFGSTVN  1047

Query  3344  PQLVTSSKPLEESSMISSRRNgia-agasagkalssaellakiRGNQERAISDGLEHQHQ  3520
              QL+    P  + S  SS RN     GA +GKALSSAELLAKIRG +E + SD LE  HQ
Sbjct  1048  SQLI----PSSQPSETSSSRNRSLPVGALSGKALSSAELLAKIRGTREASASDALE--HQ  1101

Query  3521  FNSGSSSNSRTRAAENG--ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFR  3694
              N GSSSN  +  + NG  AS P + S  +QPEVLIRQ+CTFIQ  GGS +S SI EHF+
Sbjct  1102  LNVGSSSNLVSSPSGNGGRASNPPNRSMIVQPEVLIRQLCTFIQHNGGSATSTSITEHFK  1161

Query  3695  SRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEY  3802
             SR+ SKD+ LFKNLLKEIATL++   GS W+LKP+Y
Sbjct  1162  SRIQSKDMLLFKNLLKEIATLQRGAEGSVWVLKPDY  1197



>ref|XP_009386580.1| PREDICTED: DNA repair protein rhp26 [Musa acuminata subsp. malaccensis]
Length=1205

 Score =  1349 bits (3491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/1235 (60%), Positives = 910/1235 (74%), Gaps = 52/1235 (4%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             MEE++ED++L SSLG+TSANPEDIER I  Q +N  + ++E   S      +      T+
Sbjct  5     MEEEDEDKLLLSSLGITSANPEDIERKILSQAKNDTNYASEPGESSHDYEPDETGPLPTR  64

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
                +YNKLRA+E EI AV S     +    +     D       + +E       AP ++
Sbjct  65    -VKLYNKLRALEVEIDAVASSIGSAKCIEVDGSGNSDSTSVRGDKPVENIGYDVHAPSSN  123

Query  515   ldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRD-VVKG  691
             L L++ALA DRL+ L K KAQL+KEIS   +       +   DI  E+ N  L D +VK 
Sbjct  124   LCLEQALATDRLRDLKKAKAQLQKEISLFGD------YAFANDIEHEKHNVELLDELVKE  177

Query  692   QPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTP  871
             +PK K + K+    + + K+ +K  + D+D DFD VL+AAS+GF+ETE+D+LVR+GILTP
Sbjct  178   RPKQKPKHKQKLKSNGHSKRPLKAVAYDEDADFDTVLDAASAGFMETERDKLVRRGILTP  237

Query  872   FHKLKGFERQIQEPGQSSRHSMQDNG---DLVSTSLANAIQSISEAAQSRPTTKLLDSSL  1042
             FHKLKGFER++QE G   R  + +     +L STS+A A QSIS+ A +RPTTKLLD+  
Sbjct  238   FHKLKGFERRVQERGPPIRQDVPEEDSTENLASTSIARAAQSISQIALARPTTKLLDAEA  297

Query  1043  LPKLEPPTYPFQT---PRKHVKISQSAE---NGRNDKRKRRPTPGKKWR--------VKV  1180
             LP LEPPT PFQ    P K  + S+  E   N RN KR RRP P K+WR        +  
Sbjct  298   LPALEPPTRPFQRLQGPLKRARSSRKKELDKNERNIKRTRRPGPEKRWRKDDLTNESLDG  357

Query  1181  SRENKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWL  1360
             S E+   G     +S  +E+  ++ +++    V+ EGGLK+P  I+ KLFDYQKVGVQWL
Sbjct  358   SEEDTRRGSS---ASDCEEELQDEAENKDQSSVVFEGGLKMPGAIYSKLFDYQKVGVQWL  414

Query  1361  WELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWY  1540
             WELHCQ+AGGIIGDEMGLGKT+QV++FLG+LHFS  YK SI+VCP+TLL+QW+RE KKWY
Sbjct  415   WELHCQRAGGIIGDEMGLGKTIQVISFLGALHFSKMYKTSIVVCPVTLLRQWQREVKKWY  474

Query  1541  PSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLG  1720
             P F VEILHDS +    +K    S         L           ++T+KWD +I+ ++ 
Sbjct  475   PDFKVEILHDSAHAITKQKLVKSSESDYDSESSLGSDSERP-CPVKSTEKWDYMIDRIVK  533

Query  1721  SDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTG  1900
             S+SGLL+TTYEQLRL+GEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG
Sbjct  534   SESGLLLTTYEQLRLMGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTG  593

Query  1901  SPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLR  2080
             +PIQNKL ELWSLFDFVFPGKLGVLPVFE EFAVPI++GGYANATPLQVSTAYRCAVVLR
Sbjct  594   APIQNKLGELWSLFDFVFPGKLGVLPVFETEFAVPITVGGYANATPLQVSTAYRCAVVLR  653

Query  2081  DLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALY  2260
             DLIMPYLLRRMKADVNAQLPKKTEHV+FCSLT  QRS+Y+AFLAS++VEQIFDG KN+LY
Sbjct  654   DLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTPDQRSVYRAFLASSEVEQIFDGIKNSLY  713

Query  2261  GIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQ  2440
             GIDVMRKICNHPDLLEREH+ ++PDYGN ERSGKMKVV+ +L +WK+QGHRVL F+QTQQ
Sbjct  714   GIDVMRKICNHPDLLEREHAAQNPDYGNIERSGKMKVVSRILNVWKEQGHRVLLFAQTQQ  773

Query  2441  MLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGA  2620
             MLDI+E+FL   GY YRRMDG T VKQRMALIDEFNN+ E+F+FILTT+VGGLGTNLTGA
Sbjct  774   MLDIIESFLTASGYSYRRMDGFTAVKQRMALIDEFNNSEEVFVFILTTKVGGLGTNLTGA  833

Query  2621  NRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKI  2800
             +RVII+DPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH LTNKI
Sbjct  834   DRVIIYDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKI  893

Query  2801  LKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIK  2980
             LKNPQQRR FKARD+KDLF L DD +   TE+S+IFSQLSE++++ G     Q K  S  
Sbjct  894   LKNPQQRRFFKARDMKDLFTLQDD-QGDLTETSNIFSQLSEEIHV-GVTDGYQGKQGS--  949

Query  2981  TNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH  3160
                            S S   E  +  +G  DE+ +IL++LFD HGIHSAM+HDAI+NA+
Sbjct  950   ---------------SPSGIRESTNQIDGGKDEEINILKSLFDVHGIHSAMNHDAIMNAN  994

Query  3161  DEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTL  3340
             ++ K+K+EEQAS+VAQRAA+ALR+SRMLRS+ES A+PTWTGR+G AGAP S + +FGSTL
Sbjct  995   EDFKMKMEEQASQVAQRAAQALRESRMLRSRESFAVPTWTGRAGAAGAPSSTRNRFGSTL  1054

Query  3341  NPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQ  3520
             N QL+   KP E S   +SR  G +AGAS GKALSS ELLA+IRG QERA+SD LE    
Sbjct  1055  NTQLLGPGKPSEGS---ASRPPGFSAGASTGKALSSVELLARIRGTQERAVSDALEQDLD  1111

Query  3521  FNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSR  3700
               S +S++   +   + +++P       QPEVLIRQ+CTFIQ++GGST SASI +HF+ +
Sbjct  1112  LAS-TSNHQHGKPESSHSTKPPSKLVIAQPEVLIRQLCTFIQQRGGSTDSASITQHFKDK  1170

Query  3701  VPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             + SKDL LFKNLLKEIATL+K+ +GS W+LK EYQ
Sbjct  1171  IQSKDLPLFKNLLKEIATLEKDASGSRWVLKSEYQ  1205



>ref|XP_010929631.1| PREDICTED: protein CHROMATIN REMODELING 8 isoform X2 [Elaeis 
guineensis]
Length=1105

 Score =  1347 bits (3487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 711/1108 (64%), Positives = 870/1108 (79%), Gaps = 44/1108 (4%)
 Frame = +2

Query  551   KSLLKTKAQLKKEISDLSNDSTHDTLS---VLRDIVKEQPNAVLRDVVKGQPKPKRRLke  721
             +SL KTKAQL+ EIS L  ++T +      +L D+V+E              K KR+ K 
Sbjct  19    RSLKKTKAQLQNEISKLDENATPEDFGHEKLLADLVEE--------------KCKRKSKA  64

Query  722   akspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFHKLKGFERQ  901
              +  +++ K  +KT + ++D DFDAVL+AAS+GFVETE+D+L+RKGILTPFHK+KGFER+
Sbjct  65    VEQSNRDSKSHLKTVAYNEDADFDAVLDAASTGFVETERDELIRKGILTPFHKIKGFERR  124

Query  902   IQEPGQSSRHSMQDNG--DLVSTSLANAIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPF  1075
             +Q+P  S+RH  +++   D  S S+A   Q IS+AAQ+RP TKLLD+  L  L+ PT+PF
Sbjct  125   VQQPAPSNRHVPEESAAEDHASASIAKVAQLISDAAQNRPATKLLDTVALSGLDAPTHPF  184

Query  1076  Q---TPRKHV---KISQSAENGRNDKRKRRPTPGKKWRVKVSRENKDEGPDVE------I  1219
             Q    P KH    K  +  +  R  +R +RP P KKWR   S+E   +G D +       
Sbjct  185   QRLKAPLKHPVSPKGKELEKKTRKLRRTKRPLPSKKWRKVDSKEKLPDGSDEDSMGDSIA  244

Query  1220  SSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIG  1399
             S Y + +++   D E  P V+LEGGLKIP +I+  LFDYQKVG++WLWELHCQ+AGGIIG
Sbjct  245   SDYGETQEENTDDGEQSP-VILEGGLKIPASIYMNLFDYQKVGMKWLWELHCQRAGGIIG  303

Query  1400  DEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVN  1579
             DEMGLGKTVQV++FLG+LHFS  YKPSI+VCP+TLL+QW+REA+KWYP F VEILHDS +
Sbjct  304   DEMGLGKTVQVISFLGALHFSKMYKPSIVVCPVTLLRQWQREARKWYPDFRVEILHDSAH  363

Query  1580  DFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQL  1759
               + +     S       + L   +     + ++ K+W+ LI+ V+ S+SGLL+TTYEQL
Sbjct  364   GLNKQTVAKSSESDYDSEDSLDSDNERPRPA-KSVKRWNDLIDRVVQSESGLLLTTYEQL  422

Query  1760  RLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSL  1939
             R+LGEKLLDIEWGYA+LDEGHRIRNPN +VTLVCKQLQTVHRIIMTG+PIQNKLSELWSL
Sbjct  423   RILGEKLLDIEWGYAILDEGHRIRNPNAEVTLVCKQLQTVHRIIMTGAPIQNKLSELWSL  482

Query  1940  FDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKA  2119
             FDFVFPGKLGVLPVFE EFAVPI++GGYANATPLQVSTAYRCAVVLRDLI PYLLRRMKA
Sbjct  483   FDFVFPGKLGVLPVFETEFAVPITVGGYANATPLQVSTAYRCAVVLRDLITPYLLRRMKA  542

Query  2120  DVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPD  2299
             DVNAQLPKKTEHV+FCSLTS QRS+Y+AFLAS++VEQIF+GS+N+LYGID+MRKICNHPD
Sbjct  543   DVNAQLPKKTEHVLFCSLTSDQRSVYRAFLASSEVEQIFEGSRNSLYGIDIMRKICNHPD  602

Query  2300  LLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGG  2479
             LLEREHS   PDYGNPERSGKMKVVA+VL++WK+Q HRVL F+QTQQMLDILENFL   G
Sbjct  603   LLEREHSALHPDYGNPERSGKMKVVAQVLRVWKEQEHRVLLFAQTQQMLDILENFLAASG  662

Query  2480  YKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
             Y YRRMDG TP+KQRMALIDEFNN+ ++FIFILTT+VGGLGTNLTGA+RVII+DPDWNPS
Sbjct  663   YSYRRMDGLTPIKQRMALIDEFNNSSDVFIFILTTKVGGLGTNLTGADRVIIYDPDWNPS  722

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH LTNKILKNPQQRR FKA+
Sbjct  723   TDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKILKNPQQRRFFKAK  782

Query  2840  DLKDLFVLNDDGENGSTESSSIFSQLSEDVNI-TGPQHPDQEKDKSIKTNPA----DHGT  3004
             D+KDLF L DD E GSTE+S+IFSQLSE+VN+  G  + D++   +  T P     +  +
Sbjct  783   DMKDLFTLQDDREGGSTETSNIFSQLSEEVNVGVGNGYQDKQGSSAASTAPVVPAKETNS  842

Query  3005  AMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLE  3184
                  ++S S G+E A   NG++DE+T+IL++LFDAHGIHSAM+HDAI+NA+D++K++LE
Sbjct  843   PGLGASSSNSKGKEIAGQRNGEIDEETNILKSLFDAHGIHSAMNHDAILNANDDDKMRLE  902

Query  3185  EQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSS  3364
             EQASRVA+RAAEALR+SR LRS++S ++PTWTGRSG AGAP SI++KFGST+N Q++  S
Sbjct  903   EQASRVARRAAEALRESRRLRSRDSFSVPTWTGRSGAAGAPSSIRRKFGSTINTQMLGPS  962

Query  3365  KPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSN  3544
             KP E S   +SR  G+AAGAS GKALSSAELLA+IRG QERA+ D LE     +  SSSN
Sbjct  963   KPSEGS---ASRPPGLAAGASTGKALSSAELLARIRGTQERAVGDALE--QDLDLASSSN  1017

Query  3545  SRTRAAENG-ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLA  3721
              R    EN  AS+PSH    +QPE+LIRQ+CTFIQ++GG T SASI +HF+ R+ SKDL 
Sbjct  1018  QRESIPENTVASKPSHRYMVVQPEILIRQLCTFIQQRGGQTDSASITQHFKDRIQSKDLP  1077

Query  3722  LFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             LFKNLLKEIA L+K+  GS W+LKPEYQ
Sbjct  1078  LFKNLLKEIAALEKDAGGSRWVLKPEYQ  1105



>ref|XP_010929632.1| PREDICTED: protein CHROMATIN REMODELING 8 isoform X3 [Elaeis 
guineensis]
Length=1104

 Score =  1346 bits (3484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 711/1108 (64%), Positives = 870/1108 (79%), Gaps = 44/1108 (4%)
 Frame = +2

Query  551   KSLLKTKAQLKKEISDLSNDSTHDTLS---VLRDIVKEQPNAVLRDVVKGQPKPKRRLke  721
             +SL KTKAQL+ EIS L  ++T +      +L D+V+E              K KR+ K 
Sbjct  18    RSLKKTKAQLQNEISKLDENATPEDFGHEKLLADLVEE--------------KCKRKSKA  63

Query  722   akspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFHKLKGFERQ  901
              +  +++ K  +KT + ++D DFDAVL+AAS+GFVETE+D+L+RKGILTPFHK+KGFER+
Sbjct  64    VEQSNRDSKSHLKTVAYNEDADFDAVLDAASTGFVETERDELIRKGILTPFHKIKGFERR  123

Query  902   IQEPGQSSRHSMQDNG--DLVSTSLANAIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPF  1075
             +Q+P  S+RH  +++   D  S S+A   Q IS+AAQ+RP TKLLD+  L  L+ PT+PF
Sbjct  124   VQQPAPSNRHVPEESAAEDHASASIAKVAQLISDAAQNRPATKLLDTVALSGLDAPTHPF  183

Query  1076  Q---TPRKHV---KISQSAENGRNDKRKRRPTPGKKWRVKVSRENKDEGPDVE------I  1219
             Q    P KH    K  +  +  R  +R +RP P KKWR   S+E   +G D +       
Sbjct  184   QRLKAPLKHPVSPKGKELEKKTRKLRRTKRPLPSKKWRKVDSKEKLPDGSDEDSMGDSIA  243

Query  1220  SSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIG  1399
             S Y + +++   D E  P V+LEGGLKIP +I+  LFDYQKVG++WLWELHCQ+AGGIIG
Sbjct  244   SDYGETQEENTDDGEQSP-VILEGGLKIPASIYMNLFDYQKVGMKWLWELHCQRAGGIIG  302

Query  1400  DEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVN  1579
             DEMGLGKTVQV++FLG+LHFS  YKPSI+VCP+TLL+QW+REA+KWYP F VEILHDS +
Sbjct  303   DEMGLGKTVQVISFLGALHFSKMYKPSIVVCPVTLLRQWQREARKWYPDFRVEILHDSAH  362

Query  1580  DFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQL  1759
               + +     S       + L   +     + ++ K+W+ LI+ V+ S+SGLL+TTYEQL
Sbjct  363   GLNKQTVAKSSESDYDSEDSLDSDNERPRPA-KSVKRWNDLIDRVVQSESGLLLTTYEQL  421

Query  1760  RLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSL  1939
             R+LGEKLLDIEWGYA+LDEGHRIRNPN +VTLVCKQLQTVHRIIMTG+PIQNKLSELWSL
Sbjct  422   RILGEKLLDIEWGYAILDEGHRIRNPNAEVTLVCKQLQTVHRIIMTGAPIQNKLSELWSL  481

Query  1940  FDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKA  2119
             FDFVFPGKLGVLPVFE EFAVPI++GGYANATPLQVSTAYRCAVVLRDLI PYLLRRMKA
Sbjct  482   FDFVFPGKLGVLPVFETEFAVPITVGGYANATPLQVSTAYRCAVVLRDLITPYLLRRMKA  541

Query  2120  DVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPD  2299
             DVNAQLPKKTEHV+FCSLTS QRS+Y+AFLAS++VEQIF+GS+N+LYGID+MRKICNHPD
Sbjct  542   DVNAQLPKKTEHVLFCSLTSDQRSVYRAFLASSEVEQIFEGSRNSLYGIDIMRKICNHPD  601

Query  2300  LLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGG  2479
             LLEREHS   PDYGNPERSGKMKVVA+VL++WK+Q HRVL F+QTQQMLDILENFL   G
Sbjct  602   LLEREHSALHPDYGNPERSGKMKVVAQVLRVWKEQEHRVLLFAQTQQMLDILENFLAASG  661

Query  2480  YKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
             Y YRRMDG TP+KQRMALIDEFNN+ ++FIFILTT+VGGLGTNLTGA+RVII+DPDWNPS
Sbjct  662   YSYRRMDGLTPIKQRMALIDEFNNSSDVFIFILTTKVGGLGTNLTGADRVIIYDPDWNPS  721

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH LTNKILKNPQQRR FKA+
Sbjct  722   TDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKILKNPQQRRFFKAK  781

Query  2840  DLKDLFVLNDDGENGSTESSSIFSQLSEDVNI-TGPQHPDQEKDKSIKTNPA----DHGT  3004
             D+KDLF L DD E GSTE+S+IFSQLSE+VN+  G  + D++   +  T P     +  +
Sbjct  782   DMKDLFTLQDDREGGSTETSNIFSQLSEEVNVGVGNGYQDKQGSSAASTAPVVPAKETNS  841

Query  3005  AMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLE  3184
                  ++S S G+E A   NG++DE+T+IL++LFDAHGIHSAM+HDAI+NA+D++K++LE
Sbjct  842   PGLGASSSNSKGKEIAGQRNGEIDEETNILKSLFDAHGIHSAMNHDAILNANDDDKMRLE  901

Query  3185  EQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSS  3364
             EQASRVA+RAAEALR+SR LRS++S ++PTWTGRSG AGAP SI++KFGST+N Q++  S
Sbjct  902   EQASRVARRAAEALRESRRLRSRDSFSVPTWTGRSGAAGAPSSIRRKFGSTINTQMLGPS  961

Query  3365  KPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSN  3544
             KP E S   +SR  G+AAGAS GKALSSAELLA+IRG QERA+ D LE     +  SSSN
Sbjct  962   KPSEGS---ASRPPGLAAGASTGKALSSAELLARIRGTQERAVGDALE--QDLDLASSSN  1016

Query  3545  SRTRAAENG-ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLA  3721
              R    EN  AS+PSH    +QPE+LIRQ+CTFIQ++GG T SASI +HF+ R+ SKDL 
Sbjct  1017  QRESIPENTVASKPSHRYMVVQPEILIRQLCTFIQQRGGQTDSASITQHFKDRIQSKDLP  1076

Query  3722  LFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             LFKNLLKEIA L+K+  GS W+LKPEYQ
Sbjct  1077  LFKNLLKEIAALEKDAGGSRWVLKPEYQ  1104



>ref|XP_010467713.1| PREDICTED: protein CHROMATIN REMODELING 8-like isoform X1 [Camelina 
sativa]
 ref|XP_010467714.1| PREDICTED: protein CHROMATIN REMODELING 8-like isoform X1 [Camelina 
sativa]
 ref|XP_010467715.1| PREDICTED: protein CHROMATIN REMODELING 8-like isoform X1 [Camelina 
sativa]
Length=1178

 Score =  1345 bits (3482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 759/1246 (61%), Positives = 937/1246 (75%), Gaps = 96/1246 (8%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             MEEDE D+ L SSLGVTSANPED+E+ I  +     D  ++   S+E ++ +     S++
Sbjct  1     MEEDE-DQFLLSSLGVTSANPEDLEQTILDEATKKLD--HDEGGSVEEQSIKKKLEGSSQ  57

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
               ++ NKLRAV+ EI AV S  E ++     DE    ++DG ++ D++   S +      
Sbjct  58    -NELLNKLRAVKFEIDAVASTVEHVDEV--ADENGLLQKDGGDESDVQGLHSGS------  108

Query  515   ldlqralaadrlKSLLKTKAQLKKEISDL----SNDSTHDTLSVLRDIVKEQPNAVLRDV  682
               LQ ALA DRLKSL + K QL++E + L    ++ S+ D  ++LR++VKE+        
Sbjct  109   -VLQHALATDRLKSLKRRKVQLEEEFAALHGQSASTSSADRDNLLRELVKEK--------  159

Query  683   VKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGI  862
              K +P  KR+L E + PS+   K++K  S  +D DFDA+  AAS+GFVETE+D+LVRKGI
Sbjct  160   TKKKPSLKRKLIETRKPSRRDGKKVKVVSFHEDTDFDAIFQAASTGFVETERDELVRKGI  219

Query  863   LTPFHKLKGFERQIQEPGQSSRHSM--QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDS  1036
             LTPFHKL GFER++Q+PG S+  ++   D+ +  S S+  A+QS+S AA++RPTTKLLD+
Sbjct  220   LTPFHKLDGFERRLQQPGPSNSRNLPEGDHENEDSGSIDRAVQSMSLAAKARPTTKLLDA  279

Query  1037  SLLPKLEPPTYPFQTPRKHVKISQSAEN------GRNDKRKRRPTPGKKWRVKVSREN--  1192
               LPKLEP   PF+  RK  K    ++N       R   +K+RP P  KWR ++SRE+  
Sbjct  280   QDLPKLEPNPAPFRRLRKLYKTHDYSDNEVKKSKARKKSKKKRPLPESKWRKRISREDSS  339

Query  1193  ----KDEGPDVEISSYedekddedmddeG--PPFVMLEGGLKIPETIFDKLFDYQKVGVQ  1354
                 +D G  +  SS E+E  D+  D +      + LEGGL IP+ IF  LF+YQ+VGVQ
Sbjct  340   LQESEDGGRILATSSCEEEDLDDLDDADENETSSIQLEGGLNIPQCIFRNLFEYQRVGVQ  399

Query  1355  WLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKK  1534
             WLWELHCQ+AGGIIGDEMGLGKTVQVL+FLGSLHFS  YKPSII+CP+TLL+QW+REA+K
Sbjct  400   WLWELHCQRAGGIIGDEMGLGKTVQVLSFLGSLHFSKMYKPSIIICPVTLLRQWRREAQK  459

Query  1535  WYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHV  1714
             WYP FHVE+LHDS  D  + K   K+ ESD +SE  +D D E+  S +NTKKWD LIN V
Sbjct  460   WYPDFHVELLHDSAKDSGNGKGQGKASESDYDSECSVDSDHEQKKS-KNTKKWDSLINRV  518

Query  1715  LGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIM  1894
             L S+SGLLITTYEQLRL GEKLL+IEWGYAVLDEGHRIRNPN+D+TLVCKQLQTVHRIIM
Sbjct  519   LNSESGLLITTYEQLRLQGEKLLNIEWGYAVLDEGHRIRNPNSDITLVCKQLQTVHRIIM  578

Query  1895  TGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVV  2074
             TG+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANA+PLQVSTAYRCAVV
Sbjct  579   TGAPIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCAVV  638

Query  2075  LRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNA  2254
             LRD+IMPYLLRRMKADVNA L KKTEHV+FCSLT  QRS Y+AFLAS++VE IFDG+KN+
Sbjct  639   LRDMIMPYLLRRMKADVNAHLTKKTEHVLFCSLTVEQRSTYRAFLASSEVEDIFDGNKNS  698

Query  2255  LYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQT  2434
             LYGIDVMRKICNHPDLLEREHS ++PDYGNPERSGKMKV AEVLK+WK QGHRVL FSQT
Sbjct  699   LYGIDVMRKICNHPDLLEREHSHQNPDYGNPERSGKMKVAAEVLKVWKQQGHRVLLFSQT  758

Query  2435  QQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLT  2614
             QQMLDILE+FLV   Y YRRMDG TPVKQRMALIDEFNN+ ++F+F+LTT+VGGLGTNLT
Sbjct  759   QQMLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSDDVFVFVLTTKVGGLGTNLT  818

Query  2615  GANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTN  2794
             GANRVIIFDPDWNPSNDMQARERAWRIGQKKDVT+YRLITRGTIEEKVYHRQIYKH LTN
Sbjct  819   GANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTIYRLITRGTIEEKVYHRQIYKHFLTN  878

Query  2795  KILKNPQQRRLFKARDLKDLFVLNDDGE-NGSTESSSIFSQLSEDVNITGPQHPDQEKDK  2971
             KILKNPQQRR FKARD+KDLF+L DDG+ N STE+S+IFSQL+E++NI G Q        
Sbjct  879   KILKNPQQRRFFKARDMKDLFILKDDGDSNASTETSNIFSQLAEEINIVGVQ--------  930

Query  2972  SIKTNPADHGTAMERDNNSGSNGEEKADNNNGD-----VDEDTSILRTLFDAHGIHSAMD  3136
                             +N+     E+AD +  D     +DE+T+IL++LFDAHGIHSA++
Sbjct  931   ---------------SDNTAEGSSEQADVDTTDKTGEAMDEETNILKSLFDAHGIHSAVN  975

Query  3137  HDAIVNAHD-EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPS  3313
             HDAI+NA+D EEK++LE QAS+VA+RAAEALRQSRMLRS+ES+++PTWTGRSG AGAP S
Sbjct  976   HDAIINANDEEEKMRLEHQASQVARRAAEALRQSRMLRSRESISVPTWTGRSGCAGAPSS  1035

Query  3314  IKKKFGSTLNPQLV-TSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERA  3490
             ++++FGST+N +L  T  KP    S+I   +NGI+AG S+GKA ++AELL +IRG++E+A
Sbjct  1036  VRRRFGSTVNSRLTQTGDKP----SVI---KNGISAGLSSGKAPTAAELLNRIRGSREQA  1088

Query  3491  ISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSS  3670
             I  G E     +SGSSS   +                +QPE+LIRQ+C+F+QRKGGS  +
Sbjct  1089  IGVGNESSLPSSSGSSSRVGS----------------LQPEILIRQICSFVQRKGGSADT  1132

Query  3671  ASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
              SIV HFR  V   D  LFKNLL+EIATL+KN N S W+LK EY++
Sbjct  1133  TSIVNHFRDSVSCDDKPLFKNLLREIATLEKNQNRSVWVLKSEYKD  1178



>ref|XP_010489593.1| PREDICTED: protein CHROMATIN REMODELING 8 isoform X1 [Camelina 
sativa]
 ref|XP_010489594.1| PREDICTED: protein CHROMATIN REMODELING 8 isoform X1 [Camelina 
sativa]
Length=1182

 Score =  1345 bits (3481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 761/1250 (61%), Positives = 937/1250 (75%), Gaps = 100/1250 (8%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             MEEDE D+ L SSLGVTSANPED+E+ I  +     D  ++   S+E ++ + N   S +
Sbjct  1     MEEDE-DQFLLSSLGVTSANPEDLEQTILDEATKKLD--HDEGGSVEEQSIKKNLEGSNQ  57

Query  335   ----KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQA  502
                 + ++ NKLRAV+ EI AV S  E ++       +V +     +K D   ++S    
Sbjct  58    LPSSQNELLNKLRAVKFEIDAVASTVEHVD-------EVANENGLLQKHD---DESDVHG  107

Query  503   PlndldlqralaadrlKSLLKTKAQLKKEISDL----SNDSTHDTLSVLRDIVKEQPNAV  670
               +   LQ ALA DRL+SL K K QL+KE + L    ++ S+ D  ++LR++VKE+    
Sbjct  108   LHSGSVLQHALATDRLRSLKKRKFQLEKEFAALHGQSASTSSADRENLLRELVKEKKTK-  166

Query  671   LRDVVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLV  850
                    +P  KR+L E + PS+   K++K  S  +D DFDA+  AAS+GFVETE+D+LV
Sbjct  167   -------KPSLKRKLVETRKPSRRDGKKVKVVSFHEDTDFDAIFEAASAGFVETERDELV  219

Query  851   RKGILTPFHKLKGFERQIQEPGQSSRHSM--QDNGDLVSTSLANAIQSISEAAQSRPTTK  1024
             RKGILTPFHKL GFER++Q+PG S+  ++   D+ +  S S+  A+QS+S AA++RPTT 
Sbjct  220   RKGILTPFHKLDGFERRLQQPGPSNSRNLPEGDHENEDSGSIDRAVQSMSLAAKARPTTM  279

Query  1025  LLDSSLLPKLEPPTYPFQTPRKHVKISQSAEN------GRNDKRKRRPTPGKKWRVKVSR  1186
             LLD+  LPKLEP   PF+  RK  K   S++N          ++K+RP P  KWR ++SR
Sbjct  280   LLDAEDLPKLEPNPAPFRRLRKLYKTHDSSDNEAKKSKAGKKRKKKRPLPESKWRKRISR  339

Query  1187  EN------KDEGPDVEISSYedekddedmddeG--PPFVMLEGGLKIPETIFDKLFDYQK  1342
             E+      +D G  +  SS E+E  D+  D +      + LEGGL IP+ IF  LF+YQ+
Sbjct  340   EDSSLQESEDGGRILATSSCEEEDLDDLDDADDNETSSIQLEGGLNIPQCIFRNLFEYQR  399

Query  1343  VGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKR  1522
             VGVQWLWELHCQ+AGGIIGDEMGLGKTVQVL+FLGSLHFS  YKPSII+CP+TLL+QW+R
Sbjct  400   VGVQWLWELHCQRAGGIIGDEMGLGKTVQVLSFLGSLHFSKMYKPSIIICPVTLLRQWRR  459

Query  1523  EAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKL  1702
             EA+KWYP FHVE+LHDS  D  + K   K+ ESD +SE  +D D E+  S +NTKKWD L
Sbjct  460   EAQKWYPDFHVELLHDSAKDSGNGKGQGKASESDYDSECSVDSDHEQKRS-KNTKKWDSL  518

Query  1703  INHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVH  1882
             IN VL S+SGLLITTYEQLRL GEKLL+IEWGYAVLDEGHRIRNPN+D+TLVCKQLQTVH
Sbjct  519   INRVLNSESGLLITTYEQLRLQGEKLLNIEWGYAVLDEGHRIRNPNSDITLVCKQLQTVH  578

Query  1883  RIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYR  2062
             RIIMTG+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANA+PLQVSTAYR
Sbjct  579   RIIMTGAPIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYR  638

Query  2063  CAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDG  2242
             CAVVLRD+IMPYLLRRMKADVNA L KKTEHV+FCSLT  QRS Y+AFLAS++VE+IFDG
Sbjct  639   CAVVLRDMIMPYLLRRMKADVNAHLTKKTEHVLFCSLTVEQRSTYRAFLASSEVEEIFDG  698

Query  2243  SKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLF  2422
             +KN+LYGIDVMRKICNHPDLLEREHS ++PDYGNPERSGKMKVVAEVLK+WK QGHRVL 
Sbjct  699   NKNSLYGIDVMRKICNHPDLLEREHSHQNPDYGNPERSGKMKVVAEVLKVWKQQGHRVLL  758

Query  2423  FSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLG  2602
             FSQTQQMLDILE+FLV   Y YRRMDG TPVKQRMALIDEFNN+ ++F+F+LTT+VGGLG
Sbjct  759   FSQTQQMLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSDDVFVFVLTTKVGGLG  818

Query  2603  TNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKH  2782
             TNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVT+YRLITRGTIEEKVYHRQIYKH
Sbjct  819   TNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTIYRLITRGTIEEKVYHRQIYKH  878

Query  2783  SLTNKILKNPQQRRLFKARDLKDLFVLNDDGE-NGSTESSSIFSQLSEDVNITGPQHPDQ  2959
              LTNKILKNPQQRR FKARD+KDLF+L DDG+ N STE+S+IFSQL+E++NI G Q    
Sbjct  879   FLTNKILKNPQQRRFFKARDMKDLFILKDDGDSNASTETSNIFSQLAEEINIVGVQ----  934

Query  2960  EKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGD-----VDEDTSILRTLFDAHGIH  3124
                                 +N+     E+AD +  D     +DE+T+IL++LFDAHGIH
Sbjct  935   -------------------SDNTAEGSSEQADVDTTDKTGEAMDEETNILKSLFDAHGIH  975

Query  3125  SAMDHDAIVNAHD-EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAG  3301
             SA++HDAI+NA+D EEK++LE QAS+VA+RAAEALRQSRMLRS+ES+++PTWTGRSG AG
Sbjct  976   SAVNHDAIMNANDEEEKMRLEHQASQVARRAAEALRQSRMLRSRESISVPTWTGRSGCAG  1035

Query  3302  APPSIKKKFGSTLNPQLV-TSSKPLEESSMISSRRNgiaagasagkalssaellakiRGN  3478
             AP S++++FGST+N +L  T  KP    S+I   +NGI+AG S+GKA +SAELL +IRG+
Sbjct  1036  APSSVRRRFGSTVNSRLTQTGDKP----SVI---KNGISAGLSSGKAPTSAELLNRIRGS  1088

Query  3479  QERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGG  3658
             +E+AI  G E     +SGSSS   +                +QPEVLIRQ+C+F+QRKGG
Sbjct  1089  REQAIGVGNESSLTSSSGSSSRVGS----------------LQPEVLIRQICSFVQRKGG  1132

Query  3659  STSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
             S  + SIV HFR  V   D  LFKNLL+EIATL+KN N SFW+LK EY++
Sbjct  1133  SADTTSIVNHFRDSVSCDDKPLFKNLLREIATLEKNQNRSFWVLKSEYKD  1182



>ref|XP_010467716.1| PREDICTED: protein CHROMATIN REMODELING 8-like isoform X2 [Camelina 
sativa]
Length=1177

 Score =  1345 bits (3481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 759/1245 (61%), Positives = 936/1245 (75%), Gaps = 95/1245 (8%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             MEEDE D+ L SSLGVTSANPED+E+ I  +     D  ++   S+E ++ +     S++
Sbjct  1     MEEDE-DQFLLSSLGVTSANPEDLEQTILDEATKKLD--HDEGGSVEEQSIKKKLEGSSQ  57

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
               ++ NKLRAV+ EI AV S  E ++     DE    ++DG ++ D++   S +      
Sbjct  58    -NELLNKLRAVKFEIDAVASTVEHVDEV--ADENGLLQKDGGDESDVQGLHSGS------  108

Query  515   ldlqralaadrlKSLLKTKAQLKKEISDL----SNDSTHDTLSVLRDIVKEQPNAVLRDV  682
               LQ ALA DRLKSL + K QL++E + L    ++ S+ D  ++LR++VKE+        
Sbjct  109   -VLQHALATDRLKSLKRRKVQLEEEFAALHGQSASTSSADRDNLLRELVKEK--------  159

Query  683   VKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGI  862
              K +P  KR+L E + PS+   K++K  S  +D DFDA+  AAS+GFVETE+D+LVRKGI
Sbjct  160   TKKKPSLKRKLIETRKPSRRDGKKVKVVSFHEDTDFDAIFQAASTGFVETERDELVRKGI  219

Query  863   LTPFHKLKGFERQIQEPGQSSRHSM--QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDS  1036
             LTPFHKL GFER++Q+PG S+  ++   D+ +  S S+  A+QS+S AA++RPTTKLLD+
Sbjct  220   LTPFHKLDGFERRLQQPGPSNSRNLPEGDHENEDSGSIDRAVQSMSLAAKARPTTKLLDA  279

Query  1037  SLLPKLEPPTYPFQTPRKHVKISQSAEN------GRNDKRKRRPTPGKKWRVKVSRENK-  1195
               LPKLEP   PF+  RK  K    ++N       R   +K+RP P  KWR ++SRE+  
Sbjct  280   QDLPKLEPNPAPFRRLRKLYKTHDYSDNEVKKSKARKKSKKKRPLPESKWRKRISREDSS  339

Query  1196  ----DEGPDVEISSYedekddedmddeG--PPFVMLEGGLKIPETIFDKLFDYQKVGVQW  1357
                 D G  +  SS E+E  D+  D +      + LEGGL IP+ IF  LF+YQ+VGVQW
Sbjct  340   LQESDGGRILATSSCEEEDLDDLDDADENETSSIQLEGGLNIPQCIFRNLFEYQRVGVQW  399

Query  1358  LWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKW  1537
             LWELHCQ+AGGIIGDEMGLGKTVQVL+FLGSLHFS  YKPSII+CP+TLL+QW+REA+KW
Sbjct  400   LWELHCQRAGGIIGDEMGLGKTVQVLSFLGSLHFSKMYKPSIIICPVTLLRQWRREAQKW  459

Query  1538  YPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVL  1717
             YP FHVE+LHDS  D  + K   K+ ESD +SE  +D D E+  S +NTKKWD LIN VL
Sbjct  460   YPDFHVELLHDSAKDSGNGKGQGKASESDYDSECSVDSDHEQKKS-KNTKKWDSLINRVL  518

Query  1718  GSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMT  1897
              S+SGLLITTYEQLRL GEKLL+IEWGYAVLDEGHRIRNPN+D+TLVCKQLQTVHRIIMT
Sbjct  519   NSESGLLITTYEQLRLQGEKLLNIEWGYAVLDEGHRIRNPNSDITLVCKQLQTVHRIIMT  578

Query  1898  GSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVL  2077
             G+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANA+PLQVSTAYRCAVVL
Sbjct  579   GAPIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCAVVL  638

Query  2078  RDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNAL  2257
             RD+IMPYLLRRMKADVNA L KKTEHV+FCSLT  QRS Y+AFLAS++VE IFDG+KN+L
Sbjct  639   RDMIMPYLLRRMKADVNAHLTKKTEHVLFCSLTVEQRSTYRAFLASSEVEDIFDGNKNSL  698

Query  2258  YGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQ  2437
             YGIDVMRKICNHPDLLEREHS ++PDYGNPERSGKMKV AEVLK+WK QGHRVL FSQTQ
Sbjct  699   YGIDVMRKICNHPDLLEREHSHQNPDYGNPERSGKMKVAAEVLKVWKQQGHRVLLFSQTQ  758

Query  2438  QMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTG  2617
             QMLDILE+FLV   Y YRRMDG TPVKQRMALIDEFNN+ ++F+F+LTT+VGGLGTNLTG
Sbjct  759   QMLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSDDVFVFVLTTKVGGLGTNLTG  818

Query  2618  ANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNK  2797
             ANRVIIFDPDWNPSNDMQARERAWRIGQKKDVT+YRLITRGTIEEKVYHRQIYKH LTNK
Sbjct  819   ANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTIYRLITRGTIEEKVYHRQIYKHFLTNK  878

Query  2798  ILKNPQQRRLFKARDLKDLFVLNDDGE-NGSTESSSIFSQLSEDVNITGPQHPDQEKDKS  2974
             ILKNPQQRR FKARD+KDLF+L DDG+ N STE+S+IFSQL+E++NI G Q         
Sbjct  879   ILKNPQQRRFFKARDMKDLFILKDDGDSNASTETSNIFSQLAEEINIVGVQ---------  929

Query  2975  IKTNPADHGTAMERDNNSGSNGEEKADNNNGD-----VDEDTSILRTLFDAHGIHSAMDH  3139
                            +N+     E+AD +  D     +DE+T+IL++LFDAHGIHSA++H
Sbjct  930   --------------SDNTAEGSSEQADVDTTDKTGEAMDEETNILKSLFDAHGIHSAVNH  975

Query  3140  DAIVNAHD-EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSI  3316
             DAI+NA+D EEK++LE QAS+VA+RAAEALRQSRMLRS+ES+++PTWTGRSG AGAP S+
Sbjct  976   DAIINANDEEEKMRLEHQASQVARRAAEALRQSRMLRSRESISVPTWTGRSGCAGAPSSV  1035

Query  3317  KKKFGSTLNPQLV-TSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAI  3493
             +++FGST+N +L  T  KP    S+I   +NGI+AG S+GKA ++AELL +IRG++E+AI
Sbjct  1036  RRRFGSTVNSRLTQTGDKP----SVI---KNGISAGLSSGKAPTAAELLNRIRGSREQAI  1088

Query  3494  SDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSA  3673
               G E     +SGSSS   +                +QPE+LIRQ+C+F+QRKGGS  + 
Sbjct  1089  GVGNESSLPSSSGSSSRVGS----------------LQPEILIRQICSFVQRKGGSADTT  1132

Query  3674  SIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
             SIV HFR  V   D  LFKNLL+EIATL+KN N S W+LK EY++
Sbjct  1133  SIVNHFRDSVSCDDKPLFKNLLREIATLEKNQNRSVWVLKSEYKD  1177



>ref|XP_010230474.1| PREDICTED: protein CHROMATIN REMODELING 8 [Brachypodium distachyon]
Length=1207

 Score =  1343 bits (3476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 736/1239 (59%), Positives = 911/1239 (74%), Gaps = 54/1239 (4%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             MEED++D+ L  SLGVTSAN +DIER I  + +       E   S  L   +        
Sbjct  1     MEEDDDDQRLLHSLGVTSANIDDIERKILSEAKTDPKHDTE---SCVLADGDQETLQGDP  57

Query  335   KTDMYNKLRAVETEIQAVKS---GFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
             +  ++ KLR+V+ EI AV S   G +     +       D ED  + +  E      Q  
Sbjct  58    QAKLHQKLRSVQLEIDAVASTIGGAKPTVGKKSRGLDSADAEDKKKGKRKENADGIAQDA  117

Query  506   lndldlqralaadrlKSLLKTKAQLKKEI--SDLSNDST-HDTLSVLRDIVKEQPNAVLR  676
              +   LQ+ALAA+RL+SL + KAQ++++I  SD    S+ + T  +L  +V+E+P    +
Sbjct  118   PHRGALQQALAAERLRSLKRAKAQIQRDILQSDSGPSSSGNQTDKMLAMLVEEEPRRKKK  177

Query  677   DVVKGQ-PKPK--RRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQL  847
              ++  + PK K  RRLK              T + +DD+DFDAVL+ AS+G +ETE+++L
Sbjct  178   SLMPPRGPKVKSPRRLK--------------TVTYNDDNDFDAVLDGASAGLMETEREEL  223

Query  848   VRKGILTPFHKLKGFERQIQEPGQSSRH---SMQDNGDLVSTSLANAIQSISEAAQSRPT  1018
             +RKG+LTPFHKLKGFE++++ PG S R    + Q    + ++S+A   Q++ + AQ+RPT
Sbjct  224   IRKGLLTPFHKLKGFEKRVERPGPSGRQHNSAEQTEETMEASSIAKVAQAMQKMAQNRPT  283

Query  1019  TKLLDSSLLPKLEPPTYPFQ---TPRKHVKISQSAENG--RNDKRKRRPTPGKKWRVKVS  1183
             TKLLD   LP+L+ PT PFQ    P K      S + G  R   + +RP PGK+WR   S
Sbjct  284   TKLLDPESLPRLDAPTAPFQRLGMPLKRPASPSSDKQGNKRQKSKTKRPLPGKQWRKANS  343

Query  1184  RENK---DEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQ  1354
             R+     DE      +S  + +D+     +G P V+LEGGL+IP +I+ +LFDYQKVGVQ
Sbjct  344   RKESLFDDEDVGDTAASASENEDEVIEGSDGLPPVILEGGLRIPGSIYTQLFDYQKVGVQ  403

Query  1355  WLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKK  1534
             WLWELHCQ+AGGIIGDEMGLGKTVQVL+FLGSLH S  YK SI+VCP+TLL+QW+REA K
Sbjct  404   WLWELHCQRAGGIIGDEMGLGKTVQVLSFLGSLHESGMYKSSIVVCPVTLLEQWRREASK  463

Query  1535  WYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHV  1714
             WYP F VEILHDS N    K K S   ESD  S+   +         +  KKWD LI+ V
Sbjct  464   WYPKFKVEILHDSANGSSKKAKRSSDSESDFCSDSDQEEVTRA----KPAKKWDALISRV  519

Query  1715  LGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIM  1894
             + S SGLL+TTYEQLR++ +KLLDIEWGYAVLDEGHRIRNPN +VTLVCKQLQTVHRIIM
Sbjct  520   VNSGSGLLLTTYEQLRIMRDKLLDIEWGYAVLDEGHRIRNPNAEVTLVCKQLQTVHRIIM  579

Query  1895  TGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVV  2074
             TG+PIQNKLSELWSLFDFVFPGKLGVLPVFE EF+VPI +GGYANATPLQVSTAYRCAVV
Sbjct  580   TGAPIQNKLSELWSLFDFVFPGKLGVLPVFEIEFSVPIKVGGYANATPLQVSTAYRCAVV  639

Query  2075  LRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNA  2254
             LRDLIMPYLLRRMKADVNAQLPKKTEHV+FCSLT  QR+ Y+AFLAS++VEQIFDG++N+
Sbjct  640   LRDLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTPEQRATYRAFLASSEVEQIFDGNRNS  699

Query  2255  LYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQT  2434
             LYGIDV+RKICNHPDLLEREH+ +DPDYGNPERSGKMKVV +VLK+WKDQGHRVL F+QT
Sbjct  700   LYGIDVLRKICNHPDLLEREHAAQDPDYGNPERSGKMKVVEQVLKVWKDQGHRVLLFAQT  759

Query  2435  QQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLT  2614
             QQMLDILENFL    Y YRRMDG TP KQRMALIDEFNNT EIFIFILTT+VGGLGTNLT
Sbjct  760   QQMLDILENFLTACDYPYRRMDGLTPAKQRMALIDEFNNTDEIFIFILTTKVGGLGTNLT  819

Query  2615  GANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTN  2794
             GANRVIIFDPDWNPS DMQARERAWRIGQ +DVTVYRLITRGTIEEKVYHRQIYKH LTN
Sbjct  820   GANRVIIFDPDWNPSTDMQARERAWRIGQTRDVTVYRLITRGTIEEKVYHRQIYKHFLTN  879

Query  2795  KILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKS  2974
             K+LKNPQQRR FKARD+KDLF L D+  NGSTE+S+IF QLSEDV+I  P   D+++ + 
Sbjct  880   KVLKNPQQRRFFKARDMKDLFTLQDEDMNGSTETSNIFGQLSEDVHIRAPN--DEQRSEL  937

Query  2975  IKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVN  3154
                 P    T+ E +  S   G+ K D N+   DE+++IL++LF+A GIHSA++HDAI++
Sbjct  938   SSALP----TSTEAEPCSSGRGKGKVDPNSDQADEESNILKSLFEAQGIHSAINHDAIMS  993

Query  3155  AHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGS  3334
             A+D++K++ E +AS+VAQRAAEALRQSRMLRS++S A+PTWTGR+G AGAP S+++KFGS
Sbjct  994   ANDDQKVREEAEASQVAQRAAEALRQSRMLRSRDSFAVPTWTGRAGAAGAPSSVRRKFGS  1053

Query  3335  TLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQ  3514
             TLN QLV+SS+P   S   +S+   +  GA  GKALSSAELLAKIRG +E A SD LE  
Sbjct  1054  TLNSQLVSSSQP---SGSPNSKVQSLQVGALNGKALSSAELLAKIRGTREGAASDALE--  1108

Query  3515  HQFNSGSSSNSRTRAAENGASRPSHGSAGM--QPEVLIRQVCTFIQRKGGSTSSASIVEH  3688
             HQ ++G +SN  +  + NG    S G   M  QPEVLIRQ+CTFIQ+ GGS SS S+ EH
Sbjct  1109  HQLSTGPASNQISGPSVNGRVTNSSGRNNMIVQPEVLIRQLCTFIQQNGGSASSTSLTEH  1168

Query  3689  FRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             F++R+  KD+ +FKNLLKEIATL++  +G+ W+LKP+Y+
Sbjct  1169  FKNRIQPKDMLVFKNLLKEIATLQRGASGASWVLKPDYE  1207



>gb|EMS54331.1| DNA repair and recombination protein RAD26 [Triticum urartu]
Length=1236

 Score =  1338 bits (3462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 738/1274 (58%), Positives = 905/1274 (71%), Gaps = 97/1274 (8%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQ---------------TENGFDASNEA---  280
             MEE+++ + L  SLGVTSAN +DIER I  Q               T N F   + A   
Sbjct  1     MEEEDDYQRLLHSLGVTSANIDDIERKILSQATIHPFIRFLPVHNKTSNNFSQGHAAFHF  60

Query  281   ------------ARSMELEAT-EHNATSSTKKTD----MYNKLRAVETEIQAVKSGFEQL  409
                         A +  L A  +  A  +T + D    ++ KLR+V+ EI AV S     
Sbjct  61    LLQAKTDPKKGDAEASGLTAVGDQEAKLTTPQDDVQAKLHQKLRSVQLEIDAVASTLG--  118

Query  410   ENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlndldlqralaadrlKSLLKTKAQLKKE  589
                    +Q   ++ G   +  E E +   AP      Q   A    +SL + K Q+++E
Sbjct  119   -----GAKQAAGKKSGGGVK--EEENADEDAPRGGALQQALAAERL-RSLKRAKVQIQRE  170

Query  590   I---SDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQPK---PKRRLkeakspsknkkk  751
             I     + + S +    +L  +V ++P         G PK   P RRLK           
Sbjct  171   ILQSGPVPSGSGNQKDKMLAMLVDDEPRRKKSLKPPGGPKKKSPTRRLK-----------  219

Query  752   rikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRH  931
                T + DDDDDFDAVL+ AS+GF+ETE+++L+RKG+LTPFHKLKGFE++++ PG SSR 
Sbjct  220   ---TVTYDDDDDFDAVLDGASAGFMETEREELIRKGLLTPFHKLKGFEKRVERPGTSSRQ  276

Query  932   ---SMQDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQ---TPRKH  1093
                + Q    + ++++A   Q++   AQ+RPTTKLLD+  LPKLE PT PFQ    P K 
Sbjct  277   NDSAEQAEETMEASTIAKVAQAMQNMAQNRPTTKLLDAEFLPKLEAPTAPFQRLGVPLKR  336

Query  1094  VKISQSAE--NGRNDKRKRRPTPGKKWRVKVSRE-------NKDEGPDVEISSYedekdd  1246
               +  S E  N R   + +RP PGKKW    S++       ++D G     +S  + +D+
Sbjct  337   PGLPSSEERKNKRLKSKTKRPLPGKKWMKANSKKESLLDVTDEDVGDAAASASVSENEDE  396

Query  1247  edmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTV  1426
                  +G P V+LEGGL+IP +++ +LFDYQKVGVQWLWELHCQ+AGGIIGDEMGLGKTV
Sbjct  397   VIEGSDGLPPVILEGGLRIPGSVYTQLFDYQKVGVQWLWELHCQRAGGIIGDEMGLGKTV  456

Query  1427  QVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgs  1606
             QVL+FLG+LH S  YKPSI++CP+TLLQQW+REA KWYP F VEILHDS N    K K  
Sbjct  457   QVLSFLGALHDSGMYKPSIVICPVTLLQQWRREASKWYPKFKVEILHDSANSSSKKGKRY  516

Query  1607  kshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLD  1786
                ESD   +   +         +  +KWD LI+ V+ S SGLL+TTYEQLR++ EKLLD
Sbjct  517   SDSESDVSWDSDQEEVTRT----KPAQKWDDLISRVVNSGSGLLLTTYEQLRIIREKLLD  572

Query  1787  IEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKL  1966
             +EWGYAVLDEGHRIRNPN +VTLVCKQLQTVHRIIMTG+PIQNKLSELWSLFDFVFPGKL
Sbjct  573   VEWGYAVLDEGHRIRNPNAEVTLVCKQLQTVHRIIMTGAPIQNKLSELWSLFDFVFPGKL  632

Query  1967  GVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKK  2146
             GVLPVFE EF+VPI++GGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKK
Sbjct  633   GVLPVFETEFSVPITVGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKK  692

Query  2147  TEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCR  2326
             TE V+FCSLT  QRS Y+AFLAS++VEQIFDG++N+LYGIDV+RKICNHPDLLERE + +
Sbjct  693   TEQVLFCSLTQEQRSTYRAFLASSEVEQIFDGNRNSLYGIDVLRKICNHPDLLEREQAAQ  752

Query  2327  DPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGA  2506
             +PDYGN ERSGKMKVV +VLK+WKDQGHRVL F+QTQQMLDILENFL    Y+YRRMDG 
Sbjct  753   NPDYGNIERSGKMKVVEQVLKVWKDQGHRVLLFAQTQQMLDILENFLTARDYQYRRMDGL  812

Query  2507  TPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERA  2686
             TP KQRMALIDEFNNT EIFIFILTT+VGGLGTNLTGANRVIIFDPDWNPS DMQARERA
Sbjct  813   TPPKQRMALIDEFNNTDEIFIFILTTKVGGLGTNLTGANRVIIFDPDWNPSTDMQARERA  872

Query  2687  WRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLN  2866
             WRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH LTNK+LKNPQQRR FKARD+KDLF L 
Sbjct  873   WRIGQKRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKVLKNPQQRRFFKARDMKDLFTLQ  932

Query  2867  DDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEE  3046
             DD +NGSTE+S+IF QLSEDVNI  P    +E+ +     P    T+ E + +   NG  
Sbjct  933   DDDKNGSTETSNIFGQLSEDVNIGAPD--GEERGEGSSALP----TSAEAEPSVDGNG--  984

Query  3047  KADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEAL  3226
             K+D  +   DE+++IL++LFD  G+HSA++HDAI++A+D++KL+LE +AS+VAQRAAEAL
Sbjct  985   KSDLRSDQADEESNILKSLFDGQGVHSAINHDAIMSANDDQKLRLEAEASQVAQRAAEAL  1044

Query  3227  RQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRN  3406
             RQSRMLRS++  A+PTWTGR+G AGAP S+++KFGSTLN QLV+SS+P  E S  SSR  
Sbjct  1045  RQSRMLRSRDDFAVPTWTGRAGAAGAPTSVRRKFGSTLNTQLVSSSQP-SEGSNSSSRVQ  1103

Query  3407  giaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPS  3586
              +  GA  GKALSSAELLAK+RG +E A SD LE  HQ + GS+SN R    ENG +  S
Sbjct  1104  SLQVGALHGKALSSAELLAKMRGTREGAASDALE--HQLSLGSASNQRPGLTENGRTSNS  1161

Query  3587  HGSAGM--QPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLK  3760
             + S  M  QPEVLIRQ+CTFIQ  GGS SS S+ EHF++ +  KD+ +FKNLLKEIATL+
Sbjct  1162  NSSRNMIVQPEVLIRQLCTFIQHNGGSASSTSLTEHFKNSIQPKDMLVFKNLLKEIATLQ  1221

Query  3761  KNPNGSFWILKPEY  3802
             +   G+ W+LKPEY
Sbjct  1222  RGAGGTTWVLKPEY  1235



>ref|XP_006643635.1| PREDICTED: DNA repair protein rhp26-like [Oryza brachyantha]
Length=1176

 Score =  1336 bits (3457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 734/1234 (59%), Positives = 914/1234 (74%), Gaps = 75/1234 (6%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTK  334
             ME+D++D+ L  SLGVTSA+  DIER I  Q                   T+    + ++
Sbjct  1     MEDDDDDQRLLHSLGVTSADIHDIERKIISQA-----------------TTDPAQPTISQ  43

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
             +  +++KLR+V+ EI AV S  +  +     ++  P  + G   +DI T     Q     
Sbjct  44    QPHLHHKLRSVQLEIDAVASTIKGSKLAEPGNK--PQEDKG---KDIATHGGDLQ-----  93

Query  515   ldlqralaadrlKSLLKTKAQLKKEI--SDLSNDSTHDTLSVLRDIVKEQP--NAVLRDV  682
                 +ALAA+RL SL K KAQ++K+I  SD S   ++   ++L  +V+E+P    +L+  
Sbjct  94    ----QALAAERLTSLKKAKAQIQKQILQSDTSPSGSNRKDNMLAFLVEEEPRRKKLLKPP  149

Query  683   VKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGI  862
             V  +   KRRLK              T + DDD+DFDAVL+ AS+GF+ETE+++L+RKG+
Sbjct  150   VGPKKTVKRRLK--------------TVTYDDDNDFDAVLDGASAGFMETEREELIRKGL  195

Query  863   LTPFHKLKGFERQIQ--EPGQSSRHSMQDNGDLV--STSLANAIQSISEAAQSRPTTKLL  1030
             LTPFHKLKGFE++++  EP Q    S +   + +  ++ +A   QS+ + AQ+RP TKLL
Sbjct  196   LTPFHKLKGFEKRVELHEPSQRQDDSARQTEEAIMEASRIARVAQSLQQIAQNRPATKLL  255

Query  1031  DSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRK-----RRPTPGKKWRVKVSRENK  1195
             D+  LPKL+ P  PFQ   + +K   S  + + +K++     +RP P KKWR   SR+  
Sbjct  256   DAESLPKLDAPAAPFQRLGRPLKRPVSPSSDQQEKKRPRNKTKRPLPAKKWRKANSRKLD  315

Query  1196  DEGPDVEISSYedekddedmddeG---PPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWE  1366
             D   DV  +S    +DDED   EG    P V LEGGL+IP TI+ +LFDYQKVGVQWLWE
Sbjct  316   DN--DVGDASASVSEDDEDQVAEGFDELPDVTLEGGLRIPGTIYSQLFDYQKVGVQWLWE  373

Query  1367  LHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPS  1546
             LHCQ+AGGIIGDEMGLGKTVQVL FLGSLH S  YKPSI+VCP+TLLQQW+REA +WYP 
Sbjct  374   LHCQRAGGIIGDEMGLGKTVQVLTFLGSLHNSGLYKPSIVVCPVTLLQQWRREASRWYPK  433

Query  1547  FHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSD  1726
             F VEILHDS N    K K     +S++  +  L+ +       +  KKWD LI+ ++ S 
Sbjct  434   FKVEILHDSANSSAKKSKRYSDSDSEASWDSDLEEEEVARA--KPAKKWDDLISRIVNSG  491

Query  1727  SGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSP  1906
             SGLL+TTYEQLR+LGEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+P
Sbjct  492   SGLLLTTYEQLRILGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAP  551

Query  1907  IQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDL  2086
             IQNKLSELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANATPLQVSTAYRCAVVLRDL
Sbjct  552   IQNKLSELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANATPLQVSTAYRCAVVLRDL  611

Query  2087  IMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGI  2266
             +MPYLLRRMKADVNAQLPKKTEHV+FCSLT  QR+ Y+AFLAS++VEQIFDG++N+LYGI
Sbjct  612   VMPYLLRRMKADVNAQLPKKTEHVLFCSLTHEQRATYRAFLASSEVEQIFDGNRNSLYGI  671

Query  2267  DVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQML  2446
             DV+RKICNHPDLLEREH+ ++PDYGNPERSGKMKVV +VL +WK+QGHRVL F+QTQQML
Sbjct  672   DVLRKICNHPDLLEREHAAQNPDYGNPERSGKMKVVEKVLTVWKEQGHRVLLFTQTQQML  731

Query  2447  DILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANR  2626
             DI+ENFL    Y+YRRMDG TP KQRMALIDEFNNT EIFIFILTT+VGGLGTNLTGANR
Sbjct  732   DIIENFLTACDYQYRRMDGLTPAKQRMALIDEFNNTDEIFIFILTTKVGGLGTNLTGANR  791

Query  2627  VIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILK  2806
             +II+DPDWNPS DMQARERAWRIGQ +DVTVYRLITRGTIEEKVYHRQIYKH LTNK+LK
Sbjct  792   IIIYDPDWNPSTDMQARERAWRIGQTRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKVLK  851

Query  2807  NPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTN  2986
             +PQQRR FKARD+KDLF L DD  NGSTE+S+IFSQLSEDVNI  P    Q+        
Sbjct  852   DPQQRRFFKARDMKDLFTLQDDDSNGSTETSNIFSQLSEDVNIGVPSDKQQDHHCEPSAT  911

Query  2987  PADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDE  3166
             P   GT    + +S  + + K D+++   DE+ +IL++LFDA GIHSA++HDAI+NA+D+
Sbjct  912   PTIAGT----EPSSSRHEQGKEDHSSDQADEECNILKSLFDAQGIHSAINHDAIMNANDD  967

Query  3167  EKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNP  3346
              KL+LE +A++VAQRAAEALRQSRMLRS+ES ++PTWTGR+G AGAP S+++KFGS LN 
Sbjct  968   RKLRLEAEATQVAQRAAEALRQSRMLRSRESFSVPTWTGRAGAAGAPSSVRRKFGSALNS  1027

Query  3347  QLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFN  3526
             QL+ SS+P   S  ++ R   +  GA  GKALSSAELLA+IRG +E A SD LE  HQ N
Sbjct  1028  QLIGSSQP---SETLNRRGQSLQVGALNGKALSSAELLARIRGTREGAASDALE--HQLN  1082

Query  3527  SGSSSNSRTRAAENGASRPSHGSAGM-QPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRV  3703
              GS+SN  + ++ENG +  S   + + QPEVLIRQ+CTFIQ+ GGS +S SI EHF++R+
Sbjct  1083  LGSASNHTSSSSENGRASSSSTRSTIVQPEVLIRQLCTFIQQHGGSANSTSITEHFKNRI  1142

Query  3704  PSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
              SKD+ LFKNLLKEIATL++  +G+ W+LKPEYQ
Sbjct  1143  LSKDMLLFKNLLKEIATLQRGADGATWVLKPEYQ  1176



>emb|CDX92882.1| BnaC07g41400D [Brassica napus]
Length=1129

 Score =  1335 bits (3454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 756/1236 (61%), Positives = 919/1236 (74%), Gaps = 128/1236 (10%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTKKT  340
             E+EEDR L SSLGVTSANP DIE+ I  +     D  N+ +    LE T     S   ++
Sbjct  2     EEEEDRFL-SSLGVTSANPADIEQTILDEATKKLD--NDESVEERLEGTNLLPPS---QS  55

Query  341   DMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlndld  520
             ++ NKLRAV+ EI AV S  EQ E            EDG +   +               
Sbjct  56    ELLNKLRAVKFEIDAVASTVEQAEE-----------EDGLQSGSV---------------  89

Query  521   lqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQPK  700
             LQ ALA DRL+SL K K +L+KE+S L         +   D+         RD+VKG+P 
Sbjct  90    LQNALAKDRLRSLGKRKNELEKELSGLHGQGGTSGGADRGDMQ--------RDLVKGEPS  141

Query  701   PKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFHK  880
              KR+LKE + PSK + K++K  S  +D DFDAV +AAS+GFVETE+D+LVRKGILTPFHK
Sbjct  142   LKRKLKEVRKPSKREGKKVKVVSFHEDTDFDAVFDAASAGFVETERDELVRKGILTPFHK  201

Query  881   LKGFERQIQEPGQSSRHSM----QDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSSLLP  1048
             L+GFER++Q+PG S+  ++     DN D  S+S+  A+QS+S AA++RPTTKLLD+  LP
Sbjct  202   LEGFERRLQQPGPSNSRNLPEGEDDNED--SSSIDRAVQSMSLAAKARPTTKLLDAQDLP  259

Query  1049  KLEPPTYPFQTPRKHVKISQSAENG-----RNDKRKRRPTPGKKWRVKVSREN-----KD  1198
             KLEP   PF+  RK  K + S+++          +K+RP P +KW  ++S E+      +
Sbjct  260   KLEPTPVPFRRLRKLYKTNDSSDSDAKKSEGGKGKKKRPLPKRKWTKRISNEDSSLQENE  319

Query  1199  EGPDVEISS---YedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWEL  1369
             +G  +  +S    E+  D +++DD    FV LEGGL IPE IF KLFDYQ+VGVQWLWEL
Sbjct  320   DGRRISATSSCEEEELDDFDEVDDSEKSFVPLEGGLNIPEGIFIKLFDYQRVGVQWLWEL  379

Query  1370  HCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSF  1549
             HCQKAGGIIGDEMGLGKTVQVL+FLGSLHFS  YKPSI++CP+TLL+QW+REA+    S 
Sbjct  380   HCQKAGGIIGDEMGLGKTVQVLSFLGSLHFSKMYKPSIVICPVTLLRQWRREARTCEVS-  438

Query  1550  HVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDS  1729
              V+  H+  +                                +NTKKW  LIN VL SDS
Sbjct  439   -VDGDHEQKS--------------------------------KNTKKWSSLINRVLNSDS  465

Query  1730  GLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPI  1909
             GLLITTYEQLRL GEKLL+IEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PI
Sbjct  466   GLLITTYEQLRLHGEKLLNIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPI  525

Query  1910  QNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLI  2089
             QNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANA+PLQVSTAYRCAVVLRDLI
Sbjct  526   QNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCAVVLRDLI  585

Query  2090  MPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGID  2269
             MPYLLRRMKADVNA L KKTEHV+FCSLT  QRS Y+AFLAS++VE IFDG+KN+LYGID
Sbjct  586   MPYLLRRMKADVNAHLTKKTEHVLFCSLTVEQRSTYRAFLASSEVEDIFDGNKNSLYGID  645

Query  2270  VMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLD  2449
             VMRKICNHPDLLEREHS ++PDYGNPERSGKMKVVAEVLK+WK QGHRVL FSQTQQMLD
Sbjct  646   VMRKICNHPDLLEREHSHQNPDYGNPERSGKMKVVAEVLKVWKQQGHRVLLFSQTQQMLD  705

Query  2450  ILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRV  2629
             ILE+FLV   Y YRRMDG TPVKQRMALIDEFNN+ ++F+F+LTT+VGGLGTNLTGANRV
Sbjct  706   ILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSDDVFVFVLTTKVGGLGTNLTGANRV  765

Query  2630  IIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKN  2809
             IIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKH LTN+ILKN
Sbjct  766   IIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLTNRILKN  825

Query  2810  PQQRRLFKARDLKDLFVLNDDGE-NGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTN  2986
             PQQRR FKARD+KDLF+LNDDG+ N STE+S+IFSQLSED+NI G Q  +        T+
Sbjct  826   PQQRRFFKARDMKDLFILNDDGDSNASTETSNIFSQLSEDINIVGAQTEN--------TS  877

Query  2987  PADHGTAME-RDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHD  3163
               D  T ++  D     +GE+ A+ N   VDE+T+IL++LFDAHGIHSA++HDAI+NA+D
Sbjct  878   TTDSTTQLDTHDAAEELSGEKDAETNGEPVDEETNILKSLFDAHGIHSAVNHDAIINAND  937

Query  3164  -EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTL  3340
              EEK++LE QAS+VAQRAAEALRQSRMLRS+ES+++PTWTGRSG AGAP S++++FGST+
Sbjct  938   EEEKMRLEHQASQVAQRAAEALRQSRMLRSRESISVPTWTGRSGCAGAPSSVRRRFGSTV  997

Query  3341  NPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQ  3520
             N +L T+ K        S+ +NGI+AG S+GKA SSAELL KIRG++E+AI  GLE    
Sbjct  998   NSRLTTADKS-------STVKNGISAGLSSGKAPSSAELLNKIRGSREQAIGVGLE----  1046

Query  3521  FNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSR  3700
                      +T+++ + +SR       +QPEVLIRQ+C+F+QRKGGST ++SIV HF  R
Sbjct  1047  ---------QTQSSSSSSSR----VGSLQPEVLIRQICSFVQRKGGSTDTSSIVNHFSDR  1093

Query  3701  VPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
             V +KD+ LFK+LLKEIATL+K+PNGS W+LKPEY++
Sbjct  1094  VLAKDVPLFKSLLKEIATLRKDPNGSVWVLKPEYKD  1129



>ref|NP_001041752.1| Os01g0102800 [Oryza sativa Japonica Group]
 dbj|BAB62641.1| putative DNA repair and recombination protein [Oryza sativa Japonica 
Group]
 dbj|BAB92143.1| putative DNA repair and recombination protein [Oryza sativa Japonica 
Group]
 dbj|BAD04853.1| Cockayne syndrome group B [Oryza sativa Japonica Group]
 dbj|BAF03666.1| Os01g0102800 [Oryza sativa Japonica Group]
Length=1187

 Score =  1334 bits (3453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 738/1231 (60%), Positives = 915/1231 (74%), Gaps = 58/1231 (5%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQ-TENGFDASNEAARSMELEATEHNATSST  331
             ME+D++D+ L  SLGVTSA+  DIER I  Q T +  D+S             H    + 
Sbjct  1     MEDDDDDQRLLHSLGVTSADIHDIERRIISQATTDPADSSGPTING------GHQPDDAL  54

Query  332   KKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPln  511
              K  +++KLR+V+ EI AV S  +  +  ++     P    G ++ D        QA   
Sbjct  55    AK--LHHKLRSVQIEIDAVASTIKGAK-LKQPSGNKPHEHKGKDQPDHHGAGHLQQA---  108

Query  512   dldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKG  691
                    LAADRL SL K KAQ++KEI       +H + S        + + +L  +V+ 
Sbjct  109   -------LAADRLTSLRKAKAQIQKEIL-----QSHPSPSA-----SNRKDKMLAMLVQD  151

Query  692   QPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTP  871
             +P+ K+       P    K+ +KT + DDD++FDAVL+ AS+GF+ETE+++L+RKG+LTP
Sbjct  152   EPRHKK---PPVGPKNIVKRPMKTVTYDDDNNFDAVLDGASAGFMETEREELIRKGLLTP  208

Query  872   FHKLKGFERQIQEPGQSSRH---SMQDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSSL  1042
             FHKLKGFE++++ P  S R    + Q    + ++ +A   QS+ + AQ+RP TKLLDS  
Sbjct  209   FHKLKGFEKRVELPEPSHRQDDSAGQTEEAMEASRIARVAQSLKQIAQNRPATKLLDSES  268

Query  1043  LPKLEPPTYPFQTPRKHVK--ISQSA---ENGRNDKRKRRPTPGKKWR----VKVSRENK  1195
             LPKL+ P  PFQ   K +K  +S S+   E  R   + +RP PGKKWR    +K S  + 
Sbjct  269   LPKLDAPAAPFQRLGKPLKRPVSPSSDEQEKKRPRNKTKRPLPGKKWRKANSIKESSLDD  328

Query  1196  DEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHC  1375
             ++  +  +S  +D++D      +    V LEGGL+IP T++ +LFDYQKVGVQWLWELHC
Sbjct  329   NDVGEAAVSVSDDDEDQVTEGSDELTDVTLEGGLRIPGTLYTQLFDYQKVGVQWLWELHC  388

Query  1376  QKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHV  1555
             Q+AGGIIGDEMGLGKTVQVL+FLGSLH S  YKPSI+VCP+TLLQQW+REA +WYP F V
Sbjct  389   QRAGGIIGDEMGLGKTVQVLSFLGSLHNSGLYKPSIVVCPVTLLQQWRREASRWYPKFKV  448

Query  1556  EILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGL  1735
             EILHDS N    K K S   +S++  +   +  V  +   +  KKWD LI+ V+ S SGL
Sbjct  449   EILHDSANSSSKKSKRSSDSDSEASWDSDQEEAVTCS---KPAKKWDDLISRVVSSGSGL  505

Query  1736  LITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQN  1915
             L+TTYEQLR+LGEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PIQN
Sbjct  506   LLTTYEQLRILGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQN  565

Query  1916  KLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMP  2095
             KLSELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANATPLQVSTAYRCAVVLRDL+MP
Sbjct  566   KLSELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANATPLQVSTAYRCAVVLRDLVMP  625

Query  2096  YLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVM  2275
             YLLRRMKADVNAQLPKKTEHV+FCSLT+ QR+ Y+AFLAS++VEQIFDG++N+LYGIDV+
Sbjct  626   YLLRRMKADVNAQLPKKTEHVLFCSLTTEQRATYRAFLASSEVEQIFDGNRNSLYGIDVL  685

Query  2276  RKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDIL  2455
             RKICNHPDLLEREH+ ++PDYGNPERSGKMKVV +VLK+WK+QGHRVL F+QTQQMLDI+
Sbjct  686   RKICNHPDLLEREHAAQNPDYGNPERSGKMKVVEQVLKVWKEQGHRVLLFTQTQQMLDIM  745

Query  2456  ENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVII  2635
             ENFL    Y+YRRMDG TP KQRMALIDEFNNT EIFIFILTT+VGGLGTNLTGANR+II
Sbjct  746   ENFLTACEYQYRRMDGLTPAKQRMALIDEFNNTDEIFIFILTTKVGGLGTNLTGANRIII  805

Query  2636  FDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQ  2815
             +DPDWNPS DMQARERAWRIGQ +DVTVYRLITRGTIEEKVYHRQIYKH LTNK+LK+PQ
Sbjct  806   YDPDWNPSTDMQARERAWRIGQTRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKVLKDPQ  865

Query  2816  QRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPAD  2995
             QRR FKARD+KDLF L DD  NGSTE+S+IFSQLSEDVNI  P    Q++  +    P  
Sbjct  866   QRRFFKARDMKDLFTLQDDDNNGSTETSNIFSQLSEDVNIGVPSDKQQDQLYAASATPTT  925

Query  2996  HGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKL  3175
              GT    + +S  +G+ K D+     DE+ +IL++LFDA GIHSA++HDAI+NA+D++KL
Sbjct  926   SGT----EPSSSRHGQGKEDHCPDQADEECNILKSLFDAQGIHSAINHDAIMNANDDQKL  981

Query  3176  KLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLV  3355
             +LE +A++VAQRAAEALRQSRMLRS ES ++PTWTGR+G AGAP S+++KFGSTLN QLV
Sbjct  982   RLEAEATQVAQRAAEALRQSRMLRSHESFSVPTWTGRAGAAGAPSSVRRKFGSTLNTQLV  1041

Query  3356  TSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGS  3535
              SS+P E S   + R   +  GA  GKALSSAELLA+IRG +E A SD LE  HQ N GS
Sbjct  1042  NSSQPSETS---NGRGQSLQVGALNGKALSSAELLARIRGTREGAASDALE--HQLNLGS  1096

Query  3536  SSNSRTRAAENG-ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSK  3712
             +SN  + ++ NG AS  S  S  +QPEVLIRQ+CTFIQ+ GGS SS SI EHF++R+ SK
Sbjct  1097  ASNHTSSSSGNGRASSSSTRSMIVQPEVLIRQLCTFIQQHGGSASSTSITEHFKNRILSK  1156

Query  3713  DLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             D+ LFKNLLKEIATL++  NG+ W+LKP+YQ
Sbjct  1157  DMLLFKNLLKEIATLQRGANGATWVLKPDYQ  1187



>gb|EEC69769.1| hypothetical protein OsI_00025 [Oryza sativa Indica Group]
 gb|EEE53700.1| hypothetical protein OsJ_00022 [Oryza sativa Japonica Group]
Length=1355

 Score =  1333 bits (3451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 738/1231 (60%), Positives = 915/1231 (74%), Gaps = 58/1231 (5%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQ-TENGFDASNEAARSMELEATEHNATSST  331
             ME+D++D+ L  SLGVTSA+  DIER I  Q T +  D+S             H    + 
Sbjct  169   MEDDDDDQRLLHSLGVTSADIHDIERRIISQATTDPADSSGPTING------GHQPDDAL  222

Query  332   KKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPln  511
              K  +++KLR+V+ EI AV S  +  +  ++     P    G ++ D        QA   
Sbjct  223   AK--LHHKLRSVQIEIDAVASTIKGAK-LKQPSGNKPHEHKGKDQPDHHGAGHLQQA---  276

Query  512   dldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKG  691
                    LAADRL SL K KAQ++KEI       +H + S        + + +L  +V+ 
Sbjct  277   -------LAADRLTSLRKAKAQIQKEIL-----QSHPSPSA-----SNRKDKMLAMLVQD  319

Query  692   QPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTP  871
             +P+ K+       P    K+ +KT + DDD++FDAVL+ AS+GF+ETE+++L+RKG+LTP
Sbjct  320   EPRHKK---PPVGPKNIVKRPMKTVTYDDDNNFDAVLDGASAGFMETEREELIRKGLLTP  376

Query  872   FHKLKGFERQIQEPGQSSRH---SMQDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSSL  1042
             FHKLKGFE++++ P  S R    + Q    + ++ +A   QS+ + AQ+RP TKLLDS  
Sbjct  377   FHKLKGFEKRVELPEPSHRQDDSAGQTEEAMEASRIARVAQSLKQIAQNRPATKLLDSES  436

Query  1043  LPKLEPPTYPFQTPRKHVK--ISQSA---ENGRNDKRKRRPTPGKKWR----VKVSRENK  1195
             LPKL+ P  PFQ   K +K  +S S+   E  R   + +RP PGKKWR    +K S  + 
Sbjct  437   LPKLDAPAAPFQRLGKPLKRPVSPSSDEQEKKRPRNKTKRPLPGKKWRKANSIKESSLDD  496

Query  1196  DEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHC  1375
             ++  +  +S  +D++D      +    V LEGGL+IP T++ +LFDYQKVGVQWLWELHC
Sbjct  497   NDVGEAAVSVSDDDEDQVTEGSDELTDVTLEGGLRIPGTLYTQLFDYQKVGVQWLWELHC  556

Query  1376  QKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHV  1555
             Q+AGGIIGDEMGLGKTVQVL+FLGSLH S  YKPSI+VCP+TLLQQW+REA +WYP F V
Sbjct  557   QRAGGIIGDEMGLGKTVQVLSFLGSLHNSGLYKPSIVVCPVTLLQQWRREASRWYPKFKV  616

Query  1556  EILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGL  1735
             EILHDS N    K K S   +S++  +   +  V  +   +  KKWD LI+ V+ S SGL
Sbjct  617   EILHDSANSSSKKSKRSSDSDSEASWDSDQEEAVTCS---KPAKKWDDLISRVVSSGSGL  673

Query  1736  LITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQN  1915
             L+TTYEQLR+LGEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PIQN
Sbjct  674   LLTTYEQLRILGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQN  733

Query  1916  KLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMP  2095
             KLSELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANATPLQVSTAYRCAVVLRDL+MP
Sbjct  734   KLSELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANATPLQVSTAYRCAVVLRDLVMP  793

Query  2096  YLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVM  2275
             YLLRRMKADVNAQLPKKTEHV+FCSLT+ QR+ Y+AFLAS++VEQIFDG++N+LYGIDV+
Sbjct  794   YLLRRMKADVNAQLPKKTEHVLFCSLTTEQRATYRAFLASSEVEQIFDGNRNSLYGIDVL  853

Query  2276  RKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDIL  2455
             RKICNHPDLLEREH+ ++PDYGNPERSGKMKVV +VLK+WK+QGHRVL F+QTQQMLDI+
Sbjct  854   RKICNHPDLLEREHAAQNPDYGNPERSGKMKVVEQVLKVWKEQGHRVLLFTQTQQMLDIM  913

Query  2456  ENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVII  2635
             ENFL    Y+YRRMDG TP KQRMALIDEFNNT EIFIFILTT+VGGLGTNLTGANR+II
Sbjct  914   ENFLTACEYQYRRMDGLTPAKQRMALIDEFNNTDEIFIFILTTKVGGLGTNLTGANRIII  973

Query  2636  FDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQ  2815
             +DPDWNPS DMQARERAWRIGQ +DVTVYRLITRGTIEEKVYHRQIYKH LTNK+LK+PQ
Sbjct  974   YDPDWNPSTDMQARERAWRIGQTRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKVLKDPQ  1033

Query  2816  QRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPAD  2995
             QRR FKARD+KDLF L DD  NGSTE+S+IFSQLSEDVNI  P    Q++  +    P  
Sbjct  1034  QRRFFKARDMKDLFTLQDDDNNGSTETSNIFSQLSEDVNIGVPSDKQQDQLYAASATPTT  1093

Query  2996  HGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKL  3175
              GT    + +S  +G+ K D+     DE+ +IL++LFDA GIHSA++HDAI+NA+D++KL
Sbjct  1094  SGT----EPSSSRHGQGKEDHCPDQADEECNILKSLFDAQGIHSAINHDAIMNANDDQKL  1149

Query  3176  KLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLV  3355
             +LE +A++VAQRAAEALRQSRMLRS ES ++PTWTGR+G AGAP S+++KFGSTLN QLV
Sbjct  1150  RLEAEATQVAQRAAEALRQSRMLRSHESFSVPTWTGRAGAAGAPSSVRRKFGSTLNTQLV  1209

Query  3356  TSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGS  3535
              SS+P E S   + R   +  GA  GKALSSAELLA+IRG +E A SD LE  HQ N GS
Sbjct  1210  NSSQPSETS---NGRGQSLQVGALNGKALSSAELLARIRGTREGAASDALE--HQLNLGS  1264

Query  3536  SSNSRTRAAENG-ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSK  3712
             +SN  + ++ NG AS  S  S  +QPEVLIRQ+CTFIQ+ GGS SS SI EHF++R+ SK
Sbjct  1265  ASNHTSSSSGNGRASSSSTRSMIVQPEVLIRQLCTFIQQHGGSASSTSITEHFKNRILSK  1324

Query  3713  DLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             D+ LFKNLLKEIATL++  NG+ W+LKP+YQ
Sbjct  1325  DMLLFKNLLKEIATLQRGANGATWVLKPDYQ  1355



>ref|XP_006409113.1| hypothetical protein EUTSA_v10022523mg [Eutrema salsugineum]
 gb|ESQ50566.1| hypothetical protein EUTSA_v10022523mg [Eutrema salsugineum]
Length=1179

 Score =  1330 bits (3442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 751/1246 (60%), Positives = 921/1246 (74%), Gaps = 95/1246 (8%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATS--S  328
             MEEDE DR L SSLGVTSANP DIE+ I  +     D  NE A S+E ++ E   +    
Sbjct  1     MEEDE-DRFLLSSLGVTSANPADIEQTILDEATKQLD-DNEGA-SVEEQSIEPEGSRLLP  57

Query  329   TKKTDMYNKLRAVETEIQAVKSGFEQLE-NFRRNDEQVPDREDGHEKRDIETEQSTTQAP  505
             +   ++ NKLRAV+ EI AV S  E +E +   N  Q  D  D H    ++   +T +  
Sbjct  58    SSHNELLNKLRAVKFEIDAVASTVEHVEEDAAENGLQKDDGSDVHSGSVLQHALATDRL-  116

Query  506   lndldlqralaadrlKSLLKTKAQLKKEISD---LSNDSTHDTLSVLRDIVKEQPNAVLR  676
                            +SL K K QL+KE+S     S   + D  ++LRD+VKE+P+  L+
Sbjct  117   ---------------RSLNKRKIQLEKELSGSHGWSASGSADRDNLLRDLVKEEPS--LK  159

Query  677   DVVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRK  856
               +K   KP +R          + K++K  S  +D DFDAV +AAS+GFVETE+D+LVRK
Sbjct  160   RKLKEIQKPSKR----------EGKKVKVVSFHEDTDFDAVFDAASAGFVETERDELVRK  209

Query  857   GILTPFHKLKGFERQIQEPGQSSRHSM---QDNGDLV--STSLANAIQSISEAAQSRPTT  1021
             GILTPFHKL+GFER++Q+PG S+  ++   ++  D+   S S+  A+QS+S AA++RPTT
Sbjct  210   GILTPFHKLEGFERRLQQPGPSNSDNVPEREEENDINEDSGSIDRAVQSMSLAAKARPTT  269

Query  1022  KLLDSSLLPKLEPPTYPFQTPRKHVKISQSAEN------GRNDKRKRRPTPGKKWRVKVS  1183
             KLLD+  LPKLE P+ PF+  R+  K     +N           +K+RP P +KW  +++
Sbjct  270   KLLDAEDLPKLEAPSAPFRRLRRLYKTHDPPDNEVKKSKAGKKSKKKRPLPERKWTKQIA  329

Query  1184  REN-----KDEGPDVEISSYedekddedmddeG---PPFVMLEGGLKIPETIFDKLFDYQ  1339
              E+     +++G  V  +S  +E + +D+DD        V LEGGL IPE IF KLFDYQ
Sbjct  330   HEDSSLQEREDGRRVLPTSSCEEDELDDVDDAEDNETSSVQLEGGLNIPECIFSKLFDYQ  389

Query  1340  KVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWK  1519
             +VGVQWLWELHCQKAGGIIGDEMGLGKTVQVL+FLGSLHFS  YKPSI++CP+TLL+QW+
Sbjct  390   RVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLSFLGSLHFSKMYKPSIVICPVTLLRQWR  449

Query  1520  REAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDK  1699
             REA+KWYP+FHVEILHDS  D            S+S+ +    V  +     +NTKKWD 
Sbjct  450   REAQKWYPNFHVEILHDSAQD--SGYARGVGKASESDYDSEGSVHSDHEQKSKNTKKWDS  507

Query  1700  LINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTV  1879
             LIN VL S+SGLLITTYEQLRL GEKLL+IEWGYAVLDEGHRIRNPN ++TLVCKQLQTV
Sbjct  508   LINRVLNSESGLLITTYEQLRLQGEKLLNIEWGYAVLDEGHRIRNPNAEITLVCKQLQTV  567

Query  1880  HRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAY  2059
             HRIIM+G+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANA+PLQVSTAY
Sbjct  568   HRIIMSGAPIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAY  627

Query  2060  RCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFD  2239
             RCAVVLRDLIMPYLLRRMK DVNA L KKTEHV+FCSLT  QRS Y+AFLAS++VEQI +
Sbjct  628   RCAVVLRDLIMPYLLRRMKTDVNAHLTKKTEHVLFCSLTVEQRSTYRAFLASSEVEQILE  687

Query  2240  GSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVL  2419
             G+KN+LYGIDVMRKICNHPDLLEREHS ++PDYGNPERSGK+KVVAEVLK+WK Q HRVL
Sbjct  688   GNKNSLYGIDVMRKICNHPDLLEREHSHQNPDYGNPERSGKLKVVAEVLKVWKQQKHRVL  747

Query  2420  FFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGL  2599
              FSQTQQMLDILE+FLV   Y YRRMDG TPVKQRMALIDEFNN+ ++F+FILTT+VGGL
Sbjct  748   LFSQTQQMLDILESFLVGNEYSYRRMDGLTPVKQRMALIDEFNNSDDVFVFILTTKVGGL  807

Query  2600  GTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYK  2779
             GTNLTGA+RVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYK
Sbjct  808   GTNLTGADRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYK  867

Query  2780  HSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE-NGSTESSSIFSQLSEDVNITGPQHPD  2956
             H LTNKILKNPQQRR FKARD+KDLF+L DDG+ N STE+S+IFSQL+E++NI G Q   
Sbjct  868   HFLTNKILKNPQQRRFFKARDMKDLFILKDDGDSNASTETSNIFSQLNEEINIVGVQ---  924

Query  2957  QEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMD  3136
              EK     T PA H TA E     GS+ +  AD     +DE+T+IL++LFDAHGIHSA++
Sbjct  925   SEKKPESATQPALHDTAEE-----GSSEQIDADKTGEAMDEETNILKSLFDAHGIHSAVN  979

Query  3137  HDAIVNAHD-EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPS  3313
             HDAI+NA D EEK++LE QA++VAQRAAEALRQSRMLRS+ES+++PTWTG+SG AGAP S
Sbjct  980   HDAIMNADDKEEKMRLEHQAAQVAQRAAEALRQSRMLRSRESISVPTWTGKSGCAGAPSS  1039

Query  3314  IKKKFGSTLNPQLV-TSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERA  3490
             ++++FGST+N +L  T  KP       S+ +NGI+AG S+GKA SSAELL +IRGN+ +A
Sbjct  1040  VRRRFGSTVNSRLTQTGDKP-------STIKNGISAGLSSGKAPSSAELLNRIRGNKAQA  1092

Query  3491  ISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSS  3670
             +  G E     +S SS +                   +QPEVLIRQ+C+F+Q++GG   +
Sbjct  1093  VGFGREQPPPSSSSSSGS-------------------LQPEVLIRQICSFVQQRGGKVDT  1133

Query  3671  ASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
              SIV HFR RV S+D  LFKNLLKEIATL+K+ N SFW+LK EY++
Sbjct  1134  TSIVNHFRDRVSSEDKLLFKNLLKEIATLRKDENTSFWVLKSEYKD  1179



>ref|XP_006857326.1| hypothetical protein AMTR_s00067p00081580 [Amborella trichopoda]
 gb|ERN18793.1| hypothetical protein AMTR_s00067p00081580 [Amborella trichopoda]
Length=1251

 Score =  1329 bits (3440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 750/1263 (59%), Positives = 917/1263 (73%), Gaps = 85/1263 (7%)
 Frame = +2

Query  197   GVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNATSSTKKTDMYNKLRAVETE  376
             GV SAN E+ ER++           N+     + E       S   K  ++NKLRAVE E
Sbjct  15    GVKSANAEEFERSLLLHEAEADKKENQVHDGKDTENALDTPYSDLIK--LHNKLRAVEVE  72

Query  377   IQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlndldlqralaadrlKS  556
             I AV +    + N   +   V + + G     +E  +S      N L+LQ ALAADRLKS
Sbjct  73    IDAVAASVGGVGNKDISSISVENGQLG----TVENIESENPVWTNGLELQHALAADRLKS  128

Query  557   LLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQPKPKRRLkeaksps  736
             L KT+ QL+ EIS++  +   D+L+          N + + V + +    +      + S
Sbjct  129   LRKTRNQLQNEISEIEKEIPSDSLA--------DKNLLGKLVKEKKKHKPKSEGSKLATS  180

Query  737   knkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFHKLKGFERQIQEPG  916
              N+KK+ KT + DDD DFDAVL+AAS+GFVETE+D+L+RKGILTPFHKLKGFER  Q+PG
Sbjct  181   SNRKKQKKTITFDDDLDFDAVLDAASAGFVETERDELIRKGILTPFHKLKGFERGFQKPG  240

Query  917   QSSRHSMQDNGDLVSTSLAN----------AIQSISEAAQSRPTTKLLDSSLLPKLEPPT  1066
              S+  +   N +     +            A  S+S  ++SRP+TKL+D+S LPKLEPPT
Sbjct  241   PSNSQAGPSNSEATPEEVGEHNRKAASIAKAAASLSAISKSRPSTKLVDASGLPKLEPPT  300

Query  1067  YPFQTPRKHVKISQSAE--------NGRNDKRKRRPTPGKKWRVKVSRENK----DEG--  1204
               F   +KH  IS+ A+         G   K+++RP P KKWR    +E K    +EG  
Sbjct  301   RAFHRLQKH-SISRGAQVAEKPDVVQGTPVKKRKRPLPDKKWRKVTLQEEKLFSEEEGIT  359

Query  1205  ---------------PDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQ  1339
                            PD E+ + +   D E      P  V LEGGLKIPET+F+KLFDYQ
Sbjct  360   EGHPSSSTRDSDSASPDYEVENQDGIVDHE------PTTVTLEGGLKIPETVFNKLFDYQ  413

Query  1340  KVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWK  1519
             KVGV+WLWELHCQ+AGGIIGDEMGLGKTVQV+AFLG+LHFS  YKPSI++CP+TLL QW+
Sbjct  414   KVGVKWLWELHCQRAGGIIGDEMGLGKTVQVIAFLGALHFSKMYKPSIVICPVTLLCQWR  473

Query  1520  REAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDK  1699
             RE KKWYP FHVEILHDSV          K  ESD ESE + D + + ++  +N KKWD 
Sbjct  474   REVKKWYPGFHVEILHDSVQ---LPGSRRKVRESDDESESMSDSETDNSVPAKNIKKWDA  530

Query  1700  LINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTV  1879
             LI+ + GS+SGLL+TTYEQLR+L EKLLDIEWGYAVLDEGHRIRNPN +VTLVCKQLQTV
Sbjct  531   LIDRITGSESGLLLTTYEQLRILREKLLDIEWGYAVLDEGHRIRNPNAEVTLVCKQLQTV  590

Query  1880  HRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAY  2059
             HRIIMTG+PIQNKL+ELWSLFDFVFPGKLGVLPVFEA+F+VPIS+GGYANATPLQVSTAY
Sbjct  591   HRIIMTGAPIQNKLTELWSLFDFVFPGKLGVLPVFEAQFSVPISVGGYANATPLQVSTAY  650

Query  2060  RCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFD  2239
             RCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHV+FCSLT  QR++Y+AFLAS++VEQIF+
Sbjct  651   RCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTMEQRAVYRAFLASSEVEQIFN  710

Query  2240  GSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVL  2419
             G++N+LYGIDV+RKICNHPDLLEREHS   PDYGNPERSGKMKVVA+VLK+WKDQGHRVL
Sbjct  711   GNRNSLYGIDVVRKICNHPDLLEREHSAGHPDYGNPERSGKMKVVAQVLKVWKDQGHRVL  770

Query  2420  FFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGL  2599
              F+QTQQMLDILE+FL+   Y YRRMDG TPVKQRM L+DEFN + ++F+FILTT+VGGL
Sbjct  771   LFAQTQQMLDILESFLIASEYSYRRMDGLTPVKQRMVLMDEFNGSNDVFVFILTTKVGGL  830

Query  2600  GTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYK  2779
             GTNLTGA+RVIIFDPDWNPS D+QARERAWRIGQ +DVT+YRLITRGTIEEKVYHRQIYK
Sbjct  831   GTNLTGADRVIIFDPDWNPSTDVQARERAWRIGQTRDVTIYRLITRGTIEEKVYHRQIYK  890

Query  2780  HSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQ  2959
             H LTNKILKNPQQRR FKARD++DLF L +D +   TE+SSIFSQL+E +N+ G    +Q
Sbjct  891   HFLTNKILKNPQQRRFFKARDMRDLFTLQEDADGACTETSSIFSQLTE-INL-GVHDNNQ  948

Query  2960  EKDKSIKTNPADHGTAMER----DNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHS  3127
              +  S K    D+  +  R    + +  S G+ KAD ++G+VDE++S+LR+LF+AHGIHS
Sbjct  949   GELDSAKPACNDNTGSKRRKTSKEESFSSKGKGKADESDGEVDEESSVLRSLFEAHGIHS  1008

Query  3128  AMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
             AM+HD I+NA+DEEK++LEE+AS+VAQRAAEALRQSRMLRSQE ++IPTWTGRSG AGAP
Sbjct  1009  AMNHDVIMNANDEEKMRLEEEASQVAQRAAEALRQSRMLRSQERISIPTWTGRSGAAGAP  1068

Query  3308  PSIKKKFGSTLNPQLVTSSKPLEE-SSMISSRRNgiaagasagkalssaellakiRGNQE  3484
             PS ++ FGST+N QL+++SKPLE   +  +S      AGAS GK L+S+ELLA+IRG Q 
Sbjct  1069  PSARRTFGSTVNTQLISTSKPLETPPTSGASMTKSFGAGASVGKTLTSSELLARIRGTQV  1128

Query  3485  RAISDGLEHQHQFN----SGSSSNSRTRAA-----------ENGASRPSHGSAGMQPEVL  3619
              A+  GLEHQ   N    S  S NS T              +N AS  S     +QPE+L
Sbjct  1129  SAVGAGLEHQLGSNLSVGSSHSVNSITSIGSSSKGGSRPIKDNKASSSSSKPTMVQPEIL  1188

Query  3620  IRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPE  3799
             IRQ+CTF+Q KGGSTSSASIVEHF+ +VPSKDL LFKNLLKEIA+L++   GS W+LK E
Sbjct  1189  IRQLCTFMQEKGGSTSSASIVEHFKDKVPSKDLPLFKNLLKEIASLERGTGGSKWVLKTE  1248

Query  3800  YQE  3808
             YQ+
Sbjct  1249  YQQ  1251



>ref|XP_008447410.1| PREDICTED: DNA repair protein rhp26 isoform X3 [Cucumis melo]
Length=1020

 Score =  1328 bits (3438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/1021 (67%), Positives = 808/1021 (79%), Gaps = 32/1021 (3%)
 Frame = +2

Query  830   TEKDQLVRKGILTPFHKLKGFERQIQEPGQSS-----------RHSMQDNGDLVSTSLAN  976
             +E+D+LVRKGILTPFHKLKGFER++Q  GQSS           +   ++N D  S S+A 
Sbjct  4     SERDELVRKGILTPFHKLKGFERRLQSLGQSSLQNAGGSRGEVKEEEEENDDFASDSVAR  63

Query  977   AIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRK----R  1144
             A++S+S AAQ+RPTTKLLD   LPKL+PPT PF   +   K+  SAE+    K K    R
Sbjct  64    ALRSMSVAAQARPTTKLLDPDALPKLDPPTRPFYRLKTPAKVPLSAEDKLTTKTKSKKTR  123

Query  1145  RPTPGKKWRVKVSRENKDEGPDVEIS-------SYedekddedmddeGPPFVMLEGGLKI  1303
             RP P KK+R +++ E +D+     +S       S  ++  D + D     FV LEGGLKI
Sbjct  124   RPLPDKKYRKQIAMEERDKEAAENMSDGLATSSSEREDSGDLEEDVNELSFVTLEGGLKI  183

Query  1304  PETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSI  1483
             P++IFD+LFDYQKVGVQWLWELHCQ+AGGIIGDEMGLGKTVQVLAFLG+LHFSN YKPSI
Sbjct  184   PQSIFDQLFDYQKVGVQWLWELHCQRAGGIIGDEMGLGKTVQVLAFLGALHFSNIYKPSI  243

Query  1484  IVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvek  1663
             IVCP+TL++QWKREA+KW P    EILHDS +D    K   +  +   ESE+  + D  K
Sbjct  244   IVCPVTLVRQWKREARKWCPGLLAEILHDSAHD-PTYKNMREKSDGSDESEDSEESDYRK  302

Query  1664  NLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNT  1843
             N   + TK+WD LIN VL S+SGLLITTYEQLRLLG+KLLD+EWG AVLDEGHRIRNPN 
Sbjct  303   NSQAKGTKRWDALINRVLTSESGLLITTYEQLRLLGDKLLDVEWGCAVLDEGHRIRNPNA  362

Query  1844  DVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGY  2023
             +VTLVCKQLQTVHRIIMTGSPIQNKL ELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGY
Sbjct  363   EVTLVCKQLQTVHRIIMTGSPIQNKLKELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGY  422

Query  2024  ANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQA  2203
             ANA+PLQVSTAYRCAVVLRDLIMPYLLRRMKADVNA LPKKTEHV+FCSLTS QRS+Y+A
Sbjct  423   ANASPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAHLPKKTEHVLFCSLTSEQRSVYRA  482

Query  2204  FLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEV  2383
             FLAS++VE I DG++N+L GIDVMRKICNHPDLLEREH+ ++PDYGNPERSGKMKVV +V
Sbjct  483   FLASSEVESILDGNRNSLSGIDVMRKICNHPDLLEREHAFQNPDYGNPERSGKMKVVEQV  542

Query  2384  LKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEI  2563
             LK+WK+QGHRVL F+QTQQMLDILE FLV GGY YRRMDG TPVKQRMALIDEFNN+ E+
Sbjct  543   LKVWKEQGHRVLLFAQTQQMLDILEKFLVGGGYSYRRMDGGTPVKQRMALIDEFNNSCEV  602

Query  2564  FIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGT  2743
             F+FILTT+VGGLGTNLTGA+RVIIFDPDWNPS DMQARERAWRIGQ++DVTVYRLITRGT
Sbjct  603   FVFILTTKVGGLGTNLTGADRVIIFDPDWNPSTDMQARERAWRIGQQRDVTVYRLITRGT  662

Query  2744  IEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSE  2923
             IEEKVYHRQIYKH LTNKILKNPQQRR FKARD+KDLF LN+DG +GSTE+S+IF  L++
Sbjct  663   IEEKVYHRQIYKHFLTNKILKNPQQRRFFKARDMKDLFTLNEDGMDGSTETSNIFGALTD  722

Query  2924  DVNITGPQHPDQEKDKSIK-----TNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTS  3088
              VN+ G Q  +++  KS        + AD          SG NG    +   G  DEDTS
Sbjct  723   SVNVVGVQKNEKDGQKSCSGSVSFADSADENLCKSETETSGRNGS--VEGQGGGADEDTS  780

Query  3089  ILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAI  3268
             IL++LFDAHGIHSA++HD I+NA D EK++LEEQAS+VA+RAAEALRQSR+LRS ES ++
Sbjct  781   ILKSLFDAHGIHSAVNHDIIINADDGEKIRLEEQASQVARRAAEALRQSRILRSNESFSV  840

Query  3269  PTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISS-RRNgiaagasagkals  3445
             PTWTG++GTAGAP S+++KFGST+N  +  +SK   E S   +   NG AAG S GKALS
Sbjct  841   PTWTGKAGTAGAPSSVRRKFGSTINSLVTNNSKSSNEVSKNGTIHLNGHAAGTSCGKALS  900

Query  3446  saellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIR  3625
             SA+LLAKIRGNQERAIS GLE Q   ++ S++N RT       S   + S  +QPEVLIR
Sbjct  901   SADLLAKIRGNQERAISAGLERQSTPSTSSTNNVRTVGVSYSRSSSKNLSV-VQPEVLIR  959

Query  3626  QVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             Q+CTFI ++GG+  SASIVEHF+ R+PS DL LFKNLLKEIA L+K+P+GSFW+LK EY+
Sbjct  960   QICTFIHQRGGTADSASIVEHFKDRIPSNDLPLFKNLLKEIAMLEKSPSGSFWVLKAEYK  1019

Query  3806  E  3808
             +
Sbjct  1020  Q  1020



>dbj|BAJ88557.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1220

 Score =  1326 bits (3432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 726/1250 (58%), Positives = 895/1250 (72%), Gaps = 65/1250 (5%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENG---FDASNEAARSMELEATEHNATS  325
             M E+++D+ L  SLGVTSAN +DIER I  Q +      DA      ++  + +      
Sbjct  1     MGEEDDDQRLLHSLGVTSANVDDIERKILSQAKTDPKKHDAETSGPAAVGDQESSLTTPQ  60

Query  326   STKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQ--------VPDREDGHEKRDIET  481
                +  ++ KLR+V+ EI AV S     +                  D++   +++  E 
Sbjct  61    DDAQAKLHQKLRSVQLEIDAVASTLGGAKQAAGKKGGGGSSGSADAEDKKKKKKEKVKEE  120

Query  482   EQSTTQAPlndldlqralaadrlKSLLKTKAQLKKEISDLS---NDSTHDTLSVLRDIVK  652
             E +   AP      Q   A    +SL + K Q+++EI       + S +    +L  IV+
Sbjct  121   ENADEDAPRGGALQQALAAERL-RSLKRAKVQIQREILQSGPGPSGSGNQKDKMLAMIVE  179

Query  653   EQPNAVLRDVVKGQPK---PKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGF  823
             ++P         G PK   P RRLK              T + DDDDDFDAVL+ AS+GF
Sbjct  180   DEPRRKKSLKPPGGPKKKSPTRRLK--------------TVTYDDDDDFDAVLDGASAGF  225

Query  824   VETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSR---HSMQDNGDLVSTSLANAIQSIS  994
             +ETE+++L+RKG+LTPFHKLKGFE++++ PG SSR    + Q    + ++S+A   Q++ 
Sbjct  226   METEREELIRKGLLTPFHKLKGFEKRVERPGTSSRLNDSAEQAEETMEASSIAKVAQAMQ  285

Query  995   EAAQSRPTTKLLDSSLLPKLEPPTYPFQ---TPRKHVKISQSAE--NGRNDKRKRRPTPG  1159
               AQSRPTTKLLD+  LPKL+ PT PFQ    P K   +  S E  N R   + +RP PG
Sbjct  286   NMAQSRPTTKLLDAEFLPKLDAPTAPFQRLGVPLKRPGLPSSDERKNKRLKSKTKRPLPG  345

Query  1160  KKWRVKVSRE-------NKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIF  1318
             KKW    S++       ++D G     +S  + +D+   D +  P V+LEGGL+IP +++
Sbjct  346   KKWMKANSKKESLLDVADEDVGDAAASASVSENEDEIIEDSDELPPVILEGGLRIPGSVY  405

Query  1319  DKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPL  1498
              +LFDYQKVGVQWLWELHCQ+AGGIIGDEMGLGKTVQVL+FLG+LH S  YKPSI++CP+
Sbjct  406   TQLFDYQKVGVQWLWELHCQRAGGIIGDEMGLGKTVQVLSFLGALHDSGMYKPSIVICPV  465

Query  1499  TLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFR  1678
             TLLQQW+REA KWYP F VEILHDS N    K K     ESD   +   +         +
Sbjct  466   TLLQQWRREASKWYPKFKVEILHDSANSSSKKGKRYSDSESDVSWDSDQEEVTR----VK  521

Query  1679  NTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLV  1858
               +KWD LI+ V+ S SGLL+TTYEQLR++ EKLLDIEWGYAVLDEGHRIRNPN +VTLV
Sbjct  522   PAQKWDDLISRVVNSGSGLLLTTYEQLRIIREKLLDIEWGYAVLDEGHRIRNPNAEVTLV  581

Query  1859  CKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATP  2038
             CKQLQTVHRIIMTG+PIQNKLSELWSLFDFVFPGKLGVLPVFE EF+VPI++GGYANATP
Sbjct  582   CKQLQTVHRIIMTGAPIQNKLSELWSLFDFVFPGKLGVLPVFETEFSVPITVGGYANATP  641

Query  2039  LQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLAST  2218
             LQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTE V+FCSLT  QR+ Y+AFLAS+
Sbjct  642   LQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEQVLFCSLTQEQRATYRAFLASS  701

Query  2219  DVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWK  2398
             +VEQIFDG++N+LYGIDV+RKICNHPDLLERE + ++PDYGN ERSGKMKVV ++LK+WK
Sbjct  702   EVEQIFDGNRNSLYGIDVLRKICNHPDLLEREQAAQNPDYGNIERSGKMKVVEQILKVWK  761

Query  2399  DQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFIL  2578
             DQGHRVL F+QTQQMLDILE+FL    Y+YRRMDG TP KQRMALIDEFNNT EIFIFIL
Sbjct  762   DQGHRVLLFAQTQQMLDILESFLTARDYQYRRMDGLTPPKQRMALIDEFNNTDEIFIFIL  821

Query  2579  TTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKV  2758
             TT+VGGLGTNLTGANRVIIFDPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEEKV
Sbjct  822   TTKVGGLGTNLTGANRVIIFDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEEKV  881

Query  2759  YHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNIT  2938
             YHRQIYKH LTNK+LKNPQQRR FKARD+KDLF L DD +NGSTE+S+IF QLSEDVN+ 
Sbjct  882   YHRQIYKHFLTNKVLKNPQQRRFFKARDMKDLFTLQDDDKNGSTETSNIFGQLSEDVNVG  941

Query  2939  GPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHG  3118
              P    +E+ +     P   G     D N       K+D      DE+++IL+ LFDA G
Sbjct  942   APD--GEERGERCSALPTSAGAETSVDGNG------KSDIKPDQADEESNILKNLFDAQG  993

Query  3119  IHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTA  3298
             +HSA++HDAI++A+D++KL+LE +AS+VAQRAAEALRQSRMLRS++  A+PTWTGR+G A
Sbjct  994   VHSAVNHDAIMSANDDQKLRLEAEASQVAQRAAEALRQSRMLRSRDDFAVPTWTGRAGAA  1053

Query  3299  GAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGN  3478
             GAP S+++KFGSTLN QLV+SS+P E S+   SR   +  GA  GKALSSAELLAK+RG 
Sbjct  1054  GAPSSVRRKFGSTLNTQLVSSSQPSEGSN--GSRVQSLQVGALHGKALSSAELLAKMRGT  1111

Query  3479  QERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGM--QPEVLIRQVCTFIQRK  3652
             +E A SD LE  HQ + GS+SN R  + ENG +  S  S  M  QPEVLI Q+CT+IQ+ 
Sbjct  1112  REGAASDALE--HQLSLGSASNQRPGSTENGRTSNSSSSRNMIVQPEVLICQLCTYIQQN  1169

Query  3653  GGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEY  3802
             GGS SS S+ EHF++R+  KD+ +FKNLLKEIATL++   G+ W+LKPEY
Sbjct  1170  GGSASSTSLTEHFKNRIQPKDMLVFKNLLKEIATLQRGAGGAAWVLKPEY  1219



>ref|XP_008447409.1| PREDICTED: DNA repair protein rhp26 isoform X2 [Cucumis melo]
Length=1034

 Score =  1326 bits (3431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/1020 (67%), Positives = 807/1020 (79%), Gaps = 32/1020 (3%)
 Frame = +2

Query  833   EKDQLVRKGILTPFHKLKGFERQIQEPGQSS-----------RHSMQDNGDLVSTSLANA  979
             ++D+LVRKGILTPFHKLKGFER++Q  GQSS           +   ++N D  S S+A A
Sbjct  19    KQDELVRKGILTPFHKLKGFERRLQSLGQSSLQNAGGSRGEVKEEEEENDDFASDSVARA  78

Query  980   IQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRK----RR  1147
             ++S+S AAQ+RPTTKLLD   LPKL+PPT PF   +   K+  SAE+    K K    RR
Sbjct  79    LRSMSVAAQARPTTKLLDPDALPKLDPPTRPFYRLKTPAKVPLSAEDKLTTKTKSKKTRR  138

Query  1148  PTPGKKWRVKVSRENKDEGPDVEIS-------SYedekddedmddeGPPFVMLEGGLKIP  1306
             P P KK+R +++ E +D+     +S       S  ++  D + D     FV LEGGLKIP
Sbjct  139   PLPDKKYRKQIAMEERDKEAAENMSDGLATSSSEREDSGDLEEDVNELSFVTLEGGLKIP  198

Query  1307  ETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSII  1486
             ++IFD+LFDYQKVGVQWLWELHCQ+AGGIIGDEMGLGKTVQVLAFLG+LHFSN YKPSII
Sbjct  199   QSIFDQLFDYQKVGVQWLWELHCQRAGGIIGDEMGLGKTVQVLAFLGALHFSNIYKPSII  258

Query  1487  VCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekN  1666
             VCP+TL++QWKREA+KW P    EILHDS +D    K   +  +   ESE+  + D  KN
Sbjct  259   VCPVTLVRQWKREARKWCPGLLAEILHDSAHD-PTYKNMREKSDGSDESEDSEESDYRKN  317

Query  1667  LSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTD  1846
                + TK+WD LIN VL S+SGLLITTYEQLRLLG+KLLD+EWG AVLDEGHRIRNPN +
Sbjct  318   SQAKGTKRWDALINRVLTSESGLLITTYEQLRLLGDKLLDVEWGCAVLDEGHRIRNPNAE  377

Query  1847  VTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYA  2026
             VTLVCKQLQTVHRIIMTGSPIQNKL ELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYA
Sbjct  378   VTLVCKQLQTVHRIIMTGSPIQNKLKELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYA  437

Query  2027  NATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAF  2206
             NA+PLQVSTAYRCAVVLRDLIMPYLLRRMKADVNA LPKKTEHV+FCSLTS QRS+Y+AF
Sbjct  438   NASPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAHLPKKTEHVLFCSLTSEQRSVYRAF  497

Query  2207  LASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVL  2386
             LAS++VE I DG++N+L GIDVMRKICNHPDLLEREH+ ++PDYGNPERSGKMKVV +VL
Sbjct  498   LASSEVESILDGNRNSLSGIDVMRKICNHPDLLEREHAFQNPDYGNPERSGKMKVVEQVL  557

Query  2387  KLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIF  2566
             K+WK+QGHRVL F+QTQQMLDILE FLV GGY YRRMDG TPVKQRMALIDEFNN+ E+F
Sbjct  558   KVWKEQGHRVLLFAQTQQMLDILEKFLVGGGYSYRRMDGGTPVKQRMALIDEFNNSCEVF  617

Query  2567  IFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTI  2746
             +FILTT+VGGLGTNLTGA+RVIIFDPDWNPS DMQARERAWRIGQ++DVTVYRLITRGTI
Sbjct  618   VFILTTKVGGLGTNLTGADRVIIFDPDWNPSTDMQARERAWRIGQQRDVTVYRLITRGTI  677

Query  2747  EEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSED  2926
             EEKVYHRQIYKH LTNKILKNPQQRR FKARD+KDLF LN+DG +GSTE+S+IF  L++ 
Sbjct  678   EEKVYHRQIYKHFLTNKILKNPQQRRFFKARDMKDLFTLNEDGMDGSTETSNIFGALTDS  737

Query  2927  VNITGPQHPDQEKDKSIK-----TNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSI  3091
             VN+ G Q  +++  KS        + AD          SG NG    +   G  DEDTSI
Sbjct  738   VNVVGVQKNEKDGQKSCSGSVSFADSADENLCKSETETSGRNGS--VEGQGGGADEDTSI  795

Query  3092  LRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIP  3271
             L++LFDAHGIHSA++HD I+NA D EK++LEEQAS+VA+RAAEALRQSR+LRS ES ++P
Sbjct  796   LKSLFDAHGIHSAVNHDIIINADDGEKIRLEEQASQVARRAAEALRQSRILRSNESFSVP  855

Query  3272  TWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISS-RRNgiaagasagkalss  3448
             TWTG++GTAGAP S+++KFGST+N  +  +SK   E S   +   NG AAG S GKALSS
Sbjct  856   TWTGKAGTAGAPSSVRRKFGSTINSLVTNNSKSSNEVSKNGTIHLNGHAAGTSCGKALSS  915

Query  3449  aellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQ  3628
             A+LLAKIRGNQERAIS GLE Q   ++ S++N RT       S   + S  +QPEVLIRQ
Sbjct  916   ADLLAKIRGNQERAISAGLERQSTPSTSSTNNVRTVGVSYSRSSSKNLSV-VQPEVLIRQ  974

Query  3629  VCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
             +CTFI ++GG+  SASIVEHF+ R+PS DL LFKNLLKEIA L+K+P+GSFW+LK EY++
Sbjct  975   ICTFIHQRGGTADSASIVEHFKDRIPSNDLPLFKNLLKEIAMLEKSPSGSFWVLKAEYKQ  1034



>ref|XP_008791073.1| PREDICTED: DNA repair protein rhp26 isoform X2 [Phoenix dactylifera]
Length=1110

 Score =  1320 bits (3415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 704/1112 (63%), Positives = 868/1112 (78%), Gaps = 47/1112 (4%)
 Frame = +2

Query  551   KSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQPKPKRRLkeaks  730
             +SL KTKAQL +EIS L  ++  +      DI  E+   +L ++V+  PK KR+ K  + 
Sbjct  19    RSLKKTKAQLHEEISKLDENAASE------DIGHEK---LLAELVEENPKRKRKSKAVEQ  69

Query  731   psknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFHKLKGFERQIQE  910
              +++ K  +KT + D+D DFDA L+ AS+GFVETE+D+L+RKGILTPFH++KGFER++Q+
Sbjct  70    SNRDSKSHLKTVAYDEDADFDAALDTASTGFVETERDELIRKGILTPFHRIKGFERRVQQ  129

Query  911   PGQSSRHSMQDNG--DLVSTSLANAIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTP  1084
             P  S+RH  +++   D  S S+A   QSIS+ A+SRPTTKLLD+  LP L+ PT+PFQ  
Sbjct  130   PAPSNRHVPEESAAEDHASASIAKVAQSISDIARSRPTTKLLDAEALPGLDAPTHPFQRL  189

Query  1085  RKHVK------ISQSAENGRNDKRKRRPTPGKKWRVKVSRENKDEGPDVE------ISSY  1228
             +  +K        +  +  R  +R +RP P KKWR   S+E   +G D +       + Y
Sbjct  190   KAPLKRPVSPKGKELEKKKRKLRRSKRPLPSKKWRNVDSKEKLPDGSDEDSVGDLIATDY  249

Query  1229  edekddedmddeGP-PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDE  1405
              +E  +E+  D+G    V+LEGGLKIP +I   LFDYQKVG+QWLWELHCQ+AGGIIGDE
Sbjct  250   GEETQEEENADDGEQSSVILEGGLKIPASIHKNLFDYQKVGIQWLWELHCQRAGGIIGDE  309

Query  1406  MGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDF  1585
             MGLGKTVQV++FLG+LHFS  YKPSI+VCP+TLL+QW+REA+KWYP+F VEILHDS +  
Sbjct  310   MGLGKTVQVISFLGALHFSKMYKPSIVVCPVTLLRQWQREARKWYPNFKVEILHDSAHGL  369

Query  1586  hdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRL  1765
             + +     S       + +   +     + ++ K+W+ LI+ V+ S+S LL+TTYEQLRL
Sbjct  370   NKQMVAKSSESDYDSEDSMDTDNERPRPA-KSVKRWNDLIDRVVQSESALLLTTYEQLRL  428

Query  1766  LGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFD  1945
             LGEKLLDIEWGYA+LDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PIQNKLSELWSLFD
Sbjct  429   LGEKLLDIEWGYAILDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQNKLSELWSLFD  488

Query  1946  FVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADV  2125
             FVFPGKLGVLPVFE EFAVPI++GGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADV
Sbjct  489   FVFPGKLGVLPVFETEFAVPITVGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADV  548

Query  2126  NAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLL  2305
             NAQLPKKTEHV+FCSLTS QRS+Y+AFLAS++VEQIF+G++N+LYGID+MRKICNHPDLL
Sbjct  549   NAQLPKKTEHVLFCSLTSDQRSVYRAFLASSEVEQIFEGNRNSLYGIDIMRKICNHPDLL  608

Query  2306  EREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYK  2485
             EREHS + PDYGNPERSGKMKVVA+VL++WK+QGH VL F+QTQQMLDI ENFL   GY 
Sbjct  609   EREHSAQHPDYGNPERSGKMKVVAQVLRVWKEQGHHVLLFTQTQQMLDIFENFLAASGYS  668

Query  2486  YRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSND  2665
             YRRMDG TPVKQRMAL+DEFNN+ ++FIFILTT+VGGLGTNLTGA+RVII+DPDWNPS D
Sbjct  669   YRRMDGLTPVKQRMALMDEFNNSSDVFIFILTTKVGGLGTNLTGADRVIIYDPDWNPSTD  728

Query  2666  MQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDL  2845
             MQARERAWRIGQK++VTVYRLITRGTIEEKVYHRQIYKH LTNKILKNPQQRR FKA+D+
Sbjct  729   MQARERAWRIGQKREVTVYRLITRGTIEEKVYHRQIYKHFLTNKILKNPQQRRFFKAKDM  788

Query  2846  KDLFVLNDDGENGSTESSSIFSQLSEDVNI---TGPQHPDQEKDKSIKTNPADHGTAMER  3016
             KDLF+L D  E GSTE+S IFSQL E+VN+    G QH  Q    +  T P        R
Sbjct  789   KDLFMLQDGREGGSTETSDIFSQLFEEVNVGIGNGYQH-KQGSSSAASTCP----VVPAR  843

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEK  3172
             + N        S S G++ A   NG++DE+T+IL++LFDAHGIHSAM+HDAI+NA+D++K
Sbjct  844   ETNSPGLGASSSNSKGKDIAGQRNGEIDEETNILKSLFDAHGIHSAMNHDAIMNANDDDK  903

Query  3173  LKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQL  3352
             L+LEEQASRVA+RAAEALR+SR LRS++S ++PTWTGRSG AGAP S+ +KFGS++N QL
Sbjct  904   LRLEEQASRVARRAAEALRESRRLRSRDSFSVPTWTGRSGAAGAPSSVCRKFGSSVNTQL  963

Query  3353  VTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSG  3532
             +  SKP + S   +SR  G+AAGAS GKALSSAELLA+I G QERA+ D LE     +  
Sbjct  964   LGPSKPSQGS---ASRPPGLAAGASTGKALSSAELLARIHGTQERAVDDALE--QDLDLA  1018

Query  3533  SSSNSRTRAAENG-ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS  3709
             SS N R R  E+  AS+PSH    +QPE+LIRQ+CTFIQ++GG T SASI +HF+ R+ S
Sbjct  1019  SSLNQRARIPEDTLASKPSHRYMVVQPEILIRQLCTFIQQRGGQTDSASITQHFKDRIQS  1078

Query  3710  KDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             KDL LFKNLLKEIATL+K+  GS W+LKPEY+
Sbjct  1079  KDLPLFKNLLKEIATLQKDAGGSRWVLKPEYR  1110



>ref|XP_008791074.1| PREDICTED: DNA repair protein rhp26 isoform X3 [Phoenix dactylifera]
Length=1109

 Score =  1319 bits (3414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 704/1112 (63%), Positives = 868/1112 (78%), Gaps = 47/1112 (4%)
 Frame = +2

Query  551   KSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQPKPKRRLkeaks  730
             +SL KTKAQL +EIS L  ++  +      DI  E+   +L ++V+  PK KR+ K  + 
Sbjct  18    RSLKKTKAQLHEEISKLDENAASE------DIGHEK---LLAELVEENPKRKRKSKAVEQ  68

Query  731   psknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFHKLKGFERQIQE  910
              +++ K  +KT + D+D DFDA L+ AS+GFVETE+D+L+RKGILTPFH++KGFER++Q+
Sbjct  69    SNRDSKSHLKTVAYDEDADFDAALDTASTGFVETERDELIRKGILTPFHRIKGFERRVQQ  128

Query  911   PGQSSRHSMQDNG--DLVSTSLANAIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTP  1084
             P  S+RH  +++   D  S S+A   QSIS+ A+SRPTTKLLD+  LP L+ PT+PFQ  
Sbjct  129   PAPSNRHVPEESAAEDHASASIAKVAQSISDIARSRPTTKLLDAEALPGLDAPTHPFQRL  188

Query  1085  RKHVK------ISQSAENGRNDKRKRRPTPGKKWRVKVSRENKDEGPDVE------ISSY  1228
             +  +K        +  +  R  +R +RP P KKWR   S+E   +G D +       + Y
Sbjct  189   KAPLKRPVSPKGKELEKKKRKLRRSKRPLPSKKWRNVDSKEKLPDGSDEDSVGDLIATDY  248

Query  1229  edekddedmddeGP-PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDE  1405
              +E  +E+  D+G    V+LEGGLKIP +I   LFDYQKVG+QWLWELHCQ+AGGIIGDE
Sbjct  249   GEETQEEENADDGEQSSVILEGGLKIPASIHKNLFDYQKVGIQWLWELHCQRAGGIIGDE  308

Query  1406  MGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDF  1585
             MGLGKTVQV++FLG+LHFS  YKPSI+VCP+TLL+QW+REA+KWYP+F VEILHDS +  
Sbjct  309   MGLGKTVQVISFLGALHFSKMYKPSIVVCPVTLLRQWQREARKWYPNFKVEILHDSAHGL  368

Query  1586  hdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRL  1765
             + +     S       + +   +     + ++ K+W+ LI+ V+ S+S LL+TTYEQLRL
Sbjct  369   NKQMVAKSSESDYDSEDSMDTDNERPRPA-KSVKRWNDLIDRVVQSESALLLTTYEQLRL  427

Query  1766  LGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFD  1945
             LGEKLLDIEWGYA+LDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PIQNKLSELWSLFD
Sbjct  428   LGEKLLDIEWGYAILDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQNKLSELWSLFD  487

Query  1946  FVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADV  2125
             FVFPGKLGVLPVFE EFAVPI++GGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADV
Sbjct  488   FVFPGKLGVLPVFETEFAVPITVGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADV  547

Query  2126  NAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLL  2305
             NAQLPKKTEHV+FCSLTS QRS+Y+AFLAS++VEQIF+G++N+LYGID+MRKICNHPDLL
Sbjct  548   NAQLPKKTEHVLFCSLTSDQRSVYRAFLASSEVEQIFEGNRNSLYGIDIMRKICNHPDLL  607

Query  2306  EREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYK  2485
             EREHS + PDYGNPERSGKMKVVA+VL++WK+QGH VL F+QTQQMLDI ENFL   GY 
Sbjct  608   EREHSAQHPDYGNPERSGKMKVVAQVLRVWKEQGHHVLLFTQTQQMLDIFENFLAASGYS  667

Query  2486  YRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSND  2665
             YRRMDG TPVKQRMAL+DEFNN+ ++FIFILTT+VGGLGTNLTGA+RVII+DPDWNPS D
Sbjct  668   YRRMDGLTPVKQRMALMDEFNNSSDVFIFILTTKVGGLGTNLTGADRVIIYDPDWNPSTD  727

Query  2666  MQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDL  2845
             MQARERAWRIGQK++VTVYRLITRGTIEEKVYHRQIYKH LTNKILKNPQQRR FKA+D+
Sbjct  728   MQARERAWRIGQKREVTVYRLITRGTIEEKVYHRQIYKHFLTNKILKNPQQRRFFKAKDM  787

Query  2846  KDLFVLNDDGENGSTESSSIFSQLSEDVNI---TGPQHPDQEKDKSIKTNPADHGTAMER  3016
             KDLF+L D  E GSTE+S IFSQL E+VN+    G QH  Q    +  T P        R
Sbjct  788   KDLFMLQDGREGGSTETSDIFSQLFEEVNVGIGNGYQH-KQGSSSAASTCP----VVPAR  842

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEK  3172
             + N        S S G++ A   NG++DE+T+IL++LFDAHGIHSAM+HDAI+NA+D++K
Sbjct  843   ETNSPGLGASSSNSKGKDIAGQRNGEIDEETNILKSLFDAHGIHSAMNHDAIMNANDDDK  902

Query  3173  LKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQL  3352
             L+LEEQASRVA+RAAEALR+SR LRS++S ++PTWTGRSG AGAP S+ +KFGS++N QL
Sbjct  903   LRLEEQASRVARRAAEALRESRRLRSRDSFSVPTWTGRSGAAGAPSSVCRKFGSSVNTQL  962

Query  3353  VTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSG  3532
             +  SKP + S   +SR  G+AAGAS GKALSSAELLA+I G QERA+ D LE     +  
Sbjct  963   LGPSKPSQGS---ASRPPGLAAGASTGKALSSAELLARIHGTQERAVDDALE--QDLDLA  1017

Query  3533  SSSNSRTRAAENG-ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS  3709
             SS N R R  E+  AS+PSH    +QPE+LIRQ+CTFIQ++GG T SASI +HF+ R+ S
Sbjct  1018  SSLNQRARIPEDTLASKPSHRYMVVQPEILIRQLCTFIQQRGGQTDSASITQHFKDRIQS  1077

Query  3710  KDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             KDL LFKNLLKEIATL+K+  GS W+LKPEY+
Sbjct  1078  KDLPLFKNLLKEIATLQKDAGGSRWVLKPEYR  1109



>emb|CBI37137.3| unnamed protein product [Vitis vinifera]
Length=1116

 Score =  1312 bits (3396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1082 (64%), Positives = 839/1082 (78%), Gaps = 76/1082 (7%)
 Frame = +2

Query  164   DEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSME---LEATEHNATSSTK  334
             +EEDR+L SSLGVTSANPED+ER I     N  +  +EA RS E   L+ ++    SST 
Sbjct  3     EEEDRILLSSLGVTSANPEDVEREILAAATNEAENGSEAGRSTEEEFLDKSKATELSSTS  62

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
             +  +Y+KLRA+E EI AV    +Q  N  RN+  V    D   + D E ++   QA  N+
Sbjct  63    QAKLYSKLRALEVEIDAVAYTVQQARNTERNENHVSHGNDNRAQGDAEDDKLVIQASPNN  122

Query  515   ldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDVVKGQ  694
             L LQ ALAADRL+SL KTKAQL+ E+SD   +    T+         + + V++++VK +
Sbjct  123   LTLQHALAADRLRSLKKTKAQLEIELSDWQKEKPSKTV---------EHDKVIQNLVKEE  173

Query  695   PKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPF  874
              +PK+RLKE     K+ KKR KT S DDD DFDAVL+AAS+GFVETE+D+LVRKGILTPF
Sbjct  174   ARPKKRLKEIPKSGKDLKKRKKTISFDDDVDFDAVLDAASAGFVETERDKLVRKGILTPF  233

Query  875   HKLKGFERQIQEPGQSSRHSMQDNGD----LVSTSLANAIQSISEAAQSRPTTKLLDSSL  1042
             HKLKGFER++Q+PG SSR ++ + GD    L S S+A A+QSISE+AQ+RPTTKLLDS  
Sbjct  234   HKLKGFERRLQQPGPSSRDNLPEEGDKIDDLASASIARAVQSISESAQARPTTKLLDSET  293

Query  1043  LPKLEPPTYPFQTPRKHVKI-----SQSAENGRNDKRKRRPTPGKKWRVKVSRENK----  1195
             LPKL+ P++PF   +K +K      S+  +N    ++K+RP P KKWR  +S E +    
Sbjct  294   LPKLDAPSHPFHRLKKPLKYPLPLDSEVEKNKDKKRKKKRPLPSKKWRKIISHEEELLEE  353

Query  1196  --DEGPDVEISSYedekddedmddeG--PPFVMLEGGLKIPETIFDKLFDYQKVGVQWLW  1363
               D   ++  SS E+   ++  D +   PP V LEGGL+IPE+IF KLFDYQKVGVQWLW
Sbjct  354   SEDTSDNLVTSSNEEVNREDIEDADDNEPPCVTLEGGLRIPESIFSKLFDYQKVGVQWLW  413

Query  1364  ELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYP  1543
             ELHCQ+ GGIIGDEMGLGKT+QVL+FLG+LHFSN YKPSI++CP+TLL+QWKREAKKWY 
Sbjct  414   ELHCQQVGGIIGDEMGLGKTIQVLSFLGALHFSNMYKPSIVICPVTLLRQWKREAKKWY-  472

Query  1544  SFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGS  1723
                     +S++                        D E+NLS ++TKKWD LIN VL S
Sbjct  473   -------QNSLD-----------------------SDDEENLSSKDTKKWDSLINRVLRS  502

Query  1724  DSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGS  1903
              SGLLITTYEQ+RL   KLLDI+WGYA+LDEGHRIRNPN +VT++CKQLQTVHRIIMTG+
Sbjct  503   QSGLLITTYEQIRLQAGKLLDIKWGYAILDEGHRIRNPNAEVTILCKQLQTVHRIIMTGA  562

Query  1904  PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRD  2083
             PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRD
Sbjct  563   PIQNKLAELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRD  622

Query  2084  LIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYG  2263
             LIMPYLLRRMKADVNAQLP KTEHV+FCSLT+ QRS+Y+AFLAS++VEQIFDGS+N+LYG
Sbjct  623   LIMPYLLRRMKADVNAQLPNKTEHVLFCSLTTEQRSVYRAFLASSEVEQIFDGSRNSLYG  682

Query  2264  IDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQM  2443
             IDVMRKICNHPDLLEREH+ ++PDYGNPERSGKMKVVA VLK WK+QGHRVL F+QTQQM
Sbjct  683   IDVMRKICNHPDLLEREHAYQNPDYGNPERSGKMKVVAHVLKGWKEQGHRVLLFAQTQQM  742

Query  2444  LDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGAN  2623
             LDILENFL+ GGY YRRMDG TP+K RMALIDEFN++ ++FIFILTT+VGGLGTNLTGAN
Sbjct  743   LDILENFLIAGGYVYRRMDGFTPIKHRMALIDEFNDSDDVFIFILTTKVGGLGTNLTGAN  802

Query  2624  RVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKIL  2803
             RVII+DPDWNPS DMQARERAWRIGQ +DVTVYRLITRGTIEEKVY RQIYKH LTNKIL
Sbjct  803   RVIIYDPDWNPSTDMQARERAWRIGQTRDVTVYRLITRGTIEEKVYQRQIYKHFLTNKIL  862

Query  2804  KNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKT  2983
             KNPQQ+R FKARD+KDLFVLNDDGE+ STE+S+IFSQLSEDVN+ G     Q+K KSI  
Sbjct  863   KNPQQKRFFKARDMKDLFVLNDDGEDASTETSNIFSQLSEDVNVVGKHKDSQDKQKSIIP  922

Query  2984  NPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHD  3163
                              +GE + D+ + ++D++T+ILR+LFDAH +HSA++HDAI+NAH 
Sbjct  923   ----------------VSGENEKDDQSDEMDKETNILRSLFDAHRLHSAVNHDAIMNAHG  966

Query  3164  EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLN  3343
             +EK++LEE+ASRVA+RA+EALRQS+MLRS+ES+++PTWTGRSG AGAP S+ +KFGST++
Sbjct  967   DEKMRLEEEASRVAKRASEALRQSQMLRSRESISVPTWTGRSGAAGAPSSVSRKFGSTVS  1026

Query  3344  PQ  3349
              Q
Sbjct  1027  SQ  1028


 Score =   132 bits (333),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = +2

Query  3530  GSSSNSRTRAAENG--ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRV  3703
             GS+ +S+ R+ ++G  +SR +H  + +QPEVLIR++CTFIQ+KGGST+S SIV+HF+ R+
Sbjct  1022  GSTVSSQARSTDSGPSSSRSTHNLSSVQPEVLIRKICTFIQQKGGSTNSTSIVQHFKDRI  1081

Query  3704  PSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             PSKDL LFKNLLKEIATL+K+PNGS W+LKPEY+
Sbjct  1082  PSKDLPLFKNLLKEIATLEKDPNGSSWVLKPEYR  1115



>gb|EMT18739.1| DNA repair and recombination protein RAD26 [Aegilops tauschii]
Length=1251

 Score =  1309 bits (3387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 735/1280 (57%), Positives = 904/1280 (71%), Gaps = 94/1280 (7%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQ--------------------TENGFDASN  274
             M E+++D+ L  SLGVTSAN +DIER I  Q                    T + F    
Sbjct  1     MAEEDDDQRLLHSLGVTSANIDDIERKILSQARIHPSSVHPSIPFLPVHNKTSSSFSQGE  60

Query  275   EA--------ARSMELEATEHNATSSTKKTD-----MYNKLRAVETEIQAVKS---GFEQ  406
              A        A +    AT    +S T   D     ++ KLR+V+ EI AV S   G +Q
Sbjct  61    PAKTDPKKGDAETPGPTATGDQESSLTTPQDDAQAKLHQKLRSVQLEIDAVASTLGGAKQ  120

Query  407   LENFRRNDEQVP--DREDGHEKRDIETE---QSTTQAPlndldlqralaadrlKSLLKTK  571
                 +         D ED  +K+  + +    +   AP      Q   A    +SL + K
Sbjct  121   AAGKKSGGGGSGSADAEDNKKKKKEKVKEEENADEDAPRGGALQQALAAERL-RSLKRAK  179

Query  572   AQLKKEISDLS---NDSTHDTLSVLRDIVKEQPNAVLRDVVKGQPK---PKRRLkeaksp  733
              Q+++EI       + S +    +L  +V+++P         G PK   P RRLK     
Sbjct  180   VQIQREILQSGPGPSGSGNQKDKMLAMLVEDEPRRKKSLKPPGGPKKKSPTRRLK-----  234

Query  734   sknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILTPFHKLKGFERQIQEP  913
                      T + DDDDDFD VL+ AS+GF+ETE+++L+RKG+LTPFHKLKGFE++++ P
Sbjct  235   ---------TVTYDDDDDFDTVLDGASAGFMETEREELIRKGLLTPFHKLKGFEKRVERP  285

Query  914   GQSSRH---SMQDNGDLVSTSLANAIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQ--  1078
             G SSR    + Q    + ++S+A   Q++   AQSRPTTKLLD+  LPKLE PT PFQ  
Sbjct  286   GTSSRQNGSAEQAEETIEASSIAKVAQAMQNMAQSRPTTKLLDAEFLPKLEAPTAPFQRL  345

Query  1079  -TPRKHVKISQSAE--NGRNDKRKRRPTPGKKWRVKVSRE-------NKDEGPDVEISSY  1228
               P K   +  S E  N R   + +RP PGKKW    S++       ++D G     +S 
Sbjct  346   GVPLKRPGLPSSDERKNKRLKSKTKRPLPGKKWMKANSKKETLLDVADEDVGDAAASASV  405

Query  1229  edekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEM  1408
              + +D+     +G P V+LEGGL+IP +++ +LFDYQKVGVQWLWELHCQ+AGGIIGDEM
Sbjct  406   SENEDEVIEGSDGLPPVILEGGLRIPGSVYTQLFDYQKVGVQWLWELHCQRAGGIIGDEM  465

Query  1409  GLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFh  1588
             GLGKTVQVL+FLG+LH S  YKPSI++CP+TLLQQW+REA KWYP F VEILHDS N   
Sbjct  466   GLGKTVQVLSFLGALHDSGMYKPSIVICPVTLLQQWRREASKWYPKFKVEILHDSANSSS  525

Query  1589  dkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLL  1768
              K K     ESD   +   +         +  +KWD LI+ V+ S SGLL+TTYEQLR++
Sbjct  526   KKGKRYSDSESDVSWDSDQEEVTR----MKPAQKWDDLISRVVNSGSGLLLTTYEQLRII  581

Query  1769  GEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDF  1948
              EKLLD+EWGYAVLDEGHRIRNPN +VTLVCKQLQTVHRIIMTG+PIQNKLSELWSLFDF
Sbjct  582   REKLLDVEWGYAVLDEGHRIRNPNAEVTLVCKQLQTVHRIIMTGAPIQNKLSELWSLFDF  641

Query  1949  VFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVN  2128
             VFPGKLGVLPVFE EF+VPI++GGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVN
Sbjct  642   VFPGKLGVLPVFETEFSVPITVGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVN  701

Query  2129  AQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLE  2308
             AQLPKKTE V+FCSLT  QR+ Y+AFLAS++VEQIFDG++N+LYGIDV+RKICNHPDLLE
Sbjct  702   AQLPKKTEQVLFCSLTQEQRATYRAFLASSEVEQIFDGNRNSLYGIDVLRKICNHPDLLE  761

Query  2309  REHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKY  2488
             RE + ++PDYGN ERSGKMKVV +VLK+WKDQGHRVL F+QTQQMLDILENFL    Y+Y
Sbjct  762   REQAAQNPDYGNIERSGKMKVVEQVLKVWKDQGHRVLLFAQTQQMLDILENFLTARDYQY  821

Query  2489  RRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDM  2668
             RRMDG TP KQRMALIDEFNNT EIFIFILTT+VGGLGTNLTGANRVIIFDPDWNPS DM
Sbjct  822   RRMDGLTPPKQRMALIDEFNNTDEIFIFILTTKVGGLGTNLTGANRVIIFDPDWNPSTDM  881

Query  2669  QARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLK  2848
             QARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH LTNK+LKNPQQRR FKARD+K
Sbjct  882   QARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKVLKNPQQRRFFKARDMK  941

Query  2849  DLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNS  3028
             DLF L DD +NGSTE+S+IF QLSEDVNI  P   ++ +  S     A+   ++      
Sbjct  942   DLFTLQDDDKNGSTETSNIFGQLSEDVNIGAPDGEERGERPSALPTSAEAEPSV------  995

Query  3029  GSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQ  3208
               +G+ K+D  +   DE+++IL++LFD  G+HSA++HDAI++A+D++KL+LE +AS+VAQ
Sbjct  996   --DGDGKSDLRSDQADEESNILKSLFDGQGVHSAINHDAIMSANDDQKLRLEAEASQVAQ  1053

Query  3209  RAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSM  3388
             RAAEALRQSRMLRS++  A+PTWTGR+G AGAP S+++KFGSTLN QLV+SS+   E S 
Sbjct  1054  RAAEALRQSRMLRSRDDFAVPTWTGRAGAAGAPTSVRRKFGSTLNTQLVSSSQ-PSEGSS  1112

Query  3389  ISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAEN  3568
              SSR   +  GA  GKALSSAELLAK+ G +E A SD LE  HQ + GS+SN R  + EN
Sbjct  1113  SSSRVQSLQVGALHGKALSSAELLAKMCGTREGAASDALE--HQLSLGSTSNQRPGSTEN  1170

Query  3569  GASRPSHGSAGM--QPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLK  3742
             G +  S  S  M  QPEVLIRQ+CTFIQ+ GGS SS S+ EHF++R+  KD+ +FKNLLK
Sbjct  1171  GRTSNSSSSRNMIVQPEVLIRQLCTFIQQNGGSASSTSLTEHFKNRIQPKDMLVFKNLLK  1230

Query  3743  EIATLKKNPNGSFWILKPEY  3802
             EIATL++   G+ W+LKPEY
Sbjct  1231  EIATLQRGAGGATWVLKPEY  1250



>gb|EPS63882.1| chromatin remodeling complex subunit, partial [Genlisea aurea]
Length=1118

 Score =  1283 bits (3320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 720/1228 (59%), Positives = 884/1228 (72%), Gaps = 126/1228 (10%)
 Frame = +2

Query  170   EDRVLFSSLGVTSANPEDIERNIFGQT-----ENGFDASNEAARSMELEATEHNATSSTK  334
             +D  LFS+LGVTSA+ ED+E  I  +      E+G     EA R  E E  +        
Sbjct  1     KDEALFSALGVTSASVEDVECRILEEVPRKDEEDGM----EAHRGREKETLDRK------  50

Query  335   KTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQAPlnd  514
                  N+L+A++ EI AV S  EQLEN +R+D        G+E      + ++ ++   D
Sbjct  51    ----RNELKAIKREIDAVASSVEQLENLKRDD-------GGNET----AKTNSLESSRGD  95

Query  515   ldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNA--VLRDVVK  688
               LQ ALA+DRL+SL+K K QL+KEIS  S  + H  L  ++DIVKE+  A   +++  K
Sbjct  96    RTLQLALASDRLESLMKRKTQLEKEIS-ASVSTAHRKL--IQDIVKEESVAKWSIKEAEK  152

Query  689   GQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGILT  868
                  ++RLK+               S+ DDDDFD +LNAASSG +ETE+D L+RKG+LT
Sbjct  153   TCKGREKRLKK--------------VSIGDDDDFDDILNAASSGLIETERDALIRKGVLT  198

Query  869   PFHKLKGFERQIQEPGQSSRHSMQDNG----DLVSTSLANAIQSISEAAQSRPTTKLLDS  1036
             PFHKLKG+ER+++   Q  +    +NG    DL STS+A  +Q ++EA+++RP+TKLLD 
Sbjct  199   PFHKLKGYERRLEGQEQLQQSVNSENGREDHDLASTSIARTVQLMAEASKARPSTKLLDP  258

Query  1037  SLLPKLEPPTYPFQTPRKHVKISQSAENG---RNDKRKRRPTPGKKWRVKVSRENKDEGP  1207
                PKL+PP  PF+  RK + I +S +N     ++ +KRR  P KKW  K   +++ +  
Sbjct  259   ESAPKLDPPCLPFKRLRKPLMIPESLQNKSVKESEIKKRRRQPIKKWSKKSPHQDEIQEG  318

Query  1208  DVEISSY--edekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQK  1381
               E SS   +     E+  D+   FV LEGGLKIP  IF KLFDYQKVGVQWLWELHCQK
Sbjct  319   VGEPSSEGDDCLDAVEEATDQNSDFVTLEGGLKIPGIIFHKLFDYQKVGVQWLWELHCQK  378

Query  1382  AGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEI  1561
             AGGIIGDEMGLGKT+QVLAFLGSLHFS  Y+PSIIVCP+TLL+QW+REA KWY SFH E+
Sbjct  379   AGGIIGDEMGLGKTIQVLAFLGSLHFSGMYRPSIIVCPVTLLRQWQREATKWYSSFHTEL  438

Query  1562  LHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLI  1741
             LHDS  +        +     S+ E  LD   E+  S  N+KKWD LIN VL SDSGLLI
Sbjct  439   LHDSAGE----SSRKRKKPRFSDDESSLDSGSEEKPSPLNSKKWDSLINRVLRSDSGLLI  494

Query  1742  TTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKL  1921
             TTYEQLRL G+KLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PIQNKL
Sbjct  495   TTYEQLRLHGDKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQNKL  554

Query  1922  SELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYL  2101
             SELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANATPLQVSTAYRCAVVLRDLIMPYL
Sbjct  555   SELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANATPLQVSTAYRCAVVLRDLIMPYL  614

Query  2102  LRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRK  2281
             LRRMK DV+AQLPKKTEHV+FCSLT  QRS+Y++FL+S++VEQI +GS+N+LYGIDVMRK
Sbjct  615   LRRMKVDVDAQLPKKTEHVLFCSLTPEQRSVYRSFLSSSEVEQIVNGSRNSLYGIDVMRK  674

Query  2282  ICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILEN  2461
             ICNHPDLLEREH   +PDYGNP RSGKMK+VAEVLK+WK QGHRVL FSQTQQMLDI+E 
Sbjct  675   ICNHPDLLEREHCDGEPDYGNPIRSGKMKLVAEVLKMWKVQGHRVLLFSQTQQMLDIIEQ  734

Query  2462  FLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFD  2641
             FL    Y YRRMDG+TPVKQRMALIDEFNN+ ++FIFILTT+VGGLGTNLTGANRVIIFD
Sbjct  735   FLTASDYDYRRMDGSTPVKQRMALIDEFNNSDDVFIFILTTKVGGLGTNLTGANRVIIFD  794

Query  2642  PDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQR  2821
             PDWNPS DMQARERAWRIGQKKDVTVYRLITRGTIEEKVY RQIYKH LTNKIL+NPQQR
Sbjct  795   PDWNPSTDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYQRQIYKHFLTNKILRNPQQR  854

Query  2822  RLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHG  3001
             R FK+R+LKDLF LNDDG+  STE+SSIFSQ+SE + I G  H +++K+ +   N A   
Sbjct  855   RFFKSRELKDLFTLNDDGDGCSTETSSIFSQVSE-LTIVG-THNEEQKNLNGSVNEA---  909

Query  3002  TAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL  3181
                       +NG E   N      E+   L+ LF+AHGIHSAM+HDAI+ +HDE K K+
Sbjct  910   ----------ANGSELKSN------EEVCFLQGLFEAHGIHSAMNHDAIMESHDENKTKV  953

Query  3182  EEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTS  3361
             EE+A+++AQRA+EAL QSR++R +ES+++PTWTG+SG AGAP  +++KFGSTLN +L+T+
Sbjct  954   EEEATKIAQRASEALLQSRIIRRRESISVPTWTGKSGAAGAP--MQRKFGSTLNSELITT  1011

Query  3362  SKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSS  3541
             +     ++  SS R           ALSSAELL K++  +E AI+D L          S+
Sbjct  1012  TSTSSTNAGASSGR-----------ALSSAELLMKLKKTEENAIADSL----------ST  1050

Query  3542  NSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLA  3721
              S+                 + PEVL RQ+ +FIQRKGGS +S SIV  F+ R+PS+DL 
Sbjct  1051  KSK-----------------LHPEVLTRQIRSFIQRKGGSATSVSIVSEFKERIPSEDLP  1093

Query  3722  LFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             LFKNLLKEIATL+++ +   WILKPE++
Sbjct  1094  LFKNLLKEIATLEESHH---WILKPEHR  1118



>ref|XP_010489595.1| PREDICTED: protein CHROMATIN REMODELING 8 isoform X2 [Camelina 
sativa]
Length=987

 Score =  1262 bits (3265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/1019 (66%), Positives = 804/1019 (79%), Gaps = 71/1019 (7%)
 Frame = +2

Query  824   VETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQ--DNGDLVSTSLANAIQSISE  997
             V  ++D+LVRKGILTPFHKL GFER++Q+PG S+  ++   D+ +  S S+  A+QS+S 
Sbjct  16    VLLKRDELVRKGILTPFHKLDGFERRLQQPGPSNSRNLPEGDHENEDSGSIDRAVQSMSL  75

Query  998   AAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAEN------GRNDKRKRRPTPG  1159
             AA++RPTT LLD+  LPKLEP   PF+  RK  K   S++N          ++K+RP P 
Sbjct  76    AAKARPTTMLLDAEDLPKLEPNPAPFRRLRKLYKTHDSSDNEAKKSKAGKKRKKKRPLPE  135

Query  1160  KKWRVKVSREN------KDEGPDVEISSYedekddedmddeG--PPFVMLEGGLKIPETI  1315
              KWR ++SRE+      +D G  +  SS E+E  D+  D +      + LEGGL IP+ I
Sbjct  136   SKWRKRISREDSSLQESEDGGRILATSSCEEEDLDDLDDADDNETSSIQLEGGLNIPQCI  195

Query  1316  FDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCP  1495
             F  LF+YQ+VGVQWLWELHCQ+AGGIIGDEMGLGKTVQVL+FLGSLHFS  YKPSII+CP
Sbjct  196   FRNLFEYQRVGVQWLWELHCQRAGGIIGDEMGLGKTVQVLSFLGSLHFSKMYKPSIIICP  255

Query  1496  LTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSF  1675
             +TLL+QW+REA+KWYP FHVE+LHDS  D  + K   K+ ESD +SE  +D D E+  S 
Sbjct  256   VTLLRQWRREAQKWYPDFHVELLHDSAKDSGNGKGQGKASESDYDSECSVDSDHEQKRS-  314

Query  1676  RNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTL  1855
             +NTKKWD LIN VL S+SGLLITTYEQLRL GEKLL+IEWGYAVLDEGHRIRNPN+D+TL
Sbjct  315   KNTKKWDSLINRVLNSESGLLITTYEQLRLQGEKLLNIEWGYAVLDEGHRIRNPNSDITL  374

Query  1856  VCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANAT  2035
             VCKQLQTVHRIIMTG+PIQNKL+ELWSLFDFVFPGKLGVLPVFEAEF+VPI++GGYANA+
Sbjct  375   VCKQLQTVHRIIMTGAPIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANAS  434

Query  2036  PLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLAS  2215
             PLQVSTAYRCAVVLRD+IMPYLLRRMKADVNA L KKTEHV+FCSLT  QRS Y+AFLAS
Sbjct  435   PLQVSTAYRCAVVLRDMIMPYLLRRMKADVNAHLTKKTEHVLFCSLTVEQRSTYRAFLAS  494

Query  2216  TDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLW  2395
             ++VE+IFDG+KN+LYGIDVMRKICNHPDLLEREHS ++PDYGNPERSGKMKVVAEVLK+W
Sbjct  495   SEVEEIFDGNKNSLYGIDVMRKICNHPDLLEREHSHQNPDYGNPERSGKMKVVAEVLKVW  554

Query  2396  KDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFI  2575
             K QGHRVL FSQTQQMLDILE+FLV   Y YRRMDG TPVKQRMALIDEFNN+ ++F+F+
Sbjct  555   KQQGHRVLLFSQTQQMLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSDDVFVFV  614

Query  2576  LTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEK  2755
             LTT+VGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVT+YRLITRGTIEEK
Sbjct  615   LTTKVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTIYRLITRGTIEEK  674

Query  2756  VYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE-NGSTESSSIFSQLSEDVN  2932
             VYHRQIYKH LTNKILKNPQQRR FKARD+KDLF+L DDG+ N STE+S+IFSQL+E++N
Sbjct  675   VYHRQIYKHFLTNKILKNPQQRRFFKARDMKDLFILKDDGDSNASTETSNIFSQLAEEIN  734

Query  2933  ITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGD-----VDEDTSILR  3097
             I G Q                        +N+     E+AD +  D     +DE+T+IL+
Sbjct  735   IVGVQ-----------------------SDNTAEGSSEQADVDTTDKTGEAMDEETNILK  771

Query  3098  TLFDAHGIHSAMDHDAIVNAHD-EEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPT  3274
             +LFDAHGIHSA++HDAI+NA+D EEK++LE QAS+VA+RAAEALRQSRMLRS+ES+++PT
Sbjct  772   SLFDAHGIHSAVNHDAIMNANDEEEKMRLEHQASQVARRAAEALRQSRMLRSRESISVPT  831

Query  3275  WTGRSGTAGAPPSIKKKFGSTLNPQLV-TSSKPLEESSMISSRRNgiaagasagkalssa  3451
             WTGRSG AGAP S++++FGST+N +L  T  KP       S  +NGI+AG S+GKA +SA
Sbjct  832   WTGRSGCAGAPSSVRRRFGSTVNSRLTQTGDKP-------SVIKNGISAGLSSGKAPTSA  884

Query  3452  ellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQV  3631
             ELL +IRG++E+AI  G E     +SGSSS   +                +QPEVLIRQ+
Sbjct  885   ELLNRIRGSREQAIGVGNESSLTSSSGSSSRVGS----------------LQPEVLIRQI  928

Query  3632  CTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
             C+F+QRKGGS  + SIV HFR  V   D  LFKNLL+EIATL+KN N SFW+LK EY++
Sbjct  929   CSFVQRKGGSADTTSIVNHFRDSVSCDDKPLFKNLLREIATLEKNQNRSFWVLKSEYKD  987



>ref|XP_006443809.1| hypothetical protein CICLE_v10018548mg [Citrus clementina]
 gb|ESR57049.1| hypothetical protein CICLE_v10018548mg [Citrus clementina]
Length=1049

 Score =  1238 bits (3203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/1019 (66%), Positives = 806/1019 (79%), Gaps = 41/1019 (4%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNAT----  322
             MEEDE DR+L SSLGVTSANPEDIER++    EN   A N        E   H+ +    
Sbjct  1     MEEDE-DRLLLSSLGVTSANPEDIERDVLAAAENV--AGNSNETEESNEEKPHDKSESID  57

Query  323   -SSTKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQ  499
              SST +  +YNKLRAVE EI AV S  + L      ++   D  D  E+   E E+S  Q
Sbjct  58    PSSTSQEKLYNKLRAVEFEIGAVASTVDHLRRVSTKEDNDIDDGDSTEQDGREDEKSAVQ  117

Query  500   APlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRD  679
             A  ND+ LQ AL ADRLKSL KTKAQL KE+S      T   +         + +  ++D
Sbjct  118   ASPNDMTLQHALTADRLKSLKKTKAQLVKELSHFPKGITSKGI---------EHDKFIQD  168

Query  680   VVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKG  859
             +VK + +PKR+ KEA+ P K++ K+ KT S+DDD DFD+ L+AAS+GFVET++D+LVRKG
Sbjct  169   LVKEEHRPKRKSKEAQKPGKDRSKQQKTVSVDDDFDFDSALDAASAGFVETKRDELVRKG  228

Query  860   ILTPFHKLKGFERQIQEPGQSSRHSMQD-----NGDLVSTSLANAIQSISEAAQSRPTTK  1024
             ILTPFHKLKGFER IQ+PG S++ ++ D     + D  S S+  A++ +SEAAQ+RP+TK
Sbjct  229   ILTPFHKLKGFERCIQQPGPSNKQNVPDEREARSNDPFSASVDRALRMMSEAAQARPSTK  288

Query  1025  LLDSSLLPKLEPPTYPFQTPRKHVKISQSAEN-----GRNDKRKRRPTPGKKWRVKVSRE  1189
             LLD   LPKL+ PT PFQ  +   ++ QS E+      R+ ++K+RP P KKWR +++RE
Sbjct  289   LLDPESLPKLDGPTRPFQRLKTPFRMPQSEESEVEKKKRSKRKKKRPLPDKKWRKRIARE  348

Query  1190  ------NKDEGPDVEISSYedekddedmddeG--PPFVMLEGGLKIPETIFDKLFDYQKV  1345
                   N+D    +++SSYE+EK ++D D +   PPFV LEGGLKIPE+IF+ LFDYQKV
Sbjct  349   DTRLEENEDSRDSLDMSSYEEEKQEDDEDSDNNEPPFVTLEGGLKIPESIFNNLFDYQKV  408

Query  1346  GVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKRE  1525
             GVQWLWELHCQ+AGGIIGDEMGLGKT+QVL+FLG+LHFSN YKPSI+VCP+TLL+QWKRE
Sbjct  409   GVQWLWELHCQRAGGIIGDEMGLGKTIQVLSFLGALHFSNMYKPSIVVCPVTLLRQWKRE  468

Query  1526  AKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLI  1705
             A+KWYPSF VE+LHDS  D   +KK +KS ++D++SE   D D E NLS RN KKWD LI
Sbjct  469   AEKWYPSFRVELLHDSAQDLGFRKKRAKSSDTDNDSEGSHDSDYEGNLSSRNPKKWDLLI  528

Query  1706  NHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHR  1885
             N VL S+SGLLITTYEQLRLLGEKLLD+EWGYAVLDEGHRIRNPN +++LVCKQLQTVHR
Sbjct  529   NRVLRSESGLLITTYEQLRLLGEKLLDVEWGYAVLDEGHRIRNPNAEISLVCKQLQTVHR  588

Query  1886  IIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRC  2065
             IIMTG+PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPI++GGYANA+PLQVSTAYRC
Sbjct  589   IIMTGAPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPITVGGYANASPLQVSTAYRC  648

Query  2066  AVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGS  2245
             AVVLRDLIMPYLLRRMKADVNAQLPKKTEHV+FCSLT  QR++Y+AFLAS++VEQI DGS
Sbjct  649   AVVLRDLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTEEQRAVYRAFLASSEVEQILDGS  708

Query  2246  KNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFF  2425
             +N+LYGIDVMRKICNHPDLLERE SC++PDYGNPERS KMKVVA+VLK+WKDQGHRVL F
Sbjct  709   RNSLYGIDVMRKICNHPDLLEREQSCQNPDYGNPERSEKMKVVAQVLKVWKDQGHRVLLF  768

Query  2426  SQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGT  2605
             +QTQQMLDILE+FL+  GY+YRRMDG TPVKQRMALIDE+NN+ ++FIFILTT+VGGLGT
Sbjct  769   AQTQQMLDILESFLIASGYEYRRMDGLTPVKQRMALIDEYNNSSDVFIFILTTKVGGLGT  828

Query  2606  NLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHS  2785
             NLTGANRVIIFDPDWNPS D+QARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH 
Sbjct  829   NLTGANRVIIFDPDWNPSTDVQARERAWRIGQKQDVTVYRLITRGTIEEKVYHRQIYKHF  888

Query  2786  LTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEK  2965
             LTNKILKNPQQRR FKAR++KDLF LNDDG  GSTE+S+IFSQLSEDVN+ G Q   ++K
Sbjct  889   LTNKILKNPQQRRFFKARNMKDLFTLNDDGNGGSTETSNIFSQLSEDVNVVGDQKDKEDK  948

Query  2966  DKSIKTNPADHGTAM-ERDNN-----SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIH  3124
              K  K   A+   A+ +++NN     S   G+EK DN   +VDE+T+IL++LFDA+GIH
Sbjct  949   QKHKKAASANADDAVGDKENNLEIGSSRRKGKEKVDNIGDEVDEETNILKSLFDANGIH  1007



>dbj|BAD45511.1| putative RAD26 [Oryza sativa Japonica Group]
Length=789

 Score =  1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/801 (71%), Positives = 667/801 (83%), Gaps = 13/801 (2%)
 Frame = +2

Query  1406  MGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDF  1585
             MGLGKTVQVL+FLGSLH S  YKPSI+VCP+TLLQQW+REA +WYP F VEILHDS N  
Sbjct  1     MGLGKTVQVLSFLGSLHNSGLYKPSIVVCPVTLLQQWRREASRWYPKFKVEILHDSANSS  60

Query  1586  hdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRL  1765
               K K S   +S++  +   +  V  +   +  KKWD LI+ V+ S SGLL+TTYEQLR+
Sbjct  61    SKKSKRSSDSDSEASWDSDQEEAVTCS---KPAKKWDDLISRVVSSGSGLLLTTYEQLRI  117

Query  1766  LGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFD  1945
             LGEKLLDIEWGYAVLDEGHRIRNPN ++TLVCKQLQTVHRIIMTG+PIQNKLSELWSLFD
Sbjct  118   LGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQNKLSELWSLFD  177

Query  1946  FVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADV  2125
             FVFPGKLGVLPVFEAEF+VPI++GGYANATPLQVSTAYRCAVVLRDL+MPYLLRRMKADV
Sbjct  178   FVFPGKLGVLPVFEAEFSVPITVGGYANATPLQVSTAYRCAVVLRDLVMPYLLRRMKADV  237

Query  2126  NAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLL  2305
             NAQLPKKTEHV+FCSLT+ QR+ Y+AFLAS++VEQIFDG++N+LYGIDV+RKICNHPDLL
Sbjct  238   NAQLPKKTEHVLFCSLTTEQRATYRAFLASSEVEQIFDGNRNSLYGIDVLRKICNHPDLL  297

Query  2306  EREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYK  2485
             EREH+ ++PDYGNPERSGKMKVV +VLK+WK+QGHRVL F+QTQQMLDI+ENFL    Y+
Sbjct  298   EREHAAQNPDYGNPERSGKMKVVEQVLKVWKEQGHRVLLFTQTQQMLDIMENFLTACEYQ  357

Query  2486  YRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSND  2665
             YRRMDG TP KQRMALIDEFNNT EIFIFILTT+VGGLGTNLTGANR+II+DPDWNPS D
Sbjct  358   YRRMDGLTPAKQRMALIDEFNNTDEIFIFILTTKVGGLGTNLTGANRIIIYDPDWNPSTD  417

Query  2666  MQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDL  2845
             MQARERAWRIGQ +DVTVYRLITRGTIEEKVYHRQIYKH LTNK+LK+PQQRR FKARD+
Sbjct  418   MQARERAWRIGQTRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKVLKDPQQRRFFKARDM  477

Query  2846  KDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNN  3025
             KDLF L DD  NGSTE+S+IFSQLSEDVNI  P    Q++  +    P   GT    + +
Sbjct  478   KDLFTLQDDDNNGSTETSNIFSQLSEDVNIGVPSDKQQDQLYAASATPTTSGT----EPS  533

Query  3026  SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVA  3205
             S  +G+ K D+     DE+ +IL++LFDA GIHSA++HDAI+NA+D++KL+LE +A++VA
Sbjct  534   SSRHGQGKEDHCPDQADEECNILKSLFDAQGIHSAINHDAIMNANDDQKLRLEAEATQVA  593

Query  3206  QRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESS  3385
             QRAAEALRQSRMLRS ES ++PTWTGR+G AGAP S+++KFGSTLN QLV SS+P E S 
Sbjct  594   QRAAEALRQSRMLRSHESFSVPTWTGRAGAAGAPSSVRRKFGSTLNTQLVNSSQPSETS-  652

Query  3386  MISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAE  3565
               + R   +  GA  GKALSSAELLA+IRG +E A SD LE  HQ N GS+SN  + ++ 
Sbjct  653   --NGRGQSLQVGALNGKALSSAELLARIRGTREGAASDALE--HQLNLGSASNHTSSSSG  708

Query  3566  NG-ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLK  3742
             NG AS  S  S  +QPEVLIRQ+CTFIQ+ GGS SS SI EHF++R+ SKD+ LFKNLLK
Sbjct  709   NGRASSSSTRSMIVQPEVLIRQLCTFIQQHGGSASSTSITEHFKNRILSKDMLLFKNLLK  768

Query  3743  EIATLKKNPNGSFWILKPEYQ  3805
             EIATL++  NG+ W+LKP+YQ
Sbjct  769   EIATLQRGANGATWVLKPDYQ  789



>ref|XP_006479511.1| PREDICTED: DNA repair and recombination protein RAD26-like isoform 
X3 [Citrus sinensis]
Length=1075

 Score =  1040 bits (2690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/863 (66%), Positives = 682/863 (79%), Gaps = 35/863 (4%)
 Frame = +2

Query  155   MEEDEEDRVLFSSLGVTSANPEDIERNIFGQTENGFDASNEAARSMELEATEHNAT----  322
             MEEDE DR+L SSLGVTSANPEDIER++    EN   A N        E   H+ +    
Sbjct  1     MEEDE-DRLLLSSLGVTSANPEDIERDVLAAAENV--AGNSNETEESNEEKPHDKSESID  57

Query  323   -SSTKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQ  499
              SST +  +YNKLRAVE EI AV S  + L      ++   D  D  E+   E E+S  Q
Sbjct  58    PSSTSQEKLYNKLRAVEFEIGAVASTVDHLRRVSTKEDNDIDDGDSTEQDGREDEKSAVQ  117

Query  500   APlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRD  679
             A  ND+ LQ AL ADRLKSL KTKAQL KE+S      T   +         + +  ++D
Sbjct  118   ASPNDMTLQHALTADRLKSLKKTKAQLVKELSHFPKGITSKGI---------EHDKFIQD  168

Query  680   VVKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKG  859
             +VK + +PKR+ KEA+ P K++ K+ KT S+DDD DFD+ L+AAS+GFVET++D+LVRKG
Sbjct  169   LVKEEHRPKRKSKEAQKPGKDRSKQQKTVSVDDDFDFDSALDAASAGFVETKRDELVRKG  228

Query  860   ILTPFHKLKGFERQIQEPGQSSRHSMQD-----NGDLVSTSLANAIQSISEAAQSRPTTK  1024
             ILTPFHKLKGFER IQ+PG S++ ++ D     + D  S S+  A++ +SEAAQ+RP+TK
Sbjct  229   ILTPFHKLKGFERCIQQPGPSNKQNVPDEREARSNDPFSASVDRALRMMSEAAQARPSTK  288

Query  1025  LLDSSLLPKLEPPTYPFQTPRKHVKISQSAEN-----GRNDKRKRRPTPGKKWRVKVSRE  1189
             LLD   LPKL+ PT PFQ  +   ++ QS E+      R+ ++K+RP P KKWR +++RE
Sbjct  289   LLDPESLPKLDGPTRPFQRLKTPFRMPQSEESEVEKKKRSKRKKKRPLPDKKWRKRIARE  348

Query  1190  ------NKDEGPDVEISSYedekddedmddeG--PPFVMLEGGLKIPETIFDKLFDYQKV  1345
                   N+D    +++SSYE+EK ++D D +   PPFV LEGGLKIPE+IF+ LFDYQKV
Sbjct  349   DTRLEENEDSRDSLDMSSYEEEKQEDDEDSDNNEPPFVTLEGGLKIPESIFNNLFDYQKV  408

Query  1346  GVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKRE  1525
             GVQWLWELHCQ+AGGIIGDEMGLGKT+QVL+FLG+LHFSN YKPSI+VCP+TLL+QWKRE
Sbjct  409   GVQWLWELHCQRAGGIIGDEMGLGKTIQVLSFLGALHFSNMYKPSIVVCPVTLLRQWKRE  468

Query  1526  AKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLI  1705
             A+KWYPSF VE+LHDS  D   +KK +KS ++D++SE   D D E NLS RN KKWD LI
Sbjct  469   AEKWYPSFRVELLHDSAQDLGFRKKRAKSSDTDNDSEGSHDSDYEGNLSSRNPKKWDLLI  528

Query  1706  NHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHR  1885
             N VL S+SGLLITTYEQLRLLGEKLLD+EWGYAVLDEGHRIRNPN +++LVCKQLQTVHR
Sbjct  529   NRVLRSESGLLITTYEQLRLLGEKLLDVEWGYAVLDEGHRIRNPNAEISLVCKQLQTVHR  588

Query  1886  IIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRC  2065
             IIMTG+PIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPI++GGYANA+PLQVSTAYRC
Sbjct  589   IIMTGAPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPITVGGYANASPLQVSTAYRC  648

Query  2066  AVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGS  2245
             AVVLRDLIMPYLLRRMKADVNAQLPKKTEHV+FCSLT  QR++Y+AFLAS++VEQI DGS
Sbjct  649   AVVLRDLIMPYLLRRMKADVNAQLPKKTEHVLFCSLTEEQRAVYRAFLASSEVEQILDGS  708

Query  2246  KNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFF  2425
             +N+LYGIDVMRKICNHPDLLERE SC++PDYGNPERS KMKVVA+VLK+WKDQGHRVL F
Sbjct  709   RNSLYGIDVMRKICNHPDLLEREQSCQNPDYGNPERSEKMKVVAQVLKVWKDQGHRVLLF  768

Query  2426  SQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGT  2605
             +QTQQMLDILE+FL+  GY+YRRMDG TPVKQRMALIDE+NN+ ++FIFILTT+VGGLGT
Sbjct  769   AQTQQMLDILESFLIASGYEYRRMDGLTPVKQRMALIDEYNNSSDVFIFILTTKVGGLGT  828

Query  2606  NLTGANRVIIFDPDWNPSNDMQA  2674
             NLTGANRVIIFDPDWNPS D+Q+
Sbjct  829   NLTGANRVIIFDPDWNPSTDVQS  851


 Score =   258 bits (660),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 188/232 (81%), Gaps = 6/232 (3%)
 Frame = +2

Query  3119  IHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTA  3298
             + SAM+HDAI+NAHDEEK++LEEQAS+VAQRAAEALRQSRMLRS++ +++PTWTG+SGTA
Sbjct  849   VQSAMNHDAIMNAHDEEKMRLEEQASQVAQRAAEALRQSRMLRSRDDISVPTWTGKSGTA  908

Query  3299  GAPPSIKKKFGSTLNPQLVTSSKPLE-ESSMISSRRNgiaagasagkalssaellakiRG  3475
             GAP S++KKFGST++ QL+   KPLE  SS  +   N   AGASAGK LSS+ELLA+IRG
Sbjct  909   GAPSSVRKKFGSTVSSQLI---KPLEGSSSNKTGEFNSFGAGASAGKVLSSSELLARIRG  965

Query  3476  NQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKG  3655
             N E A+  GLE   QF   SSS +  R A+   SR S  ++ +QPE+LIRQ+CTF+Q++G
Sbjct  966   NLENAVGAGLE--RQFEVASSSANVARFADTRTSRSSKNASDVQPEILIRQICTFMQQRG  1023

Query  3656  GSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             GS++SA IVEHF+ RVPSKDL LFKNLLKEIATL+K+P+GS W+LKPE+ ++
Sbjct  1024  GSSNSACIVEHFKDRVPSKDLPLFKNLLKEIATLQKDPSGSRWVLKPEFVQQ  1075



>ref|XP_002994066.1| hypothetical protein SELMODRAFT_236903 [Selaginella moellendorffii]
 gb|EFJ04853.1| hypothetical protein SELMODRAFT_236903 [Selaginella moellendorffii]
Length=1046

 Score =  1015 bits (2625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/1019 (53%), Positives = 700/1019 (69%), Gaps = 114/1019 (11%)
 Frame = +2

Query  794   AVLNAASSGFVETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQDNGDLVSTSLA  973
             A L+AAS G VETE+D+L+R G LTPF ++KGFER++Q    S R S++ +  L  TSL+
Sbjct  121   AALDAAS-GLVETERDRLIRTGALTPFDRIKGFERRVQT--LSDRQSLERD-RLAETSLS  176

Query  974   NAIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRKRRPT  1153
             NA+ S++  ++SR TTKLLD + LP LE PT  F+ P K + +      GR  KRKR P 
Sbjct  177   NAVASLAAISRSRATTKLLDPAQLPTLEAPTREFRRPPKSLDV------GRRKKRKR-PL  229

Query  1154  PGKKWRVKV-------SRENKDEGPDVE-----ISSYedekddedmddeGPPFVMLEGGL  1297
             P  KWR K        + ++ D  P +        +Y D  D++  D+E    V+LEGGL
Sbjct  230   PESKWRRKKPHKLPEQAADDNDGMPSLSHLINSFVAYLDGDDNDVNDEECDDDVILEGGL  289

Query  1298  KIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKP  1477
             +IP  I+D+LFDYQK GV+WLWELH  K GGIIGDEMGLGKTVQV+AFL +LH S  Y P
Sbjct  290   RIPLDIYDRLFDYQKTGVKWLWELHSLKTGGIIGDEMGLGKTVQVIAFLAALHHSRMYSP  349

Query  1478  SIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdv  1657
             SI+VCP+TL  QWKRE +KWYP F V+++H+S                  E+E+      
Sbjct  350   SIVVCPVTLTFQWKREVEKWYPKFDVQVVHESA----------APKGKKKEAEDSDASGD  399

Query  1658  ekNLSFRNTK--KWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIR  1831
             +   + R+ +  +WD ++   + S SGL++TTYEQLRLL + LLDI+WGYAVLDEGHRIR
Sbjct  400   DSGDARRDARLARWDGVVEKTVRSPSGLIVTTYEQLRLLKDTLLDIDWGYAVLDEGHRIR  459

Query  1832  NPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPIS  2011
             NP+ + TL+CKQLQTVHRIIMTG+PIQNKL+ELWSLFDFVFPGKLGVLPVF+A+FA+PIS
Sbjct  460   NPDAETTLICKQLQTVHRIIMTGAPIQNKLTELWSLFDFVFPGKLGVLPVFQAQFALPIS  519

Query  2012  IGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRS  2191
             IGGYANAT LQVSTAY+CAV LRDLIMPY+LRRMK+DV A+L KKTEHV+FCSLT  QR+
Sbjct  520   IGGYANATSLQVSTAYKCAVTLRDLIMPYILRRMKSDVEAKLTKKTEHVLFCSLTETQRA  579

Query  2192  IYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKV  2371
              Y+AFLAS+DVE+IF+GSKNALYGID++RKICNHPDLLERE S +  DYG P+RSGK+ V
Sbjct  580   CYRAFLASSDVERIFEGSKNALYGIDILRKICNHPDLLEREASEKHADYGLPDRSGKLMV  639

Query  2372  VAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNN  2551
             V++VL  WKDQGHRVL F QTQQMLDI+E F+ + GY YRRMDG+T VKQR ALIDEFN 
Sbjct  640   VSQVLNSWKDQGHRVLVFCQTQQMLDIVEIFVESQGYTYRRMDGSTSVKQRPALIDEFNE  699

Query  2552  TVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLI  2731
             +  +F+F+LTT+VGGLGTNLTGANRVIIFDPDWNPS DMQARERAWRIGQ KDV VYRLI
Sbjct  700   SSHVFVFLLTTKVGGLGTNLTGANRVIIFDPDWNPSTDMQARERAWRIGQTKDVIVYRLI  759

Query  2732  TRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFS  2911
             TRGTIEEKVYHRQIYK  LTNKIL++PQQRR+FK++D++DLFVL++D E   TE+S++F 
Sbjct  760   TRGTIEEKVYHRQIYKQFLTNKILRDPQQRRVFKSKDMRDLFVLHEDAEGDKTETSNLFP  819

Query  2912  QLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADN---NNGDVDED  3082
             +L                       PA    A E D    ++G E+ D    +  D  ++
Sbjct  820   ELK---------------------LPA----AAESDAKEAAHGGEEGDQITRDEQDGADE  854

Query  3083  TSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESV  3262
             + +L++L  A+GIHSAMDHDAI+  +D E++K++ +ASRVA+RAAEAL+QSR++R ++ V
Sbjct  855   SRLLQSLMQANGIHSAMDHDAILAVNDPERVKVDFEASRVAERAAEALQQSRLIRMRDDV  914

Query  3263  AIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkal  3442
             A+PTWTG SG AGAP   +++FG+ +N +L++ + P       SS               
Sbjct  915   AVPTWTGNSGAAGAPGGGRRRFGAAVNSRLMSPAPPPGTPGASSS---------------  959

Query  3443  ssaellakiRGNQERAIS--DGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEV  3616
                           RA+S  + L    Q  +G+  + R                    E 
Sbjct  960   --------------RALSSVELLAQMRQRQAGAVESKR--------------------EA  985

Query  3617  LIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILK  3793
             L  ++  F++  GGS  S ++V+HF+ ++   +L LF+ LL EIA L K+   S WILK
Sbjct  986   LRSELERFLRSHGGSALSTTVVQHFKLKLSQAELPLFRQLLNEIAALNKDGGESRWILK  1044



>ref|XP_002989066.1| hypothetical protein SELMODRAFT_450679 [Selaginella moellendorffii]
 gb|EFJ09860.1| hypothetical protein SELMODRAFT_450679 [Selaginella moellendorffii]
Length=1043

 Score =  1015 bits (2624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/1016 (53%), Positives = 699/1016 (69%), Gaps = 111/1016 (11%)
 Frame = +2

Query  794   AVLNAASSGFVETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQDNGDLVSTSLA  973
             A L+AAS G VETE+D+L+R G LTPF ++KGFER++Q    S R S++ +  L  TSL+
Sbjct  121   AALDAAS-GLVETERDRLIRTGALTPFDRIKGFERRVQT--LSDRQSLERD-RLAETSLS  176

Query  974   NAIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRKRRPT  1153
             NA+ S++  ++SR TTKLLD + LP LE PT  F+ P K + +      GR  KRKR P 
Sbjct  177   NAVASLAAISRSRATTKLLDPAQLPTLEAPTREFRRPPKSLDV------GRRKKRKR-PL  229

Query  1154  PGKKWRVK-------VSRENKDEGPD--VEISSYedekddedmddeGPPFVMLEGGLKIP  1306
             P  KWR K       ++ ++ D  P     +       D++  D+E    V+LEGGL+IP
Sbjct  230   PESKWRRKKPHKLPELAADDNDGMPSFSCHLILLTHGDDNDVNDEECDDDVILEGGLRIP  289

Query  1307  ETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSII  1486
               I+D+LFDYQK GV+WLWELH  K GGIIGDEMGLGKTVQV+AFL +LH S  Y PSI+
Sbjct  290   LDIYDRLFDYQKTGVKWLWELHSLKTGGIIGDEMGLGKTVQVIAFLAALHHSRMYSPSIV  349

Query  1487  VCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekN  1666
             VCP+TL  QWKRE +KWYP F V+++H+S                  E+E+      +  
Sbjct  350   VCPVTLTFQWKREVEKWYPKFDVQVVHESA----------APKGKKKEAEDSDASGDDSG  399

Query  1667  LSFRNTK--KWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPN  1840
              + R+ +  +WD ++   + S SGL++TTYEQLRLL + LLDI+WGYAVLDEGHRIRNP+
Sbjct  400   DAKRDARLARWDGVVEKTVRSPSGLIVTTYEQLRLLKDTLLDIDWGYAVLDEGHRIRNPD  459

Query  1841  TDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGG  2020
              + TL+CKQLQTVHRIIMTG+PIQNKL+ELWSLFDFVFPGKLGVLPVF+A+FA+PISIGG
Sbjct  460   AETTLICKQLQTVHRIIMTGAPIQNKLTELWSLFDFVFPGKLGVLPVFQAQFALPISIGG  519

Query  2021  YANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQ  2200
             YANAT LQVSTAY+CAV LRDLIMPY+LRRMK+DV A+L KKTEHV+FCSLT  QR+ Y+
Sbjct  520   YANATSLQVSTAYKCAVTLRDLIMPYILRRMKSDVEAKLTKKTEHVLFCSLTETQRACYR  579

Query  2201  AFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAE  2380
             AFLAS+DVE+IF+GSKNALYGID++RKICNHPDLLERE S +  DYG P+RSGK+ VV++
Sbjct  580   AFLASSDVERIFEGSKNALYGIDILRKICNHPDLLEREASEKHADYGLPDRSGKLMVVSQ  639

Query  2381  VLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVE  2560
             VL  WKDQGHRVL F QTQQMLDI+E F+ + GY YRRMDG+T VKQR ALIDEFN +  
Sbjct  640   VLNSWKDQGHRVLVFCQTQQMLDIVEIFVESQGYTYRRMDGSTSVKQRPALIDEFNESSH  699

Query  2561  IFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRG  2740
             +F+F+LTT+VGGLGTNLTGANRVIIFDPDWNPS DMQARERAWRIGQ KDV VYRLITRG
Sbjct  700   VFVFLLTTKVGGLGTNLTGANRVIIFDPDWNPSTDMQARERAWRIGQTKDVIVYRLITRG  759

Query  2741  TIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLS  2920
             TIEEKVYHRQIYK  LTNKIL++PQQRR+FK++D++DLFVL++D E   TE+S++F +L 
Sbjct  760   TIEEKVYHRQIYKQFLTNKILRDPQQRRVFKSKDMRDLFVLHEDAEGDKTETSNLFPELK  819

Query  2921  EDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADN---NNGDVDEDTSI  3091
                                   PA    A E D    ++G E+ D    +  D  +++ +
Sbjct  820   ---------------------LPA----AAESDGKEAAHGGEEGDQITRDEQDGADESRL  854

Query  3092  LRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIP  3271
             L++L  A+GIHSAMDHDAI+  +D E++K++ +ASRVA+RAAEAL+QSR++R ++ VA+P
Sbjct  855   LQSLMQANGIHSAMDHDAILAVNDPERVKVDFEASRVAERAAEALQQSRLIRMRDDVAVP  914

Query  3272  TWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssa  3451
             TWTG SG AGAP   +++FG+ +N +L++ + P       SS                  
Sbjct  915   TWTGNSGAAGAPGGGRRRFGAAVNSRLMSPAPPPGTPGASSS------------------  956

Query  3452  ellakiRGNQERAIS--DGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIR  3625
                        RA+S  + L    Q  +G+  + R                    E L  
Sbjct  957   -----------RALSSVELLAQMRQRQAGAVESKR--------------------EALRS  985

Query  3626  QVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILK  3793
             ++  F++  GGS  S ++V+HF+ ++   +L LF+ LL EIATL K+   S WILK
Sbjct  986   ELERFLRSHGGSALSTTVVQHFKLKLSQAELPLFRQLLNEIATLNKDGGESRWILK  1041



>gb|KGN57893.1| hypothetical protein Csa_3G375720 [Cucumis sativus]
Length=1155

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/865 (62%), Positives = 637/865 (74%), Gaps = 53/865 (6%)
 Frame = +2

Query  161   EDEEDRVLFSSLGVTSANPEDIERNIFGQ----TENGFDASN--EAARSMELEATEHNAT  322
             E+ EDR+  +SLGVTSANPEDIER++  +    +ENG +     E     +L+ T+   +
Sbjct  2     EEVEDRIFLNSLGVTSANPEDIERDLLNEAKKKSENGVEVGGIEEENVCDKLDTTD---S  58

Query  323   SSTKKTDMYNKLRAVETEIQAVKSGFEQLENFRRNDEQVPDREDGHEKRDIETEQSTTQA  502
              S     +Y KLRAVE EI AV S  E  E   RN++      D  +    E   S +  
Sbjct  59    PSASHVQLYQKLRAVEYEIDAVASTVEPGEKLERNEQHSCVSTDSQKHAREEDSVSAS--  116

Query  503   PlndldlqralaadrlKSLLKTKAQLKKEISDLSNDSTHDTLSVLRDIVKEQPNAVLRDV  682
                   LQ ALA DRL+SL KT+ QLK E+  L++      L                ++
Sbjct  117   ---GDGLQHALAVDRLRSLKKTQHQLKNELFHLNDKHAKTIL----------------EI  157

Query  683   VKGQPKPKRRLkeakspsknkkkrikTASLdddddfdAVLNAASSGFVETEKDQLVRKGI  862
             VK + KPKR+ KE K    +  KR+K  S D+D+DFDA L+AA+ GFVETE+D+LVRKGI
Sbjct  158   VKDRSKPKRKSKEVKKSGNDGGKRLKVVSFDEDNDFDAALDAATVGFVETERDELVRKGI  217

Query  863   LTPFHKLKGFERQIQEPGQSS-----------RHSMQDNGDLVSTSLANAIQSISEAAQS  1009
             LTPFHKLKGFER++Q PGQSS           +   ++N D  S S+A A++S+S AAQ+
Sbjct  218   LTPFHKLKGFERRLQSPGQSSLQNPRGSRDEVKEEEEENDDFASDSVARALRSMSVAAQA  277

Query  1010  RPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRK----RRPTPGKKWRVK  1177
             RPTTKLLD   LPKL+PPT PF   +   K+  SAE+    K K    RRP P KK+R +
Sbjct  278   RPTTKLLDPDALPKLDPPTRPFYRLKTPAKVPLSAEDKPTTKTKSKQTRRPLPDKKYRRQ  337

Query  1178  VSRENKDEGPDVEIS-------SYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDY  1336
             ++ E +D+     +S       S  ++  D + D     FV LEGGLKIP++IFD+LFDY
Sbjct  338   IAMEERDKEATENMSDGLATSSSEREDSGDLEDDVNELSFVTLEGGLKIPQSIFDELFDY  397

Query  1337  QKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQW  1516
             QKVGVQWLWELHCQ+AGGIIGDEMGLGKTVQVL+FLG+LHFSN YKPSIIVCP+TL++QW
Sbjct  398   QKVGVQWLWELHCQRAGGIIGDEMGLGKTVQVLSFLGALHFSNIYKPSIIVCPVTLVRQW  457

Query  1517  KREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWD  1696
             KREA+KW P    EILHDS +D    K   +  +   ESE+    D  KN   + TK+WD
Sbjct  458   KREARKWCPRLLAEILHDSAHD-PTYKNMREKSDGSDESEDSEGSDYRKNSQPKGTKRWD  516

Query  1697  KLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQT  1876
              LIN VL S+SGLLITTYEQLRLLG+KLLDIEWGYA+LDEGHRIRNPN +VTLVCKQLQT
Sbjct  517   ALINRVLRSESGLLITTYEQLRLLGDKLLDIEWGYAILDEGHRIRNPNAEVTLVCKQLQT  576

Query  1877  VHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTA  2056
             VHRIIMTGSPIQNKL ELWSLFDFVFPGKLGVLPVFEAEFAVPIS+GGYANA+PLQVSTA
Sbjct  577   VHRIIMTGSPIQNKLKELWSLFDFVFPGKLGVLPVFEAEFAVPISVGGYANASPLQVSTA  636

Query  2057  YRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIF  2236
             YRCAVVLRDLIMPYLLRRMKADVNA LPKKTEHV+FCSLTS QRS+Y+AFLAS++V+ I 
Sbjct  637   YRCAVVLRDLIMPYLLRRMKADVNAHLPKKTEHVLFCSLTSEQRSVYRAFLASSEVKSIL  696

Query  2237  DGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRV  2416
             DG++N+L GIDVMRKICNHPDLLEREH+ ++PDYGNPERSGKMKVV +VLK+WK+QGHRV
Sbjct  697   DGNRNSLSGIDVMRKICNHPDLLEREHAFQNPDYGNPERSGKMKVVEQVLKVWKEQGHRV  756

Query  2417  LFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGG  2596
             L F+QTQQMLDILE FLV GGY YRRMDG TPVKQRMALIDEFNN+ E+F+FILTT+VGG
Sbjct  757   LLFAQTQQMLDILERFLVGGGYTYRRMDGGTPVKQRMALIDEFNNSCEVFVFILTTKVGG  816

Query  2597  LGTNLTGANRVIIFDPDWNPSNDMQ  2671
             LGTNLTGA+RVIIFDPDWNPS DMQ
Sbjct  817   LGTNLTGADRVIIFDPDWNPSTDMQ  841


 Score =   293 bits (750),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 179/322 (56%), Positives = 235/322 (73%), Gaps = 17/322 (5%)
 Frame = +2

Query  2870  DGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKS-----IKTNPADHGTAMERDNNSGS  3034
             DG +GSTE+S+IFS L++ VN+ G Q  +++  KS     +  + AD          SG 
Sbjct  842   DGMDGSTETSNIFSALTDSVNVVGVQKNEKDGQKSSSGSVLFADSADENLCKSEIETSGR  901

Query  3035  NGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRA  3214
             +     +   G  DEDT+IL++LFDAHGIHSA++HD I+NA D EK++LEEQAS+VA+RA
Sbjct  902   SS--SIEGQGGGADEDTNILKSLFDAHGIHSAVNHDIIINADDGEKIRLEEQASQVARRA  959

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVT----SSKPLEES  3382
             AEALRQSRMLRS ESV++PTWTG++GTAGAP S+++KFGST+N  +VT    SS  + ++
Sbjct  960   AEALRQSRMLRSNESVSVPTWTGKAGTAGAPSSVRRKFGSTVNTLVVTNNSKSSNEVSKN  1019

Query  3383  SMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAA  3562
               I    NG AAG S GKALSSA+LLAKIRGNQERAIS GLEHQ   ++ S++N RT   
Sbjct  1020  GTI--HLNGHAAGTSCGKALSSADLLAKIRGNQERAISAGLEHQ---STSSTNNVRTVGV  1074

Query  3563  ENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLK  3742
              +  S   + S  +QPEVLIRQ+CTFI ++GG+ +SASIVEHF+ R+PS DL LFKNLLK
Sbjct  1075  GSSRSSSKNLSV-VQPEVLIRQICTFIHQRGGAAASASIVEHFKDRIPSNDLPLFKNLLK  1133

Query  3743  EIATLKKNPNGSFWILKPEYQE  3808
             EIA L+K+ +GSFW+LK EY++
Sbjct  1134  EIAILEKSSSGSFWVLKAEYKQ  1155



>ref|XP_001764202.1| transcription-coupled repair protein CSB/RAD26 [Physcomitrella 
patens]
 gb|EDQ71043.1| transcription-coupled repair protein CSB/RAD26 [Physcomitrella 
patens]
Length=802

 Score =   962 bits (2486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/818 (59%), Positives = 609/818 (74%), Gaps = 34/818 (4%)
 Frame = +2

Query  1406  MGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSV--N  1579
             MGLGKT+QVL FL  LH S  Y PSI+VCP+TLL+QWKREAKKWYP+F+VEILHDS   +
Sbjct  1     MGLGKTIQVLVFLAGLHNSGMYTPSIVVCPVTLLRQWKREAKKWYPAFNVEILHDSAVAS  60

Query  1580  DFhdkkkgskshesdseseelldvdvekNLSFRNTK----KWDKLINHVLGSDSGLLITT  1747
                  KK  K      E  +  + D  +N   +  K    +WD +I+ V+ S  G+++TT
Sbjct  61    QKSSNKKKRKPKRGSDEEFDEEESDYSENEQEKPVKVKKDRWDGMIDRVVDSSDGIILTT  120

Query  1748  YEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSE  1927
             YEQLR++ +KLLDI WGYA+LDEGHRIRNP+   TL+CKQLQTVHRIIMTG+PIQN+L+E
Sbjct  121   YEQLRIVRDKLLDINWGYAILDEGHRIRNPDAGTTLICKQLQTVHRIIMTGAPIQNRLTE  180

Query  1928  LWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLR  2107
             LWSLFDFVFPGKLGVLPVF+A+F++PI+IGGY+NATPLQVSTAYRCAVVLRDLIMPYLLR
Sbjct  181   LWSLFDFVFPGKLGVLPVFQAQFSLPIAIGGYSNATPLQVSTAYRCAVVLRDLIMPYLLR  240

Query  2108  RMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKIC  2287
             RMK+DV+A LPKKTEHV+FCSLT  QRS Y+AFLAS++VEQIFDG++N+L+GID++RKIC
Sbjct  241   RMKSDVDAHLPKKTEHVLFCSLTKDQRSAYRAFLASSEVEQIFDGNRNSLFGIDILRKIC  300

Query  2288  NHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL  2467
             NHPDLLEREHS   PDYGN ERSGK+KV+A+VL+LWK QGHRVL F+QTQQMLDI+EN++
Sbjct  301   NHPDLLEREHSAGHPDYGNIERSGKLKVLAQVLELWKTQGHRVLLFTQTQQMLDIVENYV  360

Query  2468  VTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPD  2647
              + GY YRRMDG TPVKQRM LIDEFN    +FIFILTT+VGGLGTNL GANRV+IFDPD
Sbjct  361   TSKGYVYRRMDGNTPVKQRMQLIDEFNEGDHVFIFILTTKVGGLGTNLIGANRVVIFDPD  420

Query  2648  WNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRL  2827
             WNPS DMQARERAWRIGQKK+V +YRLITRGTIEEKVYHRQIYKH LTNKIL++PQQRR 
Sbjct  421   WNPSTDMQARERAWRIGQKKEVVIYRLITRGTIEEKVYHRQIYKHFLTNKILRDPQQRRF  480

Query  2828  FKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTA  3007
             FKARD++DLF L +  EN +TE+S++F+++            D +++   K  P      
Sbjct  481   FKARDMRDLFTLQE--ENAATETSTLFAEVGGSNRRQRGTKKDSQEEALNKHRP------  532

Query  3008  MERDNNSGS-NGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLE  3184
              E+DN+  S +GE +        +E++ IL+ LFDA+GIHSAMDHDAI+  H+ E++ ++
Sbjct  533   -EQDNSHNSEDGEPQ--------EEESRILKNLFDANGIHSAMDHDAILGIHESERVMID  583

Query  3185  EQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSS  3364
              +ASRVA+RAA AL+QSR LRS ++V++PTWTGRSG AGAP +++++FGST N +LV SS
Sbjct  584   HEASRVAERAALALQQSRRLRSADNVSVPTWTGRSGVAGAPATVRQRFGSTANARLVASS  643

Query  3365  KPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQ------FN  3526
                +  S  S  +  I   A +    +        R  + +  + G     Q       +
Sbjct  644   SQGQTRSEESGNQPAIGISAGSSAGRAFTSADLLARVRERKLDTPGESSTLQDFFLSTIS  703

Query  3527  SGSSSNSRTRAAENGASRPS----HGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFR  3694
              GS  N+        +  PS    +G   +QPEVLIRQ+CTFIQR+GGS +S+ +V  FR
Sbjct  704   IGSVPNASPSTRPTTSRPPSGPGRNGEIPVQPEVLIRQLCTFIQREGGSVASSHVVNQFR  763

Query  3695  SRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
              R+ S+D+ LF+ LLK+IA L+K    S W+LKPEYQE
Sbjct  764   DRISSRDVPLFRQLLKQIAVLQKGSLESKWVLKPEYQE  801



>ref|XP_003075208.1| Cockayne syndrome group B (ISS), partial [Ostreococcus tauri]
Length=1134

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/1044 (43%), Positives = 616/1044 (59%), Gaps = 136/1044 (13%)
 Frame = +2

Query  806   AASSGFVETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQDNGDLVSTSLANAIQ  985
             A+     ETE+++L+R G+LTPF +L+GFER ++E   SS+ +                 
Sbjct  179   ASKGAATETERERLIRIGVLTPFDRLEGFERAVKERESSSKAA----------------A  222

Query  986   SISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRKRRPTPGKK  1165
             + +   +SR  TK L +  +P+LE    PF +       S+S +    ++R        +
Sbjct  223   ATAAWRESRNKTKTLTAEEMPRLEANARPFASRATRNATSESTKKQMAERRA-------E  275

Query  1166  WRVKV--------SRENKDEG-----PDVEISSYedekddedmddeGPPFVMLEGGLKIP  1306
             W+ K+         +  +  G      D E ++YE+  +++    E   F    GGL IP
Sbjct  276   WKAKMLENDGAVAGKRTRQSGRTMHDSDEEYANYEETAEEDRNVSEEVEFA---GGLSIP  332

Query  1307  ETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSII  1486
                +++L  +QK  ++WLWELHCQ+AGGIIGDEMGLGKTVQV +FL +LH S  Y PSII
Sbjct  333   GDTYERLLPHQKTCLKWLWELHCQRAGGIIGDEMGLGKTVQVSSFLCALHHSGMYSPSII  392

Query  1487  VCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekN  1666
             VCP T+L+QW+RE + W P     ILHDS       K                       
Sbjct  393   VCPATMLRQWRRELRIWAPKLKATILHDSAMSSSSGKT----------------------  430

Query  1667  LSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTD  1846
                   ++ +++ +  +    G+L+TTYEQ+RL  +K+  + WGYAVLDEGH+IRNP+ D
Sbjct  431   ----KARERERVFDMCVRDGDGILVTTYEQMRLFRDKICSVRWGYAVLDEGHKIRNPDAD  486

Query  1847  VTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYA  2026
             +T+V KQLQTVHRI+M+G+PIQN+LSELWSLFDFVFPGKLG LPVF+A+FAVPI IGGY 
Sbjct  487   ITIVSKQLQTVHRIVMSGAPIQNRLSELWSLFDFVFPGKLGTLPVFQAQFAVPIQIGGYT  546

Query  2027  NATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAF  2206
             NA+  QV+TAYRCAV L+DLI PYLLRRMK DV+ +LP+KTE V+FC +T  QR  Y+A+
Sbjct  547   NASNQQVTTAYRCAVTLKDLIAPYLLRRMKCDVDVKLPEKTEQVLFCPMTQEQREAYRAY  606

Query  2207  LASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVL  2386
             LAS +VE+I DGS+ AL GIDV+RKI NHPDLLER       +YG+  RSGK++V  +VL
Sbjct  607   LASREVEEILDGSREALGGIDVLRKIVNHPDLLERRTQAASEEYGDASRSGKLQVTLKVL  666

Query  2387  KLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFN-NTVEI  2563
              LW++QGHR L FSQTQQMLDILE  +   GY YRRMDG T +  RM+LIDEFN N   I
Sbjct  667   SLWREQGHRCLVFSQTQQMLDILEAAVARAGYSYRRMDGNTSIGMRMSLIDEFNDNDKGI  726

Query  2564  FIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGT  2743
             F+F+LTT+VGGLG NLTGANRV++FDPDWNPS D QARERAWRIGQ+K+VTVYRLIT GT
Sbjct  727   FVFLLTTKVGGLGVNLTGANRVMLFDPDWNPSTDAQARERAWRIGQQKEVTVYRLITAGT  786

Query  2744  IEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLND-------DGENGSTESSS  2902
             IEEKVYHRQIYK  LT+K+LK+P+QRR FKARD+ DLF  ++       D   G+ E+  
Sbjct  787   IEEKVYHRQIYKEFLTSKVLKDPKQRRFFKARDMADLFTFDEVACGGGGDESKGTIETVE  846

Query  2903  IFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNS-GSNGEEKADNN------  3061
             +FS++   + + G        ++  +    +HG     DN++      +K D +      
Sbjct  847   LFSEVEGQI-LRGDVEESVISEEGAEDGEVEHGEWDPNDNHAPPKRTAKKIDGHRVRVET  905

Query  3062  --------NGDVDE-DTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRA  3214
                     NGD    D  ILR LFD+  I  AM+HD I+ A   +++    +A RVA+RA
Sbjct  906   ARDPDAHVNGDSGAGDAQILRGLFDSGNIQVAMNHDKIMGAAGVDRMAHNAEAERVARRA  965

Query  3215  AEALRQS-RMLRSQESVAIPTWTGRSGTA-GAPPSIKKKFGSTLNPQLVTSSKPLEESSM  3388
             AEALR S +  R+  +V +PTWTG  G      PS              +  +PL     
Sbjct  966   AEALRLSAQSARAGLAVHVPTWTGNRGAVHSTAPS-------------ASVVRPLGRFGR  1012

Query  3389  ISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAEN  3568
              S +     +  +A  + +  E +A  R +  RA+   LE        SS    T+A + 
Sbjct  1013  TSIQSRSNDSSTAALGSRALLERIAARREDNARAVEADLE--------SSELDETQAND-  1063

Query  3569  GASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEI  3748
                             ++R +   ++ +GG  S++ +++ F+ RV S   ALF+ LLK  
Sbjct  1064  ----------------MMRDIILLLKSRGGRASTSFVIDAFQDRVQSHQHALFRKLLKLA  1107

Query  3749  ATLKKNPNG------SFWILKPEY  3802
             A L+++P        S W+LK E+
Sbjct  1108  ADLERSPTSSREGSTSSWVLKQEF  1131



>emb|CEG01136.1| SNF2-related [Ostreococcus tauri]
Length=1133

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/1044 (43%), Positives = 616/1044 (59%), Gaps = 136/1044 (13%)
 Frame = +2

Query  806   AASSGFVETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQDNGDLVSTSLANAIQ  985
             A+     ETE+++L+R G+LTPF +L+GFER ++E   SS+ +                 
Sbjct  178   ASKGAATETERERLIRIGVLTPFDRLEGFERAVKERESSSKAA----------------A  221

Query  986   SISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRKRRPTPGKK  1165
             + +   +SR  TK L +  +P+LE    PF +       S+S +    ++R        +
Sbjct  222   ATAAWRESRNKTKTLTAEEMPRLEANARPFASRATRNATSESTKKQMAERRA-------E  274

Query  1166  WRVKV--------SRENKDEG-----PDVEISSYedekddedmddeGPPFVMLEGGLKIP  1306
             W+ K+         +  +  G      D E ++YE+  +++    E   F    GGL IP
Sbjct  275   WKAKMLENDGAVAGKRTRQSGRTMHDSDEEYANYEETAEEDRNVSEEVEFA---GGLSIP  331

Query  1307  ETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSII  1486
                +++L  +QK  ++WLWELHCQ+AGGIIGDEMGLGKTVQV +FL +LH S  Y PSII
Sbjct  332   GDTYERLLPHQKTCLKWLWELHCQRAGGIIGDEMGLGKTVQVSSFLCALHHSGMYSPSII  391

Query  1487  VCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekN  1666
             VCP T+L+QW+RE + W P     ILHDS       K                       
Sbjct  392   VCPATMLRQWRRELRIWAPKLKATILHDSAMSSSSGKT----------------------  429

Query  1667  LSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTD  1846
                   ++ +++ +  +    G+L+TTYEQ+RL  +K+  + WGYAVLDEGH+IRNP+ D
Sbjct  430   ----KARERERVFDMCVRDGDGILVTTYEQMRLFRDKICSVRWGYAVLDEGHKIRNPDAD  485

Query  1847  VTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYA  2026
             +T+V KQLQTVHRI+M+G+PIQN+LSELWSLFDFVFPGKLG LPVF+A+FAVPI IGGY 
Sbjct  486   ITIVSKQLQTVHRIVMSGAPIQNRLSELWSLFDFVFPGKLGTLPVFQAQFAVPIQIGGYT  545

Query  2027  NATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAF  2206
             NA+  QV+TAYRCAV L+DLI PYLLRRMK DV+ +LP+KTE V+FC +T  QR  Y+A+
Sbjct  546   NASNQQVTTAYRCAVTLKDLIAPYLLRRMKCDVDVKLPEKTEQVLFCPMTQEQREAYRAY  605

Query  2207  LASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVL  2386
             LAS +VE+I DGS+ AL GIDV+RKI NHPDLLER       +YG+  RSGK++V  +VL
Sbjct  606   LASREVEEILDGSREALGGIDVLRKIVNHPDLLERRTQAASEEYGDASRSGKLQVTLKVL  665

Query  2387  KLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFN-NTVEI  2563
              LW++QGHR L FSQTQQMLDILE  +   GY YRRMDG T +  RM+LIDEFN N   I
Sbjct  666   SLWREQGHRCLVFSQTQQMLDILEAAVARAGYSYRRMDGNTSIGMRMSLIDEFNDNDKGI  725

Query  2564  FIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGT  2743
             F+F+LTT+VGGLG NLTGANRV++FDPDWNPS D QARERAWRIGQ+K+VTVYRLIT GT
Sbjct  726   FVFLLTTKVGGLGVNLTGANRVMLFDPDWNPSTDAQARERAWRIGQQKEVTVYRLITAGT  785

Query  2744  IEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLND-------DGENGSTESSS  2902
             IEEKVYHRQIYK  LT+K+LK+P+QRR FKARD+ DLF  ++       D   G+ E+  
Sbjct  786   IEEKVYHRQIYKEFLTSKVLKDPKQRRFFKARDMADLFTFDEVACGGGGDESKGTIETVE  845

Query  2903  IFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNS-GSNGEEKADNN------  3061
             +FS++   + + G        ++  +    +HG     DN++      +K D +      
Sbjct  846   LFSEVEGQI-LRGDVEESVISEEGAEDGEVEHGEWDPNDNHAPPKRTAKKIDGHRVRVET  904

Query  3062  --------NGDVDE-DTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRA  3214
                     NGD    D  ILR LFD+  I  AM+HD I+ A   +++    +A RVA+RA
Sbjct  905   ARDPDAHVNGDSGAGDAQILRGLFDSGNIQVAMNHDKIMGAAGVDRMAHNAEAERVARRA  964

Query  3215  AEALRQS-RMLRSQESVAIPTWTGRSGTA-GAPPSIKKKFGSTLNPQLVTSSKPLEESSM  3388
             AEALR S +  R+  +V +PTWTG  G      PS              +  +PL     
Sbjct  965   AEALRLSAQSARAGLAVHVPTWTGNRGAVHSTAPS-------------ASVVRPLGRFGR  1011

Query  3389  ISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAEN  3568
              S +     +  +A  + +  E +A  R +  RA+   LE        SS    T+A + 
Sbjct  1012  TSIQSRSNDSSTAALGSRALLERIAARREDNARAVEADLE--------SSELDETQAND-  1062

Query  3569  GASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEI  3748
                             ++R +   ++ +GG  S++ +++ F+ RV S   ALF+ LLK  
Sbjct  1063  ----------------MMRDIILLLKSRGGRASTSFVIDAFQDRVQSHQHALFRKLLKLA  1106

Query  3749  ATLKKNPNG------SFWILKPEY  3802
             A L+++P        S W+LK E+
Sbjct  1107  ADLERSPTSSREGSTSSWVLKQEF  1130



>gb|KHN05865.1| DNA repair and recombination protein RAD26 [Glycine soja]
Length=539

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/580 (64%), Positives = 444/580 (77%), Gaps = 50/580 (9%)
 Frame = +2

Query  2090  MPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGID  2269
             MPYLLRRMKADVNAQLPKKTEHV+FCSLTS Q S Y+AFLASTDVEQI DG +N+LYGID
Sbjct  1     MPYLLRRMKADVNAQLPKKTEHVLFCSLTSEQVSAYRAFLASTDVEQILDGHRNSLYGID  60

Query  2270  VMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLD  2449
             VMRKICNHP+LLER+H+  DPDYGNP+RSGKMKVVA+VLK+WK+QGH VL F+QTQQMLD
Sbjct  61    VMRKICNHPNLLERDHAFDDPDYGNPKRSGKMKVVAQVLKVWKEQGHHVLLFTQTQQMLD  120

Query  2450  ILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRV  2629
             I ENFL T G+ YRRMDG TPVKQRMALIDEFN++ EIFIFILTT+VGGLGTNLTGANRV
Sbjct  121   IFENFLTTSGHIYRRMDGLTPVKQRMALIDEFNDSSEIFIFILTTKVGGLGTNLTGANRV  180

Query  2630  IIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKN  2809
             II+DPDWNPS DMQARERAWRIGQK+DVTVYRLITRGTIEEKVYHRQIYKH LTNKILKN
Sbjct  181   IIYDPDWNPSTDMQARERAWRIGQKRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKILKN  240

Query  2810  PQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNP  2989
             PQQ+R FKARD+KDLF  N DGE GSTE+S+IFSQ+SE+VNI G     + KDK   + P
Sbjct  241   PQQKRFFKARDMKDLFTPNVDGETGSTETSNIFSQISEEVNIIGTHK--ENKDKYKHSQP  298

Query  2990  AD---HGTAMERDNNS--GS---NGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDA  3145
             A+      A+  D+ S  GS    G+EK ++N+  VDE+T+IL++LFDA+GIHSAM+HD 
Sbjct  299   AELDSEDVAVGNDDKSERGSLRGKGKEKVEHNSNKVDEETNILKSLFDANGIHSAMNHDL  358

Query  3146  IVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK  3325
             I+NA DEEK++LEEQAS+VAQRAAEALRQSRM+RS +S A         +   P     K
Sbjct  359   IMNAQDEEKMRLEEQASQVAQRAAEALRQSRMVRSHDSKA---------SNELPNKGTNK  409

Query  3326  FGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGL  3505
                    +  +S K L  + +++                        IRGNQE+AI  GL
Sbjct  410   INGFAAGE--SSGKALSSAELLAQ-----------------------IRGNQEKAIGAGL  444

Query  3506  EHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVE  3685
             EHQ  F   SSS ++ R+ +  +S  +  S+ +QPEVLIR++CTFIQ++GGS  SASIV+
Sbjct  445   EHQ--FGVSSSSTNQARSVDARSSMATENSS-VQPEVLIRKICTFIQQRGGSFDSASIVQ  501

Query  3686  HFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEYQ  3805
             +F+ R+PSKD+ LFKNLLKEIATL K   GS W+LKP+YQ
Sbjct  502   YFKDRIPSKDVVLFKNLLKEIATLHK---GSNWVLKPDYQ  538



>emb|CEG71759.1| hypothetical protein RMATCC62417_07439 [Rhizopus microsporus]
Length=1140

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/878 (44%), Positives = 550/878 (63%), Gaps = 77/878 (9%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             LEGGL+IP  ++  LFDYQK  +QWLWELH Q+ GGI+GDEMGLGKT+Q +AFL SLH+S
Sbjct  301   LEGGLRIPGELWSCLFDYQKTCIQWLWELHRQEVGGILGDEMGLGKTIQAVAFLASLHYS  360

Query  1463  NAYKP---SIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             N   P    ++VCP T+++QW +E   W+P   V ILH S +        + S + + E 
Sbjct  361   NMLGPGKACVVVCPATVMKQWVQEFHSWWPPLRVAILHSSGSGV-KTGTYTSSEDEEMED  419

Query  1634  eelldvdvekNLSFRNTKKW------DKLINHVLGSDSG---------------LLITTY  1750
              E ++   E +  F +  K        K    +LG+ +G               +LITTY
Sbjct  420   AEDVEDVKEDDFEFNSRGKLVFKKKKTKKKKSILGTKAGRRVSALVKKYIKLGGVLITTY  479

Query  1751  EQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSEL  1930
               ++   E LL  +WGY +LDEGH+IRNP+++ TL  KQ +T HRII++G+PIQN L EL
Sbjct  480   SGVQSYREVLLKHQWGYVILDEGHKIRNPDSETTLAVKQFKTPHRIILSGTPIQNNLKEL  539

Query  1931  WSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRR  2110
             WSLFDF+FPG+LG LP+F+++F+VPISIGGYANAT +QV TAY+CA +LRDLI PYLLRR
Sbjct  540   WSLFDFIFPGRLGTLPIFQSQFSVPISIGGYANATNIQVQTAYKCACMLRDLINPYLLRR  599

Query  2111  MKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICN  2290
             MK DV A LPKK E V+FC LT  QR  Y  F+ S +++ I +  +  LYGID++RKICN
Sbjct  600   MKVDVAADLPKKNEQVLFCKLTKPQREAYLQFIHSKEMDAILERRRQVLYGIDIVRKICN  659

Query  2291  HPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV  2470
             HPDL++   +  +PDYGNPERSGKM VV  +LK+WK Q HRVL F QT+QMLDI+E  + 
Sbjct  660   HPDLVDLTITEGNPDYGNPERSGKMVVVRALLKMWKQQHHRVLLFCQTRQMLDIMETMIR  719

Query  2471  TGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDW  2650
                Y+Y RMDG TPV QRMAL++E+N    IF+F+LTT+VGGLG NLTGA+RVI+FDPDW
Sbjct  720   HLDYRYLRMDGTTPVSQRMALVNEYNGNKHIFVFLLTTKVGGLGLNLTGADRVILFDPDW  779

Query  2651  NPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLF  2830
             NPS D+QARERAWR+GQKKDVT+YRL+T GTIEEK+YHRQIYK  LTNKILK+P+Q+R F
Sbjct  780   NPSTDVQARERAWRLGQKKDVTIYRLMTSGTIEEKIYHRQIYKQFLTNKILKDPKQKRFF  839

Query  2831  KARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAM  3010
              A +L+ LF L  + ++  TE+  +F     +V+    +H +Q+++  +K+   +   A+
Sbjct  840   DASNLQSLFTLATE-DSTETETGRLFK--GTEVSYNKKKHTNQDEEGQLKS--LEGVNAL  894

Query  3011  ERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQ  3190
             E+   +G + EE+   N  + +ED  +L++LF+  GI SA+ HD I+N+   + + +E +
Sbjct  895   EQ--YAGEHFEEEEHKNRLEQEED-HVLQSLFEMTGIQSALQHDQIINSDTHDAMIVERE  951

Query  3191  ASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKP  3370
             A+ VAQRAA AL++SR LR    +  PTWTGRSG+AGAP  + +K   T  P+   S   
Sbjct  952   ANLVAQRAAAALKESRRLRRAMDIGTPTWTGRSGSAGAPRYVFQKRSETPPPRFGQS---  1008

Query  3371  LEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSR  3550
             + + +M  +  +                           +   G+    + +  +  +SR
Sbjct  1009  MNDDTMSDTSTS---------------------------SFGSGIISGFKGSGNAKPSSR  1041

Query  3551  TRAA----ENGASRPSHGSAGMQP---------EVLIRQVCTFIQRKGGSTSSASIVEHF  3691
             T  A       A +    + G  P         E +I ++  F+    G  +S  I+++ 
Sbjct  1042  TLLARIKERKAAVKDDTTAEGSVPVTVLDDATREGMIVKLRDFLSEHEGRATSQEIMDNL  1101

Query  3692  RSRVPSKDLALFKNLLKEIATLKKNPNG-SFWILKPEY  3802
                +  + + +F+ +L++IA  +KN  G   W+LK E+
Sbjct  1102  TLNIKKEQVIIFRKMLQQIAKFEKNEQGKGVWVLKEEF  1139



>emb|CEG84102.1| Putative YALI0C16643p [Rhizopus microsporus]
Length=871

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/874 (45%), Positives = 549/874 (63%), Gaps = 69/874 (8%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             LEGGL++P  ++  LFDYQK  VQWLWELH Q+ GGI+GDEMGLGKT+Q +AFL SLH+S
Sbjct  32    LEGGLRVPGELWSCLFDYQKTCVQWLWELHRQEVGGILGDEMGLGKTIQAVAFLASLHYS  91

Query  1463  NAYKP---SIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             N   P    ++VCP T+++QW +E   W+P   V ILH S +        + S + + E 
Sbjct  92    NMLGPGKACVVVCPATVMKQWVQEFHSWWPPLRVAILHSSGSGI-KTGTYTSSEDEEMED  150

Query  1634  eelldvdvekNLSFRNTKKW------DKLINHVLGSDSG---------------LLITTY  1750
              E ++   E +  F +  K        K    +LG+ +G               +LITTY
Sbjct  151   VEDVEDVKEDDFEFNSRGKLVFKKKKTKKKKSILGTKAGRRVSALVKKYIKLGGVLITTY  210

Query  1751  EQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSEL  1930
               ++   E LL  +WGY VLDEGH+IRNP+++ TL  KQ +T HRII++G+PIQN L EL
Sbjct  211   SGVQSYREVLLKHQWGYVVLDEGHKIRNPDSETTLAVKQFKTPHRIILSGTPIQNNLKEL  270

Query  1931  WSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRR  2110
             WSLFDF+FPG+LG LP+F+++F+VPISIGGYANAT +QV TAY+CA +LRDLI PYLLRR
Sbjct  271   WSLFDFIFPGRLGTLPIFQSQFSVPISIGGYANATNIQVQTAYKCACMLRDLINPYLLRR  330

Query  2111  MKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICN  2290
             MK DV A LPKK E V+FC LT  QR  Y  F+ S +++ I +  +  LYGID++RKICN
Sbjct  331   MKVDVAADLPKKNEQVLFCKLTKPQREAYLQFIHSKEMDAILERRRQVLYGIDIVRKICN  390

Query  2291  HPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV  2470
             HPDL++   +  +P+YGNPERSGKM VV  +LK+WK Q HRVL F QT+QMLDI+E  + 
Sbjct  391   HPDLVDLTITEGNPNYGNPERSGKMVVVRALLKMWKQQHHRVLLFCQTRQMLDIMETMIR  450

Query  2471  TGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDW  2650
                Y+Y RMDG TPV QRMAL++E+N+   IF+F+LTT+VGGLG NLTGA+RVI+FDPDW
Sbjct  451   RLDYRYLRMDGTTPVNQRMALVNEYNDNKHIFVFLLTTKVGGLGLNLTGADRVILFDPDW  510

Query  2651  NPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLF  2830
             NPS D+QARERAWR+GQKKDVT+YRL+T GTIEEK+YHRQIYK  LTNKILK+P+Q+R F
Sbjct  511   NPSTDVQARERAWRLGQKKDVTIYRLMTSGTIEEKIYHRQIYKQFLTNKILKDPKQKRFF  570

Query  2831  KARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAM  3010
              A +L+ LF L  + ++  TE+  +F     +V+    +  +Q+ +  +K+   +   A+
Sbjct  571   DASNLQSLFTLATE-DSTETETGRLFK--GTEVSYNKKKQTNQDDEGQLKS--LEGVNAL  625

Query  3011  ERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQ  3190
             E+   +G + EE+   N  + +ED  +L++LF+  GI SA+ HD I+N+   + + +E +
Sbjct  626   EQ--YAGEHFEEEEHKNRLEQEED-HVLQSLFEMTGIQSALQHDQIINSDTHDAMIVERE  682

Query  3191  ASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK--------FGSTLNP  3346
             A+ VAQRAA AL++SR LR    +  PTWTGRSG+AGAP  + +K        FG ++N 
Sbjct  683   ANLVAQRAAAALKESRRLRRAMDIGTPTWTGRSGSAGAPRYVFQKRSETPPPRFGQSMND  742

Query  3347  QLVT-SSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQF  3523
               ++ +S     S +IS  +                       GN + +    L    + 
Sbjct  743   DTMSDTSTSSFGSGIISGFKGS---------------------GNAKPSSRALLARIKER  781

Query  3524  NSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRV  3703
              +    ++ T       S P         E +I ++  F+    G  +S  I+++    +
Sbjct  782   KAAVKDDTTTE-----GSVPVTVLDDATREGMIVKLRDFLSDHEGRATSQEIMDNLTLNI  836

Query  3704  PSKDLALFKNLLKEIATLKKNPNG-SFWILKPEY  3802
               + + +F+ +L++IA  +KN  G   W+LK E+
Sbjct  837   KKEQVIIFRKMLQQIAKFEKNEQGKGVWVLKEEF  870



>ref|XP_005706328.1| chromatin remodeling complex / DNA-dep ATPase [Galdieria sulphuraria]
 gb|EME29808.1| chromatin remodeling complex / DNA-dep ATPase [Galdieria sulphuraria]
Length=924

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/846 (45%), Positives = 508/846 (60%), Gaps = 108/846 (13%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
             V  +GGL++P  I+D+LF YQ+VGVQWLWELHCQ  GGI+GDEMGLGKT+QV+  L SL 
Sbjct  182   VCFDGGLRLPADIYDRLFPYQQVGVQWLWELHCQGVGGIVGDEMGLGKTIQVIVLLASLS  241

Query  1457  FSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             +S+    P  IV P TLL QWKRE   W+PSF V I+H S  D                 
Sbjct  242   YSHLLPGPVCIVAPATLLSQWKREFATWWPSFRVRIMHKSAGDG----------------  285

Query  1634  eelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLD  1813
                                 D  I   +     +L+T+YEQ+R   E +L  +W Y +LD
Sbjct  286   --------------------DLWIVEDIIEQGDILVTSYEQVRRFHEYILVHKWDYVILD  325

Query  1814  EGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAE  1993
             EGHRIRNP+ ++TLVCK+ +TVHRIIMTG+P+QN+L ELWSLFDFV+PGKLG LPVFE +
Sbjct  326   EGHRIRNPDAEITLVCKRFKTVHRIIMTGAPLQNRLKELWSLFDFVYPGKLGTLPVFEEQ  385

Query  1994  FAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSL  2173
             F+VPI++G Y NATPLQV TAY+CA VLR+L+ PYLLRR+K DV  QLPKK E ++FC L
Sbjct  386   FSVPITLGSYLNATPLQVHTAYKCASVLRNLVSPYLLRRLKKDVALQLPKKQEQILFCKL  445

Query  2174  TSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPER  2353
             T  QR +Y+ +L S +++++  GS N L  + V+RKICNHPDL +      D  YG   R
Sbjct  446   TKEQRELYKKYLNSRELQKVLQGSVNMLTAVSVLRKICNHPDLYDENALEDDRRYGEWTR  505

Query  2354  SGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMAL  2533
             +GK+ V+ +VL  W     RVL FSQ++ MLDILE F     Y Y RMDG T +++RM L
Sbjct  506   AGKLVVLDQVLLSWSKDDSRVLIFSQSRAMLDILEMFARQRRYTYLRMDGETAMQERMKL  565

Query  2534  IDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDV  2713
             ID FN   E+F+F+LTT+VGGLG NLTGANRV+++DPDWNPS D+QARERAWRIGQK+DV
Sbjct  566   IDSFNQDDEVFLFLLTTKVGGLGINLTGANRVVLYDPDWNPSTDLQARERAWRIGQKRDV  625

Query  2714  TVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTE  2893
              +YRL+T GTIEEK+YHRQI+K  LTNK+LK+ QQ R F+ +DL DLF L D+ E+G TE
Sbjct  626   IIYRLVTSGTIEEKIYHRQIFKQLLTNKVLKDAQQTRFFRPKDLFDLFTLGDEYEDG-TE  684

Query  2894  SSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDV  3073
             +  +FS  S  V  TG +                     +R  N     E   DN     
Sbjct  685   TGDLFSGTSA-VEWTGSR--------------------FQRSENEEDCAESDKDNCIEST  723

Query  3074  DEDTSILRTLFDAHGIHSAMDHDAIVNA--HDEEKLKLEEQASRVAQRAAEALRQSRMLR  3247
             +E T +L+ L D   +HSAMDHDA+++   +  ++  LEE+A +VA  A E LR+SR+ R
Sbjct  724   NE-TRLLKELLDGKSLHSAMDHDAVLDVLGNGTDRQLLEEEAMKVATDALENLRKSRVAR  782

Query  3248  SQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagas  3427
              Q S+ +PTWTG +G AGA      +FG             ++ +S+  SR+        
Sbjct  783   QQSSIFMPTWTGNAGEAGALSV--PRFGR------------VKATSVTPSRK--------  820

Query  3428  agkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQ  3607
                                    + L+++   NS S      R    G       S G +
Sbjct  821   -----------------------ESLDNEKYTNSSSEILRDIRKQSLGVVGGELKSQGNR  857

Query  3608  PEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSF-W  3784
               +L+ ++C F++++ G  ++  IV  FR ++ S  L +FK LLK++AT     +G+  W
Sbjct  858   HVMLMEELCQFLRQRQGKATTTEIVSTFREQISSDALLIFKQLLKQVATKTCEESGALVW  917

Query  3785  ILKPEY  3802
              LK E+
Sbjct  918   SLKEEF  923



>ref|XP_003057492.1| ran-binding dexh-box helicase [Micromonas pusilla CCMP1545]
 gb|EEH59137.1| ran-binding dexh-box helicase [Micromonas pusilla CCMP1545]
Length=1514

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/754 (49%), Positives = 483/754 (64%), Gaps = 105/754 (14%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
             V+ +GGL++P   +D+L ++QK  ++WLWE+HCQ+AGG++GDEMGLGKTVQV AFL +L 
Sbjct  628   VIFDGGLRLPAETYDRLLEHQKTSIKWLWEIHCQRAGGVVGDEMGLGKTVQVAAFLCALE  687

Query  1457  FSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsese  1636
              S  Y+P++IVCP T+L+QW+RE + W P  +  ILH+S      +     S +      
Sbjct  688   RSGLYQPTLIVCPATMLRQWRRELRAWAPKLNCGILHESAVSAASRAAARGSKKQARC--  745

Query  1637  elldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDE  1816
                                  +I   +    G+L+TTYE LR++ + LL + WGYA+LDE
Sbjct  746   --------------------NIIRERVRDPKGVLLTTYEHLRVMRDHLLPVRWGYAILDE  785

Query  1817  GHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEF  1996
             GH+IRNP+ DVT+  KQLQTVHR++MTG+PIQN+L+ELWSLFDF FPGKLG LPVF+A+F
Sbjct  786   GHKIRNPDADVTICAKQLQTVHRLVMTGAPIQNRLAELWSLFDFCFPGKLGTLPVFQAQF  845

Query  1997  AVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLT  2176
             AVPI +GGY+NA+  QV+TAYRCA +L++LI PYLLRRMKADV+ QLP KTE V+FC +T
Sbjct  846   AVPIQVGGYSNASQQQVTTAYRCASMLKELISPYLLRRMKADVDIQLPTKTEQVLFCPMT  905

Query  2177  SVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERS  2356
               QR  Y+A++ S DVE+I +G + AL GIDV+RKI NHPDLLER        YG  ERS
Sbjct  906   QEQREAYRAYVHSRDVEEILEGRREALGGIDVLRKIVNHPDLLERRTKAAHEKYGEVERS  965

Query  2357  GKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALI  2536
             GK  V  +VL+LWK+QGHRVL FSQTQQMLDILE  +   GY YRRMDGATPV QRM LI
Sbjct  966   GKQLVTQKVLELWKEQGHRVLLFSQTQQMLDILEAMVAKAGYPYRRMDGATPVSQRMTLI  1025

Query  2537  DEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVT  2716
             DEFN    +F+F+LTT+VGGLG NLTGA+RV+++DPDWNPS D QARERAWRIGQ ++VT
Sbjct  1026  DEFNTDANVFVFLLTTKVGGLGVNLTGADRVLLYDPDWNPSTDAQARERAWRIGQTREVT  1085

Query  2717  VYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDD------GE  2878
             VYRL+T GTIEEKVYHRQIYK  LT+K+LK+P+QRR FKA+DL DLF   +D      G 
Sbjct  1086  VYRLVTAGTIEEKVYHRQIYKEFLTSKVLKDPKQRRFFKAKDLADLFTWEEDNHGQGVGG  1145

Query  2879  NGSTESSSIFSQL-------------------------------SEDVNITGPQHPDQ--  2959
             +G  E++ +F+++                               ++D++   P+  D   
Sbjct  1146  DGQIETAELFAEVEGEIRAADVAEAEDDEAEDEDEDDGGVGGLTAKDIDGASPESADDTA  1205

Query  2960  ------------EKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTL  3103
                            K+ K+ P      +  D ++G+    +A    G  D D +I+R+L
Sbjct  1206  WDIDADPAAAAAAARKAAKSKPGGKRFTIATDRSAGA----RAAQTGG--DGDAAIMRSL  1259

Query  3104  F--------------------DAHGIHSAMDHDAIVNA-HDEEKL-----KLEEQASRVA  3205
             F                     A  I  AM HDAI+ A +  + L         +A RVA
Sbjct  1260  FGGGGGGGGTGAEGAAGEPSTGAGLIRGAMSHDAIMRAPNGRDHLVGGGGSAALEADRVA  1319

Query  3206  QRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
             +RA EALRQSR+ R    VA+PTWTGRSG AGAP
Sbjct  1320  RRAEEALRQSRVARGSAGVAVPTWTGRSGAAGAP  1353



>emb|CEG71760.1| hypothetical protein RMATCC62417_07439 [Rhizopus microsporus]
Length=1068

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/714 (51%), Positives = 491/714 (69%), Gaps = 33/714 (5%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             LEGGL+IP  ++  LFDYQK  +QWLWELH Q+ GGI+GDEMGLGKT+Q +AFL SLH+S
Sbjct  301   LEGGLRIPGELWSCLFDYQKTCIQWLWELHRQEVGGILGDEMGLGKTIQAVAFLASLHYS  360

Query  1463  NAYKP---SIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             N   P    ++VCP T+++QW +E   W+P   V ILH S +        + S + + E 
Sbjct  361   NMLGPGKACVVVCPATVMKQWVQEFHSWWPPLRVAILHSSGSGV-KTGTYTSSEDEEMED  419

Query  1634  eelldvdvekNLSFRNTKKW------DKLINHVLGSDSG---------------LLITTY  1750
              E ++   E +  F +  K        K    +LG+ +G               +LITTY
Sbjct  420   AEDVEDVKEDDFEFNSRGKLVFKKKKTKKKKSILGTKAGRRVSALVKKYIKLGGVLITTY  479

Query  1751  EQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSEL  1930
               ++   E LL  +WGY +LDEGH+IRNP+++ TL  KQ +T HRII++G+PIQN L EL
Sbjct  480   SGVQSYREVLLKHQWGYVILDEGHKIRNPDSETTLAVKQFKTPHRIILSGTPIQNNLKEL  539

Query  1931  WSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRR  2110
             WSLFDF+FPG+LG LP+F+++F+VPISIGGYANAT +QV TAY+CA +LRDLI PYLLRR
Sbjct  540   WSLFDFIFPGRLGTLPIFQSQFSVPISIGGYANATNIQVQTAYKCACMLRDLINPYLLRR  599

Query  2111  MKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICN  2290
             MK DV A LPKK E V+FC LT  QR  Y  F+ S +++ I +  +  LYGID++RKICN
Sbjct  600   MKVDVAADLPKKNEQVLFCKLTKPQREAYLQFIHSKEMDAILERRRQVLYGIDIVRKICN  659

Query  2291  HPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV  2470
             HPDL++   +  +PDYGNPERSGKM VV  +LK+WK Q HRVL F QT+QMLDI+E  + 
Sbjct  660   HPDLVDLTITEGNPDYGNPERSGKMVVVRALLKMWKQQHHRVLLFCQTRQMLDIMETMIR  719

Query  2471  TGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDW  2650
                Y+Y RMDG TPV QRMAL++E+N    IF+F+LTT+VGGLG NLTGA+RVI+FDPDW
Sbjct  720   HLDYRYLRMDGTTPVSQRMALVNEYNGNKHIFVFLLTTKVGGLGLNLTGADRVILFDPDW  779

Query  2651  NPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLF  2830
             NPS D+QARERAWR+GQKKDVT+YRL+T GTIEEK+YHRQIYK  LTNKILK+P+Q+R F
Sbjct  780   NPSTDVQARERAWRLGQKKDVTIYRLMTSGTIEEKIYHRQIYKQFLTNKILKDPKQKRFF  839

Query  2831  KARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAM  3010
              A +L+ LF L  + ++  TE+  +F     +V+    +H +Q+++  +K+   +   A+
Sbjct  840   DASNLQSLFTLATE-DSTETETGRLFK--GTEVSYNKKKHTNQDEEGQLKS--LEGVNAL  894

Query  3011  ERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQ  3190
             E+   +G + EE+   N  + +ED  +L++LF+  GI SA+ HD I+N+   + + +E +
Sbjct  895   EQ--YAGEHFEEEEHKNRLEQEED-HVLQSLFEMTGIQSALQHDQIINSDTHDAMIVERE  951

Query  3191  ASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQL  3352
             A+ VAQRAA AL++SR LR    +  PTWTGRSG+AGAP  + +K   T  P+ 
Sbjct  952   ANLVAQRAAAALKESRRLRRAMDIGTPTWTGRSGSAGAPRYVFQKRSETPPPRF  1005



>ref|XP_007514075.1| DNA repair and recombination protein RAD26 [Bathycoccus prasinos]
 emb|CCO15512.1| DNA repair and recombination protein RAD26 [Bathycoccus prasinos]
Length=1189

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/860 (46%), Positives = 523/860 (61%), Gaps = 81/860 (9%)
 Frame = +2

Query  797   VLNAASSGFVETEKDQLVRKGILTPFHKLKGFER-QIQEPGQSSRHS----MQDNGDLVS  961
             +L   S+G  ETE+++L+R G +TPF +L GF++ +  E G+  +            L +
Sbjct  203   LLGGGSNG--ETERERLIRIGAMTPFDRLDGFDKARTDEAGKKLKEKAALLQSAKSKLKT  260

Query  962   TSLANAIQSISEAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRK  1141
               L +A + + E   SR   + +   + P     +   +      K  +     + +K+K
Sbjct  261   IDLKDAPKQM-EKMHSRAIGEAISRRVKPTKNGDSAAKKKLALKRKQWKEQSEQQQNKKK  319

Query  1142  RRPTPGKKWRVKVSRENKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFD  1321
                +  KK R      + DE          D  +D D   E    V  EGGL +    F 
Sbjct  320   NGASARKKRRSSFQAYSSDEE-----ELDGDADEDGDDVIEAEEDVEFEGGLSVDGDRFA  374

Query  1322  KLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLT  1501
             KL  +QK  V+WLWELHCQ+AGGIIGDEMGLGKTVQV AFLG+L  SN Y+ S++VCP T
Sbjct  375   KLLPHQKTAVKWLWELHCQRAGGIIGDEMGLGKTVQVAAFLGALSKSNLYQASVVVCPAT  434

Query  1502  LLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRN  1681
             +L+QW+RE K W P     +LHDS                        D     N + +N
Sbjct  435   MLRQWRRELKIWAPELKPVVLHDSA--------------------ITQDALKVANGNRKN  474

Query  1682  TKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVC  1861
               K    I +      GL+ITTYE LR + E LL + WGYAVLDEGH+IRNP  D+T+V 
Sbjct  475   AMK--NAIRNATRDPKGLVITTYECLRGMREDLLTVRWGYAVLDEGHKIRNPEADITVVS  532

Query  1862  KQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPL  2041
             K+L+TVHRIIMTG+P+QN+LSELWSL DFV+PGKLG LPVF+A+FAVPI IGGY NA+  
Sbjct  533   KRLRTVHRIIMTGAPVQNRLSELWSLIDFVYPGKLGTLPVFQAQFAVPIQIGGYVNASDQ  592

Query  2042  QVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTD  2221
               +TAYRCAV L+DLI PYLLRR+K D++  LP KTE V+FC +T  QR  Y+ FL+S +
Sbjct  593   AATTAYRCAVALKDLISPYLLRRLKQDLDINLPDKTEQVLFCPMTENQRDAYKGFLSSRE  652

Query  2222  VEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKD  2401
             VE I DG + AL GIDV+RKI NHPDLLER     D +YG+P RSGK++V  ++L +WK 
Sbjct  653   VEDIIDGRREALGGIDVLRKIVNHPDLLERNSRAGDANYGDPVRSGKLQVALKILSMWKS  712

Query  2402  QGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVE-------  2560
             QGHR L FSQTQQMLDILE  +   GY YRRMDG TPV  RM L+D FN+          
Sbjct  713   QGHRCLVFSQTQQMLDILEQAVANEGYTYRRMDGTTPVAHRMGLVDSFNDAGNVGEEGVA  772

Query  2561  -------IFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTV  2719
                    +F+F+LTT+VGGLG NLTGANRV++FDPDWNPS D QARERAWRIGQ K VT+
Sbjct  773   AEDMQEPVFVFLLTTKVGGLGINLTGANRVLLFDPDWNPSTDAQARERAWRIGQTKAVTI  832

Query  2720  YRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN------  2881
             YRLIT GTIEEKVYHRQIYK  LT K+LK+P+QRR FKARD+ DLF  +D  E       
Sbjct  833   YRLITTGTIEEKVYHRQIYKEFLTGKVLKDPKQRRFFKARDMMDLFAYDDPEEKQRGGGV  892

Query  2882  ---------GSTESSSIFSQLSEDVNITGPQHPDQEK------DKSI---KTNPADHGTA  3007
                       + E++ +F+++  ++     +  D+E       D+S+   +T  A++GT 
Sbjct  893   AGSAAMGGGAANETAELFAEVEGEILAADCKDEDEESLITVEGDESLEEGETTTANNGTI  952

Query  3008  ME---RDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAH-GIHSAMDHDAIVNAHDEEKL  3175
             +E   R   +  N   K DN  G    D +IL++LFD   G+HSAM HD I++A D ++ 
Sbjct  953   VEGVQRVETNRLNVNNKDDNGKG----DAAILKSLFDGEGGLHSAMCHDKILSAADSDRR  1008

Query  3176  KLEEQASRVAQRAAEALRQS  3235
                  A R+A++AAEA+++S
Sbjct  1009  AKIAFADRIARQAAEAVKRS  1028



>ref|XP_501912.1| YALI0C16643p [Yarrowia lipolytica]
 emb|CAG82232.1| YALI0C16643p [Yarrowia lipolytica CLIB122]
Length=1085

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/719 (51%), Positives = 479/719 (67%), Gaps = 30/719 (4%)
 Frame = +2

Query  1280  MLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHF  1459
             +LEG  K+P  IF+ LFDYQK  VQWLWELH QK GGIIGDEMGLGKT+Q+++FL  LH 
Sbjct  280   ILEGNFKVPGEIFNALFDYQKTCVQWLWELHTQKTGGIIGDEMGLGKTIQIISFLAGLHH  339

Query  1460  SNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsese  1636
             S    KP I+VCP T+++QW  E  KW+P+  V ILH         +      +   E +
Sbjct  340   SGLLTKPVIVVCPATVMKQWVEEFHKWWPALRVVILH------SMGEGSKGKKKRKGEID  393

Query  1637  elldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDE  1816
                D D     +  +TK   + I+ V   D  +++TTY  L+     LLD EWGY +LDE
Sbjct  394   SDDDDDEMIRPTPSSTKNLVETIDKVF-KDGHVVVTTYAGLKSYRSLLLDREWGYCILDE  452

Query  1817  GHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEF  1996
             GH+IRNP++ +TL CKQL+TVHR+I++G+PIQN L+ELWSL DFV PG+LG LPVF ++F
Sbjct  453   GHKIRNPDSQITLDCKQLKTVHRLILSGTPIQNNLTELWSLLDFVCPGRLGTLPVFHSQF  512

Query  1997  AVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLT  2176
             AVPI++GGYANAT +QV TAY+CAVVLRDLI PYLLRRMK DV   LPKK E V+FC LT
Sbjct  513   AVPINVGGYANATNIQVQTAYKCAVVLRDLIAPYLLRRMKTDVATDLPKKEEKVLFCKLT  572

Query  2177  SVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPD--YGNPE  2350
               QR  Y+ FL S +++ I  G + +L+GID++RKICNHPDL  RE   +  D  YG+P 
Sbjct  573   DSQRLHYKGFLKSEELKSILAGKRQSLFGIDILRKICNHPDLASREILKKTADYYYGDPA  632

Query  2351  RSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTG-GYKYRRMDGATPVKQRM  2527
             +SGKM+VV  ++ LWK QGHR L F QT+QML+ILE+F       KY RMDG TP+ +R 
Sbjct  633   KSGKMQVVKALVDLWKKQGHRTLLFCQTRQMLEILEDFFANMPDIKYLRMDGTTPISKRQ  692

Query  2528  ALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKK  2707
              ++D +N      +F+LTTRVGGLG NLTGANRVIIFDPDWNPS D+QARER+WR+GQK+
Sbjct  693   DMVDTYNKDTSYDLFLLTTRVGGLGVNLTGANRVIIFDPDWNPSTDLQARERSWRLGQKR  752

Query  2708  DVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGS  2887
             +V VYRL+T GTIEEK+YHRQI+K  LTNKILK+ +QRR FK  D+ DLF L DDGE  +
Sbjct  753   NVVVYRLMTAGTIEEKIYHRQIFKQFLTNKILKDAKQRRFFKMNDIHDLFSL-DDGEGDT  811

Query  2888  TESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNG  3067
             TE+  IFS   + +    P+   ++ D   +    +  + +E+  N     EE+A++N+G
Sbjct  812   TETGMIFSGSEKKIENKKPEKKMKDDDDFYQVVGLNGVSKLEKFENG---EEERAESNDG  868

Query  3068  DVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLR  3247
             D D++  IL  +F   G+HSA++HDAI++A   E + +E +A RVA+ AA+ALR SR   
Sbjct  869   DNDDN--ILNDIFSQTGVHSALEHDAIMDASRPETVIIEREAKRVAEVAAKALRDSRKKA  926

Query  3248  SQESVAIPTWTGRSGTA-------------GAPPSIKKKFGSTLNPQLVTSSKPLEESS  3385
                 +   TWTG+ G+A             G P     KF S+   Q + + K LEES+
Sbjct  927   QANDIGTVTWTGKFGSAGKFGKKKQSAGKVGVPKFGSDKFSSSSILQNIKAKKSLEEST  985



>ref|XP_005652138.1| hypothetical protein COCSUDRAFT_34894 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27594.1| hypothetical protein COCSUDRAFT_34894 [Coccomyxa subellipsoidea 
C-169]
Length=735

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/808 (48%), Positives = 519/808 (64%), Gaps = 86/808 (11%)
 Frame = +2

Query  1406  MGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDF  1585
             MGLGKTVQ+  FL  LH S  ++PSIIVCP T+L+QW RE + WYP F V +LH+S    
Sbjct  1     MGLGKTVQLAVFLAGLHHSGRFRPSIIVCPATVLRQWLRELRLWYPPFRVIVLHES----  56

Query  1586  hdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRL  1765
                                         + R +++  KL+  V  S +G+L+T+Y+QLRL
Sbjct  57    -----------------------QRSGNAPRPSRQ--KLVQLVKNSQAGILLTSYDQLRL  91

Query  1766  LGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFD  1945
                +LL + WGYA+LDEGH+IRNP+ ++TLV KQL TVHRIIM+GSPIQN L+ELWSLFD
Sbjct  92    QRSELLAVNWGYAILDEGHKIRNPDAEITLVAKQLATVHRIIMSGSPIQNHLTELWSLFD  151

Query  1946  FVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADV  2125
             FVFPGKLG LPVF A+FA+PI IGGYANA+ +QVSTA++CAVVLRDLI PYLLRR KADV
Sbjct  152   FVFPGKLGTLPVFRAQFALPIQIGGYANASAMQVSTAFKCAVVLRDLIAPYLLRRRKADV  211

Query  2126  NAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLL  2305
               QLPKKTE V+FCSLT+ QR +Y+++LAS +V+ I +  +NAL GID++RKICNHPDLL
Sbjct  212   AQQLPKKTEQVLFCSLTTDQRDLYRSYLASDEVQDILNDRRNALAGIDILRKICNHPDLL  271

Query  2306  EREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYK  2485
             +R        YG+P RSGK+ V  +VL+ WK QGH+ LFF+QTQQMLDI+E  +   G++
Sbjct  272   QRRQWESTEKYGDPVRSGKLVVALKVLQHWKQQGHKALFFTQTQQMLDIVERAVQAAGFR  331

Query  2486  YRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSND  2665
             Y RMDG+T V  R  L+D+FN   ++F+F+LTT+VGGLG NLTGA+RV+++DPDWNPS D
Sbjct  332   YHRMDGSTAVGARARLVDDFNGNEQVFVFLLTTKVGGLGINLTGADRVLLYDPDWNPSTD  391

Query  2666  MQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDL  2845
             MQARERAWRIGQK++VT+YRLIT GTIEEKVYHRQIYK  LT K+L++P+Q+R FK++D+
Sbjct  392   MQARERAWRIGQKREVTIYRLITSGTIEEKVYHRQIYKQFLTEKVLQDPKQKRFFKSKDI  451

Query  2846  KDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNN  3025
              DLF L D    G++E++ IFS L   + +  P  PD     +    PA           
Sbjct  452   HDLFTLGDQ-YAGASETAHIFSSLHGGLEV--PLDPDSVAVPAEAAGPA-----------  497

Query  3026  SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVA  3205
                          G+VD D  ILR LF+  G+ SA+DH  I  A++ E L ++ QA+R+A
Sbjct  498   -------------GEVD-DAKILRDLFEGTGVMSALDHSKIEGANNPEALNIDAQAARIA  543

Query  3206  QRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESS  3385
             +RAA ALRQSR       V  PTWTGRSG +GAP     +FG+T N +L           
Sbjct  544   RRAAAALRQSRAACVTAPVNQPTWTGRSGGSGAP-----RFGATSNQRLA----------  588

Query  3386  MISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSN---SRTR  3556
                  R  ++   S+  A + A      RG    A   G +         SS+   +R R
Sbjct  589   -----RGALSEPGSSEAAPADAGAGEVRRGTAGLARFGGGQAGTTGGLAPSSSVLLARLR  643

Query  3557  AAENGASRPSHGSAGMQPEV-----LIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLA  3721
               +   S  +  +A   PEV     L +++  +++  GG   S ++++HF   +P+    
Sbjct  644   ERQAAVSAAASSAARNDPEVEEAHELSQRIVAYLEEAGGQADSHAVIQHFAPSLPAAKAP  703

Query  3722  LFKNLLKEIATLKKNPN-GSFWILKPEY  3802
             LF+ LL+++A+L++NP+ G  W+L+P++
Sbjct  704   LFRQLLQQVASLRRNPSAGKIWVLRPDF  731



>gb|EIE87512.1| hypothetical protein RO3G_12223 [Rhizopus delemar RA 99-880]
Length=778

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/704 (50%), Positives = 479/704 (68%), Gaps = 45/704 (6%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L+GGL++P  ++  LFDYQK  VQWLWELH Q+ GGI+GDEMGLGKT+Q++AFL SL++S
Sbjct  27    LDGGLRVPGELWSCLFDYQKTCVQWLWELHRQEVGGILGDEMGLGKTIQIIAFLSSLYYS  86

Query  1463  NAYKP---SIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             N   P   S++VCP T+++QW +E  KW+P   + ILH S +        S   E   E 
Sbjct  87    NVLGPGQASVVVCPATVMKQWVQEFHKWWPPQRIAILHSSGSGIKTGNYTSTDDEESDEE  146

Query  1634  eelldvdvekN-------------------LSFRNTKKWDKLINHVLGSDSGLLITTYEQ  1756
              E ++ + E +                   L  +  K+   L++  +    G+LITTY  
Sbjct  147   MEEVEEEYEPDRRGGQAKRRKGKRHPARSLLGTKAGKRVSALVDKYI-KLGGVLITTYSG  205

Query  1757  LRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWS  1936
             ++   E LL   WGY +LDEGH+IRNP+++ TL  KQ ++ HRII++G+PIQN L ELWS
Sbjct  206   VQTYREVLLKHRWGYVILDEGHKIRNPDSETTLAIKQFKSPHRIILSGTPIQNNLKELWS  265

Query  1937  LFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMK  2116
             LFDFVFPG+LG LP+F+++F+VPISIGGYANAT +QV TAY+CA +LRDLI PYLLRRMK
Sbjct  266   LFDFVFPGRLGTLPIFQSQFSVPISIGGYANATNIQVQTAYKCACMLRDLINPYLLRRMK  325

Query  2117  ADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHP  2296
              DV A LPKK E V+FC LT  QR  Y  F+ S +++ I +  +  LYGID++RKICNHP
Sbjct  326   VDVAADLPKKNEQVLFCKLTKPQRRAYLQFIQSKEMDAILERRRQVLYGIDIVRKICNHP  385

Query  2297  DLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTG  2476
             DL+    + R+PDYGN +RSGKM VV  +LKLWK Q HRVL F QT+QMLDI+E  +   
Sbjct  386   DLVNLAMTDRNPDYGNSDRSGKMVVVKALLKLWKAQKHRVLLFCQTRQMLDIIERMIRDQ  445

Query  2477  GYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNP  2656
              Y+Y RMDG TP+ QR+A+++E+N+   +F+F+LTT+VGGLG NLTGA+RVI+FDPDWNP
Sbjct  446   EYRYMRMDGTTPIHQRIAMVNEYNDNKHLFVFLLTTKVGGLGLNLTGADRVILFDPDWNP  505

Query  2657  SNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKA  2836
             S D+QARERAWR+GQ KDVT+YRL+T GTIEEK+YHRQIYK  LTNKILK+P+Q+R F A
Sbjct  506   STDVQARERAWRLGQTKDVTIYRLMTSGTIEEKIYHRQIYKQFLTNKILKDPKQKRFFDA  565

Query  2837  RDLKDLFVL-NDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAME  3013
              +L+ LF L ++D E   TE+  +F     +VN       D+ + + +         A+E
Sbjct  566   SNLQSLFTLASEDAE--ETETGQLFK--GTEVNYNKKDEEDERRLEGVD--------ALE  613

Query  3014  RDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQA  3193
             +  +  S  E++ +++         +L++LF+  GI SA+ HD I+++   + + +E++A
Sbjct  614   QYVDERSEEEKQEEDH---------VLQSLFEMTGIQSALKHDQIMDSASHDAMIIEKEA  664

Query  3194  SRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK  3325
             + VAQRAA AL++SR LR    +  PTWTGRSG+AGAP  +  K
Sbjct  665   NLVAQRAAAALKESRRLRRAMDIGTPTWTGRSGSAGAPRYVFNK  708



>gb|EFA85198.1| SNF2-related domain-containing protein [Polysphondylium pallidum 
PN500]
Length=1376

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/849 (43%), Positives = 525/849 (62%), Gaps = 79/849 (9%)
 Frame = +2

Query  1265  GPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFL  1444
             G  FV ++G  K+P  I+ +LF+YQ   V+W+WELH Q++GGIIGDEMGLGKT+Q+++FL
Sbjct  581   GEDFV-IDGEFKVPFEIYHRLFEYQVTCVRWMWELHSQESGGIIGDEMGLGKTIQIISFL  639

Query  1445  GSLHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshes  1621
              SLH+S     P++I+ P TLL  W +E  KW+P F V + H S                
Sbjct  640   ASLHYSKMLCGPALIIAPATLLSNWVKEIHKWWPPFRVILFHSS----------------  683

Query  1622  dseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGY  1801
                                NTK+  K +   + +   +L+TTYE +R+  + LL   W Y
Sbjct  684   ------------------NNTKQTQKQLVETIATKGHILLTTYEGVRINQDILLKHHWEY  725

Query  1802  AVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPV  1981
              +LDEGH+IRNP+ D+TL  KQ  T HRII++GSPIQNKL+ELWSLFDF+FPGKLG LP+
Sbjct  726   VILDEGHKIRNPDADITLSVKQFPTCHRIILSGSPIQNKLTELWSLFDFIFPGKLGTLPI  785

Query  1982  FEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVI  2161
             F ++F+VPI++GGYANA+ LQV TAY+CAV LRDLI PY+LRR+KADV   LP K E V+
Sbjct  786   FMSQFSVPINLGGYANASSLQVQTAYKCAVALRDLISPYMLRRVKADVLQSLPSKNEQVL  845

Query  2162  FCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLE--REHSCRDPD  2335
              C LT  Q  +Y  FL+S + + + DG KN LY ID+++KICNHPD+L    +   +  D
Sbjct  846   LCPLTPFQERLYMKFLSSNEAKDVMDGKKNLLYAIDILKKICNHPDILHKDDDDKDKPDD  905

Query  2336  YGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPV  2515
             YGN ERS K+KVV E+L +W+ QGH+VL F QT+QMLDI+E F+    Y+YRRMDG T +
Sbjct  906   YGNVERSSKLKVVQEILPMWQQQGHKVLLFCQTRQMLDIVEEFIKNSNYQYRRMDGTTSI  965

Query  2516  KQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRI  2695
             K R  L++EFNN   +FIF+LTT+VGGLG NLTGANRVI+FDPDWNPS D+QARER +RI
Sbjct  966   KVRQTLVEEFNNDPILFIFLLTTKVGGLGINLTGANRVILFDPDWNPSTDIQARERVYRI  1025

Query  2696  GQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDL--FVLND  2869
             GQKK VT+YRL+T GTIEEK+YHRQIYK  L+NKILK+P+Q+R F+++  KDL  +V   
Sbjct  1026  GQKKTVTIYRLMTTGTIEEKIYHRQIYKQFLSNKILKDPRQKRFFQSKHFKDLLSYVKVK  1085

Query  2870  DGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGE--  3043
              G    +E+  IF+  + ++                   P D      R +N  + G   
Sbjct  1086  KG----SETGDIFTGTNSEI------------------LPEDFQENKRRRSNESTTGSKV  1123

Query  3044  -----EKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQ  3208
                  E+    +    ED+ IL+ LF+  G+ SA+ HD+I+     E + LEE+A+++A+
Sbjct  1124  TEIPFEQQQQEDEKTSEDSYILKHLFEKEGLKSALKHDSIMEQSAPEAVLLEEEANKIAK  1183

Query  3209  RAAEALRQSRM-LRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESS  3385
             +A E L+ SR  +   +  + PTWTGRSGT+GAP ++     +  N     + +P +   
Sbjct  1184  KAVELLKISRQKIEQTDRFSTPTWTGRSGTSGAPQALLNSNNNNNNDNDTPAQQPPK---  1240

Query  3386  MISSRRNgiaagasagkalssaellakiRGNQERAISDGLEH---QHQFNSGSSSNSRTR  3556
               S+R    +    +    S          +   ++S+ L++   +++F S SS++  + 
Sbjct  1241  --SNRFGNKSKAIFSQSTTSPTLQPIMPIVSDSASVSNTLKNVSTENKFQS-SSADILSN  1297

Query  3557  AAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNL  3736
               +    + S    G++P+ +I  +  F+  KGGS+++  I++HF+  + ++   LF++L
Sbjct  1298  LQQEDVDKASELFGGIKPKEIIEGIYDFLMSKGGSSATQDIIDHFKISITAEQAPLFRSL  1357

Query  3737  LKEIATLKK  3763
             LK +AT  K
Sbjct  1358  LKSVATFSK  1366



>ref|XP_007872223.1| hypothetical protein PNEG_00350 [Pneumocystis murina B123]
 gb|EMR11321.1| hypothetical protein PNEG_00350 [Pneumocystis murina B123]
Length=1088

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/852 (44%), Positives = 514/852 (60%), Gaps = 101/852 (12%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
              EG   +P  I   LF+YQK  +QWLWELHCQ+AGGII DEMGLGKT+Q+  FL  LH+S
Sbjct  325   FEGYYSLPGDIHPSLFNYQKTCIQWLWELHCQEAGGIIADEMGLGKTIQIAGFLAGLHYS  384

Query  1463  NAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                  P +IVCP T+++QW  E  +W+P F V ILH S +   + K     +   SE+  
Sbjct  385   QKLSGPILIVCPATIMRQWVNEFHQWWPPFRVIILHTSGSGLVNIKHELNKNYKSSETM-  443

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                     N +F   K  +K+I  ++ +   +LI TY  LR+  E LL  +W Y +LDEG
Sbjct  444   --------NSNFL-KKNVEKIIKKII-TLGHVLIITYSGLRIYKEYLLPNKWAYCILDEG  493

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++ ++L+CKQ++T HRII++G+PIQN L ELWSLFDF+FPG+LG LP+F+ +FA
Sbjct  494   HKIRNPDSTISLICKQIKTPHRIILSGTPIQNNLDELWSLFDFIFPGRLGTLPIFQNQFA  553

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYANA+ +QV TAY+CA VLRDLI PYLLRRMKADV + LP KTE V+FC LT 
Sbjct  554   IPINIGGYANASNIQVQTAYKCACVLRDLISPYLLRRMKADVASDLPNKTEQVLFCKLTK  613

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCR--DPDYGNPER  2353
              Q+  YQ+FL S D++ I +G +N LYGID++RKICNHPDL+++    +  + +YG+P +
Sbjct  614   FQKEAYQSFLNSKDMDLILNGERNVLYGIDILRKICNHPDLVDKISLLKINNIEYGDPRK  673

Query  2354  SGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL-VTGGYKYRRMDGATPVKQRMA  2530
             SGKM+V+ ++LKLWK QGHR L F+QT+QMLDILE F+     + Y RMDG T +  R  
Sbjct  674   SGKMQVIEDILKLWKSQGHRTLLFTQTRQMLDILEKFIKKMDQFNYYRMDGGTSISSRQY  733

Query  2531  LIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKD  2710
             L+D+FNN+ +I IF+LTTRVGGLG NL GANRVIIFDPDWNPS D+QARER WR+GQKK+
Sbjct  734   LVDKFNNSDDIHIFLLTTRVGGLGVNLIGANRVIIFDPDWNPSTDVQARERVWRVGQKKE  793

Query  2711  VTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGST  2890
             V +YRL+T GTIEEK+YHRQI+K  LTNKILK+P+Q+R FK  DL DLF L  D   GS 
Sbjct  794   VIIYRLMTSGTIEEKIYHRQIFKQFLTNKILKDPKQKRFFKISDLYDLFSLKSDDIGGSE  853

Query  2891  E------SSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKA  3052
                    +  I+ Q     ++T   H  +E  + +K+ P   G A   +  +G    +K 
Sbjct  854   TGEMFIGTEKIYCQ--SKSSLTNTMHKSEEDKEKLKSIP---GVAGLENFTTGDTKSKKK  908

Query  3053  DNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQ  3232
             D+       +  IL  +F   G+ S + HD I+N+  +E L +E++A+R+++ A   L+ 
Sbjct  909   DH-------EFEILEDIFSKSGVCSTLQHDVIMNSVQQEALLVEKEATRISEEAIRILKA  961

Query  3233  SRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgi  3412
             SR    +  +   TWTGR                             +ESS ++ RRN  
Sbjct  962   SRKNIQKSEIGTLTWTGR----------------------------FKESSQVNFRRNSN  993

Query  3413  aagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTR-AAENGASRPSH  3589
             A                         IS  L            N + R   EN   +   
Sbjct  994   A------------------------PISSSL----------LLNLKNRNCLENNNIQNLF  1019

Query  3590  GSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVP-SKDLALFKNLLKEIATLKKN  3766
             G    +   LI+ +  FI  KGG  SS  I+E F + V  ++ +  F+ LLK+IA L+  
Sbjct  1020  GILNDKSVKLIKSIYDFINVKGGKVSSTDIIERFGTSVNGTQQVVEFRKLLKKIAKLE--  1077

Query  3767  PNGSFWILKPEY  3802
                 FW+LK ++
Sbjct  1078  --NKFWVLKEKF  1087



>dbj|GAM27604.1| hypothetical protein SAMD00019534_107800 [Acytostelium subglobosum 
LB1]
Length=1315

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/848 (44%), Positives = 510/848 (60%), Gaps = 53/848 (6%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             ++G  KIP  ++ +LF+YQ   V+W+WELH Q+ GGIIGDEMGLGKTVQ+++FL SLH+S
Sbjct  511   VDGDFKIPYEVYHRLFEYQVTCVKWMWELHNQECGGIIGDEMGLGKTVQIISFLASLHYS  570

Query  1463  NAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                  P++I+ P TLL  W +E   W+P F   + H S                      
Sbjct  571   KMLGGPALIIAPATLLSNWVKEIHTWWPPFRAILYHSS----------------------  608

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                       S ++ K   +LI  V  S   +L+TTYE +R+  + LL   W Y +LDEG
Sbjct  609   --------GTSNKDKKTMKQLIETV-ASKGHILMTTYESVRINQDTLLKHHWEYIILDEG  659

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP+ DVTL  KQ  T HRII++GSPIQNKL+ELWSLFDFVFPGKLG LP+F+ +FA
Sbjct  660   HKIRNPDADVTLSVKQFPTSHRIILSGSPIQNKLTELWSLFDFVFPGKLGTLPIFKTQFA  719

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             VPIS+GGYANA+ LQV TAY+CAV LR+LI PY+LRR+KADV   LP K E V+ C LT 
Sbjct  720   VPISLGGYANASTLQVQTAYQCAVALRNLISPYMLRRIKADVLQSLPSKNEQVLLCPLTP  779

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
              Q   Y  FLAS +   + DG KN LY ID+++K+CNHPD+L ++   +  DYGN ERS 
Sbjct  780   FQEREYLKFLASNEATDVLDGKKNLLYAIDILKKVCNHPDILLKDGEDKPYDYGNVERSA  839

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALID  2539
             K+KVV ++L +W+ QGH+VL F QT+QMLDI+E+F+V  G  YRRMDG T VK R +L++
Sbjct  840   KLKVVQQILPMWQQQGHKVLLFCQTRQMLDIVESFIVECGLTYRRMDGTTSVKTRQSLVE  899

Query  2540  EFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTV  2719
             EFN    +FIF+LTT+VGGLG NLTGANRVI+FDPDWNPS D+QARER +RIGQ K VT+
Sbjct  900   EFNQDPTLFIFLLTTKVGGLGINLTGANRVILFDPDWNPSTDIQARERVYRIGQLKSVTI  959

Query  2720  YRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLN---DDGENGST  2890
             YRL+T GTIEEK+YHRQIYK  L+NKILK+P+Q+R F++R  KDL   N      E G  
Sbjct  960   YRLMTTGTIEEKIYHRQIYKQFLSNKILKDPRQKRFFRSRHFKDLLSYNKVVKGSETGDI  1019

Query  2891  ESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGD  3070
              + +    L ED   +  +        S     AD  T   R    G       DNNN D
Sbjct  1020  FNGTNSEILPEDFAASQQRKRGNSGVDSPPAADADSPTYQTRPYQPGGGSN---DNNNDD  1076

Query  3071  ---VDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRM  3241
                  ED  IL+ LF+  G+ SA+ HD+I+     E   LE +A+++A +A E ++ SR 
Sbjct  1077  ETKESEDAYILKHLFEKEGLKSALKHDSIMEQSGPEASLLENEATKIANKAVELIKLSRA  1136

Query  3242  -LRSQ-ESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgia  3415
              + SQ   ++ PTWTGRSGT+G P ++    G  L   L+ S  P        ++   I 
Sbjct  1137  KIESQGNRLSTPTWTGRSGTSGIPSTLA---GHPLE-GLIASPPPATTGGRFGNKNKAIY  1192

Query  3416  agasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGS  3595
               AS       + +      N  +     L  Q    S  SS   +   ++   + S   
Sbjct  1193  TPASPTLQPIVSIIPDNKMNNNNKP----LVGQAGKASLDSSAILSTLQQSDIEKASEMF  1248

Query  3596  AGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNG  3775
              G++P  +I+ +  F+  KGG++++ +I++HF   + +    LF++LLK +A   K    
Sbjct  1249  GGIKPSDIIKNIFDFLMSKGGNSTTQAIIDHFALSISADQAPLFRSLLKSVAVFSKTL--  1306

Query  3776  SFWILKPE  3799
               W +KP+
Sbjct  1307  KLWTIKPD  1314



>emb|CCE45191.1| hypothetical protein CPAR2_702030 [Candida parapsilosis]
Length=1011

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/710 (48%), Positives = 464/710 (65%), Gaps = 39/710 (5%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  
Sbjct  296   PDSKLNDAFKLPGDIYPSLFDYQKTCVQWLWELYSQKTGGIIGDEMGLGKTIQIISFLAG  355

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP +IV P T+L QW  E  +W+P     ILH   +   +  K S++   + 
Sbjct  356   LHYSGLLRKPVLIVVPATVLNQWVNEFHRWWPPLRCVILHSIGSGMGENAKVSEAKMEEY  415

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                             +      K+++ V+     +LITTY  LR+  + +L  EWGY V
Sbjct  416   MENWDPQTSKSSLKGIKTQINAQKIVDRVVAK-GHVLITTYVGLRIYSKYILPQEWGYCV  474

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP++D++L CKQ++TV+RII++G+PIQN L+ELWSLFDF+FPG+LG LPVF+
Sbjct  475   LDEGHKIRNPDSDISLTCKQIKTVNRIILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQ  534

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F++PI++GGYAN+  LQV TAY+CAVVLRDLI PYLLRR+K DV   LPKK+E V+F 
Sbjct  535   QQFSIPINVGGYANSNNLQVKTAYKCAVVLRDLISPYLLRRLKNDVAKDLPKKSEMVLFV  594

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT +Q+ +Y+ FL S D+  I  G +N L G+DV+RKICNHPDL+ R+      +YG+P
Sbjct  595   KLTRIQQDLYEKFLESEDLNSILKGKRNVLMGVDVLRKICNHPDLVYRDALMHKSNYGDP  654

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV--------TGGYKYRRMDG  2503
             ++SGKM+V+  +L+LW+ +GH+ L F QT+QMLDILE F+            + Y RMDG
Sbjct  655   KKSGKMQVLKNLLQLWQSEGHKTLLFCQTRQMLDILEKFVSNLPCLNDQAQYFTYLRMDG  714

Query  2504  ATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARER  2683
             +T + QR +L+DEFNN   + +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARER
Sbjct  715   STAISQRQSLVDEFNNDPNVHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARER  774

Query  2684  AWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVL  2863
             AWR+GQKKD+T+YRL+T G+IEEK+YHRQI+K  L NKILK+P+QRR FK  DL DLF L
Sbjct  775   AWRLGQKKDITIYRLMTTGSIEEKIYHRQIFKTFLQNKILKDPKQRRFFKTNDLHDLFTL  834

Query  2864  NDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNG-  3040
              D  E G TE+  +F   SE            +K +  K+  +   T    +N+   N  
Sbjct  835   GDQDEKG-TETGDMFHARSE------------QKYRGSKSRKSASLTKKRHENDDDFNQV  881

Query  3041  ------------EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLE  3184
                         EE  DN     ++++ I+  +F   G+HSA+ HD I+N +DEE    E
Sbjct  882   AKITGVSRLGQYEEGEDNKPESSNDESRIIAGIFAQSGVHSALKHDEIINYNDEEARFAE  941

Query  3185  EQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGS  3334
              +A +   +A EALR+SR L  ++ V  PTWTG+ G+AG    +K  FG+
Sbjct  942   REAEKYVSQATEALRRSRKLARKKPVGTPTWTGKFGSAG---KLKGTFGA  988



>ref|XP_002502040.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63298.1| predicted protein [Micromonas sp. RCC299]
Length=1481

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/731 (49%), Positives = 458/731 (63%), Gaps = 85/731 (12%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
             ++ +GGL+IP   + +L ++Q+  ++WLWELHCQ+AGGIIGDEMGLGKTVQV AFL +L 
Sbjct  609   IIFDGGLRIPSGTYARLLEHQRTSIKWLWELHCQRAGGIIGDEMGLGKTVQVSAFLCALE  668

Query  1457  FSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsese  1636
              S  Y+P+++VCP T+L+QW+RE + W P+    ILH+S                     
Sbjct  669   RSGLYRPTLVVCPATMLRQWRRELRAWAPALRPVILHESA--------------------  708

Query  1637  elldvdvekNLSFRNTKKWD--KLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVL  1810
                 V        R  KK    KL+   +    G+L+TTYE LRL+ + +L + WGYAVL
Sbjct  709   ----VSQSALADARGNKKSARLKLLRDCVADAKGVLLTTYEHLRLMRDHVLSVRWGYAVL  764

Query  1811  DEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEA  1990
             DEGH+IRNP+ DVT+  KQLQTVHR+IMTG+PIQN+LSELWSLFDF FPGKLG LPVF+A
Sbjct  765   DEGHKIRNPDADVTICAKQLQTVHRLIMTGAPIQNRLSELWSLFDFCFPGKLGTLPVFQA  824

Query  1991  EFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCS  2170
             +FAVPI +GGY+NA+  QV TAYRCA +L+DLI PYLLRRMKADVN  LPKKTE V+FC 
Sbjct  825   QFAVPIQLGGYSNASQQQVVTAYRCATMLKDLISPYLLRRMKADVNINLPKKTEQVLFCP  884

Query  2171  LTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPE  2350
             +T  QR  Y++++ S DVE+I +G + AL GIDV+RKI NHPDLLER        YG  E
Sbjct  885   MTGEQREAYRSYIHSRDVEEILEGRREALGGIDVLRKIVNHPDLLERTTQAHSEKYGEAE  944

Query  2351  RSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMA  2530
             RSGK+ V  +VL LW++QGHR L FSQTQQMLDILE  +   GY YRRMDG TPV  RM 
Sbjct  945   RSGKLLVTEKVLGLWREQGHRCLLFSQTQQMLDILEAAIARAGYTYRRMDGTTPVSHRMR  1004

Query  2531  LIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKD  2710
             LIDEFN   ++F+F+LTT+VGGLG NLTGA+RV+++DPDWNPS D QARERAWRIGQ K+
Sbjct  1005  LIDEFNGDDDVFVFLLTTKVGGLGVNLTGADRVLLYDPDWNPSTDAQARERAWRIGQTKE  1064

Query  2711  VTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDD------  2872
             VTVYRLIT GTIEEKVYHRQIYK  LT+K+LK+P+QRR FKA+DL DLF   +D      
Sbjct  1065  VTVYRLITAGTIEEKVYHRQIYKEFLTSKVLKDPKQRRFFKAKDLADLFTWEEDNANTKP  1124

Query  2873  GENGSTESSSIFSQLSEDVNITGPQHPDQEKDK-------------SIKTNPADHGTA--  3007
             G+  + E++ +F+++  ++        + + D              + K+ P   G    
Sbjct  1125  GKEDAIETAELFTEVEAEIRAADVAGSESDADDFRSDAAGEDGKVGTEKSAPEAGGWGAG  1184

Query  3008  -----------------------MERDNNSGSNG--EEKADNNNGDVDEDTSILRTLFDA  3112
                                    MERD   GSN                D +I+R+LF  
Sbjct  1185  DPDLVPNGVAPGGSVPGGPSRFRMERDRLVGSNNRDGGGGSGAAARDGGDAAIMRSLFGG  1244

Query  3113  HG---------IHSAMDHDAIVNA----HDEEKLKLEEQASRVAQRAAEALRQSRMLRSQ  3253
              G         I  AM+HDAI+ A     D        + +      A A       R +
Sbjct  1245  GGDGGSGAAGTIRGAMNHDAIMGAAGGGRDHVTSGHHARVAAERTARAAAEAVRASSRGR  1304

Query  3254  ESVAIPTWTGR  3286
              +VA+PTWTGR
Sbjct  1305  ANVAVPTWTGR  1315



>ref|XP_002491552.1| Protein involved in transcription-coupled repair nucleotide excision 
repair of UV-induced DNA lesion [Komagataella pastoris 
GS115]
 emb|CAY69272.1| Protein involved in transcription-coupled repair nucleotide excision 
repair of UV-induced DNA lesion [Komagataella pastoris 
GS115]
 emb|CCA38338.1| DNA excision repair protein ERCC-6 [Komagataella pastoris CBS 
7435]
Length=1088

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/696 (49%), Positives = 481/696 (69%), Gaps = 25/696 (4%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
              +L+   ++P  ++  LFDYQK  VQWLWEL+ QK GGI+GDEMGLGKTVQ+++F+  LH
Sbjct  288   AILDDDYRLPGDVYPALFDYQKTCVQWLWELYLQKVGGILGDEMGLGKTVQIISFIAGLH  347

Query  1457  FSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             ++    KP I+VCP T+L+QW  E  +W+P   V ILH         +   ++  S  + 
Sbjct  348   YTKKLNKPVIVVCPATVLRQWCNEFHRWWPPLRVVILHAIGTGLSGSRTSLQNEASIEKL  407

Query  1634  eelldvdvekNL-SFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVL  1810
              E  +    K+L S +   +  +LI+ V  +   ++ITTY  LR+  + LL  +WGYA+L
Sbjct  408   LEEEEYGSTKSLASLKAESRVKELIDSVF-TRGHVIITTYVGLRIYSKHLLKRDWGYAIL  466

Query  1811  DEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEA  1990
             DEGH+IRNPN+D++L CKQL+T +R+I++G+PIQN L+ELWSLFDF+FPG+LG LPVF+ 
Sbjct  467   DEGHKIRNPNSDISLTCKQLRTPNRVILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQN  526

Query  1991  EFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCS  2170
             +FA+PI++GGYANAT LQV   Y+CAV L+DLI PYLLRR+KADV   LPKK+E V+FC 
Sbjct  527   QFAIPINVGGYANATNLQVQVGYKCAVTLKDLISPYLLRRVKADVAKDLPKKSEMVLFCK  586

Query  2171  LTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLE---REHSCRDPDYG  2341
             LT+ Q ++Y+ FL S ++ +I  G +  LYGID++RKICNHPDL++   +  S +DP YG
Sbjct  587   LTAPQHALYEKFLRSDELSRILQGKRQVLYGIDILRKICNHPDLVDVHAKRRSKKDPTYG  646

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL----VTGG-------YKY  2488
             +  +SGKM+VV ++L+LWK QGH+ L F+QT+QMLDILE+FL      G        +K+
Sbjct  647   SASKSGKMQVVKKLLELWKSQGHKTLLFTQTRQMLDILESFLERLNAKGAEEEDFVPFKF  706

Query  2489  RRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDM  2668
              RMDG T +  R +L+D FNN     +F+LTTRVGGLG NLTGANRVII+DPDWNPS D+
Sbjct  707   LRMDGTTSIGVRQSLVDVFNNDPSYNVFLLTTRVGGLGVNLTGANRVIIYDPDWNPSTDV  766

Query  2669  QARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLK  2848
             QARERAWR+GQKKDVT+YRL+  G+IEEK+YHRQI+K  LTNKILK+P+QRR FK  +L+
Sbjct  767   QARERAWRLGQKKDVTIYRLMIAGSIEEKIYHRQIFKQFLTNKILKDPKQRRFFKMNELQ  826

Query  2849  DLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNS  3028
             DLF L D  E G TE+  +F+ +  +   T P+H  +  ++     P D    + + N  
Sbjct  827   DLFTLGDPDEKG-TETGDMFNGMEYNFKGTKPRHSQKLSNRERSEEPQDDLVKLAQIN--  883

Query  3029  GSNGEEKADNNNGDVDEDTS-----ILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQA  3193
             G +G ++ D +  +  + TS     ++  LF + G+HSA+ HD+I+++ + E+ + E +A
Sbjct  884   GVSGLQEFDGSKDEQMDSTSRQEEELMSGLFASSGVHSALQHDSIMDSTEPEQNEAELEA  943

Query  3194  SRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAG  3301
              R+A  AA +LR+SR L  +  + +PTWTG+ G+AG
Sbjct  944   RRIAAEAANSLRESRKLARKSKIGVPTWTGKFGSAG  979



>ref|XP_003871023.1| Rad26 protein [Candida orthopsilosis Co 90-125]
 emb|CCG24897.1| Rad26 protein [Candida orthopsilosis]
Length=1005

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/703 (48%), Positives = 470/703 (67%), Gaps = 33/703 (5%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    ++P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  294   LNDSFRLPGDIYPSLFDYQKTCVQWLWELYSQKTGGIIGDEMGLGKTIQIISFLAGLHYS  353

Query  1463  NA-YKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                +KP ++V P T++ QW  E  +W+P     ILH   +   +  K S++   +     
Sbjct  354   GLLHKPVLVVVPATVMNQWVNEFHRWWPPLRCVILHSIGSGMGNDAKISEAKMEEYLETW  413

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                   +     ++     K++N V+     +LITTY  LR+  + +L  EWGY VLDEG
Sbjct  414   DPQTSKKSLRGIKSQINAQKIVNTVV-EKGHVLITTYVGLRIYSKYILPQEWGYCVLDEG  472

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CKQ++TV+RII++G+PIQN L+ELWSLFDFVFPG+LG LPVF+ +F+
Sbjct  473   HKIRNPDSDISLTCKQIKTVNRIILSGTPIQNNLTELWSLFDFVFPGRLGTLPVFQQQFS  532

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI++GGYAN+  LQV TAY+CAVVLRDLI PYLLRR+K DV   LPKK+E V+F  LT 
Sbjct  533   IPINVGGYANSNNLQVKTAYKCAVVLRDLISPYLLRRLKNDVAKDLPKKSEMVLFVKLTR  592

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             VQ+ +Y+ FL S D+  I  G +N L G+D++RKICNHPDL+ RE       YG+P++SG
Sbjct  593   VQQDLYEKFLDSEDLNSILRGKRNVLMGVDMLRKICNHPDLIYREALMHKASYGDPKKSG  652

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV--------TGGYKYRRMDGATPV  2515
             KM+V+  +L+LW+++GH+ L F QT+QMLDILE F+         +  + Y RMDG+T +
Sbjct  653   KMQVLKNLLQLWQNEGHKTLLFCQTRQMLDILEKFVSNLSLLNNESKHFTYLRMDGSTAI  712

Query  2516  KQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRI  2695
              QR  L+DEFNN   + +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+
Sbjct  713   SQRQNLVDEFNNDPSLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRL  772

Query  2696  GQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDG  2875
             GQKKD+T+YRL+T G+IEEK+YHRQI+K  L NKILK+P+QRR FK  DL DLF L D  
Sbjct  773   GQKKDITIYRLMTTGSIEEKIYHRQIFKTFLQNKILKDPKQRRFFKNNDLHDLFTLGDQD  832

Query  2876  ENGSTESSSIF----------SQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNN  3025
             E G TE+  +F          ++L +  ++T  +H + +    +        T + R   
Sbjct  833   EKG-TETGDMFQARSEQKYRGTKLRKSASLTRKRHENDDDYSQVAKI-----TGVSRLGQ  886

Query  3026  SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVA  3205
                  E + +++N    +++ I+  +F   G+HSA+ HD I+N +DEE    E++A +  
Sbjct  887   YEEGEEHRPESSN----DESRIMAGIFAQSGVHSALKHDEILNYNDEEARFAEKEAEKYV  942

Query  3206  QRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGS  3334
              +A EALR+SR L  ++ V  PTWTG+ G+AG    +K  FG+
Sbjct  943   SQATEALRRSRKLARKKPVGTPTWTGKFGSAG---KLKGTFGA  982



>ref|XP_459783.2| DEHA2E10934p [Debaryomyces hansenii CBS767]
 emb|CAG88022.2| DEHA2E10934p [Debaryomyces hansenii CBS767]
Length=1157

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/730 (47%), Positives = 476/730 (65%), Gaps = 34/730 (5%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  
Sbjct  342   PDAVLNSKFKLPGDIYPSLFDYQKTCVQWLWELYSQKTGGIIGDEMGLGKTIQIISFLAG  401

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP ++V P T++ QW  E  +W+P     ILH   +        S+      
Sbjct  402   LHYSGLLEKPVLVVVPATVMNQWVNEFHRWWPPLRCVILHSIGSGMGKNAIHSEEKIEAF  461

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +    N+    K I   +     +L+TTY  LR+  + +L  +WGY V
Sbjct  462   LETTDPSSVKNDSFKGINSHMRAKEIIDTVMEKGHVLVTTYVGLRIYSKFILPRQWGYVV  521

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP++D++L CKQ++T +RII++G+PIQN L ELWSLFDF+FPG+LG LPVFE
Sbjct  522   LDEGHKIRNPDSDISLTCKQIKTYNRIILSGTPIQNNLIELWSLFDFIFPGRLGTLPVFE  581

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F+VPI++GGYANA+ +QV T Y+CAV+LRDLI PYLLRR+K+DV   LPKK E V+F 
Sbjct  582   QQFSVPINMGGYANASNVQVQTGYKCAVILRDLISPYLLRRLKSDVAQDLPKKNEMVLFV  641

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLERE--HSCRDPDYG  2341
              LT  Q+ +Y+ FL+S D+  I  G +N L G+D++RKICNHPDL++RE     ++ +YG
Sbjct  642   KLTQYQQDLYEKFLSSEDLHAILKGKRNILMGVDILRKICNHPDLVDREILQRRKNYNYG  701

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL------------VTGGYK  2485
             NP +SGK++V+  +L+LW+ QGHR L F QT+QMLDILE F+            V G + 
Sbjct  702   NPAKSGKLQVLKNLLQLWQMQGHRTLLFCQTKQMLDILEKFVTNLPSLNENGEEVRGTFN  761

Query  2486  YRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSND  2665
             Y RMDG+T + +R AL+D FN   +  +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D
Sbjct  762   YLRMDGSTNIGRRQALVDTFNEDKQYHVFLLTTKVGGLGINLTGADRVIIYDPDWNPSTD  821

Query  2666  MQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDL  2845
             +QARERAWR+GQKKD+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FK  DL
Sbjct  822   IQARERAWRLGQKKDITIYRLMTAGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKVNDL  881

Query  2846  KDLFVLNDDGENGSTESSSIFSQLSEDVN---------ITGPQHPDQEKDKSIKTNPADH  2998
              DLF L D  E G TE+  +F+      N         +  P+H + +    +    A+ 
Sbjct  882   HDLFSLGDQDEVG-TETGDLFNGSETKFNGKKDRKSNKLFKPKHKNDDDFYQV----ANI  936

Query  2999  GTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK  3178
                 + DN  G N +EK    +G+ DE + I+  LF   G+HSA+ HD I+++  +E   
Sbjct  937   NGVSKLDNFEGDN-QEKDGEQDGNKDE-SRIMEGLFANSGVHSALKHDDIMDSSKQEVSI  994

Query  3179  LEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAG--APPSIKKKFGSTLNP-Q  3349
             +E++A+RVA  AAEAL++SR L  + ++  PTWTG+ G AG   P   + K  S   P +
Sbjct  995   IEKEANRVAAEAAEALKRSRKLTRKNNIGTPTWTGKFGLAGKFGPKVKRTKLSSNDKPSK  1054

Query  3350  LVTSSKPLEE  3379
             L++S+  L E
Sbjct  1055  LLSSTSILSE  1064



>ref|XP_002422295.1| ATP-dependent helicase, putative; DNA repair and recombination 
protein rad26 homologue, putative [Candida dubliniensis CD36]
 emb|CAX40300.1| ATP-dependent helicase, putative [Candida dubliniensis CD36]
Length=1054

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/706 (48%), Positives = 474/706 (67%), Gaps = 30/706 (4%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  260   LNDKFKLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFLAGLHYS  319

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP +IV P T+L QW  E  +W+P     ILH   +        SK  E    ++ 
Sbjct  320   GLLDKPVLIVVPATVLNQWVNEFHRWWPPLRCIILHSIGSGMSGAVSESKLEEYLESTDP  379

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                      +  +   +  ++I+ V+     +L+TTY  LR+  + +L  EWGY VLDEG
Sbjct  380   DSTQSSLHGIKSQINAQ--EIIDRVM-EKGHVLVTTYVGLRIYSKHILPREWGYVVLDEG  436

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ +F+
Sbjct  437   HKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQQFS  496

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  497   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAQDLPKKNEMVLFVKLTK  556

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             +Q+ +Y++FL S D+E I  G +N L G+D++RKICNHPDL+ R+   +  +YG+P +SG
Sbjct  557   IQQELYESFLQSEDLESILKGKRNVLMGVDILRKICNHPDLVYRDTLMKKKNYGDPAKSG  616

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F     L+ GG +KY RMDG+TP+ +
Sbjct  617   KMQVLKNLLRLWQHENHKTLLFCQTRQMLDILEKFVANLSLINGGDFKYLRMDGSTPISK  676

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D FN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  677   RQMLVDAFNQDPDMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  736

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             K+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  737   KRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  796

Query  2882  GSTESSSIF---SQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNN-SG------  3031
             G TE++ +F    Q  +  + T P+     K K +            +  N SG      
Sbjct  797   G-TETAHLFEGGEQSQQKYSGTKPR-----KSKGLFKKKYKDDDDFSQVANISGVSKLDK  850

Query  3032  -SNGEEKADNNNG--DVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQASR  3199
               +GE+  +  +     +ED  I+ ++F   G+HS + HD I++  +E +  L E++A +
Sbjct  851   FEDGEQNGETRDSTYSANEDNRIMSSIFAQSGVHSTLQHDDIISGSNENESSLVEKEADK  910

Query  3200  VAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGST  3337
             +A  AAEAL++SRM   +  +  PTWTG+ G+AG   S K+K  ++
Sbjct  911   LATAAAEALKRSRMQTRKNVIGTPTWTGKFGSAGKFGSKKRKLTNS  956



>ref|XP_004202990.1| Piso0_001862 [Millerozyma farinosa CBS 7064]
 emb|CCE79774.1| Piso0_001862 [Millerozyma farinosa CBS 7064]
Length=1116

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/872 (42%), Positives = 528/872 (61%), Gaps = 83/872 (10%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
              +L    ++P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+QV++F+  LH
Sbjct  300   AVLNDSFRLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQVISFIAGLH  359

Query  1457  FSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             +S   + P +IV P T+L QW  E  +W+P     ILH   +  +      +    +   
Sbjct  360   YSKRLEDPVLIVVPATVLNQWVNEFHRWWPPLRCVILHSIGSGMNKALISKEEKMEELLE  419

Query  1634  eelldvdvekNL-SFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVL  1810
                     + +L S+ N  K   +++ V      +LITTY  LR+  + +L  +WGYA+L
Sbjct  420   NADPFSVNKSSLKSYENELKAKDIVDSVF-QKGHILITTYVGLRIYSKYILPRKWGYAIL  478

Query  1811  DEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEA  1990
             DEGH+IRNP+++V+L CKQ++T +R+I++G+PIQN L ELWSLFDFVFPG+LG LPVF+ 
Sbjct  479   DEGHKIRNPDSEVSLTCKQIKTYNRVILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQ  538

Query  1991  EFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCS  2170
             +FAVPI++GGYANA+ +QV T Y+CAV+LRDLI PYLLRR+K+DV   LPKK E V+F  
Sbjct  539   QFAVPINMGGYANASNVQVQTGYKCAVILRDLISPYLLRRLKSDVARDLPKKNEMVLFVK  598

Query  2171  LTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLERE--HSCRDPDYGN  2344
             LT  Q+ +Y+ FL S DV  I  G +N L G+D++RKICNHPDL++R+     R+ +YG+
Sbjct  599   LTEYQQQLYEKFLDSEDVSAILKGKRNVLMGVDILRKICNHPDLIDRDILSHRRNYNYGD  658

Query  2345  PERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL------------VTGGYKY  2488
             P +SGK++V+  +L+LWK +GHR L F QT+QMLDILE F+            + G + Y
Sbjct  659   PRKSGKLQVLKNLLQLWKKEGHRTLLFCQTRQMLDILEKFVGNLKSISDEGDDIDGKFNY  718

Query  2489  RRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDM  2668
              RMDG+TP+  R +L+D FNN     +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+
Sbjct  719   LRMDGSTPIAVRQSLVDTFNNNNYYHVFLLTTKVGGLGINLTGADRVIIYDPDWNPSTDI  778

Query  2669  QARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLK  2848
             QARERAWR+GQKKD+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR F+  DL 
Sbjct  779   QARERAWRLGQKKDITIYRLMTAGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFRMNDLH  838

Query  2849  DLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNS  3028
             DLF L D  E G TE+  +FS    +   TG +       KS K N   H    +  +  
Sbjct  839   DLFSLGDPEEMG-TETGDMFS--GSEKKFTGSKSR-----KSRKLNKPKHSNDDDFLDIV  890

Query  3029  GSNGEEKADNNNGDVDEDTS----------ILRTLFDAHGIHSAMDHDAIVNAHDEEKLK  3178
               NG  K D   GD +ED S          IL  +F   G+HSA+ HD IV++  +E   
Sbjct  891   QINGVSKLDKFQGDSEEDKSHAKPKVDEDRILEGIFAQSGVHSALKHDEIVDSSKQEHSL  950

Query  3179  LEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVT  3358
             + ++A ++A  AA AL++SR+      V  PTWTG+ G AG       KFG+       T
Sbjct  951   VSKEAEKIASEAAAALKRSRLAARNTGVGTPTWTGKFGLAG-------KFGT--KKIAKT  1001

Query  3359  SSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSS  3538
             +      + ++SS                              +I D L+++      S+
Sbjct  1002  TGTNKNTTKLLSS-----------------------------GSILDSLKNK------ST  1026

Query  3539  SNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSAS-IVEHFRSRVPSKD  3715
             + S     ++  S  +  S  +  +  I+++  F+ ++    S+++ I++     +  + 
Sbjct  1027  NKSNNSVFKSNRSSSTEKSLNVDKQQFIQKIHNFLLKQADYFSTSNDILKAIEIEISDEG  1086

Query  3716  LA-LFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
              A + +++L+EIAT  K+  G  W+LKP++ E
Sbjct  1087  TASMVRSMLREIATWNKDRKG--WVLKPDFVE  1116



>gb|EMG50087.1| hypothetical protein G210_4903 [Candida maltosa Xu316]
Length=1026

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/702 (47%), Positives = 472/702 (67%), Gaps = 28/702 (4%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+QV++FL  
Sbjct  249   PDSRLNNSFKLPGDIYPSLFDYQKTCVQWLWELYSQKTGGIIGDEMGLGKTIQVISFLAG  308

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP +IV P T+L QW  E  +W+P     ILH   +  ++K   SK  E   
Sbjct  309   LHYSGLLDKPVLIVVPATVLNQWVNEFHRWWPPLRCVILHSIGSGMNEKISESKLEEYLE  368

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
              ++        + +  +   K  ++I+ VL     +L+TTY  LR+  + +L  EWGYAV
Sbjct  369   TTDPTASKSSLQGIKSKINAK--EIIDRVL-EKGHVLVTTYVGLRIYADYILPHEWGYAV  425

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDF+FPG+LG LPVF+
Sbjct  426   LDEGHKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFIFPGRLGTLPVFQ  485

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F+VPI++GGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F 
Sbjct  486   QQFSVPINMGGYANSNNLQVKTAYKCAVVLRDLITPYMLRRLKSDVAKDLPKKNEMVLFV  545

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT +Q+ +Y+ FL S D++ I  G +N L G+D++RKICNHPDL+ R+   +   YG+P
Sbjct  546   KLTKIQQDLYEKFLQSDDLDSILKGKRNVLMGVDILRKICNHPDLVYRDALMKRKSYGDP  605

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-------GGYKYRRMDGA  2506
              +SGKM+V+ ++L++W+ + H+ L F QT+QMLDILE F+         G + Y RMDG+
Sbjct  606   LKSGKMQVLQKLLQIWQSENHKTLLFCQTRQMLDILEKFVANLPLLNGMGEFNYLRMDGS  665

Query  2507  TPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERA  2686
             TP+ +R  L+D FN    + +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERA
Sbjct  666   TPISRRQMLVDTFNQDPNMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERA  725

Query  2687  WRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLN  2866
             WR+GQKKD+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FK  DL DLF L 
Sbjct  726   WRLGQKKDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKNNDLHDLFTLG  785

Query  2867  DDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEE  3046
             D  ++ STE+S++F   +E+ ++   ++ D   D   +         +++        +E
Sbjct  786   DQDDDASTETSTLFQNQNENSSMFTKKYKDD--DDFYQVAKITGVAKLDKYEEGEEESDE  843

Query  3047  KADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK----LEEQASRVAQRA  3214
               D+N         ++ ++F  +G+HSA+ HD I+ +    +      +E +A+++A  A
Sbjct  844   STDDN--------RVMSSIFSTNGVHSALKHDDIIGSQQGREGSSTNIIEREANKIATAA  895

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTL  3340
             A+AL++S   R++  + +PTWTG+ G AG   + K+K  + L
Sbjct  896   ADALKRS---RTKTKIGVPTWTGKFGVAGKFNNKKRKSTAIL  934



>emb|CDS07037.1| hypothetical protein LRAMOSA09560 [Absidia idahoensis var. thermophila]
Length=1080

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/723 (48%), Positives = 463/723 (64%), Gaps = 61/723 (8%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQK-----------------VGVQWLWELHCQKAGGIIGDE  1405
             + L  GL IP  I+  L DYQK                 +GV+WLWELH QK        
Sbjct  299   IDLGTGLHIPREIWTNLLDYQKTCWYRRGQAHVSLLTPKLGVKWLWELHSQK--------  350

Query  1406  MGLGKTVQVLAFLGSLHFSNAYKP---SIIVCPLTLLQQWKREAKKWYPSFHVEILHDSV  1576
              GLGKTVQ++AFL  L+ S    P   ++IVCP T+++QW  E  +W+P   V +LH + 
Sbjct  351   -GLGKTVQMIAFLSGLYHSKILGPGKATVIVCPATVMKQWVEEFHRWWPPIRVAVLHATG  409

Query  1577  NDFhdkkkgskshesdseseelld-----vdvekNLSFRNTKKWDKLINHVLGSDSG---  1732
             +      K   +          L+              R  K    L N VL + +G   
Sbjct  410   SVMRTDTKQFTNPTQSDYDSSELEDVDLWKSESIARKRRKGKSEQSLSNDVLRTKTGRKA  469

Query  1733  ------------LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQT  1876
                         +LITTY  ++   + LL   WGY VLDEGH+IRNP+++ TL CKQ +T
Sbjct  470   HALVERFVRLGGVLITTYNGVQAYRQILLKHRWGYVVLDEGHKIRNPDSETTLACKQFKT  529

Query  1877  VHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTA  2056
              HRII++G+PIQN L ELWSLFDF+FPG+LG LPVF+ +F+VPI+IGGYANAT +QV TA
Sbjct  530   SHRIILSGTPIQNNLKELWSLFDFIFPGRLGTLPVFQTQFSVPITIGGYANATNMQVQTA  589

Query  2057  YRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIF  2236
             YRCA VLRDLI PYLLRRMK DV   LP K E V+FC LTS+QR  Y  F+ S D++ I 
Sbjct  590   YRCACVLRDLINPYLLRRMKVDVATDLPAKNEQVLFCKLTSIQREAYLRFINSKDMDAIL  649

Query  2237  DGSKNALYGIDVMRKICNHPDLLE--REHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGH  2410
             +  +  LYGID++RKICNHPDL+    + +  DP YG+PE+SGK+ VV  +L+LWK Q H
Sbjct  650   ERRRQVLYGIDIVRKICNHPDLVTATTKSAAEDPSYGDPEKSGKLVVVRALLRLWKTQNH  709

Query  2411  RVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRV  2590
             +VL FSQT+QMLDI+E  + + G+KY RMDG T V QRM L+++FN   +I++F+LTT+V
Sbjct  710   KVLLFSQTRQMLDIIERVVKSLGFKYLRMDGNTAVGQRMVLVNDFNTQDDIYVFLLTTKV  769

Query  2591  GGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQ  2770
             GGLG NLTGA+RVIIFDPDWNPS DMQARERAWR+GQ+KDVT+YRL+T GTIEEK+YHRQ
Sbjct  770   GGLGLNLTGADRVIIFDPDWNPSTDMQARERAWRLGQRKDVTIYRLMTSGTIEEKIYHRQ  829

Query  2771  IYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIF--SQLSEDVNI--T  2938
             IYK  LTNKILK+P+Q+R F A +LK LF L DDG +  TE+  +F  +++S   +   T
Sbjct  830   IYKQFLTNKILKDPKQKRFFDASNLKALFTLGDDGSSSGTETGQLFKGTEVSYQSSKPET  889

Query  2939  GPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHG  3118
             G +    +KD+ +  N       +  D N     EE+A +      ED ++L++LF+  G
Sbjct  890   GSKSSADDKDQLLALNGVADVEQLAEDYN-----EEQAGDLETHYAED-NVLKSLFEMTG  943

Query  3119  IHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTA  3298
             I SA+ HD I+ +  +E+L  + +A+ VA+ A + L++SR  R +  VA PTWTGRSG A
Sbjct  944   IQSALQHDQIMESGQQERLLADNEAALVAKHATQVLKESRRERRKMGVATPTWTGRSGVA  1003

Query  3299  GAP  3307
             GAP
Sbjct  1004  GAP  1006



>gb|KGU01780.1| DNA excision repair protein ERCC-6 [Candida albicans 19F]
Length=1055

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/714 (47%), Positives = 473/714 (66%), Gaps = 27/714 (4%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  257   LNEKFKLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFLAGLHYS  316

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP ++V P T+L QW  E  +W+P     ILH   +  +     SK  E    ++ 
Sbjct  317   GLLDKPVLVVVPATVLNQWVNEFHRWWPPLRCIILHSIGSGMNGSVSESKLEEYLESTDP  376

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
             +        +  +   +  ++++ V+     +L+TTY  LR+  + +L  EWGY VLDEG
Sbjct  377   VATQSSLHGIKSQINAQ--EIVDRVM-EKGHVLVTTYVGLRIYSKHILPREWGYVVLDEG  433

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ EF+
Sbjct  434   HKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQEFS  493

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  494   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAQDLPKKNEMVLFVKLTK  553

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             +Q+ +Y++FL S D+E I  G +N L G+D++RKICNHPDL+ R+   +  +YG+P +SG
Sbjct  554   IQQELYESFLQSEDLESILKGKRNVLMGVDILRKICNHPDLVYRDTLMKRKNYGDPAKSG  613

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F     L+ GG + Y RMDG+TP+ +
Sbjct  614   KMQVLKNLLRLWQSENHKTLLFCQTRQMLDILEKFVANLSLINGGDFNYLRMDGSTPISK  673

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D FN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  674   RQMLVDAFNQDPDMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  733

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             K+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  734   KRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  793

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEK--------DKSIKTNPADHGTAMERDNNSGSN  3037
             G TE++ +F    +         P Q +        D    +  A      + D     +
Sbjct  794   G-TETAQLFEGGEQSQQKYSGTKPRQSRGLFKKKYKDDDDFSQVARISGVSKLDKFEDGD  852

Query  3038  GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQASRVAQRA  3214
               +   ++    +ED  I+ ++F   G+HS + HD I++   E++  L E++A ++A  A
Sbjct  853   HNDGDGDSTYSANEDNRIMSSIFAQSGVHSTLQHDDIISGSKEKESSLVEKEADKLATAA  912

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             AEAL++SRM   + ++  PTWTG+ G+AG       KFG      L +SS  L+
Sbjct  913   AEALKKSRMQTRKNTIGTPTWTGKFGSAG-------KFGLKRRKLLNSSSTILQ  959



>gb|KGR01163.1| DNA excision repair protein ERCC-6 [Candida albicans P78048]
Length=1055

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/714 (47%), Positives = 473/714 (66%), Gaps = 27/714 (4%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  257   LNEKFKLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFLAGLHYS  316

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP ++V P T+L QW  E  +W+P     ILH   +  +     SK  E    ++ 
Sbjct  317   GLLDKPVLVVVPATVLNQWVNEFHRWWPPLRCIILHSIGSGMNGSVSESKLEEYLESTDP  376

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
             +        +  +   +  ++++ V+     +L+TTY  LR+  + +L  EWGY VLDEG
Sbjct  377   VATQSSLHGIKSQINAQ--EIVDRVM-EKGHVLVTTYVGLRIYSKHILPREWGYVVLDEG  433

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ EF+
Sbjct  434   HKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQEFS  493

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  494   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAQDLPKKNEMVLFVKLTK  553

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             +Q+ +Y++FL S D+E I  G +N L G+D++RKICNHPDL+ R+   +  +YG+P +SG
Sbjct  554   IQQELYESFLQSEDLESILKGKRNVLMGVDILRKICNHPDLVYRDTLMKRKNYGDPAKSG  613

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F     L+ GG + Y RMDG+TP+ +
Sbjct  614   KMQVLKNLLRLWQSENHKTLLFCQTRQMLDILEKFVANLSLINGGDFNYLRMDGSTPISK  673

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D FN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  674   RQMLVDAFNQDPDMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  733

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             K+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  734   KRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  793

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEK--------DKSIKTNPADHGTAMERDNNSGSN  3037
             G TE++ +F    +         P Q +        D    +  A      + D     +
Sbjct  794   G-TETAQLFEGGEQSQQKYSGTKPRQSRGLFKKKYKDDDDFSQVARISGVSKLDKFEDGD  852

Query  3038  GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQASRVAQRA  3214
               +   ++    +ED  I+ ++F   G+HS + HD I++   E++  L E++A ++A  A
Sbjct  853   HNDGDGDSTYSANEDNRIMSSIFAQSGVHSTLQHDDIISGSKEKESSLVEKEADKLATAA  912

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             AEAL++SRM   + ++  PTWTG+ G+AG       KFG      L +SS  L+
Sbjct  913   AEALKKSRMQTRKNTIGTPTWTGKFGSAG-------KFGLKKRKLLNSSSTILQ  959



>gb|KHC43820.1| DNA excision repair protein ERCC-6 [Candida albicans P60002]
Length=1054

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/714 (47%), Positives = 472/714 (66%), Gaps = 27/714 (4%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  257   LNEKFKLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFLAGLHYS  316

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP ++V P T+L QW  E  +W+P     ILH   +  +     SK  E    ++ 
Sbjct  317   GLLDKPVLVVVPATVLNQWVNEFHRWWPPLRCIILHSIGSGMNGSVSESKLEEYLESTDP  376

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                      +  +   +  ++++ V+     +L+TTY  LR+  + +L  EWGY VLDEG
Sbjct  377   DATQSSLHGIKSQINAQ--EIVDRVM-EKGHVLVTTYVGLRIYSKHILPREWGYVVLDEG  433

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ EF+
Sbjct  434   HKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQEFS  493

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  494   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAQDLPKKNEMVLFVKLTK  553

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             +Q+ +Y++FL S D+E I  G +N L G+D++RKICNHPDL+ R+   +  +YG+P +SG
Sbjct  554   IQQELYESFLQSEDLESILKGKRNVLMGVDILRKICNHPDLVYRDTLMKRKNYGDPAKSG  613

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F     L+ GG + Y RMDG+TP+ +
Sbjct  614   KMQVLKNLLRLWQSENHKTLLFCQTRQMLDILEKFVANLSLINGGDFNYLRMDGSTPISK  673

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D FN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  674   RQMLVDAFNQDPDMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  733

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             K+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  734   KRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  793

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEK--------DKSIKTNPADHGTAMERDNNSGSN  3037
             G TE++ +F    +         P Q +        D    +  A      + D     +
Sbjct  794   G-TETAQLFEGGEQSQQKYSGTKPRQSRGLFKKKYKDDDDFSQVARISGVSKLDKFEDGD  852

Query  3038  GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQASRVAQRA  3214
               +   ++    +ED  I+ ++F   G+HS + HD I++   E++  L E++A ++A  A
Sbjct  853   HNDGDGDSTYSANEDNRIMSSIFAQSGVHSTLQHDDIISGSKEKESSLVEKEADKLATAA  912

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             AEAL++SRM   + ++  PTWTG+ G+AG       KFG      L +SS  L+
Sbjct  913   AEALKKSRMQTRKNTIGTPTWTGKFGSAG-------KFGLKRRKLLNSSSTILQ  959



>gb|KHC44495.1| DNA excision repair protein ERCC-6 [Candida albicans P37039]
Length=1055

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/714 (47%), Positives = 473/714 (66%), Gaps = 27/714 (4%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  257   LNEKFKLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFLAGLHYS  316

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP ++V P T+L QW  E  +W+P     ILH   +  +     SK  E    ++ 
Sbjct  317   GLLDKPVLVVVPATVLNQWVNEFHRWWPPLRCIILHSIGSGMNGSVSESKLEEYLESTDP  376

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
             +        +  +   +  ++++ V+     +L+TTY  LR+  + +L  EWGY VLDEG
Sbjct  377   VATQSSLHGIKSQINAQ--EIVDRVM-EKGHVLVTTYVGLRIYSKHILPREWGYVVLDEG  433

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ EF+
Sbjct  434   HKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQEFS  493

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  494   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAQDLPKKNEMVLFVKLTK  553

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             +Q+ +Y++FL S D+E I  G +N L G+D++RKICNHPDL+ R+   +  +YG+P +SG
Sbjct  554   IQQELYESFLQSEDLESILKGKRNVLMGVDILRKICNHPDLVYRDTLMKRKNYGDPAKSG  613

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F     L+ GG + Y RMDG+TP+ +
Sbjct  614   KMQVLKNLLRLWQSENHKTLLFCQTRQMLDILEKFVANLSLINGGDFNYLRMDGSTPISK  673

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D FN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  674   RQMLVDAFNQDPDMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  733

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             K+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  734   KRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  793

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEK--------DKSIKTNPADHGTAMERDNNSGSN  3037
             G TE++ +F    +         P Q +        D    +  A      + D     +
Sbjct  794   G-TETAQLFEGGEQSQQKYSGTKPRQSRGLFKKKYKDDDDFSQVARISGVSKLDKFEDGD  852

Query  3038  GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQASRVAQRA  3214
               +   ++    +ED  I+ ++F   G+HS + HD I++   E++  L E++A ++A  A
Sbjct  853   HNDGDGDSTYSANEDNRIMSSIFAQSGVHSTLQHDDIISGSKEKESSLVEKEADKLATAA  912

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             AEAL++SRM   + ++  PTWTG+ G+AG       KFG      L +SS  L+
Sbjct  913   AEALKKSRMQTRKNTIGTPTWTGKFGSAG-------KFGLKKRKLLNSSSTILQ  959



>gb|KGT63062.1| DNA excision repair protein ERCC-6 [Candida albicans 12C]
Length=1055

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/714 (47%), Positives = 473/714 (66%), Gaps = 27/714 (4%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  257   LNEKFKLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFLAGLHYS  316

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP ++V P T+L QW  E  +W+P     ILH   +  +     SK  E    ++ 
Sbjct  317   GLLDKPVLVVVPATVLNQWVNEFHRWWPPLRCIILHSIGSGMNGSVSESKLEEYLESTDP  376

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
             +        +  +   +  ++++ V+     +L+TTY  LR+  + +L  EWGY VLDEG
Sbjct  377   VATQSSLHGIKSQINAQ--EIVDRVM-EKGHVLVTTYVGLRIYSKHILPREWGYVVLDEG  433

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ EF+
Sbjct  434   HKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQEFS  493

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  494   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAQDLPKKNEMVLFVKLTK  553

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             +Q+ +Y++FL S D+E I  G +N L G+D++RKICNHPDL+ R+   +  +YG+P +SG
Sbjct  554   IQQELYESFLQSEDLESILKGKRNVLMGVDILRKICNHPDLVYRDTLMKRKNYGDPAKSG  613

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F     L+ GG + Y RMDG+TP+ +
Sbjct  614   KMQVLKNLLRLWQSENHKTLLFCQTRQMLDILEKFVANLSLINGGDFNYLRMDGSTPISK  673

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D FN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  674   RQMLVDAFNQDPDMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  733

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             K+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  734   KRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  793

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEK--------DKSIKTNPADHGTAMERDNNSGSN  3037
             G TE++ +F    +         P Q +        D    +  A      + D     +
Sbjct  794   G-TETAQLFEGGEQSQQKYSGTKPRQSRGLFKKKYKDDDDFSQVARISGVSKLDKFEDGD  852

Query  3038  GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQASRVAQRA  3214
               +   ++    +ED  I+ ++F   G+HS + HD I++   E++  L E++A ++A  A
Sbjct  853   HNDGDGDSTYSANEDNRIMSSIFAQSGVHSTLQHDDIISGSKEKESSLVEKEADKLATAA  912

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             AEAL++SRM   + ++  PTWTG+ G+AG       KFG      L +SS  L+
Sbjct  913   AEALKKSRMQTRKNTIGTPTWTGKFGSAG-------KFGLKRRKLLNSSSTILQ  959



>ref|XP_714234.1| hypothetical protein CaO19.607 [Candida albicans SC5314]
 gb|EAK95157.1| hypothetical protein CaO19.607 [Candida albicans SC5314]
 gb|EEQ43834.1| hypothetical protein CAWG_02085 [Candida albicans WO-1]
 gb|KGQ81189.1| DNA excision repair protein ERCC-6 [Candida albicans P37005]
 gb|KGR00918.1| DNA excision repair protein ERCC-6 [Candida albicans P57072]
 gb|KHC28102.1| DNA excision repair protein ERCC-6 [Candida albicans P76055]
 gb|KHC28589.1| DNA excision repair protein ERCC-6 [Candida albicans P76067]
Length=1055

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/714 (47%), Positives = 472/714 (66%), Gaps = 27/714 (4%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  257   LNEKFKLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFLAGLHYS  316

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP ++V P T+L QW  E  +W+P     ILH   +  +     SK  E    ++ 
Sbjct  317   GLLDKPVLVVVPATVLNQWVNEFHRWWPPLRCIILHSIGSGMNGSVSESKLEEYLESTDP  376

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                      +  +   +  ++++ V+     +L+TTY  LR+  + +L  EWGY VLDEG
Sbjct  377   DATQSSLHGIKSQINAQ--EIVDRVM-EKGHVLVTTYVGLRIYSKHILPREWGYVVLDEG  433

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ EF+
Sbjct  434   HKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQEFS  493

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  494   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAQDLPKKNEMVLFVKLTK  553

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             +Q+ +Y++FL S D+E I  G +N L G+D++RKICNHPDL+ R+   +  +YG+P +SG
Sbjct  554   IQQELYESFLQSEDLESILKGKRNVLMGVDILRKICNHPDLVYRDTLMKRKNYGDPAKSG  613

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F     L+ GG + Y RMDG+TP+ +
Sbjct  614   KMQVLKNLLRLWQSENHKTLLFCQTRQMLDILEKFVANLSLINGGDFNYLRMDGSTPISK  673

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D FN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  674   RQMLVDAFNQDPDMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  733

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             K+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  734   KRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  793

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEK--------DKSIKTNPADHGTAMERDNNSGSN  3037
             G TE++ +F    +         P Q +        D    +  A      + D     +
Sbjct  794   G-TETAQLFEGGEQSQQKYSGTKPRQSRGLFKKKYKDDDDFSQVARISGVSKLDKFEDGD  852

Query  3038  GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQASRVAQRA  3214
               +   ++    +ED  I+ ++F   G+HS + HD I++   E++  L E++A ++A  A
Sbjct  853   HNDGDGDSTYSANEDNRIMSSIFAQSGVHSTLQHDDIISGSKEKESSLVEKEADKLATAA  912

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             AEAL++SRM   + ++  PTWTG+ G+AG       KFG      L +SS  L+
Sbjct  913   AEALKKSRMQTRKNTIGTPTWTGKFGSAG-------KFGLKKRKLLNSSSTILQ  959



>gb|KGQ82092.1| DNA excision repair protein ERCC-6 [Candida albicans P94015]
Length=1055

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/714 (47%), Positives = 472/714 (66%), Gaps = 27/714 (4%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  257   LNEKFKLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFLAGLHYS  316

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP ++V P T+L QW  E  +W+P     ILH   +  +     SK  E    ++ 
Sbjct  317   GLLDKPVLVVVPATVLNQWVNEFHRWWPPLRCIILHSIGSGMNGSVSESKLEEYLESTDP  376

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                      +  +   +  ++++ V+     +L+TTY  LR+  + +L  EWGY VLDEG
Sbjct  377   DATQSSLHGIKSQINAQ--EIVDRVM-EKGHVLVTTYVGLRIYSKHILPREWGYVVLDEG  433

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ EF+
Sbjct  434   HKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQEFS  493

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  494   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAQDLPKKNEMVLFVKLTK  553

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             +Q+ +Y++FL S D+E I  G +N L G+D++RKICNHPDL+ R+   +  +YG+P +SG
Sbjct  554   IQQELYESFLQSEDLESILKGKRNVLMGVDILRKICNHPDLVYRDTLMKRKNYGDPAKSG  613

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F     L+ GG + Y RMDG+TP+ +
Sbjct  614   KMQVLKNLLRLWQSENHKTLLFCQTRQMLDILEKFVANLSLINGGDFNYLRMDGSTPISK  673

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D FN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  674   RQMLVDAFNQDPDMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  733

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             K+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  734   KRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  793

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEK--------DKSIKTNPADHGTAMERDNNSGSN  3037
             G TE++ +F    +         P Q +        D    +  A      + D     +
Sbjct  794   G-TETAQLFEGGEQSQQKYSGTKPRQSRGLFKKKYKDDDDFSQVARISGVSKLDKFEDGD  852

Query  3038  GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQASRVAQRA  3214
               +   ++    +ED  I+ ++F   G+HS + HD I++   E++  L E++A ++A  A
Sbjct  853   HNDGDGDSTYSANEDNRIMSSIFAQSGVHSTLQHDDIISGSKEKESSLVEKEADKLATAA  912

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             AEAL++SRM   + ++  PTWTG+ G+AG       KFG      L +SS  L+
Sbjct  913   AEALKKSRMQTRKNTIGTPTWTGKFGSAG-------KFGLKRRKLLNSSSTILQ  959



>gb|KGQ80968.1| DNA excision repair protein ERCC-6 [Candida albicans GC75]
 gb|KGU18226.1| DNA excision repair protein ERCC-6 [Candida albicans P34048]
 gb|KHC70646.1| DNA excision repair protein ERCC-6 [Candida albicans SC5314]
 gb|KHC77233.1| DNA excision repair protein ERCC-6 [Candida albicans SC5314]
Length=1055

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/714 (47%), Positives = 472/714 (66%), Gaps = 27/714 (4%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  257   LNEKFKLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFLAGLHYS  316

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP ++V P T+L QW  E  +W+P     ILH   +  +     SK  E    ++ 
Sbjct  317   GLLDKPVLVVVPATVLNQWVNEFHRWWPPLRCIILHSIGSGMNGSVSESKLEEYLESTDP  376

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                      +  +   +  ++++ V+     +L+TTY  LR+  + +L  EWGY VLDEG
Sbjct  377   DATQSSLHGIKSQINAQ--EIVDRVM-EKGHVLVTTYVGLRIYSKHILPREWGYVVLDEG  433

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ EF+
Sbjct  434   HKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQEFS  493

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  494   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAQDLPKKNEMVLFVKLTK  553

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             +Q+ +Y++FL S D+E I  G +N L G+D++RKICNHPDL+ R+   +  +YG+P +SG
Sbjct  554   IQQELYESFLQSEDLESILKGKRNVLMGVDILRKICNHPDLVYRDTLMKRKNYGDPAKSG  613

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F     L+ GG + Y RMDG+TP+ +
Sbjct  614   KMQVLKNLLRLWQSENHKTLLFCQTRQMLDILEKFVANLSLINGGDFNYLRMDGSTPISK  673

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D FN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  674   RQMLVDAFNQDPDMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  733

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             K+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  734   KRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  793

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEK--------DKSIKTNPADHGTAMERDNNSGSN  3037
             G TE++ +F    +         P Q +        D    +  A      + D     +
Sbjct  794   G-TETAQLFEGGEQSQQKYSGTKPRQSRGLFKKKYKDDDDFSQVARISGVSKLDKFEDGD  852

Query  3038  GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQASRVAQRA  3214
               +   ++    +ED  I+ ++F   G+HS + HD I++   E++  L E++A ++A  A
Sbjct  853   HNDGDGDSTYSANEDNRIMSSIFAQSGVHSTLQHDDIISGSKEKESSLVEKEADKLATAA  912

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             AEAL++SRM   + ++  PTWTG+ G+AG       KFG      L +SS  L+
Sbjct  913   AEALKKSRMQTRKNTIGTPTWTGKFGSAG-------KFGLKKRKLLNSSSTILQ  959



>gb|KGR05680.1| DNA excision repair protein ERCC-6 [Candida albicans P37037]
 gb|KGU21658.1| DNA excision repair protein ERCC-6 [Candida albicans P75063]
 gb|KHC28795.1| DNA excision repair protein ERCC-6 [Candida albicans Ca6]
Length=1055

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/714 (47%), Positives = 472/714 (66%), Gaps = 27/714 (4%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  257   LNEKFKLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFLAGLHYS  316

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP ++V P T+L QW  E  +W+P     ILH   +  +     SK  E    ++ 
Sbjct  317   GLLDKPVLVVVPATVLNQWVNEFHRWWPPLRCIILHSIGSGMNGSVSESKLEEYLESTDP  376

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                      +  +   +  ++++ V+     +L+TTY  LR+  + +L  EWGY VLDEG
Sbjct  377   DATQSSLHGIKSQINAQ--EIVDRVM-EKGHVLVTTYVGLRIYSKHILPREWGYVVLDEG  433

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ EF+
Sbjct  434   HKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQEFS  493

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  494   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAQDLPKKNEMVLFVKLTK  553

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             +Q+ +Y++FL S D+E I  G +N L G+D++RKICNHPDL+ R+   +  +YG+P +SG
Sbjct  554   IQQELYESFLQSEDLESILKGKRNVLMGVDILRKICNHPDLVYRDTLMKRKNYGDPAKSG  613

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F     L+ GG + Y RMDG+TP+ +
Sbjct  614   KMQVLKNLLRLWQSENHKTLLFCQTRQMLDILEKFVANLSLINGGDFNYLRMDGSTPISK  673

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D FN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  674   RQMLVDAFNQDPDMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  733

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             K+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  734   KRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  793

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEK--------DKSIKTNPADHGTAMERDNNSGSN  3037
             G TE++ +F    +         P Q +        D    +  A      + D     +
Sbjct  794   G-TETAQLFEGGEQSQQKYSGTKPRQSRGLFKKKYKDDDDFSQVARISGVSKLDKFEDGD  852

Query  3038  GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQASRVAQRA  3214
               +   ++    +ED  I+ ++F   G+HS + HD I++   E++  L E++A ++A  A
Sbjct  853   HNDGDGDSTYSANEDNRIMSSIFAQSGVHSTLQHDDIISGSKEKESSLVEKEADKLATAA  912

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             AEAL++SRM   + ++  PTWTG+ G+AG       KFG      L +SS  L+
Sbjct  913   AEALKKSRMQTRKNTIGTPTWTGKFGSAG-------KFGLKRRKLLNSSSTILQ  959



>gb|KGU01022.1| DNA excision repair protein ERCC-6 [Candida albicans P87]
 gb|KGU20729.1| DNA excision repair protein ERCC-6 [Candida albicans P57055]
 gb|KHC54816.1| DNA excision repair protein ERCC-6 [Candida albicans P75010]
 gb|KHC60009.1| DNA excision repair protein ERCC-6 [Candida albicans P75016]
 gb|KHC64346.1| DNA excision repair protein ERCC-6 [Candida albicans P78042]
Length=1055

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/714 (47%), Positives = 472/714 (66%), Gaps = 27/714 (4%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  257   LNEKFKLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFLAGLHYS  316

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP ++V P T+L QW  E  +W+P     ILH   +  +     SK  E    ++ 
Sbjct  317   GLLDKPVLVVVPATVLNQWVNEFHRWWPPLRCIILHSIGSGMNGSVSESKLEEYLESTDP  376

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                      +  +   +  ++++ V+     +L+TTY  LR+  + +L  EWGY VLDEG
Sbjct  377   DATQSSLHGIKSQINAQ--EIVDRVM-EKGHVLVTTYVGLRIYSKHILPREWGYVVLDEG  433

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ EF+
Sbjct  434   HKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQEFS  493

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  494   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAQDLPKKNEMVLFVKLTK  553

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             +Q+ +Y++FL S D+E I  G +N L G+D++RKICNHPDL+ R+   +  +YG+P +SG
Sbjct  554   IQQELYESFLQSEDLESILKGKRNVLMGVDILRKICNHPDLVYRDTLMKRKNYGDPAKSG  613

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F     L+ GG + Y RMDG+TP+ +
Sbjct  614   KMQVLKNLLRLWQSENHKTLLFCQTRQMLDILEKFVANLSLINGGDFNYLRMDGSTPISK  673

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D FN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  674   RQMLVDAFNQDPDMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  733

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             K+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  734   KRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  793

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEK--------DKSIKTNPADHGTAMERDNNSGSN  3037
             G TE++ +F    +         P Q +        D    +  A      + D     +
Sbjct  794   G-TETAQLFEGGEQSQQKYSGTKPRQSRGLFKKKYKDDDDFSQVARISGVSKLDKFEDGD  852

Query  3038  GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQASRVAQRA  3214
               +   ++    +ED  I+ ++F   G+HS + HD I++   E++  L E++A ++A  A
Sbjct  853   HNDGDGDSTYSANEDNRIMSSIFAQSGVHSTLQHDDIISGSKEKESSLVEKEADKLATAA  912

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             AEAL++SRM   + ++  PTWTG+ G+AG       KFG      L +SS  L+
Sbjct  913   AEALKKSRMQTRKNTIGTPTWTGKFGSAG-------KFGLKKRKLLNSSSTILQ  959



>ref|XP_714194.1| hypothetical protein CaO19.8240 [Candida albicans SC5314]
 gb|EAK95111.1| hypothetical protein CaO19.8240 [Candida albicans SC5314]
 gb|KGU01511.1| DNA excision repair protein ERCC-6 [Candida albicans L26]
Length=1055

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/714 (47%), Positives = 472/714 (66%), Gaps = 27/714 (4%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  257   LNEKFKLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFLAGLHYS  316

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP ++V P T+L QW  E  +W+P     ILH   +  +     SK  E    ++ 
Sbjct  317   GLLDKPVLVVVPATVLNQWVNEFHRWWPPLRCIILHSIGSGMNGSVSESKLEEYLESTDP  376

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                      +  +   +  ++++ V+     +L+TTY  LR+  + +L  EWGY VLDEG
Sbjct  377   DATQSSLHGIKSQINAQ--EIVDRVM-EKGHVLVTTYVGLRIYSKHILPREWGYVVLDEG  433

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK+++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ EF+
Sbjct  434   HKIRNPDSDISLTCKKIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQEFS  493

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  494   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAQDLPKKNEMVLFVKLTK  553

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
             +Q+ +Y++FL S D+E I  G +N L G+D++RKICNHPDL+ R+   +  +YG+P +SG
Sbjct  554   IQQELYESFLQSEDLESILKGKRNVLMGVDILRKICNHPDLVYRDTLMKRKNYGDPAKSG  613

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F     L+ GG + Y RMDG+TP+ +
Sbjct  614   KMQVLKNLLRLWQSENHKTLLFCQTRQMLDILEKFVANLSLINGGDFNYLRMDGSTPISK  673

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D FN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  674   RQMLVDAFNQDPDMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  733

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             K+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  734   KRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  793

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEK--------DKSIKTNPADHGTAMERDNNSGSN  3037
             G TE++ +F    +         P Q +        D    +  A      + D     +
Sbjct  794   G-TETAQLFEGGEQSQQKYSGTKPRQSRGLFKKKYKDDDDFSQVARISGVSKLDKFEDGD  852

Query  3038  GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQASRVAQRA  3214
               +   ++    +ED  I+ ++F   G+HS + HD I++   E++  L E++A ++A  A
Sbjct  853   HNDGDGDSTYSANEDNRIMSSIFAQSGVHSTLQHDDIISGSKEKESSLVEKEADKLATAA  912

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             AEAL++SRM   + ++  PTWTG+ G+AG       KFG      L +SS  L+
Sbjct  913   AEALKKSRMQTRKNTIGTPTWTGKFGSAG-------KFGLKRRKLLNSSSTILQ  959



>ref|XP_004202370.1| Piso0_001862 [Millerozyma farinosa CBS 7064]
 emb|CCE89064.1| Piso0_001862 [Millerozyma farinosa CBS 7064]
Length=1117

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/876 (42%), Positives = 528/876 (60%), Gaps = 91/876 (10%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
              +L    ++P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++F+  LH
Sbjct  301   AVLNESFRLPGDIYPSLFDYQKTCVQWLWELYTQKTGGIIGDEMGLGKTIQIISFIAGLH  360

Query  1457  FSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             +S   + P +IV P T+L QW  E  +W+P     ILH   +  +      +    +   
Sbjct  361   YSKLLEDPVLIVVPATVLNQWVNEFHRWWPPLRCVILHSIGSGMNKALVSKEEKMEELLE  420

Query  1634  eelldvdvekNL-SFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVL  1810
                     + +L S+ N  K  ++++ V      +LITTY  LR+  + +L  +WGYA+L
Sbjct  421   NADPFAVNKSSLKSYENELKAKEIVDSVF-QKGHILITTYVGLRIYSKYILPRKWGYAIL  479

Query  1811  DEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEA  1990
             DEGH+IRNP++DV+L CKQ++T +R+I++G+PIQN L ELWSLFDFVFPG+LG LPVF+ 
Sbjct  480   DEGHKIRNPDSDVSLTCKQIKTYNRVILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQ  539

Query  1991  EFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCS  2170
             +FAVPI++GGYANA+ +QV T Y+CAV+LRDLI PYLLRR+K+DV   LPKK E V+F  
Sbjct  540   QFAVPINMGGYANASNVQVQTGYKCAVILRDLISPYLLRRLKSDVARDLPKKNEMVLFVK  599

Query  2171  LTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLERE--HSCRDPDYGN  2344
             LT  Q+ +Y+ F+ S DV  I  G +N L G+D++RKICNHPDL++R+     R+ +YG+
Sbjct  600   LTEYQQQLYEKFIDSEDVSAILKGKRNVLMGVDILRKICNHPDLIDRDILSHRRNYNYGD  659

Query  2345  PERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL------------VTGGYKY  2488
             P +SGK++V+  +L+LWK +GHR L F QT+QMLDILE F+            + G + Y
Sbjct  660   PRKSGKLQVLKNLLQLWKKEGHRTLLFCQTRQMLDILEKFVGNLKSINDEGDDIDGKFNY  719

Query  2489  RRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDM  2668
              RMDG+TP+  R +L+D FNN     +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+
Sbjct  720   LRMDGSTPIAVRQSLVDTFNNNNYCHVFLLTTKVGGLGINLTGADRVIIYDPDWNPSTDI  779

Query  2669  QARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLK  2848
             QARERAWR+GQKKD+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR F+  DL 
Sbjct  780   QARERAWRLGQKKDITIYRLMTAGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFRMNDLH  839

Query  2849  DLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNS  3028
             DLF L D  E G TE+  +FS    +   TG +       KS K N   H    +  +  
Sbjct  840   DLFSLGDPEEMG-TETGDMFS--GSEKKFTGSKSR-----KSRKLNKPKHSNDDDFLDIV  891

Query  3029  GSNGEEKADNNNGDVDEDTS----------ILRTLFDAHGIHSAMDHDAIVNAHDEEKLK  3178
               NG  K D   GD +ED S          IL  +F   G+HSA+ HD IV++  +E   
Sbjct  892   QINGVSKLDKFQGDSEEDKSHAKPKVDEDRILEGIFAQSGVHSALKHDEIVDSSKQEHSL  951

Query  3179  LEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAG--APPSIKKKFGSTLNPQL  3352
             +  +A ++A  AA AL++SR+      V  PTWTG+ G AG   P  + K   S+ N   
Sbjct  952   VSREAEKIAAEAAAALKRSRLAARNTGVGTPTWTGKFGLAGKFGPKKVTKTTNSSKN---  1008

Query  3353  VTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSG  3532
               ++K L   S++ S +N                                          
Sbjct  1009  --TTKLLSSGSILDSLKN------------------------------------------  1024

Query  3533  SSSNSRTRAAENGASRPS--HGSAGMQPEVLIRQVCTFIQRKGGSTSSAS-IVEHFRSRV  3703
               S ++   +   ++RPS    S  +  E +I+++  F+ ++    S+++ I++     +
Sbjct  1025  -KSTNKPNKSVFKSNRPSSTEKSLNVDKEQIIQKIHNFLSKQADHFSTSNDILKAIEIEI  1083

Query  3704  PSKDLA-LFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
               +  A + +++L+EIAT  K+  G  W+LKP++ E
Sbjct  1084  SDEGTASIVRSMLREIATWNKDRKG--WVLKPDFVE  1117



>ref|XP_002548373.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gb|EER33852.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
Length=1043

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/682 (48%), Positives = 463/682 (68%), Gaps = 17/682 (2%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    ++P  I+  LFDYQK  VQWLWEL+ QK GGI+GDEMGLGKT+Q+++FL  LH+S
Sbjct  267   LNENFRLPGDIYPSLFDYQKTCVQWLWELYSQKTGGILGDEMGLGKTIQIISFLAGLHYS  326

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP +IV P T+L QW  E  +W+P     ILH S+    + K  +++   +     
Sbjct  327   GLLDKPVLIVVPATVLNQWVNEFHRWWPPLRCVILH-SIGSGMNGKNINEAKLEEFLENA  385

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
               +         ++     ++I+ V+     +L+TTY  LR+  + LL  EWGY VLDEG
Sbjct  386   DPNSSKSSLSGVKSQINAKEIIDRVM-EKGHVLVTTYVGLRIYSKYLLPREWGYVVLDEG  444

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CK ++TV+RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ +F+
Sbjct  445   HKIRNPDSDISLTCKMIKTVNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQQQFS  504

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYAN+  LQV TAY+CAVVLRDLI PY+LRR+K+DV   LPKK E V+F  LT 
Sbjct  505   IPINIGGYANSNNLQVKTAYKCAVVLRDLISPYMLRRLKSDVAKDLPKKNEMVLFVKLTK  564

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
              Q+ +Y+ FL S D++ I  G +N L GID++RKICNHPDL+ R+   +   YG+P RSG
Sbjct  565   PQQELYEKFLQSEDLDSILKGKRNMLMGIDILRKICNHPDLVYRDAMMKKKSYGDPSRSG  624

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENF-----LVTGG-YKYRRMDGATPVKQ  2521
             KM+V+  +L++W+ + H+ L F QT+QMLDILE F     L+ GG + Y RMDG+TP+ +
Sbjct  625   KMQVLKNLLQIWQSEDHKTLLFCQTRQMLDILEKFVANLPLLNGGEFNYLRMDGSTPISR  684

Query  2522  RMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQ  2701
             R  L+D+FN    + +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQ
Sbjct  685   RQMLVDKFNRDPNMHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRLGQ  744

Query  2702  KKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGEN  2881
             KKD+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L D  E 
Sbjct  745   KKDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKANDLHDLFTLGDQDEE  804

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER-DNNSGSNGEEKADN  3058
             G TE+ ++F++ + +   +      +  D   +       + +++ ++    +G +K   
Sbjct  805   G-TETEAMFNEKNNNNGSSLFTKKYKNDDDFYQVAKIAGVSKLDKFEDGEDEDGNDKQSE  863

Query  3059  NNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK--LEEQASRVAQRAAEALRQ  3232
             N     +D+ ++ ++F   G+HS + HD IVN+  +E     LE +AS++A  AAEAL++
Sbjct  864   NK----DDSRVMSSIFSTGGVHSTLAHDDIVNSQSKEDPTNMLENEASKIANAAAEALKE  919

Query  3233  SRMLRSQESVAIPTWTGRSGTA  3298
             SR    +  + +PTWTG+ G+ 
Sbjct  920   SRKQARKNKIGVPTWTGKFGSV  941



>gb|KFM24571.1| DNA repair protein rhp26 [Auxenochlorella protothecoides]
Length=751

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/809 (46%), Positives = 487/809 (60%), Gaps = 143/809 (18%)
 Frame = +2

Query  854   KGILTPFHKLKGFERQIQ--EPGQSSRHS--MQDNGDLVSTSLANAIQSISEAAQSRPTT  1021
             +G+LTPF  + GFER++   + G S R S   ++ G   +  +A  + SI  A   R TT
Sbjct  3     QGVLTPFDNVNGFERRVMHSKAGPSGRASPEAEEPGSEAAQRMAARLASIKAA---RHTT  59

Query  1022  KLLDSSLLPKLEPPT------YPFQTPRKHVKISQSAENGRNDK----RKRRPTPGKKWR  1171
             +LLD+  LP+ E PT      Y  Q   ++V+ ++     R  K    R+   + G+   
Sbjct  60    RLLDAQDLPQQERPTKRVDEGYWRQGNSEYVQPAKRRRRPRLRKLRGPREESASSGED--  117

Query  1172  VKVSRENKDEGP-DVEISSYedekddedmddeGP---------PFVMLEGGLKIPETIFD  1321
             V   R++ DE   D   ++    +D    ++ G            V  EGG +I   I+D
Sbjct  118   VGGERDDADEANFDARQAARARRRDRGAAEEGGSGSEAEPEEDALVEFEGGFRISAGIYD  177

Query  1322  KLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLT  1501
             +LF+YQ+ GV+WLWELH  + GGI+GDEMGLGKTVQ+ AFL  L  S  Y+PS+IVCP T
Sbjct  178   RLFEYQRTGVKWLWELHTHRTGGILGDEMGLGKTVQIGAFLAGLLASGLYRPSLIVCPAT  237

Query  1502  LLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRN  1681
             +L+QW                                                     R 
Sbjct  238   VLRQW----------------------------------------------------LRE  245

Query  1682  TKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVC  1861
              + W   +  + GS +GLL+TTYE +RL  E LL ++WGY +LDEGH+IRNP+ +VTL  
Sbjct  246   LRAWAPDLR-LAGSAAGLLLTTYEHMRLQRELLLSVDWGYVILDEGHKIRNPDAEVTLTA  304

Query  1862  KQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPL  2041
             KQ+ TVHR+I+TG+PIQN+L+ELWSLFDFVFPGKLG LPVF+A+F +PI IGGYANA+ L
Sbjct  305   KQMPTVHRLILTGAPIQNRLTELWSLFDFVFPGKLGTLPVFQAQFGLPIQIGGYANASAL  364

Query  2042  QVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTD  2221
             QVSTAY+CAVVLRD++ PYLLRR KADV+         V+FC LT VQR +Y+A+LAS D
Sbjct  365   QVSTAYKCAVVLRDVVGPYLLRRRKADVD---------VLFCMLTPVQRDLYKAYLASKD  415

Query  2222  VEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKD  2401
             ++ IF G + AL GID++RKICNHPDLL+R       DYG  ERSGK+ V+A VLK W  
Sbjct  416   LKDIFAGHRAALAGIDILRKICNHPDLLDRARWEASEDYGKQERSGKLVVLARVLKHWHA  475

Query  2402  QGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILT  2581
             QGH+ L F+QTQQMLDI+E  + T GY+Y RMDGAT V QR  L+D+FN+   +F+F+LT
Sbjct  476   QGHKALVFTQTQQMLDIVEKTVNTEGYRYHRMDGATAVSQRALLMDDFNDNPNVFLFLLT  535

Query  2582  TRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVY  2761
             TRVGGLG NLTGANR+++FDPDWN S D+QARERAWRIGQ +DVTVYR +T GTIEEK+Y
Sbjct  536   TRVGGLGVNLTGANRIVVFDPDWNFSTDVQARERAWRIGQTRDVTVYRFVTSGTIEEKIY  595

Query  2762  HRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITG  2941
             HRQ+YK  L++K+L++P+QRR FKARD+ DLF L  + ++G TE+S+IF       +  G
Sbjct  596   HRQVYKQFLSDKVLRDPRQRRFFKARDMHDLFTLGGEYQDG-TETSAIFGDAGFLHHHPG  654

Query  2942  PQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGI  3121
             P                                         DVD        LF+  G+
Sbjct  655   P-----------------------------------------DVD--------LFEGTGL  665

Query  3122  HSAMDHDAIVNAHDEEKLKLEEQASRVAQ  3208
             HSA+DH AI +A+D     LE  AS V Q
Sbjct  666   HSALDHSAIEHANDPG--TLERLASAVVQ  692


 Score = 64.3 bits (155),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +2

Query  3611  EVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWIL  3790
             E L   V  F++  GGS  SA++VEHF+  +P+  L LF+ +LK +ATL++      W+L
Sbjct  684   ERLASAVVQFLEGLGGSAPSAALVEHFQETLPAAQLPLFRGVLKSVATLRRRDGAKLWVL  743

Query  3791  KPEY  3802
             KPE+
Sbjct  744   KPEF  747



>gb|KGO69543.1| Helicase, C-terminal [Penicillium italicum]
Length=1116

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/689 (48%), Positives = 457/689 (66%), Gaps = 24/689 (3%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P + L+ GL++P  I   LF YQK GVQWLWELH Q  GGIIGDEMGLGKT+Q +++L +
Sbjct  313   PAMELDNGLRVPGDISRFLFPYQKTGVQWLWELHQQTVGGIIGDEMGLGKTIQAISYLAA  372

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH SN   KP+I+VCP TL++QW  E  +W+P F V ILH S +   +  K S    + S
Sbjct  373   LHHSNKLTKPAIVVCPATLMKQWVNEFHRWWPPFRVSILHSSGSGMINLGKESSRENALS  432

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +   +  KK  K +      +  +L+TTY  L+   + L+D+EWG A+
Sbjct  433   SEMMGSRNSRHLSAGQKAAKKIIKRVTE----EGHVLVTTYSGLQTYADALVDVEWGCAI  488

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+  +T  CK+L+T HRII++G+P+QN L +LWSLFDFVFP +LG L  F+
Sbjct  489   LDEGHKIRNPDAGITFSCKELRTPHRIILSGTPMQNSLVDLWSLFDFVFPMRLGNLVTFK  548

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F +PI  GGYA+A+ LQV TA +CA  L+D I PYLL+R KADV + LP K+E VIFC
Sbjct  549   NQFEIPIRQGGYASASNLQVQTAAKCAETLKDAISPYLLQRFKADVTSDLPMKSEQVIFC  608

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT +QR+IY+ FL S D++ I  G +N+LYGID++RKI NHPDL +     R+ DYG+ 
Sbjct  609   KLTQLQRTIYKRFLGSDDMKSIVRGKRNSLYGIDILRKISNHPDLADHTLRSREADYGDA  668

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL-VTGGYKYRRMDGATPVKQR  2524
             ERSGKMKV+  +L++W+D GH+ L F+Q + MLDI+E FL V GG+ YRRMDG TP+K+R
Sbjct  669   ERSGKMKVLQGLLEVWRDTGHKTLLFTQGRLMLDIIEKFLGVLGGFNYRRMDGTTPIKER  728

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               L+DEFNN  +I +F+LTTRVGG+G NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  729   QNLVDEFNNDPDIHVFLLTTRVGGIGVNLTGADRVIIYDPDWNPSTDLQARERAWRLGQK  788

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             +DVT++RL+T+GTIEEK+YHRQI+K  LTNKI ++P QR  F+  DL DLF L D+ ++ 
Sbjct  789   RDVTIFRLMTKGTIEEKIYHRQIFKQFLTNKITRDPHQREGFQLSDLYDLFTLTDENDD-  847

Query  2885  STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNN  3064
               E++ +F    ++  +T   + ++ KD  +  N     T  E DN +  NG    ++  
Sbjct  848   ELETTKLF----KNAEVT---YQEEAKDVPVSKNIKPAPTPKEEDNITDINGIANVEDFQ  900

Query  3065  GDVDEDTS-------ILRTLFDAHGIHSAMDHDAIVNAH---DEEKLKLEEQASRVAQRA  3214
                +E+ +       I+  +F   G+HSA+ HD IVN       +   +E +A RVA  A
Sbjct  901   NAAEEEKNAKTSEDRIMHGIFARSGVHSAVQHDQIVNGKRVLRADPKMIEAEARRVANEA  960

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAG  3301
             AE LR++        + +PTWTGR G  G
Sbjct  961   AEELRKAEETARALPIGLPTWTGRFGMGG  989



>ref|XP_001383607.2| DNA dependent ATPase [Scheffersomyces stipitis CBS 6054]
 gb|ABN65578.2| DNA dependent ATPase [Scheffersomyces stipitis CBS 6054]
Length=1067

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/870 (42%), Positives = 520/870 (60%), Gaps = 91/870 (10%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+QV++F+  
Sbjct  261   PDAVLNNQFKLPGDIYPSLFDYQKTCVQWLWELYSQKTGGIIGDEMGLGKTIQVISFVAG  320

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP ++V P T+L QW  E  +W+P     ILH S+     K       + + 
Sbjct  321   LHYSGLLDKPVLVVVPATVLNQWVNEFHRWWPPLRCIILH-SIGSGMGKSAVRSEEKLEE  379

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
               E       + +L   N++   K I   +     +L+TTY  LR+  + +L  EWGY V
Sbjct  380   FLENSDPTQSKNSLRGINSQINAKEIVDRVMEKGHVLVTTYVGLRIYSKHILPREWGYVV  439

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP++D++L CKQ++T +RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+
Sbjct  440   LDEGHKIRNPDSDISLTCKQIKTYNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFQ  499

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F++PI++GGYANA+ +QV T Y+CAV+LRDLI PYLLRR+K+DV   LPKK E V+F 
Sbjct  500   QQFSIPINMGGYANASNIQVQTGYKCAVILRDLISPYLLRRLKSDVAQDLPKKNEMVLFV  559

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLER---EHSCRDPDY  2338
              LT VQ+ +Y+ FL S ++  I  G +N L G+D++RKICNHPDL+ R   EH  ++ +Y
Sbjct  560   KLTQVQQELYEKFLHSEELSSILKGRRNVLMGVDILRKICNHPDLVNRDILEHK-KNYNY  618

Query  2339  GNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT--------GGYKYRR  2494
             GNP +SGKM+V+  +L+LW+ Q H+ L F QT+QMLDILE F+            + Y R
Sbjct  619   GNPVKSGKMQVLKNLLQLWQSQEHKTLLFCQTRQMLDILEKFVANLRLLDIDHEYFTYLR  678

Query  2495  MDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQA  2674
             MDG+TP+ +R  L+D+FN+   + +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QA
Sbjct  679   MDGSTPIAKRQDLVDKFNSDPNLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQA  738

Query  2675  RERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDL  2854
             RERAWR+GQKKD+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FK  DL DL
Sbjct  739   RERAWRLGQKKDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKVNDLHDL  798

Query  2855  FVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGS  3034
             F L D  E G TE+  +F+    +      + P     K  K +   +  A         
Sbjct  799   FTLGDQNEVG-TETGDMFNGSETNFGGNKTRAPSTLLKKKHKNDDDFYKVA-------SI  850

Query  3035  NGEEKADNNNGDVD---------EDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEE  3187
              G  K D   GD +         ++  I+  +F   G+HSA+ HD I+N+ ++E   +E+
Sbjct  851   TGVSKLDKFQGDEEEEEVSGESRDENRIMEGIFANSGVHSALKHDEIINSSNQEMSLVEK  910

Query  3188  QASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSK  3367
             +AS+VA  AA AL++SR L  +  +  PTWTG+ G AG       +FG            
Sbjct  911   EASKVANEAASALKRSRKLARRNEIGTPTWTGKFGLAG-------RFG------------  951

Query  3368  PLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNS  3547
               ++   +S R N   +                    Q++A+   +     F   S+S+ 
Sbjct  952   --QKKKTVSGRINKSKSILGEL--------------KQKKAVRASV-----FTKKSNSSE  990

Query  3548  RTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSK---DL  3718
                A +  A+              I ++ TF+Q +  S  ++S++    + V  K   D+
Sbjct  991   NNEAVDKKAT--------------IEKLVTFLQSRPDSFGTSSVILK-NAGVAMKDENDM  1035

Query  3719  ALFKNLLKEIATLKKNPNGSFWILKPEYQE  3808
              L +++L+EIA      +G  W LK E+ +
Sbjct  1036  ILIRSMLREIAVWDSGRSG--WKLKKEFSQ  1063



>gb|EKV16005.1| DNA repair protein Rhp26/Rad26, putative [Penicillium digitatum 
PHI26]
 gb|EKV20517.1| DNA repair protein Rhp26/Rad26, putative [Penicillium digitatum 
Pd1]
Length=1117

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/860 (45%), Positives = 522/860 (61%), Gaps = 81/860 (9%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P + L+ GL++P  I   LF YQK+GVQWLWELH Q  GGIIGDEMGLGKT+Q +++L +
Sbjct  314   PAMELDNGLRVPGDISRFLFPYQKIGVQWLWELHQQTVGGIIGDEMGLGKTIQAISYLAA  373

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S    KP+IIVCP TL++QW  E  +W+P F V ILH S +   +  K S    + S
Sbjct  374   LHHSKKLTKPAIIVCPATLMKQWVNEFHRWWPPFRVSILHSSGSGMINLGKESSRENALS  433

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                       + +      +K DK I   +  +  +L+TTY  L+   + L+D+EWG A+
Sbjct  434   SEMMGSRNSRQLSAG----QKADKRIIKRVTEEGHVLVTTYSGLQSYADALVDVEWGCAI  489

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+  +T  CK+L+T HRII++G+P+QN L +LWSLFDFVFP +LG L  F+
Sbjct  490   LDEGHKIRNPDAGITFSCKELRTPHRIILSGTPMQNSLVDLWSLFDFVFPMRLGNLVTFK  549

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F +PI  GGYA+A+ LQV TA +CA  L+D I PYLL+R KADV + LP K+E VIFC
Sbjct  550   NQFEIPIRQGGYASASNLQVQTAAKCAETLKDAISPYLLQRFKADVTSDLPMKSEQVIFC  609

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT +QR+IY+ FL S D++ I  G +N+L+GID++RKI NHPDL +     R+ DYG+ 
Sbjct  610   KLTQLQRTIYKRFLGSDDMKSIVRGKRNSLFGIDILRKISNHPDLADHALRSREADYGDA  669

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL-VTGGYKYRRMDGATPVKQR  2524
             ERSGKMKV+  +L++W+D GH+ L F+Q + MLDI+E FL V GG+  RRMDG TP+K+R
Sbjct  670   ERSGKMKVLKGLLEVWRDTGHKTLVFTQGRLMLDIIEKFLGVLGGFNSRRMDGTTPIKER  729

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               L+DEFNN  EI +F+LTTRVGG+G NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  730   QNLVDEFNNNPEIHVFLLTTRVGGIGVNLTGADRVIIYDPDWNPSTDLQARERAWRLGQK  789

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             +DVT++RL+T+GTIEEK+YHRQI+K  LTNKI ++P QR  F+  DL DLF L D+ +  
Sbjct  790   RDVTIFRLMTKGTIEEKIYHRQIFKQFLTNKITRDPHQREGFQLSDLYDLFTLTDENDE-  848

Query  2885  STESSSIFSQLSEDVNITGPQHPDQEKD----KSIKTNPADHGTAMERDNNSGSNGEE--  3046
               E++ +F    ++  +T   + ++ KD    K+IK  P         D N  +N EE  
Sbjct  849   ELETTKLF----KNAEVT---YQEEAKDVPGSKNIKPGPTPKAEDDITDINGIANVEEFQ  901

Query  3047  --KADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH---DEEKLKLEEQASRVAQR  3211
                 ++ N    ED  I+  +F   G+HSA+ HD IVN       +   +E +A RVA  
Sbjct  902   NAAEEDKNAKTSED-RIMHGIFARSGVHSAVQHDQIVNGKRGVRADPKMIEAEARRVANE  960

Query  3212  AAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMI  3391
             AAE LR++        + +PTWTGR G  G      +  GS+  P  V  S     SS +
Sbjct  961   AAEELRKAEETARALPIGLPTWTGRFGMGGREDP--RAGGSSARPAGVGPS-----SSDL  1013

Query  3392  SSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENG  3571
              +R N  AA A+                              Q  SGS S S        
Sbjct  1014  LARLNPAAAAAAG-----------------------------QRASGSDSPS--------  1036

Query  3572  ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS-KDLALFKNLLKEI  3748
              +R   G   M    LIR    ++  + G T S SIV HF     + + +A F+  LK++
Sbjct  1037  -ARMPRGKDFMP---LIRD---YLACQRGPTLSQSIVHHFNHYCSNPQRVAEFQESLKKV  1089

Query  3749  ATLK--KNPNGSFWILKPEY  3802
             ATL+  ++  G  W LKPE+
Sbjct  1090  ATLQHGRDRRGR-WTLKPEF  1108



>ref|XP_003067838.1| SNF2 family N-terminal domain containing protein [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER25693.1| SNF2 family N-terminal domain containing protein [Coccidioides 
posadasii C735 delta SOWgp]
Length=1213

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/868 (43%), Positives = 523/868 (60%), Gaps = 73/868 (8%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L+GG +IP  I+  LFDYQK GVQWLWEL+ Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  392   PDSVLDGGYRIPGDIYPYLFDYQKTGVQWLWELYQQRVGGIIGDEMGLGKTIQVIAFLAG  451

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S     P I+VCP T+++QW  E  +W+P   V ILH S +   + KK S++ ++ +
Sbjct  452   LHYSKKLDAPIIVVCPPTVMKQWVNEFHRWWPPLRVSILHTSGSGMINIKKESRAEDTLT  511

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +   +  K+   ++  VL  D  +L+TTY  L+     L+ ++WG A+
Sbjct  512   SEIWDPYRPTRMSGGQKAAKR---ILKRVL-EDGHVLVTTYAGLQTYTSLLIPVDWGCAI  567

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  568   LDEGHKIRNPDTAITIHCKELRTPHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  627

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKKTE V+FC
Sbjct  628   NQFEFPIRAGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKTEQVLFC  687

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCR--DPDYG  2341
              LT +QR+ Y+AFL+S ++  I  G ++ L+G+D++RKICNHPDL E +   +  + +YG
Sbjct  688   KLTKLQRAAYEAFLSSNEMSAIMRGRRDVLFGVDILRKICNHPDLPEHKTLSQKANYNYG  747

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             N  +SGKM+VV  +L+LW+D GH+ L F+Q + MLDILE F+ +  G+ YRRMDG TP+K
Sbjct  748   NSAKSGKMQVVKALLELWRDTGHKTLLFAQHRIMLDILEKFIKSLTGFNYRRMDGNTPIK  807

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R  ++DEFNN  +I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  808   VRQGMVDEFNNDPDIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDLQARERAWRLG  867

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK+DVT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F+  DL DLF L   G+
Sbjct  868   QKRDVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFQMSDLHDLFTL---GD  924

Query  2879  NGSTESSSIF----------SQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNS  3028
             NG TE+S +F          S+  +D   +  +   +EKDK  K      G A      S
Sbjct  925   NGPTETSKMFQEADVTFQENSKHEKDTKESKVEEERKEKDKISKVT----GVAALEQYQS  980

Query  3029  GSNGEEKADNN---NGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDE----EKLKLEE  3187
              +    + D         + D  ++ T+F   G+HSA++H+ I N        +   +E 
Sbjct  981   ATGTPTETDGETKRTAASNSDARLMETIFTRSGVHSALEHEQIFNGRKRSVKADPKIIEA  1040

Query  3188  QASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSK  3367
             +A RVA  AA+ L +++ +     V  PTWTG+ GTAG P          ++P     + 
Sbjct  1041  EAKRVAAEAAKELLKAQEVARTVPVGTPTWTGQFGTAGRP----------VDPTAPRGTM  1090

Query  3368  PLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNS  3547
             P+      S  R                     + G    +I   L   ++     SS+ 
Sbjct  1091  PVYAGGGGSVARR-------------------TMHGPSSASIIANL--TNRTTGQHSSSG  1129

Query  3548  RTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS-KDLAL  3724
             R     +G S P     G    V+IR    +I  +GG+  +  +V+HF     S +  A 
Sbjct  1130  RNSPGRSGTSTPR----GKDFMVMIRD---YITAQGGAVYTQMLVDHFNRFCDSPRATAE  1182

Query  3725  FKNLLKEIATLKKN--PNGSFWILKPEY  3802
             FK +L+ IA L+K        W+LKPEY
Sbjct  1183  FKEILRTIAVLEKTGRQGRGKWVLKPEY  1210



>emb|CDH16567.1| probable DNA repair and recombination protein RAD26 [Zygosaccharomyces 
bailii ISA1307]
Length=1038

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/1018 (39%), Positives = 569/1018 (56%), Gaps = 138/1018 (14%)
 Frame = +2

Query  827   ETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQDNGDLVSTSLANAIQ----SIS  994
             E+++D LVR G LT F   +GFE +  E  Q S + +Q   D V  S  N I+    SI 
Sbjct  129   ESDRDFLVRTGQLTAFGTKRGFEIE-GESDQESSNEIQGETDAVDQSSKNDIEYKEESIV  187

Query  995   EAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRKRRPTPG-KKWR  1171
              +++  P   +  S++  K +   Y +Q      ++   ++N R + RK  P P   +W 
Sbjct  188   YSSEDEPDVIVKPSAV--KDDGDEYYYQK-----RLRMWSKN-RAEDRKADPNPDWPEWW  239

Query  1172  VKVSRENKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGV  1351
              K         PD                    P   L+   KIP  I+  LFDYQK  V
Sbjct  240   KK--------HPDF-------------------PDAKLDDQFKIPGEIYSLLFDYQKTCV  272

Query  1352  QWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYK-PSIIVCPLTLLQQWKREA  1528
             QWL+EL+ QK GGIIGDEMGLGKT+Q++AFL +LH SN    P+I+VCP T+++QW  E 
Sbjct  273   QWLYELYQQKCGGIIGDEMGLGKTIQIIAFLAALHHSNLLNGPTIVVCPATVMKQWCNEF  332

Query  1529  KKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLIN  1708
               W+P F   ILH             K   S++E EE++        S+ + +  DK  +
Sbjct  333   HHWWPPFRTVILHS-----IGAGMSGKKKMSEAELEEVIMSSEPSQFSYEDFQNSDKTKS  387

Query  1709  HVLGSD------------SGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVT  1852
             H+  S+              ++ITTY  LR+  + LL + W YA+LDEGH+IRNP++D++
Sbjct  388   HIESSNLLQSLIDRVVTKGHIIITTYVGLRVHADMLLKVNWAYAILDEGHKIRNPDSDIS  447

Query  1853  LVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANA  2032
             L CK L+T +RII++G+PIQN L+ELWSLFDF+FPGKLG LP+F+ +F  PI++GGYANA
Sbjct  448   LTCKALKTPNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPIFQQQFVQPINMGGYANA  507

Query  2033  TPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLA  2212
             + +QV T Y+CAV LRDLI PYLLRR+KADV   LP+K E V+FC LT VQR  Y  FL 
Sbjct  508   SNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPEKKEMVLFCKLTQVQRQKYLEFLH  567

Query  2213  STDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKL  2392
             S ++++I  G +  L+GID++RKICNHPDLLER     +  YG+P+RSGKM+VV ++L L
Sbjct  568   SRELDEIKGGKRKVLFGIDILRKICNHPDLLERNERRNEASYGDPKRSGKMQVVKQLLLL  627

Query  2393  WKDQGHRVLFFSQTQQMLDILENFLV-----TGGYKYRRMDGATPVKQRMALIDEFNNTV  2557
             WK +GH+ L F+Q++QMLDILE F+          K+ RMDG T +  R +L+DEFN   
Sbjct  628   WKKEGHKALLFTQSRQMLDILEEFIAFKDEELSALKFLRMDGTTSISVRQSLVDEFNKG-  686

Query  2558  EIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITR  2737
                +F+LTTRVGGLG NLTGANR+IIFDPDWNPS DMQARERAWRIGQ ++VT+YRL+  
Sbjct  687   NYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWRIGQTREVTIYRLMVT  746

Query  2738  GTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQL  2917
             G+IEEK+YHRQI+K  LTNKIL +P+Q+R FK  +L DLF L  +  + + E  S   + 
Sbjct  747   GSIEEKIYHRQIFKQFLTNKILSDPKQKRFFKMNELHDLFTLGGENGHATEELESEVQKR  806

Query  2918  SEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILR  3097
             +E +  +  +  D + ++ I  N    G +      +G   + K         ED  ++ 
Sbjct  807   TEGLKSSKTEESD-DFEQVISLN----GVSKLESFYTGKEDQTKYKK------EDDRLIE  855

Query  3098  TLFDAHGIHSAMDHDAIVNAHDEEKLK-LEEQASRVAQRAAEALRQSRMLRSQESVAIPT  3274
              L    G+ SA  HD+++ +H +     +  +AS++A+ A +ALR+SR  R +  +  PT
Sbjct  856   GLLGESGLASAASHDSMIESHSKGPSDIIAREASKLAEAAVKALRKSRRERKKFHIETPT  915

Query  3275  WTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssae  3454
             WTGR G AG    I+KK  +       T+ KP+  S+++ + R                 
Sbjct  916   WTGRFGQAG---KIRKKAAA-------TNRKPIGSSAILENIRKSQ--------------  951

Query  3455  llakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVC  3634
                                              + AE   ++ S      + +  ++Q+ 
Sbjct  952   ---------------------------------KQAEIMPTQESTAEEVNESQGALQQIE  978

Query  3635  TF-IQRKGGSTSSASIVEHFRSRVPSK-DLALFKNLLKEIATLKKNPNGSFWILKPEY  3802
              F +Q+ G   SS  IV      + +K D+   + LLK IAT  K   G  WIL  E+
Sbjct  979   HFLLQKPGFFASSNEIVNSINVNLSTKEDIIKIRALLKSIATFDKAKKG--WILNQEF  1034



>gb|EFW16014.1| DNA repair and recombination protein RAD26 [Coccidioides posadasii 
str. Silveira]
Length=1198

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/868 (43%), Positives = 523/868 (60%), Gaps = 73/868 (8%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L+GG +IP  I+  LFDYQK GVQWLWEL+ Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  377   PDSVLDGGYRIPGDIYPYLFDYQKTGVQWLWELYQQRVGGIIGDEMGLGKTIQVIAFLAG  436

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S     P I+VCP T+++QW  E  +W+P   V ILH S +   + KK S++ ++ +
Sbjct  437   LHYSKKLDAPIIVVCPPTVMKQWVNEFHRWWPPLRVSILHTSGSGMINIKKESRAEDTLT  496

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +   +  K+   ++  VL  D  +L+TTY  L+     L+ ++WG A+
Sbjct  497   SEIWDPYRPTRMSGGQKAAKR---ILKRVL-EDGHVLVTTYAGLQTYTSLLIPVDWGCAI  552

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  553   LDEGHKIRNPDTAITIHCKELRTPHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  612

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKKTE V+FC
Sbjct  613   NQFEFPIRAGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKTEQVLFC  672

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCR--DPDYG  2341
              LT +QR+ Y+AFL+S ++  I  G ++ L+G+D++RKICNHPDL E +   +  + +YG
Sbjct  673   KLTKLQRAAYEAFLSSNEMSAIMRGRRDVLFGVDILRKICNHPDLPEHKTLSQKANYNYG  732

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             N  +SGKM+VV  +L+LW+D GH+ L F+Q + MLDILE F+ +  G+ YRRMDG TP+K
Sbjct  733   NSAKSGKMQVVKALLELWRDTGHKTLLFAQHRIMLDILEKFIKSLTGFNYRRMDGNTPIK  792

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R  ++DEFNN  +I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  793   VRQGMVDEFNNDPDIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDLQARERAWRLG  852

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F+  DL DLF L   G+
Sbjct  853   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFQMSDLHDLFTL---GD  909

Query  2879  NGSTESSSIF----------SQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNS  3028
             NG TE+S +F          S+  +D   +  +   +EKDK  K      G A      S
Sbjct  910   NGPTETSKMFQEADVTFQENSKHEKDTKESKVEEERKEKDKISKVT----GVAALEQYQS  965

Query  3029  GSNGEEKADNN---NGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDE----EKLKLEE  3187
              +    + D         + D  ++ T+F   G+HSA++H+ I N        +   +E 
Sbjct  966   ATGTPTETDGETKRTAASNSDARLMETIFTRSGVHSALEHEQIFNGRKRSVKADPKIIEA  1025

Query  3188  QASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSK  3367
             +A RVA  AA+ L +++ +     V  PTWTG+ GTAG P          ++P     + 
Sbjct  1026  EAKRVAAEAAKELLKAQEVARTVPVGTPTWTGQFGTAGRP----------VDPTAPRGTM  1075

Query  3368  PLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNS  3547
             P+      S  R                     + G    +I   L   ++     SS+ 
Sbjct  1076  PVYAGGGGSVARR-------------------TMHGPSSASIIANL--TNRTTGQHSSSG  1114

Query  3548  RTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS-KDLAL  3724
             R     +G S P     G    V+IR    +I  +GG+  +  +V+HF     S +  A 
Sbjct  1115  RNSPGRSGTSTPR----GKDFMVMIRD---YITAQGGAVYTQMLVDHFNRFCDSPRATAE  1167

Query  3725  FKNLLKEIATLKKN--PNGSFWILKPEY  3802
             FK +L+ IA L+K        W+LKPEY
Sbjct  1168  FKEILRTIAVLEKTGRQGRGKWVLKPEY  1195



>ref|XP_007729735.1| DNA excision repair protein ERCC-6 [Capronia epimyces CBS 606.96]
 gb|EXJ92845.1| DNA excision repair protein ERCC-6 [Capronia epimyces CBS 606.96]
Length=1202

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/882 (42%), Positives = 529/882 (60%), Gaps = 87/882 (10%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +   G KIP  I+  LFDYQK GVQWL+EL+ Q+ GGIIGDEMGLGKT+Q++AFL  
Sbjct  372   PDTVFNDGYKIPGDIYPSLFDYQKTGVQWLYELYTQQVGGIIGDEMGLGKTIQMIAFLAG  431

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP I+VCP T+++QW  E  +W+P F V ILH S +   + +  S   +   
Sbjct  432   LHYSRKLTKPIIVVCPATVMKQWVNEFHRWWPPFRVTILHSSGSGMVNLRNESSKEDELL  491

Query  1628  eseelldvdvekNLSFRN------TKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDI  1789
             + E         + + RN       K    ++  V     G+L+TTY  L+     L+ +
Sbjct  492   DLEW--------DPTLRNRPLTPAQKAARNMLKPVFEDGGGVLVTTYSGLQTYAPLLIPV  543

Query  1790  EWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLG  1969
             +W YA+LDEGH+IRNPNT +T+ CK+L+T +RII++G+P+QN L ELWSLFDFVFP +LG
Sbjct  544   DWEYAILDEGHKIRNPNTAITIYCKELRTPNRIILSGTPMQNNLIELWSLFDFVFPMRLG  603

Query  1970  VLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKT  2149
              L  F  +F +PI  GGYANA+ LQV TA++CA  L+D I PYLL+R K DV + LPKK+
Sbjct  604   TLVSFRNQFEIPIRQGGYANASNLQVQTAFKCAETLKDAISPYLLQRFKIDVASDLPKKS  663

Query  2150  EHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRD  2329
             E V+FC LT +QR+ YQ FL S ++  I +G +  LYG+D++RKICNHPDL   +H    
Sbjct  664   EQVLFCKLTPLQRAEYQRFLDSNEMGAIINGKRQVLYGVDILRKICNHPDLTGHKHLSVK  723

Query  2330  P--DYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMD  2500
             P  +YG+P +SGKM+VV  +L+LWK+ GH+ L F+Q + MLDILE ++ +  G KYRRMD
Sbjct  724   PGYNYGDPSKSGKMQVVGALLELWKETGHKTLLFAQHRIMLDILEKYVRSFSGLKYRRMD  783

Query  2501  GATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARE  2680
             G TP++ R +++DEFN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARE
Sbjct  784   GNTPIQLRQSMVDEFNTDPDLHVFLLTTKVGGLGINLTGADRVIIYDPDWNPSTDLQARE  843

Query  2681  RAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFV  2860
             RAWR+GQK++VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F   DL DLF 
Sbjct  844   RAWRLGQKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFHLNDLHDLFT  903

Query  2861  LNDDGENGSTESSSIFSQLSEDVNITGPQHP-------DQEKDKSIKTNPADHG------  3001
             L  +GE   TE+S++F    +D  +  P  P       D++ D +I     D        
Sbjct  904   LAKEGE--PTETSNLF----QDAEVKYPSGPAKAHEAGDKDADNNIAPKSGDTNIETLPG  957

Query  3002  -TAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEK--  3172
              ++MER   +G   EE   N  G  + +  ++  +F   GIHSA++HDAI++ +   K  
Sbjct  958   ISSMER--YAGEIVEEANANKEGSTNSEDRVMEGIFARSGIHSAVEHDAIIDGNKTGKKV  1015

Query  3173  ----LKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP--PSIKKKFGS  3334
                 + +E++A +VA  AA  LR++        +  PTWTG+ G +G P   + ++ F S
Sbjct  1016  AADPVLIEQEARKVAAEAARELRRAGDAARHVPIGTPTWTGQFGVSGRPQETTAQRAFSS  1075

Query  3335  TLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQ  3514
                    +    ++ +S++++ +                         Q  AI   +   
Sbjct  1076  AAR----SRGGAIQSTSLLANLQQ-----------------------RQANAIGSRVATP  1108

Query  3515  HQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEV--LIRQVCTFIQRKGGSTSSASIVEH  3688
                   +SS +R+  +    SR    +A    +   LIR    F+   GG+T +  +++H
Sbjct  1109  R-----TSSPARSSVSTASTSRAGTPTAPQSKDFGKLIRD---FLNAHGGATYTQMLIDH  1160

Query  3689  FRSRVPSKDLAL-FKNLLKEIATLKKNPNG-SFWILKPEYQE  3808
             F     +    + FK  LK IA L+K   G   W+LK EY++
Sbjct  1161  FNRYCTTPQATMDFKETLKMIARLEKGSRGRGRWVLKEEYKK  1202



>gb|KEY81873.1| DNA repair protein Rhp26/Rad26 [Aspergillus fumigatus var. RP-2014]
Length=1214

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/870 (43%), Positives = 515/870 (59%), Gaps = 87/870 (10%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P V  + G ++P  +   LFDYQK GVQWLWEL+ QK GGIIGDEMGLGKT+Q +AFL  
Sbjct  402   PDVSYDNGYRLPGDLNPYLFDYQKTGVQWLWELYQQKVGGIIGDEMGLGKTIQAIAFLAG  461

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    +P I+VCP T+++QW  E  +W+P F V ILH S +   + ++ S   ++  
Sbjct  462   LHYSKKLDRPVIVVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIRRESSREDALL  521

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                   +     +    N K   K++  V+  +  +L+TTY  L+     L+ +EWG A+
Sbjct  522   SQTYSSNSRGITS----NQKAARKVVKRVV-EEGHVLVTTYSGLQTYSHFLIPVEWGCAI  576

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+ CK+L+T HRII++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  577   LDEGHKIRNPNTSITIHCKELRTPHRIILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  636

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKKTE V+FC
Sbjct  637   NQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKTEQVLFC  696

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT  QR  Y++FL S ++E I  G +  LYG+D++RKICNHPDL   +       YGN 
Sbjct  697   KLTKPQRMAYESFLKSEEMESILKGRRQILYGVDILRKICNHPDLQNHKMQSHQSGYGNA  756

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
              +SGKM+VV  +L+LW+D GH+ L F+Q + MLDILE F+ +  G+ YRRMDG TP++ R
Sbjct  757   NKSGKMQVVKSLLELWRDTGHKTLLFAQHRIMLDILEKFVRSLSGFNYRRMDGTTPIQNR  816

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               ++DEFNN   I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  817   QTMVDEFNNDPNIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLGQK  876

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRL-FKARDLKDLFVLNDDGEN  2881
             +DV+VYRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+  F+  DL DLF L D+ + 
Sbjct  877   RDVSVYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTSFQLSDLYDLFALGDE-KP  935

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGS---------  3034
             G+TE+S +F    +D  IT   H D + + +  T   D  + M+ + N  S         
Sbjct  936   GATETSKLF----QDAQITF--HGDGDGNTAQPTKAEDVSSDMQAEKNDISKVVGVSSVE  989

Query  3035  ----NGEEKADNNN--GDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK---LEE  3187
                   E+ +D     G V+ ++ I+  +F   G+HSA++HD IVN     +     +E 
Sbjct  990   RYQGESEQPSDQEKGPGGVNSESRIMEGIFARSGVHSALEHDQIVNGKRVVRADPKIIEA  1049

Query  3188  QASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPS--IKKKFGSTLNPQLVTS  3361
             +A RVA  AAE LR++        +  PTWTG+ G AG P    +   FG   +    T+
Sbjct  1050  EAKRVAAEAAEELRRAGEAARSVPIGTPTWTGQFGVAGRPEERPLPSAFGGRSSTARRTA  1109

Query  3362  SKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSS  3541
             + P   S + +                                              S+ 
Sbjct  1110  AGPSSASILANL---------------------------------------------SAR  1124

Query  3542  NSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF-RSRVPSKDL  3718
                +R+A N  + PS    G+    +IR    +I  +GG+  +  +++HF R     +  
Sbjct  1125  TPSSRSATNSPA-PSRTPTGVDFMTMIRD---YILSQGGAVYTQMLIDHFNRYCTTPQRS  1180

Query  3719  ALFKNLLKEIATLKKNP-NG-SFWILKPEY  3802
             A FK +LK IA L+K   NG   W LKPE+
Sbjct  1181  AEFKEMLKTIAVLEKGGRNGRGRWSLKPEF  1210



>ref|XP_746571.1| DNA repair protein Rhp26/Rad26 [Aspergillus fumigatus Af293]
 gb|EAL84533.1| DNA repair protein Rhp26/Rad26, putative [Aspergillus fumigatus 
Af293]
 gb|EDP47317.1| DNA repair protein Rhp26/Rad26, putative [Aspergillus fumigatus 
A1163]
Length=1214

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/870 (43%), Positives = 514/870 (59%), Gaps = 87/870 (10%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P V  + G ++P  +   LFDYQK GVQWLWEL+ QK GGIIGDEMGLGKT+Q +AFL  
Sbjct  402   PDVSYDNGYRLPGDLNPYLFDYQKTGVQWLWELYQQKVGGIIGDEMGLGKTIQAIAFLAG  461

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    +P I+VCP T+++QW  E  +W+P F V ILH S +   + +  S   ++  
Sbjct  462   LHYSKKLDRPVIVVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIRSESSREDALL  521

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                   +     +    N K   K++  V+  +  +L+TTY  L+     L+ +EWG A+
Sbjct  522   SQTYSSNSRGITS----NQKAARKVVKRVV-EEGHVLVTTYSGLQTYSHFLIPVEWGCAI  576

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+ CK+L+T HRII++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  577   LDEGHKIRNPNTSITIHCKELRTPHRIILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  636

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKKTE V+FC
Sbjct  637   NQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKTEQVLFC  696

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT  QR  Y++FL S ++E I  G +  LYG+D++RKICNHPDL   +       YGN 
Sbjct  697   KLTKPQRMAYESFLKSEEMESILKGRRQILYGVDILRKICNHPDLQNHKMQSHQSGYGNA  756

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
              +SGKM+VV  +L+LW+D GH+ L F+Q + MLDILE F+ +  G+ YRRMDG TP++ R
Sbjct  757   NKSGKMQVVKSLLELWRDTGHKTLLFAQHRIMLDILEKFVRSLSGFNYRRMDGTTPIQNR  816

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               ++DEFNN   I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  817   QTMVDEFNNDPNIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLGQK  876

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRL-FKARDLKDLFVLNDDGEN  2881
             +DV+VYRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+  F+  DL DLF L D+ + 
Sbjct  877   RDVSVYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTSFQLSDLYDLFALGDE-KP  935

Query  2882  GSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGS---------  3034
             G+TE+S +F    +D  +T   H D + + +  T   D  + M+ + N  S         
Sbjct  936   GATETSKLF----QDAQVTF--HGDGDGNTAQPTKAEDVSSDMQAEKNDISKVVGVSSVE  989

Query  3035  ----NGEEKADNNN--GDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK---LEE  3187
                   E+ +D     G V+ ++ I+  +F   G+HSA++HD IVN     +     +E 
Sbjct  990   RYQGESEQPSDQEKGPGGVNSESRIMEGIFARSGVHSALEHDQIVNGKRVVRADPKIIEA  1049

Query  3188  QASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPS--IKKKFGSTLNPQLVTS  3361
             +A RVA  AAE LR++        +  PTWTG+ G AG P    +   FG   +    T+
Sbjct  1050  EAKRVAAEAAEELRRAGEAARSVPIGTPTWTGQFGVAGRPEERPLPSAFGGRSSTARRTA  1109

Query  3362  SKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSS  3541
             + P   S + +                                              S+ 
Sbjct  1110  AGPSSASILANL---------------------------------------------SAR  1124

Query  3542  NSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF-RSRVPSKDL  3718
                +R+A N  + PS    G+    +IR    +I  +GG+  +  +++HF R     +  
Sbjct  1125  TPSSRSATNSPA-PSRSPTGVDFMTMIRD---YILSQGGAVYTQMLIDHFNRYCTTPQRS  1180

Query  3719  ALFKNLLKEIATLKKNP-NG-SFWILKPEY  3802
             A FK +LK IA L+K   NG   W LKPE+
Sbjct  1181  AEFKEMLKTIAVLEKGGRNGRGRWSLKPEF  1210



>dbj|GAM43350.1| protein involved in transcription-coupled repair [Talaromyces 
cellulolyticus]
Length=1155

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/860 (43%), Positives = 515/860 (60%), Gaps = 73/860 (8%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P    +GG ++P  IF  LFDYQK GVQWLWEL+ Q+ GGIIGDEMGLGKT+QV++FL  
Sbjct  350   PDAEYDGGYRVPGDIFPVLFDYQKTGVQWLWELYQQQVGGIIGDEMGLGKTIQVISFLAG  409

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S    KP I+V P T+++QW  E  +W+P F V ILH S +   + +  S    + +
Sbjct  410   LHHSGKLTKPVIVVAPATVMKQWVTEFHRWWPPFRVSILHTSGSGMINVRSESNRENALN  469

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
             +     +       + +  K   K++  V+     +L+TTY  L+     L+ ++W  A+
Sbjct  470   DEMWDPNRPYTMTKAQKTAK---KIVQRVV-EQGHVLVTTYSGLQTYAPVLIPVDWDCAI  525

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+ CK+L+T HR+I++G+P+QN LSELWSLFDFVFP +LG L  F 
Sbjct  526   LDEGHKIRNPNTSITIHCKELRTPHRLILSGTPMQNNLSELWSLFDFVFPMRLGTLVDFR  585

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA RCA  L+D I PYLL+R K DV + LPKK+E V+FC
Sbjct  586   NQFEFPIRQGGYANASNLQVQTAARCAETLKDAISPYLLQRFKVDVASDLPKKSEQVLFC  645

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              L+ +QR  Y+ FL S +   I  G +  LYG+D++RKICNHPDL+  +       YG+P
Sbjct  646   KLSPLQRKAYEQFLNSQECNSILAGRRQVLYGVDMLRKICNHPDLVTHKLFSATTGYGDP  705

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
              +SGKM+VV  +L+LWKD GH+ L F+Q + ML+ILE F+ T  G+ YRRMDG TP+ +R
Sbjct  706   SKSGKMQVVKALLELWKDTGHKTLLFAQHRIMLNILEKFVNTLSGFNYRRMDGETPIHRR  765

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               L+DEFNN+ +I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS DMQARERAWR+GQK
Sbjct  766   QLLVDEFNNSPDIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDMQARERAWRLGQK  825

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             ++VT+YRL+T GTIEEK+YHRQI+K  LTNK+LK+P+QR+ F+  +L DLF L   GE G
Sbjct  826   REVTIYRLMTAGTIEEKIYHRQIFKQFLTNKVLKDPKQRQTFEMSNLHDLFSL---GEEG  882

Query  2885  STESSSIF------SQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEE  3046
              TE+SS+F       +  E  +   P+ P Q  +K I+    +   A+E  ++     E 
Sbjct  883   QTETSSMFKTEVTYQEKDESKDKIKPEQPPQNDEKEIQK--VEGIAAVEHFHDDADEAEA  940

Query  3047  KADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHD---EEKLKLEEQASRVAQRAA  3217
             K + +NG    +  ++ T+F   G+HSA++HD IVN       +K  +E +A R+A  AA
Sbjct  941   KGE-DNGAPKSEARLMETIFAQSGVHSALEHDRIVNGKKIIAPDKSIIEAEAKRLAAEAA  999

Query  3218  EALRQSRMLRSQESVAIPTWTGRSGTAGAPPS-IKKKFGSTLNPQLVTSSKPLEESSMIS  3394
             E LR++     Q  V  PTWTG+ G AG P    +  FG   +      + P   S +  
Sbjct  1000  EKLRKAEQAARQVPVGTPTWTGQFGIAGRPEERPRSAFGGAASIARGAGAGPSSASILA-  1058

Query  3395  SRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGA  3574
                                                     +  N   ++ SRT +  +  
Sbjct  1059  ----------------------------------------NLANRTGAARSRTNSPRDS-  1077

Query  3575  SRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF-RSRVPSKDLALFKNLLKEIA  3751
               P  G  G++P+  +  +  ++  +GGS  +  +++HF R     +  A FK  LK +A
Sbjct  1078  --PVPG-GGVRPD-FMSMIRDYMIAQGGSAYTQMLIDHFNRFCTTPQRSAEFKETLKTVA  1133

Query  3752  TLKK---NPNGSFWILKPEY  3802
             +L+K   N  G  W+LK E+
Sbjct  1134  SLEKGGRNGRGK-WLLKKEF  1152



>gb|EWG87973.1| Rad26p [Saccharomyces cerevisiae P301]
Length=1085

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/706 (50%), Positives = 468/706 (66%), Gaps = 51/706 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  I+  LF+YQK  VQWL+EL+ Q  GGIIGDEMGLGKT+QV+AF+ +
Sbjct  279   PDAKLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAA  338

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E   W+P     ILH   +     +K         
Sbjct  339   LHHSGLLTGPVLIVCPATVMKQWCNEFHHWWPPLRTVILHSMGSGMASDQKFKMDENDLE  398

Query  1628  eseelldvdvekNLSFRN---TKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEK  1777
                            ++N   TKK        DKLI+ V+ +D  +LITTY  LR+  +K
Sbjct  399   NLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVV-TDGHILITTYVGLRIHSDK  457

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP+++++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  458   LLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFP  517

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI+IGGYANAT +QV T Y+CAV LRDLI PYLLRR+KADV   L
Sbjct  518   GKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDL  577

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P+K E V+FC LT  QRS Y  FL S+D+ QI +G +N L+GID++RKICNHPDLL+R+ 
Sbjct  578   PQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDT  637

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGY  2482
               ++PDYG+P+RSGKM+VV ++L LW  QG++ L F+Q++QMLDILE F+ T        
Sbjct  638   KRQNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL  697

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIF-IFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
              Y RMDG T +K R +L+D FNN  E F +F+LTTRVGGLG NLTGANR+IIFDPDWNPS
Sbjct  698   NYLRMDGTTNIKGRQSLVDRFNN--ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS  755

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTN+IL +P+Q+R FK  
Sbjct  756   TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIH  815

Query  2840  DLKDLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER  3016
             +L DLF L   GENG STE      +L+E+V         Q+  +++K + ++     E+
Sbjct  816   ELHDLFSLG--GENGYSTE------ELNEEV---------QKHTENLKNSKSEESDDFEQ  858

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH--DE  3166
               N        S  NG+EK +N+    ++D  I   L     + + M HD++VN+H    
Sbjct  859   LVNLSGVSKLESFYNGKEKKENSK--TEDDRLIEGLLGGESNLETVMSHDSVVNSHAGSS  916

Query  3167  EKLKLEEQASRVAQRAAEALRQSR-MLRSQESVAIPTWTGRSGTAG  3301
                 + ++ASRVA  A  ALR+SR  +  Q  +  PTWTGR G AG
Sbjct  917   SSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGKAG  962



>gb|EDZ71203.1| YJR035Wp-like protein [Saccharomyces cerevisiae AWRI1631]
Length=1046

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/706 (50%), Positives = 467/706 (66%), Gaps = 51/706 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  I+  LF+YQK  VQWL+EL+ Q  GGIIGDEMGLGKT+QV+AF+ +
Sbjct  240   PDAKLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAA  299

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E   W+P     ILH   +     +K         
Sbjct  300   LHHSGLLTGPVLIVCPATVMKQWCNEFHHWWPPLRTVILHSMGSGMASDQKFKMDENDLE  359

Query  1628  eseelldvdvekNLSFRN---TKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEK  1777
                            ++N   TKK        DKLI+ V+ +D  +LITTY  LR+  +K
Sbjct  360   NLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVV-TDGHILITTYVGLRIHSDK  418

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP+++++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  419   LLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFP  478

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI+IGGYANAT +QV T Y+CAV LRDLI PYLLRR+KADV   L
Sbjct  479   GKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDL  538

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P+K E V+FC LT  QRS Y  FL S+D+ QI +G +N L+GID++RKICNHPDLL+R+ 
Sbjct  539   PQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDT  598

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGY  2482
                +PDYG+P+RSGKM+VV ++L LW  QG++ L F+Q++QMLDILE F+ T        
Sbjct  599   KRHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL  658

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIF-IFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
              Y RMDG T +K R +L+D FNN  E F +F+LTTRVGGLG NLTGANR+IIFDPDWNPS
Sbjct  659   NYLRMDGTTNIKGRQSLVDRFNN--ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS  716

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTN+IL +P+Q+R FK  
Sbjct  717   TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIH  776

Query  2840  DLKDLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER  3016
             +L DLF L   GENG STE      +L+E+V         Q+  +++K + ++     E+
Sbjct  777   ELHDLFSLG--GENGYSTE------ELNEEV---------QKHTENLKNSKSEESDDFEQ  819

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH--DE  3166
               N        S  NG+EK +N+    ++D  I   L     + + M HD++VN+H    
Sbjct  820   LVNLSGVSKLESFYNGKEKKENSK--TEDDRLIEGLLGGESNLETVMSHDSVVNSHAGSS  877

Query  3167  EKLKLEEQASRVAQRAAEALRQSR-MLRSQESVAIPTWTGRSGTAG  3301
                 + ++ASRVA  A  ALR+SR  +  Q  +  PTWTGR G AG
Sbjct  878   SSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGKAG  923



>ref|NP_012569.1| DNA-dependent ATPase RAD26 [Saccharomyces cerevisiae S288c]
 sp|P40352.1|RAD26_YEAST RecName: Full=DNA repair and recombination protein RAD26; AltName: 
Full=ATP-dependent helicase RAD26 [Saccharomyces cerevisiae 
S288c]
 gb|AAA34655.1| gtA1085 [Saccharomyces cerevisiae]
 emb|CAA89562.1| RAD26 [Saccharomyces cerevisiae]
 tpg|DAA08824.1| TPA: DNA-dependent ATPase RAD26 [Saccharomyces cerevisiae S288c]
Length=1085

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/706 (50%), Positives = 468/706 (66%), Gaps = 51/706 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  I+  LF+YQK  VQWL+EL+ Q  GGIIGDEMGLGKT+QV+AF+ +
Sbjct  279   PDAKLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAA  338

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E + W+P     ILH   +     +K         
Sbjct  339   LHHSGLLTGPVLIVCPATVMKQWCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLE  398

Query  1628  eseelldvdvekNLSFRN---TKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEK  1777
                            ++N   TKK        DKLI+ V+ +D  +LITTY  LR+  +K
Sbjct  399   NLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVV-TDGHILITTYVGLRIHSDK  457

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP+++++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  458   LLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFP  517

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI+IGGYANAT +QV T Y+CAV LRDLI PYLLRR+KADV   L
Sbjct  518   GKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDL  577

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P+K E V+FC LT  QRS Y  FL S+D+ QI +G +N L+GID++RKICNHPDLL+R+ 
Sbjct  578   PQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDT  637

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGY  2482
                +PDYG+P+RSGKM+VV ++L LW  QG++ L F+Q++QMLDILE F+ T        
Sbjct  638   KRHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL  697

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIF-IFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
              Y RMDG T +K R +L+D FNN  E F +F+LTTRVGGLG NLTGANR+IIFDPDWNPS
Sbjct  698   NYLRMDGTTNIKGRQSLVDRFNN--ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS  755

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTN+IL +P+Q+R FK  
Sbjct  756   TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIH  815

Query  2840  DLKDLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER  3016
             +L DLF L   GENG STE      +L+E+V         Q+  +++K + ++     E+
Sbjct  816   ELHDLFSLG--GENGYSTE------ELNEEV---------QKHTENLKNSKSEESDDFEQ  858

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH--DE  3166
               N        S  NG+EK +N+    ++D  I   L     + + M HD++VN+H    
Sbjct  859   LVNLSGVSKLESFYNGKEKKENSK--TEDDRLIEGLLGGESNLETVMSHDSVVNSHAGSS  916

Query  3167  EKLKLEEQASRVAQRAAEALRQSR-MLRSQESVAIPTWTGRSGTAG  3301
                 + ++ASRVA  A  ALR+SR  +  Q  +  PTWTGR G AG
Sbjct  917   SSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGKAG  962



>gb|EIW09557.1| Rad26p [Saccharomyces cerevisiae CEN.PK113-7D]
Length=1085

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/706 (50%), Positives = 468/706 (66%), Gaps = 51/706 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  I+  LF+YQK  VQWL+EL+ Q  GGIIGDEMGLGKT+QV+AF+ +
Sbjct  279   PDAKLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAA  338

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E + W+P     ILH   +     +K         
Sbjct  339   LHHSGLLTGPVLIVCPATVMKQWCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLE  398

Query  1628  eseelldvdvekNLSFRN---TKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEK  1777
                            ++N   TKK        DKLI+ V+ +D  +LITTY  LR+  +K
Sbjct  399   NLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVV-TDGHILITTYVGLRIHSDK  457

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP+++++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  458   LLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFP  517

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI+IGGYANAT +QV T Y+CAV LRDLI PYLLRR+KADV   L
Sbjct  518   GKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDL  577

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P+K E V+FC LT  QRS Y  FL S+D+ QI +G +N L+GID++RKICNHPDLL+R+ 
Sbjct  578   PQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDT  637

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGY  2482
                +PDYG+P+RSGKM+VV ++L LW  QG++ L F+Q++QMLDILE F+ T        
Sbjct  638   KRHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL  697

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIF-IFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
              Y RMDG T +K R +L+D FNN  E F +F+LTTRVGGLG NLTGANR+IIFDPDWNPS
Sbjct  698   NYLRMDGTTNIKGRQSLVDRFNN--ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS  755

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTN+IL +P+Q+R FK  
Sbjct  756   TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIH  815

Query  2840  DLKDLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER  3016
             +L DLF L   GENG STE      +L+E+V         Q+  +++K + ++     E+
Sbjct  816   ELHDLFSLG--GENGYSTE------ELNEEV---------QKHTENLKNSKSEESDDFEQ  858

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH--DE  3166
               N        S  NG+EK +N+    ++D  I   L     + + M HD++VN+H    
Sbjct  859   LVNLSGVSKLESFYNGKEKKENSK--TEDDRLIEGLLGGESNLETVMSHDSVVNSHAGSS  916

Query  3167  EKLKLEEQASRVAQRAAEALRQSR-MLRSQESVAIPTWTGRSGTAG  3301
                 + ++ASRVA  A  ALR+SR  +  Q  +  PTWTGR G AG
Sbjct  917   SSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGKAG  962



>gb|EEU05949.1| Rad26p [Saccharomyces cerevisiae JAY291]
 gb|EWG85135.1| Rad26p [Saccharomyces cerevisiae R008]
 gb|AHY79023.1| Rad26p [Saccharomyces cerevisiae YJM993]
Length=1085

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/706 (50%), Positives = 467/706 (66%), Gaps = 51/706 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  I+  LF+YQK  VQWL+EL+ Q  GGIIGDEMGLGKT+QV+AF+ +
Sbjct  279   PDAKLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAA  338

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E   W+P     ILH   +     +K         
Sbjct  339   LHHSGLLTGPVLIVCPATVMKQWCNEFHHWWPPLRTVILHSMGSGMASDQKFKMDENDLE  398

Query  1628  eseelldvdvekNLSFRN---TKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEK  1777
                            ++N   TKK        DKLI+ V+ +D  +LITTY  LR+  +K
Sbjct  399   NLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVV-TDGHILITTYVGLRIHSDK  457

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP+++++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  458   LLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFP  517

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI+IGGYANAT +QV T Y+CAV LRDLI PYLLRR+KADV   L
Sbjct  518   GKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDL  577

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P+K E V+FC LT  QRS Y  FL S+D+ QI +G +N L+GID++RKICNHPDLL+R+ 
Sbjct  578   PQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDT  637

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGY  2482
                +PDYG+P+RSGKM+VV ++L LW  QG++ L F+Q++QMLDILE F+ T        
Sbjct  638   KRHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL  697

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIF-IFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
              Y RMDG T +K R +L+D FNN  E F +F+LTTRVGGLG NLTGANR+IIFDPDWNPS
Sbjct  698   NYLRMDGTTNIKGRQSLVDRFNN--ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS  755

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTN+IL +P+Q+R FK  
Sbjct  756   TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIH  815

Query  2840  DLKDLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER  3016
             +L DLF L   GENG STE      +L+E+V         Q+  +++K + ++     E+
Sbjct  816   ELHDLFSLG--GENGYSTE------ELNEEV---------QKHTENLKNSKSEESDDFEQ  858

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH--DE  3166
               N        S  NG+EK +N+    ++D  I   L     + + M HD++VN+H    
Sbjct  859   LVNLSGVSKLESFYNGKEKKENSK--TEDDRLIEGLLGGESNLETVMSHDSVVNSHAGSS  916

Query  3167  EKLKLEEQASRVAQRAAEALRQSR-MLRSQESVAIPTWTGRSGTAG  3301
                 + ++ASRVA  A  ALR+SR  +  Q  +  PTWTGR G AG
Sbjct  917   SSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGKAG  962



>gb|EDN63356.1| DNA dependent ATPase [Saccharomyces cerevisiae YJM789]
Length=1085

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/706 (50%), Positives = 467/706 (66%), Gaps = 51/706 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  I+  LF+YQK  VQWL+EL+ Q  GGIIGDEMGLGKT+QV+AF+ +
Sbjct  279   PDAKLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAA  338

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E   W+P     ILH   +     +K         
Sbjct  339   LHHSGLLTGPVLIVCPATVMKQWCNEFHHWWPPLRTVILHSMGSGMASDQKFKMDENDLE  398

Query  1628  eseelldvdvekNLSFRN---TKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEK  1777
                            ++N   TKK        DKLI+ V+ +D  +LITTY  LR+  +K
Sbjct  399   NLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVV-TDGHILITTYVGLRIHSDK  457

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP+++++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  458   LLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFP  517

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI+IGGYANAT +QV T Y+CAV LRDLI PYLLRR+KADV   L
Sbjct  518   GKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDL  577

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P+K E V+FC LT  QRS Y  FL S+D+ QI +G +N L+GID++RKICNHPDLL+R+ 
Sbjct  578   PQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDT  637

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGY  2482
                +PDYG+P+RSGKM+VV ++L LW  QG++ L F+Q++QMLDILE F+ T        
Sbjct  638   KRHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL  697

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIF-IFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
              Y RMDG T +K R +L+D FNN  E F +F+LTTRVGGLG NLTGANR+IIFDPDWNPS
Sbjct  698   NYLRMDGTTNIKGRQSLVDRFNN--ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS  755

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTN+IL +P+Q+R FK  
Sbjct  756   TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIH  815

Query  2840  DLKDLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER  3016
             +L DLF L   GENG STE      +L+E+V         Q+  +++K + ++     E+
Sbjct  816   ELHDLFSLG--GENGYSTE------ELNEEV---------QKHTENLKNSKSEESDDFEQ  858

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH--DE  3166
               N        S  NG+EK +N+    ++D  I   L     + + M HD++VN+H    
Sbjct  859   LVNLSGVSKLESFYNGKEKKENSK--TEDDRLIEGLLGGESNLETVMSHDSVVNSHAGSS  916

Query  3167  EKLKLEEQASRVAQRAAEALRQSR-MLRSQESVAIPTWTGRSGTAG  3301
                 + ++ASRVA  A  ALR+SR  +  Q  +  PTWTGR G AG
Sbjct  917   SSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGKAG  962



>gb|EDV12779.1| DNA dependent ATPase [Saccharomyces cerevisiae RM11-1a]
Length=1085

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/706 (50%), Positives = 467/706 (66%), Gaps = 51/706 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  I+  LF+YQK  VQWL+EL+ Q  GGIIGDEMGLGKT+QV+AF+ +
Sbjct  279   PDAKLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAA  338

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E   W+P     ILH   +     +K         
Sbjct  339   LHHSGLLTGPVLIVCPATVMKQWCNEFHHWWPPLRTVILHSMGSGMASDQKFKMDENDLE  398

Query  1628  eseelldvdvekNLSFRN---TKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEK  1777
                            ++N   TKK        DKLI+ V+ +D  +LITTY  LR+  +K
Sbjct  399   NLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVV-TDGHILITTYVGLRIHSDK  457

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP+++++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  458   LLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFP  517

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI+IGGYANAT +QV T Y+CAV LRDLI PYLLRR+KADV   L
Sbjct  518   GKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDL  577

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P+K E V+FC LT  QRS Y  FL S+D+ QI +G +N L+GID++RKICNHPDLL+R+ 
Sbjct  578   PQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDT  637

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGY  2482
                +PDYG+P+RSGKM+VV ++L LW  QG++ L F+Q++QMLDILE F+ T        
Sbjct  638   KRHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL  697

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIF-IFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
              Y RMDG T +K R +L+D FNN  E F +F+LTTRVGGLG NLTGANR+IIFDPDWNPS
Sbjct  698   NYLRMDGTTNIKGRQSLVDRFNN--ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS  755

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTN+IL +P+Q+R FK  
Sbjct  756   TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIH  815

Query  2840  DLKDLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER  3016
             +L DLF L   GENG STE      +L+E+V         Q+  +++K + ++     E+
Sbjct  816   ELHDLFSLG--GENGYSTE------ELNEEV---------QKHTENLKNSKSEESDDFEQ  858

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH--DE  3166
               N        S  NG+EK +N+    ++D  I   L     + + M HD++VN+H    
Sbjct  859   LVNLSGVSKLESFYNGKEKKENSK--TEDDRLIEGLLGGESNLETVMSHDSVVNSHAGSS  916

Query  3167  EKLKLEEQASRVAQRAAEALRQSR-MLRSQESVAIPTWTGRSGTAG  3301
                 + ++ASRVA  A  ALR+SR  +  Q  +  PTWTGR G AG
Sbjct  917   SSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGKAG  962



>ref|XP_007723422.1| DNA excision repair protein ERCC-6 [Capronia coronata CBS 617.96]
 gb|EXJ91228.1| DNA excision repair protein ERCC-6 [Capronia coronata CBS 617.96]
Length=1202

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/881 (42%), Positives = 527/881 (60%), Gaps = 86/881 (10%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L  G KIP  I+  LFDYQK GVQWL+EL+ Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  373   PDTVLSDGYKIPGDIYPSLFDYQKTGVQWLYELYTQQVGGIIGDEMGLGKTIQVIAFLAG  432

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP I+VCP T+++QW  E  +W+P F V ILH S +   + +  S   ++  
Sbjct  433   LHYSKKLTKPIIVVCPATVMKQWVNEFHRWWPPFRVTILHSSGSGMLNLRNESSKEDNLL  492

Query  1628  eseelldvdvekNLSFRN------TKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDI  1789
             + E         + + RN       K   K++  +   + G+L+TTY  L+     L+ +
Sbjct  493   DLEW--------DPALRNRPLTPAQKAAQKMLKPIF-EEGGVLVTTYSGLQTYAPLLIPV  543

Query  1790  EWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLG  1969
             +W YA+LDEGH+IRNPNT +T+ CK+L+T +R+I++G+P+QN L ELWSLFDFVFP +LG
Sbjct  544   DWEYAILDEGHKIRNPNTAITIYCKELRTPNRVILSGTPMQNNLIELWSLFDFVFPMRLG  603

Query  1970  VLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKT  2149
              L  F  +F +PI  GGYANA+ LQV TA++CA  L+D I PYLL+R K DV + LPKK+
Sbjct  604   TLVNFRNQFDIPIRQGGYANASNLQVQTAFKCAETLKDAISPYLLQRFKIDVASDLPKKS  663

Query  2150  EHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH-SCR  2326
             E V+FC LT +QR  YQ FL S ++  I  G +  LYGID++RKICNHPDL + +H S R
Sbjct  664   EQVLFCKLTPLQRREYQRFLDSNEMGAIITGKRQVLYGIDILRKICNHPDLTDHKHLSVR  723

Query  2327  DP-DYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMD  2500
                +YG+P +SGKM+VV  +L LWK+ GH+ L F+Q + MLDILE ++ +  G+KYRRMD
Sbjct  724   AGYNYGDPAKSGKMQVVGALLDLWKETGHKTLLFAQHRIMLDILEKYVKSLSGFKYRRMD  783

Query  2501  GATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARE  2680
             G TP++ R +++DEFN    + +F+LTT+VGGLG NLTGA+RVIIFDPDWNPS D+QARE
Sbjct  784   GNTPIQNRQSMVDEFNTDPNLHVFLLTTKVGGLGINLTGADRVIIFDPDWNPSTDLQARE  843

Query  2681  RAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFV  2860
             RAWR+GQK++VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F   DL DLF 
Sbjct  844   RAWRLGQKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFHLNDLHDLFS  903

Query  2861  LNDDGENGSTESSSIF--SQLSEDVNITGPQHPDQEK-DKSIKTNPADHG-------TAM  3010
             L ++G    TE+S++F  +Q+       G    D+   DK   +N  D         +++
Sbjct  904   LANEG--APTETSNLFQDAQVKYSSKPAGELETDRTNGDKQAASNSGDTNVVALPGISSV  961

Query  3011  ERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEK------  3172
             ER   +G   EE   N  G  + +  ++  +F   GIHSA++HDAI++     K      
Sbjct  962   ER--YAGEVEEEAKANQEGATNSEDRMMEGIFARSGIHSAVEHDAIIDGSRAGKKVTADP  1019

Query  3173  LKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQL  3352
             + +E++A +VA  AA  L+++  +  Q  V  PTWTG+ G +G P     +     N   
Sbjct  1020  ILVEQEARKVAAEAARELKRAGEVARQVPVGTPTWTGQFGVSGRPQETTAQ--RAFNSPA  1077

Query  3353  VTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSG  3532
              +    ++ SS++++                                      Q Q N+ 
Sbjct  1078  RSRGGAMQSSSLLANL------------------------------------QQRQANAA  1101

Query  3533  SSSNSRTRA---AENGASRPSHGSAGM----QPEVLIRQVCTFIQRKGGSTSSASIVEHF  3691
              S ++  R    A +  S  S   AG     Q +   + +  F+   GG+  +  +++HF
Sbjct  1102  GSRDATPRTSSPARSTGSAASMSRAGTPTLPQGKDFGKLIRDFLTAHGGAAYTQMLIDHF  1161

Query  3692  RSRVPSKDLAL-FKNLLKEIATLKKNPNG-SFWILKPEYQE  3808
                  +    L FK  LK IATL+K   G   W+LK EY++
Sbjct  1162  NRFCTTPQATLEFKETLKVIATLEKAGRGRGRWVLKEEYKK  1202



>gb|EPS30715.1| hypothetical protein PDE_05667 [Penicillium oxalicum 114-2]
Length=1147

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/858 (43%), Positives = 513/858 (60%), Gaps = 69/858 (8%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P + L  GL +P  I   LF YQ+ GVQWLWELH Q  GGIIGDEMGLGKT+Q +A+L S
Sbjct  340   PDLDLHNGLHVPGDIGKFLFPYQRTGVQWLWELHQQSVGGIIGDEMGLGKTIQAIAYLAS  399

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+SN Y KP+IIVCP TL++QW  E  +W+P F V ILH S +   +  + S    + +
Sbjct  400   LHYSNMYTKPAIIVCPATLMKQWVNEFHRWWPPFRVSILHSSGSGMMNLGRESSREAALA  459

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +   +  K   K+I  V+  +  +L+TTY  L+   + L+D+EWG A+
Sbjct  460   SELMGSIPSRHLSAGQKAAK---KIIKRVM-EEGHVLVTTYSGLQSYADALVDVEWGCAI  515

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+  +T  CK+L+T HRII++G+P+QN L +LWSLFDFVFP +LG L  F+
Sbjct  516   LDEGHKIRNPDAGITFSCKELRTPHRIILSGTPMQNSLVDLWSLFDFVFPMRLGTLVTFK  575

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F +PI  GGYA+AT LQV TA +CA  L+D I PYLL+R KADV + LP+KTE VIFC
Sbjct  576   NQFEIPIRQGGYASATNLQVQTAAKCAATLKDAISPYLLQRYKADVTSDLPQKTEQVIFC  635

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT  QR++Y+ FL S D+  I  G +N+L+GID++RKICNHPDL+ R+    D D+GN 
Sbjct  636   KLTQEQRNVYKRFLGSDDMSSIIRGKRNSLFGIDILRKICNHPDLVNRQIRTHDSDFGNS  695

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
             +RSGKMKV+  +L++WKD GH+ L F+QT+QMLDI+E F+ + GG+ +RRMDG TP+K R
Sbjct  696   DRSGKMKVLKGLLEVWKDTGHKTLLFAQTRQMLDIIEKFIWSLGGFNFRRMDGNTPIKDR  755

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               ++DEFN   ++ +F+LTTRVGG+G NLTGA+RVII+DPDWNPS DMQARERAWR+GQK
Sbjct  756   QTMVDEFNKDPDLHVFLLTTRVGGIGVNLTGADRVIIYDPDWNPSTDMQARERAWRLGQK  815

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             +DVT++RL+T+GTIEEK+YHRQI+K  LTNKI ++PQQR  F+A DL DLF L ++ +N 
Sbjct  816   RDVTIFRLMTKGTIEEKIYHRQIFKQFLTNKITRDPQQRESFQASDLYDLFSLTEENDN-  874

Query  2885  STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERD-------NNSGSNGE  3043
               E++ +F             +P  ++  ++    A    A E D        N      
Sbjct  875   ELETTKLFKNADVTYQEQAKANPGNQRRGAVNRQKAQPVQADEEDISAVQGVANVEQFRN  934

Query  3044  EKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK---LEEQASRVAQRA  3214
             E  D  +    ED  I+  +F   G+H+A++HD I+N     +     +EE+A RVA  A
Sbjct  935   EAEDEKSSKTAED-RIMHGIFARSGVHAALEHDQIINGKRNVRADPKLIEEEARRVAAEA  993

Query  3215  AEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMIS  3394
             A  LR++  +     + +PTWTG  G  G   +     GS+  P    +++    SS+++
Sbjct  994   ARELRRAEEVARNTPIGLPTWTGSFGVGGRVDTAGNG-GSSSRP----AARGPSSSSLLA  1048

Query  3395  SRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGA  3574
             +                                          N  +SS     +   G+
Sbjct  1049  N-----------------------------------------LNPNASSIMSPNSTPPGS  1067

Query  3575  SRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS-KDLALFKNLLKEIA  3751
               PS    G     LIR    F+  + G   +  IV+ F     + + +A F+ +LK +A
Sbjct  1068  VTPSRMPRGKDFLPLIRD---FLLSRRGPVFTQVIVDQFNHYCTNPQRVAEFQEMLKTVA  1124

Query  3752  TLKKNPNG-SFWILKPEY  3802
             +L ++  G   W LKPE+
Sbjct  1125  SLDRDRGGRGRWTLKPEF  1142



>dbj|GAA24384.1| K7_Rad26p [Saccharomyces cerevisiae Kyokai no. 7]
Length=1085

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/706 (50%), Positives = 467/706 (66%), Gaps = 51/706 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  I+  LF+YQK  VQWL+EL+ Q  GGIIGDEMGLGKT+QV+AF+ +
Sbjct  279   PDAKLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAA  338

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E   W+P     ILH   +     +K         
Sbjct  339   LHHSGLLTGPVLIVCPATVMKQWCNEFHHWWPPLRTVILHSMGSGMASDQKFKMDENDLE  398

Query  1628  eseelldvdvekNLSFRN---TKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEK  1777
                            ++N   TKK        DKLI+ V+ +D  +LITTY  LR+  +K
Sbjct  399   NLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVV-TDGHILITTYVGLRIHSDK  457

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP+++++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  458   LLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFP  517

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI+IGGYANAT +QV T Y+CAV LRDLI PYLLRR+KADV   L
Sbjct  518   GKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDL  577

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P+K E V+FC LT  QRS Y  FL S+D+ QI +G +N L+GID++RKICNHPDLL+R+ 
Sbjct  578   PQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDT  637

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGY  2482
                +PDYG+P+RSGKM+VV ++L LW  QG++ L F+Q++QMLDILE F+ T        
Sbjct  638   KRHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL  697

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIF-IFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
              Y RMDG T +K R +L+D FNN  E F +F+LTTRVGGLG NLTGANR+IIFDPDWNPS
Sbjct  698   NYLRMDGTTNIKGRQSLVDRFNN--ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS  755

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTN+IL +P+Q+R FK  
Sbjct  756   TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIH  815

Query  2840  DLKDLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER  3016
             +L DLF L   GENG STE      +L+E+V         Q+  +++K + ++     E+
Sbjct  816   ELHDLFSLG--GENGYSTE------ELNEEV---------QKHTENLKNSKSEESDDFEQ  858

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH--DE  3166
               N        S  NG+EK +N+    ++D  I   L     + + M HD++VN+H    
Sbjct  859   LVNLSGVSKLESFYNGKEKKENSK--TEDDRLIEGLLGGESNLETVMSHDSVVNSHAGSS  916

Query  3167  EKLKLEEQASRVAQRAAEALRQSR-MLRSQESVAIPTWTGRSGTAG  3301
                 + ++ASRVA  A  ALR+SR  +  Q  +  PTWTGR G AG
Sbjct  917   SSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGKAG  962



>gb|KGO44998.1| Helicase, C-terminal [Penicillium expansum]
 gb|KGO60302.1| Helicase, C-terminal [Penicillium expansum]
Length=1117

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/690 (48%), Positives = 456/690 (66%), Gaps = 26/690 (4%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P + L+ GL++P  I   LF YQK+GVQWLWELH Q  GGIIGDEMGLGKT+Q +++L +
Sbjct  314   PAMELDNGLRVPGDISRFLFPYQKIGVQWLWELHQQTVGGIIGDEMGLGKTIQAISYLAA  373

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S    KP+I+VCP TL++QW  E  +W+P F V ILH S +   +  K S    + S
Sbjct  374   LHHSKKLTKPAIVVCPATLMKQWVNEFHRWWPPFRVSILHSSGSGMINLGKESSRENALS  433

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +   +  KK  K +      +  +L+TTY  L+   + L+D+EWG A+
Sbjct  434   SEMMGSRNSRHLSAGQKAAKKIIKRVTE----EGHVLVTTYSGLQSYADALVDVEWGCAI  489

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+  +T  CK+L+T HRII++G+P+QN L +LWSLFDFVFP +LG L  F+
Sbjct  490   LDEGHKIRNPDAGITFSCKELRTPHRIILSGTPMQNSLVDLWSLFDFVFPMRLGNLVTFK  549

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F +PI  GGYA+A+ LQV TA +CA  L+D I PYLL+R KADV + LP K+E VIFC
Sbjct  550   NQFEIPIRQGGYASASNLQVQTAAKCAETLKDAISPYLLQRFKADVTSDLPMKSEQVIFC  609

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT +QR+IY+ FL S D++ I  G +N+LYGID++RKI NHPDL +     R+ DYG+ 
Sbjct  610   KLTQLQRTIYKRFLGSDDMKSIVRGKRNSLYGIDILRKISNHPDLADHTLRSREADYGDA  669

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL-VTGGYKYRRMDGATPVKQR  2524
             ERSGKMKV+  +L++W+D GH+ L F+Q + MLDI+E FL V GG+ YRRMDG TP+K+R
Sbjct  670   ERSGKMKVLKGLLEVWRDTGHKTLLFTQGRLMLDIIEKFLGVLGGFNYRRMDGTTPIKER  729

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               L+DEFNN  +I +F+LTTRVGG+G NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  730   QNLVDEFNNNPDIHVFLLTTRVGGIGVNLTGADRVIIYDPDWNPSTDLQARERAWRLGQK  789

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             +DVT++RL+T+GTIEEK+YHRQI+K  LTNKI ++P QR  F+  DL DLF L D+ ++ 
Sbjct  790   RDVTIFRLMTKGTIEEKIYHRQIFKQFLTNKITRDPHQREGFQLSDLYDLFTLTDENDD-  848

Query  2885  STESSSIFSQLSEDVNITGPQHP-DQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNN  3061
               E++ +F    ++  +T  +   D    +SIK  P       E D+ +  NG    +N 
Sbjct  849   ELETTKLF----KNAEVTYQEEAKDVPSSRSIKPAP----VPKEEDDITDINGIANVENF  900

Query  3062  NGDVDEDTS-------ILRTLFDAHGIHSAMDHDAIVNAH---DEEKLKLEEQASRVAQR  3211
                 +E+ +       I+  +F   G+HSA+ HD IVN       +   +E +A RVA  
Sbjct  901   QNAAEEEKNAKTSEDRIMHGIFARSGVHSAVQHDQIVNGKRVLRADPKMIEAEARRVANE  960

Query  3212  AAEALRQSRMLRSQESVAIPTWTGRSGTAG  3301
             AAE LR++        + +PTWTGR G  G
Sbjct  961   AAEELRKAEETARALPIGLPTWTGRFGMGG  990



>emb|CAA57290.1| RAD26 [Saccharomyces cerevisiae]
Length=1085

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/706 (50%), Positives = 467/706 (66%), Gaps = 51/706 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  I+  LF+YQK  VQWL+EL+ Q  GGIIGDEMGLGKT+QV+AF+ +
Sbjct  279   PDAKLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAA  338

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E   W+P     ILH   +     +K         
Sbjct  339   LHHSGLLTGPVLIVCPATVMKQWCNEFHHWWPPLRTVILHSMGSGMASDQKFKMDENDLE  398

Query  1628  eseelldvdvekNLSFRN---TKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEK  1777
                            ++N   TKK        DKLI+ V+ +D  +LITTY  LR+  +K
Sbjct  399   NLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVV-TDGHILITTYVGLRIHSDK  457

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP+++++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  458   LLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFP  517

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI+IGGYANAT +QV T Y+CAV LRDLI PYLLRR+KADV   L
Sbjct  518   GKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDL  577

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P+K E V+FC LT  QRS Y  FL S+D+ QI +G +N L+GID++RKICNHPDLL+R+ 
Sbjct  578   PQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDT  637

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGY  2482
                +PDYG+P+RSGKM+VV ++L LW  QG++ L F+Q++QMLDILE F+ T        
Sbjct  638   KRHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL  697

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIF-IFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
              Y RMDG T +K R +L+D FNN  E F +F+LTTRVGGLG NLTGANR+IIFDPDWNPS
Sbjct  698   NYLRMDGTTNIKGRQSLVDRFNN--ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS  755

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTN+IL +P+Q+R FK  
Sbjct  756   TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIH  815

Query  2840  DLKDLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER  3016
             +L DLF L   GENG STE      +L+E+V         Q+  +++K + ++     E+
Sbjct  816   ELHDLFSLG--GENGYSTE------ELNEEV---------QKHTENLKNSKSEESDDFEQ  858

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH--DE  3166
               N        S  NG+EK +N+    ++D  I   L     + + M HD++VN+H    
Sbjct  859   LVNLSGVSKLESFYNGKEKKENSK--TEDDRLIEGLLGGESNLETVMSHDSVVNSHAGSS  916

Query  3167  EKLKLEEQASRVAQRAAEALRQSR-MLRSQESVAIPTWTGRSGTAG  3301
                 + ++ASRVA  A  ALR+SR  +  Q  +  PTWTGR G AG
Sbjct  917   SSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGKAG  962



>gb|KGO47105.1| Helicase, C-terminal [Penicillium expansum]
Length=1117

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/693 (48%), Positives = 459/693 (66%), Gaps = 32/693 (5%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P + L+ GL++P  I   LF YQK+GVQWLWELH Q  GGIIGDEMGLGKT+Q +++L +
Sbjct  314   PAMELDNGLRVPGDISRFLFPYQKIGVQWLWELHQQTVGGIIGDEMGLGKTIQAISYLAA  373

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S    KP+I+VCP TL++QW  E  +W+P F V ILH S +   +  K S    + S
Sbjct  374   LHHSKKLTKPAIVVCPATLMKQWVNEFHRWWPPFRVSILHSSGSGMINLGKESSRENALS  433

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +   +  KK  K +      +  +L+TTY  L+   + L+D+EWG A+
Sbjct  434   SEMMGSRNSRHLSAGQKAAKKIIKRVTE----EGHVLVTTYSGLQSYADALVDVEWGCAI  489

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+  +T  CK+L+T HRII++G+P+QN L +LWSLFDFVFP +LG L  F+
Sbjct  490   LDEGHKIRNPDAGITFSCKELRTPHRIILSGTPMQNSLVDLWSLFDFVFPMRLGNLVTFK  549

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F +PI  GGYA+A+ LQV TA +CA  L+D I PYLL+R KADV + LP K+E VIFC
Sbjct  550   NQFEIPIRQGGYASASNLQVQTAAKCAETLKDAISPYLLQRFKADVTSDLPMKSEQVIFC  609

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT +QR+IY+ FL S D++ I  G +N+LYGID++RKI NHPDL +     R+ DYG+ 
Sbjct  610   KLTQLQRTIYKRFLGSDDMKSIVRGKRNSLYGIDILRKISNHPDLADHTLRSREADYGDA  669

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL-VTGGYKYRRMDGATPVKQR  2524
             ERSGKMKV+  +L++W+D GH+ L F+Q + MLDI+E FL V GG+ YRRMDG TP+K+R
Sbjct  670   ERSGKMKVLKGLLEVWRDTGHKTLLFTQGRLMLDIIEKFLGVLGGFNYRRMDGTTPIKER  729

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               L+DEFNN  +I +F+LTTRVGG+G NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  730   QNLVDEFNNNPDIHVFLLTTRVGGIGVNLTGADRVIIYDPDWNPSTDLQARERAWRLGQK  789

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             +DVT++RL+T+GTIEEK+YHRQI+K  LTNKI ++P QR  F+  DL DLF L D+ ++ 
Sbjct  790   RDVTIFRLMTKGTIEEKIYHRQIFKQFLTNKITRDPHQREGFQLSDLYDLFTLTDENDD-  848

Query  2885  STESSSIFSQLSEDVNITGPQHPDQEKD----KSIKTNPADHGTAMERDNNSGSNGEEKA  3052
               E++ +F    ++  +T   + ++ KD    +SIK  P       E D+ +  NG    
Sbjct  849   ELETTKLF----KNAEVT---YQEEAKDIPSSRSIKPAP----VPKEEDDITDINGIANV  897

Query  3053  DNNNGDVDEDTS-------ILRTLFDAHGIHSAMDHDAIVNAH---DEEKLKLEEQASRV  3202
             +N     +E+ +       I+  +F   G+HSA+ HD IVN       +   +E +A RV
Sbjct  898   ENFQNAAEEEKNAKTSEDRIMHGIFARSGVHSAVQHDQIVNGKRVLRADPKMIEAEARRV  957

Query  3203  AQRAAEALRQSRMLRSQESVAIPTWTGRSGTAG  3301
             A  AAE LR++        + +PTWTGR G  G
Sbjct  958   ANEAAEELRKAEETARALPIGLPTWTGRFGMGG  990



>ref|XP_007373433.1| hypothetical protein SPAPADRAFT_133417 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW33849.1| hypothetical protein SPAPADRAFT_133417 [Spathaspora passalidarum 
NRRL Y-27907]
Length=1042

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/692 (48%), Positives = 462/692 (67%), Gaps = 26/692 (4%)
 Frame = +2

Query  1280  MLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHF  1459
             +L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++F+  LH+
Sbjct  256   ILNSKFKLPGDIYPSLFDYQKTCVQWLWELYSQKTGGIIGDEMGLGKTIQIISFIAGLHY  315

Query  1460  SNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsese  1636
             S    KP ++V P T+L QW  E  KW+P     ILH   +   +K    K        +
Sbjct  316   SGLLDKPVLVVVPATVLNQWVNEFHKWWPPLRCIILHSIGSGMGEKVSEEKLESFLETHD  375

Query  1637  elldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDE  1816
                     + +  +   +  ++I+ V+     +LITTY  LR+  + +L  EWGY +LDE
Sbjct  376   PHASTSSLRGIKSQINAQ--EIIDRVM-EKGHVLITTYVGLRIYSKHILPREWGYVILDE  432

Query  1817  GHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEF  1996
             GH+IRNP++D++L CKQ++T +RII++G+PIQN L ELWSLFDF+FPG+LG LPVF+ +F
Sbjct  433   GHKIRNPDSDISLTCKQIKTYNRIILSGTPIQNNLIELWSLFDFIFPGRLGTLPVFQQQF  492

Query  1997  AVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLT  2176
             ++PI++GGYANA+ +QV T Y+CAV+LRDLI PYLLRR+K+DV   LPKK E V+F  LT
Sbjct  493   SIPINMGGYANASNVQVQTGYKCAVILRDLITPYLLRRLKSDVAQDLPKKNEMVLFVKLT  552

Query  2177  SVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLERE--HSCRDPDYGNPE  2350
              +Q+ +Y+ FL S ++  I  G +N L G+D++RKICNHPDL+ RE     +  +YGNP 
Sbjct  553   RIQQDLYEKFLHSEELNSILKGKRNVLMGVDMLRKICNHPDLINREILMYKKGYNYGNPA  612

Query  2351  RSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV------------TGGYKYRR  2494
             +SGKM+V+  +L+LW+ Q H+ L F QT+QMLDILE F+             TG + Y R
Sbjct  613   KSGKMQVLKNLLQLWQSQNHKTLLFCQTRQMLDILEKFVANLHVLDEEGNDSTGYFNYLR  672

Query  2495  MDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQA  2674
             MDG TP+ +R  L+D+FN  +   +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QA
Sbjct  673   MDGGTPISKRQTLVDKFNTDLTQHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQA  732

Query  2675  RERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDL  2854
             RERAWR+GQK+D+T+YRL+T G+IEEK+YHRQI+K  LTNKILK+P+QRR FK  DL DL
Sbjct  733   RERAWRLGQKRDITIYRLMTTGSIEEKIYHRQIFKTFLTNKILKDPKQRRFFKINDLHDL  792

Query  2855  FVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEK-DKSIKTNPADHGTAMERDNNSG  3031
             F L D  E G TE+  +FS  S +V  +G +   Q    K   TN  D     +    + 
Sbjct  793   FTLGDQNEQG-TETGDLFS--SSEVKFSGTKPRKQTSLFKKKYTNDDDFYQVAKISGVAK  849

Query  3032  SNG--EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVA  3205
              +   +EK +   G  DED  I++ LF   G+HS + HD I+++  +E   +E +A+R+A
Sbjct  850   LDQYVDEKEEPEQGK-DED-RIMQGLFTNSGVHSTLKHDDIIDSSMQETSLIEREANRIA  907

Query  3206  QRAAEALRQSRMLRSQESVAIPTWTGRSGTAG  3301
               AAEAL++SR L  ++ +  PTWTG+ G AG
Sbjct  908   TAAAEALKRSRKLARKKEIGTPTWTGKFGLAG  939



>ref|XP_664707.1| hypothetical protein AN7103.2 [Aspergillus nidulans FGSC A4]
 gb|EAA61308.1| hypothetical protein AN7103.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF79076.1| TPA: DNA repair protein Rhp26/Rad26, putative (AFU_orthologue; 
AFUA_4G03840) [Aspergillus nidulans FGSC A4]
Length=1193

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/851 (42%), Positives = 499/851 (59%), Gaps = 67/851 (8%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P + L+ G +IP  I   LFDYQK GVQW+WELH Q+ GGIIGDEMGLGKT+Q +AFL  
Sbjct  380   PDLHLDNGYRIPGDIHPLLFDYQKTGVQWMWELHQQQVGGIIGDEMGLGKTIQAIAFLAG  439

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP I+VCP T+++QW  E  +W+P F V ILH S +   + K  S   ++  
Sbjct  440   LHYSKRLTKPIIVVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIKSESSREDALM  499

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                           S    K   K++  V+  +  +L+TTY  L+     L+ +EWG  +
Sbjct  500   YGTYWSGG------SSSGLKAARKVVKRVV-EEGHVLVTTYSGLQSYASLLIPVEWGGTI  552

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+  K+L+T HRII++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  553   LDEGHKIRNPNTSITMHAKELRTPHRIILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  612

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC
Sbjct  613   NQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKSEQVLFC  672

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT  QR  Y+AFL S +++ I  G +  LYG+D++RKICNHPDL   +     P+YGNP
Sbjct  673   RLTKPQRQAYEAFLGSEEMQSILRGRRQVLYGVDILRKICNHPDLQNHKLLYAKPNYGNP  732

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
              +SGKM+VV  +L+LWK+ GH+ L F+Q + MLDILE F+ +  G+ YRRMDG TP++ R
Sbjct  733   TKSGKMQVVRSLLELWKETGHKTLLFAQHRIMLDILEKFVKSLSGFNYRRMDGTTPIQHR  792

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               ++DEFN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  793   QTMVDEFNKDPDLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLGQK  852

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             +DVT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F+  DL DLF L ++G+ G
Sbjct  853   RDVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFQLSDLYDLFALGEEGQ-G  911

Query  2885  STESSSIFSQ----LSEDVNITGPQHPDQEKDKSIKTNPAD----HGTAMERDNNSGSNG  3040
              TE+S +F +      E+ +   P+  D    + ++    D     G A           
Sbjct  912   PTETSKLFKEAEVTYEENRDKDAPKERDASYQRDVEAEKQDISKVTGVAAIEQFQGEPEQ  971

Query  3041  EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK---LEEQASRVAQR  3211
             + K ++     + ++ ++  +F   G+HSA++HD IVN     +     +E +A RVA  
Sbjct  972   QAKQESGESGTNSESRLMEGIFARSGVHSALEHDQIVNGKRVVRADPKIIEAEAKRVAAE  1031

Query  3212  AAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMI  3391
             AAE LR++        +  PTWTG+ G AG P             +  T+ + L   S  
Sbjct  1032  AAEQLRRAGEAAKSVPIGTPTWTGQFGVAGKPEESPMPMRGPFGGRSSTARRALAGPSSA  1091

Query  3392  SSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENG  3571
             S   N                                          SS    +R+A N 
Sbjct  1092  SIIANL-----------------------------------------SSRTPSSRSATNS  1110

Query  3572  ASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF-RSRVPSKDLALFKNLLKEI  3748
              + P +  +G     +IR    FI   GGS  + ++++HF R     +  A FK +LK+I
Sbjct  1111  PA-PGNEPSGKDFITMIRD---FITTHGGSVYTQNLIDHFNRYCTTPQKSAEFKEMLKQI  1166

Query  3749  ATLKKNPNGSF  3781
             A L K    +F
Sbjct  1167  AVLDKGGRNAF  1177



>ref|XP_001240720.1| hypothetical protein CIMG_07883 [Coccidioides immitis RS]
Length=1198

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/864 (43%), Positives = 526/864 (61%), Gaps = 65/864 (8%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L+GG +IP  I+  LFDYQK GVQWLWEL+ Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  377   PDSVLDGGYRIPGDIYPYLFDYQKTGVQWLWELYQQRVGGIIGDEMGLGKTIQVIAFLAG  436

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S     P I+VCP T+++QW  E  +W+P   V ILH S +   + KK S++ ++ +
Sbjct  437   LHYSKKLDAPIIVVCPPTVMKQWVNEFHRWWPPLRVSILHTSGSGMINIKKESRAEDTLT  496

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +   +  K+   ++  VL  D  +L+TTY  L+     L+ ++WG A+
Sbjct  497   SEIWDPYRPTRMSGGQKAAKR---ILKRVL-EDGHVLVTTYAGLQTYTSLLIPVDWGCAI  552

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  553   LDEGHKIRNPDTAITIHCKELRTPHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  612

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKKTE V+FC
Sbjct  613   NQFEFPIRAGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKTEQVLFC  672

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCR--DPDYG  2341
              LT +QR+ Y+AFL+S ++  I  G ++ L+G+D++RKICNHPDL E +   +  + +YG
Sbjct  673   KLTKLQRAAYEAFLSSNEMSAIMRGRRDVLFGVDILRKICNHPDLPEHKTLSQKANYNYG  732

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             N  +SGKM+VV  +L+LW+D GH+ L F+Q + MLDILE F+ +  G+ YRRMDG TP+K
Sbjct  733   NSAKSGKMQVVKALLELWRDTGHKTLLFAQHRIMLDILEKFIKSLTGFNYRRMDGNTPIK  792

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R  ++DEFNN  +I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  793   VRQGMVDEFNNDPDIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDLQARERAWRLG  852

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F+  DL DLF L   G+
Sbjct  853   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFQMSDLHDLFTL---GD  909

Query  2879  NGSTESSSIFSQL-------SEDVNITGPQHPDQEKDKSIKTNPADHGTAMER-DNNSGS  3034
             NG TE+S +F +        S+    T     ++E+ +  K +      A+E+  + +G+
Sbjct  910   NGPTETSKMFQEAGVTFQENSKHEKGTKESKVEEERKEKDKISKVTGVAALEQYQSATGT  969

Query  3035  NGEEKADNNNGDVDE-DTSILRTLFDAHGIHSAMDHDAIVNAHDE----EKLKLEEQASR  3199
               E   +         D  ++ T+F   G+HSA++H+ I N        +   +E +A R
Sbjct  970   PTETDGETKRTAASHSDARLMETIFARSGVHSALEHEQIFNGRKRSVKADPKIIEAEAKR  1029

Query  3200  VAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEE  3379
             VA  AA+ L +++ +     V  PTWTG+ GTAG P          ++P     + P+  
Sbjct  1030  VAAEAAKELLKAQEVARTVPVGTPTWTGQFGTAGRP----------VDPTAPRGTMPVYA  1079

Query  3380  SSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRA  3559
                 S  R                     + G    +I   L   ++     SS+ R   
Sbjct  1080  GGGGSVARR-------------------TMHGPSSASIIANL--TNRTTGQHSSSGRNSP  1118

Query  3560  AENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS-KDLALFKNL  3736
             A +G S P     G    V+IR    +I  +GG+  +  +V+HF     S +  A FK +
Sbjct  1119  ARSGTSTPR----GKDFMVMIRD---YITAQGGAVYTQMLVDHFNRFCDSPRATAEFKEI  1171

Query  3737  LKEIATLKKN--PNGSFWILKPEY  3802
             L+ IA L+K        W+L+PEY
Sbjct  1172  LRTIAVLEKTGRQGRGKWVLRPEY  1195



>ref|XP_002542686.1| hypothetical protein UREG_02202 [Uncinocarpus reesii 1704]
 gb|EEP77353.1| hypothetical protein UREG_02202 [Uncinocarpus reesii 1704]
Length=1203

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/878 (43%), Positives = 528/878 (60%), Gaps = 93/878 (11%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
              ML+ G +IP  I+  LFDYQK GVQWLWELH Q+ GGIIGDEMGLGKT+QV+AFL  LH
Sbjct  386   TMLDNGYRIPGDIYPYLFDYQKTGVQWLWELHQQRVGGIIGDEMGLGKTIQVIAFLAGLH  445

Query  1457  FSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             +S     P I+VCP T+++QW  E  +W+P   V ILH S +   + KK S + +     
Sbjct  446   YSKKLTGPVIVVCPPTVMKQWVNEFHRWWPPLRVSILHTSGSGMVNIKKESYAEDRLMSE  505

Query  1634  eelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLD  1813
                 D         +  ++   ++  VL  D  +LITTY  L+     L+ ++W  A+LD
Sbjct  506   IWEPDRPTRLPGGQKGARR---ILKRVL-EDGHVLITTYAGLQTYASLLIPVDWSCAILD  561

Query  1814  EGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAE  1993
             EGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F  +
Sbjct  562   EGHKIRNPDTAITIHCKELRTAHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFRNQ  621

Query  1994  FAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSL  2173
             F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKKTE V+FC L
Sbjct  622   FEFPIRTGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKTEQVLFCKL  681

Query  2174  TSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCR--DPDYGNP  2347
             T VQR+ Y+AFL S ++  I  G ++ LYG+D++RKICNHPDL E     +  D +YG+ 
Sbjct  682   TRVQRAAYEAFLGSNEMASIMRGRRDVLYGVDILRKICNHPDLPEHRTLSQKSDYNYGSG  741

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
              +SGKM+VV  +++LWK+ GH+ L F+Q + MLDILE F+ +  G+ YRRMDG TP+K R
Sbjct  742   VKSGKMQVVKSLIELWKETGHKTLLFAQHRIMLDILEKFMKSLPGFNYRRMDGNTPIKIR  801

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
              +++DEFN   +I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  802   QSIVDEFNTDPDIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDLQARERAWRLGQK  861

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             ++VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F+  DL DLF L   G +G
Sbjct  862   REVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFQMSDLHDLFTL---GNDG  918

Query  2885  STESSSIFSQLSEDVNIT--------------GPQHPDQEKDKSIKTNPADHGTAMERDN  3022
              TE+S +F    +D ++T               P   +QE+DK  +       T++E+  
Sbjct  919   PTETSRLF----QDADVTFNEGNDSAKAAEKPQPVQTEQEEDKISRVAGV---TSLEKYE  971

Query  3023  NSGSN--GEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDE----EKLKLE  3184
             +  S   G + A         D+ ++ T+F   G+HSA++H+ I+         +   +E
Sbjct  972   SETSTPAGTDAATKAAPASSSDSRLMETIFARSGVHSAIEHEQIIGGRKRGVKADPKIIE  1031

Query  3185  EQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSS  3364
              +A RVA +AAE L +++ +     V  PTWTG+ GTAG P       G+   P     +
Sbjct  1032  AEAKRVAAQAAEELLKAQKVARTVPVGTPTWTGQFGTAGRPEERNAPLGTV--PVYAGGN  1089

Query  3365  KPLE------ESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFN  3526
              P         +S+I++  N                          RA+       HQ +
Sbjct  1090  GPRRTVGGPSSASIIANLTN--------------------------RAVG------HQSS  1117

Query  3527  SGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVP  3706
             SG +S  R+     GA+ P     G     +IR    +I  +GG+  +  +V+HF     
Sbjct  1118  SGRNSPVRS-----GANSPR----GKDFMAMIRD---YIIAQGGAVYTQMLVDHFNRFCD  1165

Query  3707  S-KDLALFKNLLKEIATLKKNPNGSF--WILKPEYQEE  3811
             S +  A FK +L+ IA L+K  + +   W+LKPEY ++
Sbjct  1166  SPRATAEFKEMLRTIAVLEKTGSQARGKWVLKPEYSQK  1203



>gb|EYE91379.1| DNA repair protein Rhp26/Rad26 [Aspergillus ruber CBS 135680]
Length=1190

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/698 (48%), Positives = 459/698 (66%), Gaps = 25/698 (4%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P +  + G + P  +   LFDYQK G+QWLWELH Q  GGIIGDEMGLGKT+QV+++L  
Sbjct  382   PDLEYDNGYRAPGDVHQYLFDYQKTGMQWLWELHQQHVGGIIGDEMGLGKTIQVISYLAG  441

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S  + KP+++VCP T+++QW  E  +W+P F V ILH S +   + +  S   +   
Sbjct  442   LHYSKQFTKPALVVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMVNVRNESSREDELL  501

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
               +              + +K  + +   +  +  +L+TTY  L+     L+ +EWG AV
Sbjct  502   TQKYRGGSSR----GLTSAQKAARKVTKRVAEEGHVLVTTYAGLQTYAPLLIPMEWGCAV  557

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T  CK+L+T HRII++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  558   LDEGHKIRNPDTSITFHCKELRTPHRIILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  617

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC
Sbjct  618   NQFDFPIRQGGYANASNLQVQTAAKCAETLKDAITPYLLQRFKIDVAADLPKKSEQVLFC  677

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT  Q   Y+AFL S +++ I  G + AL+GID++RKICNHPDLL+R+ +  + +YG  
Sbjct  678   KLTMPQMQAYKAFLGSGEMQSILTGRRQALFGIDILRKICNHPDLLDRKITSGNTNYGRA  737

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
              +SGKM+VV  +L LWKD GH+ L F+Q + MLDILE  + +   ++YRRMDG+TP+K R
Sbjct  738   SQSGKMQVVKSLLHLWKDTGHKTLLFTQHRIMLDILEKLVRSMPDFQYRRMDGSTPIKSR  797

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
              +++DEFNN   + +F+LTTRVGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  798   QSMVDEFNNDPNLHVFLLTTRVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLGQK  857

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             +DVTVYRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR  F+  DL DLF L D  ENG
Sbjct  858   RDVTVYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRSTFQLSDLHDLFTLGD--ENG  915

Query  2885  STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER--DNNSGSNGEEKADN  3058
              TE+S +F         T    P++ +D S  T  A    +ME+  +    +N     D 
Sbjct  916   QTETSKLFQDAEVKYENT---DPNETQDLSKVTGIA----SMEKFHEPEPQTNSASTPDP  968

Query  3059  NNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK-----LEEQASRVAQRAAEA  3223
             N  D   ++ I+  +F   G+HSA++HD I+N + +  ++     +E +A RVA  AAE 
Sbjct  969   NANDNKTESRIMEGIFSRAGVHSALEHDQIINPNGKRVVRADPKIIEAEAKRVAAEAAEE  1028

Query  3224  LRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGST  3337
             LR++        +  PTWTG+SG AG P S+   FG +
Sbjct  1029  LRRAGEAARSVPIGTPTWTGQSGIAGRPESM---FGGS  1063



>ref|NP_588091.1| SNF2 family helicase Rhp26 [Schizosaccharomyces pombe 972h-]
 sp|Q9UR24.1|RHP26_SCHPO RecName: Full=DNA repair protein rhp26; AltName: Full=RAD26 homolog 
[Schizosaccharomyces pombe 972h-]
 dbj|BAA84456.1| Rhp26 [Schizosaccharomyces pombe]
 emb|CAB62827.1| SNF2 family helicase Rhp26 [Schizosaccharomyces pombe]
Length=973

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/865 (43%), Positives = 522/865 (60%), Gaps = 70/865 (8%)
 Frame = +2

Query  827   ETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQDNGDLVSTSLANAIQSISEAA-  1003
             E E+ +L+R G +TPF  L G ++++    +SS          +  ++  +  +  E A 
Sbjct  121   ELERQELIRTGKVTPFRNLSGLQKEVDFDDESS----------IREAVIKSEGTYYETAP  170

Query  1004  --QSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRKRRPTPGKKWR--  1171
                S P+   +D  ++P+ E   Y          ++ + ++G +   ++R       R  
Sbjct  171   HLSSEPSN--IDHGIIPRDEKDEYVTVDAVTEKVVTAAIDDGDDLVYRQRLNAWCANRKE  228

Query  1172  ----VKVSRENKD----EGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKL  1327
                    S  NKD    EG D  +  +  +K        G  F   EGG  IP  I   L
Sbjct  229   LRDQASASENNKDRGEFEGKDEWLLPHPSKK--------GQTF---EGGFTIPGDIRPHL  277

Query  1328  FDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAY-KPSIIVCPLTL  1504
             F YQ   VQWLWEL+CQ+AGGIIGDEMGLGKT+Q+++FL SLH S  + KP++IVCP TL
Sbjct  278   FRYQVTCVQWLWELYCQEAGGIIGDEMGLGKTIQIVSFLSSLHHSGKFQKPALIVCPATL  337

Query  1505  LQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNT  1684
             ++QW  E   W+    V +LH + +    ++   +  + +S++ E    + + ++  R  
Sbjct  338   MKQWVNEFHTWWAPLRVVVLHATGS---GQRASREKRQYESDASESEAEESKTSIKLRGA  394

Query  1685  K----KWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVT  1852
                  ++ K +   + +   +LITTY  LR+ G+ +L  EWGY VLDEGH+IRNP+++++
Sbjct  395   SSSFHRYAKNLVESVFTRGHILITTYAGLRIYGDLILPREWGYCVLDEGHKIRNPDSEIS  454

Query  1853  LVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANA  2032
             + CKQ++TV+RII++G+PIQN L+ELW+LFDFVFPG+LG LPVF+ +FA+PI+IGGYANA
Sbjct  455   ISCKQIRTVNRIILSGTPIQNNLTELWNLFDFVFPGRLGTLPVFQNQFALPINIGGYANA  514

Query  2033  TPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLA  2212
             + +QV TAY+CA +LRDLI PYLLRRMK DV A LPKK+E V+FC LT +QR  YQ FL 
Sbjct  515   SNVQVQTAYKCACMLRDLISPYLLRRMKLDVAADLPKKSEQVLFCKLTPLQRKAYQDFLQ  574

Query  2213  STDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSC--RDPDYGNPERSGKMKVVAEVL  2386
              +D+++I +G +  LYGID++RKICNHPDL+ RE+     D +YG+PE+SGK+KV+  +L
Sbjct  575   GSDMQKILNGKRQMLYGIDILRKICNHPDLVTREYLLHKEDYNYGDPEKSGKLKVIRALL  634

Query  2387  KLWKDQGHRVLFFSQTQQMLDILENFLV-TGGYKYRRMDGATPVKQRMALIDEFNNTVEI  2563
              LWK QGHR L FSQT+QMLDILE  L       Y RMDG+T +  R  L+D FN     
Sbjct  635   TLWKKQGHRTLLFSQTRQMLDILEIGLKDLPDVHYCRMDGSTSIALRQDLVDNFNKNEYF  694

Query  2564  FIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGT  2743
              +F+LTTRVGGLG NLTGA+RVI+FDPDWNPS D QARERAWR+GQKKDV VYRL+T GT
Sbjct  695   DVFLLTTRVGGLGVNLTGADRVILFDPDWNPSTDAQARERAWRLGQKKDVVVYRLMTAGT  754

Query  2744  IEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIF-----  2908
             IEEK+YHRQI+K  LTNKILK+P+QRR FK  DL DLF L D+   G TE+ S+F     
Sbjct  755   IEEKIYHRQIFKQFLTNKILKDPKQRRFFKMTDLHDLFTLGDNKTEG-TETGSMFLGSER  813

Query  2909  ----------SQLSEDVNITG-PQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKAD  3055
                          +ED+      +H   +K K + ++       +          E    
Sbjct  814   VLRKDNSSRNGNEAEDIPARDRKKHKIHDKGKKVNSSKVFEKMGIASMEKYKPPQESNVT  873

Query  3056  NNNGDVD-EDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQ  3232
               N D    D S+L  +F + GI S + HD I+ A   E + +E++A+RVA  A  A+  
Sbjct  874   KTNSDSTLGDDSVLDDIFASAGIQSTLKHDDIMEASQTESILVEKEATRVANEALRAVSS  933

Query  3233  SR-----MLRSQESVAIPTWTGRSG  3292
              R     ++  Q+S  +P  +  SG
Sbjct  934   FRRPPRQLIPPQQSTNVPGTSKPSG  958



>ref|XP_007757868.1| DNA excision repair protein ERCC-6 [Cladophialophora yegresii 
CBS 114405]
 gb|EXJ58245.1| DNA excision repair protein ERCC-6 [Cladophialophora yegresii 
CBS 114405]
Length=1197

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/871 (42%), Positives = 525/871 (60%), Gaps = 70/871 (8%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L+ G K+P  I+  LFDYQK GVQWL ELH Q+ GGIIGDEMGLGKT+Q++AFL  
Sbjct  370   PDTVLDAGYKLPGDIYPSLFDYQKTGVQWLHELHIQQVGGIIGDEMGLGKTIQIIAFLAG  429

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP I+VCP T+++QW  E  +W+P F V ILH S +   + +  +   +S  
Sbjct  430   LHYSKRLDKPIIVVCPATVMKQWVNEFHRWWPPFRVTILHSSGSGMINVRNEASKEDSLV  489

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
             + E   +     N      +K  + I   +    G+L+TTY  L+     L+ ++W YAV
Sbjct  490   DLEWDPNAG---NRPLTGAQKAAQRILRPILEKGGVLVTTYSGLQTYAPLLIPVDWQYAV  546

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+ CK+L+T +RII++G+P+QN L ELWSLFDFVFP +LG L  F 
Sbjct  547   LDEGHKIRNPNTAITIYCKELRTPNRIILSGTPMQNNLIELWSLFDFVFPMRLGTLVNFR  606

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F +PI  GGYANA+ LQV TA++CA  L+D I PYLL+R K DV + LPKK+E V+FC
Sbjct  607   NQFEIPIRQGGYANASNLQVQTAFKCAETLKDAISPYLLQRFKIDVASDLPKKSEQVLFC  666

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLE--REHSCRDPDYG  2341
              LTS+QR  YQ F+ S +++ I  G +  LYGID++RKICNHPDL +  R       DYG
Sbjct  667   KLTSLQRKEYQKFITSGEMDAIMTGKRQVLYGIDLLRKICNHPDLTDHKRLPGKSGYDYG  726

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             NP +SGKM+VV  +L+LW+D GH+ L F+Q + MLDILE ++ +  G+KYRRMDG TP++
Sbjct  727   NPAKSGKMQVVGSLLELWRDTGHKTLLFAQHRIMLDILEKYVRSLSGFKYRRMDGNTPIQ  786

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R +++DEFN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  787   TRQSMVDEFNTDPDLHVFLLTTKVGGLGINLTGADRVIIYDPDWNPSTDLQARERAWRLG  846

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F   DL DLF L ++G+
Sbjct  847   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFHLNDLHDLFSLGNEGD  906

Query  2879  NGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADH---GTAMERDNNSGSNGEEK  3049
                TE+S +F    +D  +   +H  +  D       AD      A    N     G   
Sbjct  907   --ETETSKLF----QDAQV---KHSTKPADAPTAVTTADENQSAPANTETNIEALPGISS  957

Query  3050  ADNNNGDVDEDTS------------ILRTLFDAHGIHSAMDHDAIVNAHDEEKLK-----  3178
              +   G+V+E+              ++  +F   GIHSA++HDAI++   ++K+      
Sbjct  958   MEQYAGEVEEEEQAKKDPTNNSEDRVMEGIFSRAGIHSAVEHDAIIDGKTQKKVAADPVM  1017

Query  3179  LEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVT  3358
             +E++A +VA  AA+ LR++  +     +  PTWTG+ G AG P     +   + N +  +
Sbjct  1018  IEQEARKVAAEAAKELRRAGEVARTVPIGTPTWTGQFGVAGRPQETTARNAFSSNSR--S  1075

Query  3359  SSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSS  3538
                 L+ SS++++ +                      RG   R  S          + SS
Sbjct  1076  RGGGLQSSSLLANLQR--------------QGNHLPSRGGTPRTASP---------ARSS  1112

Query  3539  SNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF-RSRVPSKD  3715
              ++ + + E   + P     G     LIR    ++   GGS  +  +++HF R    ++ 
Sbjct  1113  GSAASVSREGTPTLPRGKDFGK----LIRD---YLTTHGGSVYTQMLIDHFNRYCTTAQA  1165

Query  3716  LALFKNLLKEIATLKKNPNG-SFWILKPEYQ  3805
              A FK  LK IA L+K   G   W+LK EY+
Sbjct  1166  TAEFKETLKLIARLEKGSRGRGRWVLKDEYK  1196



>ref|XP_001274839.1| DNA repair protein Rhp26/Rad26, putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW13413.1| DNA repair protein Rhp26/Rad26, putative [Aspergillus clavatus 
NRRL 1]
Length=1221

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/868 (43%), Positives = 508/868 (59%), Gaps = 80/868 (9%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P V  + G ++P  I   LFDYQK GVQWLWEL+ QK GGIIGDEMGLGKT+Q +AFL  
Sbjct  402   PDVSYDNGYRLPGDINPYLFDYQKTGVQWLWELYQQKVGGIIGDEMGLGKTIQTIAFLAG  461

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S     P I+VCP T+++QW  E  +W+P F V ILH S +   + +  S   ++  
Sbjct  462   LHYSKKLDGPIIVVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMINIRNESSREDALL  521

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +    N K   K++  V+  +  +L+TTY  ++     L+ +EWG A+
Sbjct  522   SQSYSYGSRALTS----NQKAARKVVKRVV-EEGHVLVTTYSGIQTYAPFLIPVEWGCAI  576

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  577   LDEGHKIRNPNTSITIHCKELRTPHRVILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  636

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKKTE V+FC
Sbjct  637   NQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKTEQVLFC  696

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT  QR  Y+ FL S D++ I  G +  LYG+D++RKICNHPDL   +       YGN 
Sbjct  697   KLTKSQREAYETFLRSEDMQSILKGRRQVLYGVDILRKICNHPDLQNHKLESHQVGYGNG  756

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
              RSGKM+VV  +L+LW+D GH+ L F+Q + MLDILE F+ +  G+ +RRMDG TP++ R
Sbjct  757   NRSGKMQVVKSLLELWRDTGHKTLLFAQHRIMLDILEKFVNSLSGFNHRRMDGTTPIQHR  816

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
              A++DEFNN   + +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  817   QAMVDEFNNDPNLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLGQK  876

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRL-FKARDLKDLFVLNDDGEN  2881
             ++V+VYRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+  F+  DL DLF L D+ + 
Sbjct  877   REVSVYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTSFQLSDLYDLFSLGDE-KP  935

Query  2882  GSTESSSIFSQ----LSEDVNITGPQHPD--------QEKDKSIKTNPADHGTAMERDNN  3025
             GSTE+S +F         D + +G Q            E+ K I+      G +   D  
Sbjct  936   GSTETSKLFKDAEVTFQGDTDTSGQQSAGSQNASTTAHEEKKDIRKVV---GVSSLEDYQ  992

Query  3026  SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK---LEEQAS  3196
               S      D   G  + ++ I+  +F   G+HSA++HD IVN     +     +E +A 
Sbjct  993   GESEQPRDPDKGAGAANSESRIMEGIFARSGVHSALEHDQIVNGKRVVRADPKIIEAEAK  1052

Query  3197  RVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPS--IKKKFGSTLNPQLVTSSKP  3370
             RVA  AAE LR++        +  PTWTG+ G AG P    +   FG   +    T++ P
Sbjct  1053  RVASEAAEELRRAGEAARAVPIGTPTWTGQFGVAGKPEERPLPSAFGGRSSTTRRTAAGP  1112

Query  3371  LEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSR  3550
                S + +                                           ++ ++  SR
Sbjct  1113  SSASILAN------------------------------------------LSARATPPSR  1130

Query  3551  TRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF-RSRVPSKDLALF  3727
             +R+A  G+  P     G+    +IR    +I  +GGS  +  +++HF R     +  A F
Sbjct  1131  SRSA-TGSPAPGRTPTGVDFMTMIRD---YILAQGGSVFTQMLIDHFNRYCTTPQRSAEF  1186

Query  3728  KNLLKEIATLKK---NPNGSFWILKPEY  3802
             K +LK IA L+K   N  G  W LKPE+
Sbjct  1187  KEMLKTIAVLEKGGRNGRGQ-WSLKPEF  1213



>ref|XP_002559134.1| Pc13g07020 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP91771.1| Pc13g07020 [Penicillium rubens Wisconsin 54-1255]
Length=1116

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/863 (44%), Positives = 521/863 (60%), Gaps = 88/863 (10%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P + L+ GL++P  I   LF YQK GVQWLWELH Q  GGIIGDEMGLGKT+Q +++L +
Sbjct  314   PAMELDNGLRVPGDISRFLFSYQKTGVQWLWELHQQTVGGIIGDEMGLGKTIQAISYLAA  373

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S  + KP+I+VCP TL++QW  E  +W+P F V ILH S +   +  K S    + +
Sbjct  374   LHHSKKFTKPAIVVCPATLMKQWVNEFHRWWPPFRVSILHSSGSGMINIGKESSRENALT  433

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +   +  KK  K +      D  +L+TTY  L+   + L+D+EWG A+
Sbjct  434   SEMMGSHSSRHLSAGQKAAKKIIKRVTE----DGHVLVTTYSGLQSYADALVDVEWGCAI  489

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+  +T  CK+L+T HRII++G+P+QN L +LWSLFDFVFP +LG L  F+
Sbjct  490   LDEGHKIRNPDAGITFSCKELRTPHRIILSGTPMQNSLVDLWSLFDFVFPMRLGNLVTFK  549

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F +PI  GGYA+A+ LQV TA +CA  L+D I PYLL+R KADV + LP K+E VIFC
Sbjct  550   NQFEIPIRQGGYASASNLQVQTAAKCAETLKDAISPYLLQRFKADVTSDLPLKSEQVIFC  609

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT +QR+IY+ FL S D++ I  G +N+LYGID++RKI NHPDL +     R+ DYG+ 
Sbjct  610   KLTQLQRTIYKRFLGSDDMKSIIRGRRNSLYGIDILRKISNHPDLADHTLRSREADYGDA  669

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL-VTGGYKYRRMDGATPVKQR  2524
             ERSGKMKV+  +L++W+D GH+ L F+Q + MLDI+E FL V GG+  RRMDG TP+K+R
Sbjct  670   ERSGKMKVLKGLLEVWRDTGHKTLLFTQGRLMLDIIEKFLGVLGGFNCRRMDGTTPIKER  729

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
              +L+++FNN   I +F+LTTRVGG+G NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  730   QSLVNDFNNDPNIHVFLLTTRVGGIGVNLTGADRVIIYDPDWNPSTDLQARERAWRLGQK  789

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             +DVT++RL+T+GTIEEK+YHRQI+K  LTNKI ++P QR  F+  DL DLF L D+ ++ 
Sbjct  790   RDVTIFRLMTKGTIEEKIYHRQIFKQFLTNKITRDPHQREGFQLSDLYDLFTLTDENDD-  848

Query  2885  STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPAD----------HGTA-MERDNNSG  3031
               E++ +F    +D  +T  +    +K  S K+ PA           HG A +E   N+ 
Sbjct  849   ELETTKLF----KDAEVTYQEEAKDDKRGS-KSKPARTPEEDDINDIHGIAKVEEFQNTA  903

Query  3032  SNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH---DEEKLKLEEQASRV  3202
                EEK    N    ED  I+  +F   G+HSA+ H+ IVN       +   +E +A RV
Sbjct  904   E--EEK----NAKTSED-RIMHGIFARSGVHSAVQHEQIVNGKRVLRADPKMIEAEARRV  956

Query  3203  AQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEES  3382
             A  AAE LR++        + +PTWTGR G  G      +  GS+  P     S     S
Sbjct  957   ADEAAEELRKAEETARALPIGLPTWTGRFGMGGREDP--RAAGSSARPAGAGPS-----S  1009

Query  3383  SMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAA  3562
             S + +R N  AA A+                              Q +SGS S S     
Sbjct  1010  SDLLARLNPAAAAAAG-----------------------------QRSSGSDSPS-----  1035

Query  3563  ENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS-KDLALFKNLL  3739
                 +R   G   M    LIR    F+  + G T S +IV HF     + + +A F+  L
Sbjct  1036  ----ARMPRGKDFMP---LIRD---FLASQRGPTLSQAIVHHFNHYCSNPQRVAEFQESL  1085

Query  3740  KEIATLK--KNPNGSFWILKPEY  3802
             K++ATL+  ++  G  W LKPE+
Sbjct  1086  KKVATLEHGRDRRGR-WTLKPEF  1107



>gb|EAS29452.2| DNA repair and recombination protein RAD26 [Coccidioides immitis 
RS]
Length=1213

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/864 (43%), Positives = 526/864 (61%), Gaps = 65/864 (8%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L+GG +IP  I+  LFDYQK GVQWLWEL+ Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  392   PDSVLDGGYRIPGDIYPYLFDYQKTGVQWLWELYQQRVGGIIGDEMGLGKTIQVIAFLAG  451

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S     P I+VCP T+++QW  E  +W+P   V ILH S +   + KK S++ ++ +
Sbjct  452   LHYSKKLDAPIIVVCPPTVMKQWVNEFHRWWPPLRVSILHTSGSGMINIKKESRAEDTLT  511

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +   +  K+   ++  VL  D  +L+TTY  L+     L+ ++WG A+
Sbjct  512   SEIWDPYRPTRMSGGQKAAKR---ILKRVL-EDGHVLVTTYAGLQTYTSLLIPVDWGCAI  567

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  568   LDEGHKIRNPDTAITIHCKELRTPHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  627

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKKTE V+FC
Sbjct  628   NQFEFPIRAGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKTEQVLFC  687

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCR--DPDYG  2341
              LT +QR+ Y+AFL+S ++  I  G ++ L+G+D++RKICNHPDL E +   +  + +YG
Sbjct  688   KLTKLQRAAYEAFLSSNEMSAIMRGRRDVLFGVDILRKICNHPDLPEHKTLSQKANYNYG  747

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             N  +SGKM+VV  +L+LW+D GH+ L F+Q + MLDILE F+ +  G+ YRRMDG TP+K
Sbjct  748   NSAKSGKMQVVKALLELWRDTGHKTLLFAQHRIMLDILEKFIKSLTGFNYRRMDGNTPIK  807

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R  ++DEFNN  +I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  808   VRQGMVDEFNNDPDIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDLQARERAWRLG  867

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F+  DL DLF L   G+
Sbjct  868   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFQMSDLHDLFTL---GD  924

Query  2879  NGSTESSSIFSQL-------SEDVNITGPQHPDQEKDKSIKTNPADHGTAMER-DNNSGS  3034
             NG TE+S +F +        S+    T     ++E+ +  K +      A+E+  + +G+
Sbjct  925   NGPTETSKMFQEAGVTFQENSKHEKGTKESKVEEERKEKDKISKVTGVAALEQYQSATGT  984

Query  3035  NGEEKADNNNGDVDE-DTSILRTLFDAHGIHSAMDHDAIVNAHDE----EKLKLEEQASR  3199
               E   +         D  ++ T+F   G+HSA++H+ I N        +   +E +A R
Sbjct  985   PTETDGETKRTAASHSDARLMETIFARSGVHSALEHEQIFNGRKRSVKADPKIIEAEAKR  1044

Query  3200  VAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEE  3379
             VA  AA+ L +++ +     V  PTWTG+ GTAG P          ++P     + P+  
Sbjct  1045  VAAEAAKELLKAQEVARTVPVGTPTWTGQFGTAGRP----------VDPTAPRGTMPVYA  1094

Query  3380  SSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRA  3559
                 S  R                     + G    +I   L   ++     SS+ R   
Sbjct  1095  GGGGSVARR-------------------TMHGPSSASIIANL--TNRTTGQHSSSGRNSP  1133

Query  3560  AENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS-KDLALFKNL  3736
             A +G S P     G    V+IR    +I  +GG+  +  +V+HF     S +  A FK +
Sbjct  1134  ARSGTSTPR----GKDFMVMIRD---YITAQGGAVYTQMLVDHFNRFCDSPRATAEFKEI  1186

Query  3737  LKEIATLKKN--PNGSFWILKPEY  3802
             L+ IA L+K        W+L+PEY
Sbjct  1187  LRTIAVLEKTGRQGRGKWVLRPEY  1210



>ref|XP_006676526.1| hypothetical protein BATDEDRAFT_9561, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF82797.1| hypothetical protein BATDEDRAFT_9561, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=912

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/680 (48%), Positives = 454/680 (67%), Gaps = 29/680 (4%)
 Frame = +2

Query  1280  MLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHF  1459
             ++  G  +P  ++  LF YQ+  V+WLWEL+CQ+ GG++GDEMGLGKT+Q+++FL  L F
Sbjct  230   VIHKGYCVPGDVYRHLFPYQRTCVKWLWELYCQEVGGLVGDEMGLGKTIQIISFLAGLGF  289

Query  1460  SNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILH-------------DSVNDFhdkk  1597
             S   K P IIVCP T+L+QW +E  KW+P F V ILH             DS + +   +
Sbjct  290   SRLLKGPVIIVCPATVLRQWVQEFHKWWPPFRVAILHSTGSGLGSEAHDRDSESTYMSDE  349

Query  1598  kgsksh-esdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGE  1774
                  +       ++        +   ++  K   L+ +++  +  +L+TTY  +R+  +
Sbjct  350   SEENEYFLDKKRPKKKGKRSDTLHYPIKSKSKARALVANIV-KNGHVLVTTYAAIRIHAD  408

Query  1775  KLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVF  1954
              LL ++W Y VLDEGH+IRNP+++VT+ CK+ +T HRII++G+PIQN L ELWS++DFVF
Sbjct  409   ILLPVKWAYCVLDEGHKIRNPDSEVTMACKRFKTPHRIILSGTPIQNNLIELWSIYDFVF  468

Query  1955  PGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQ  2134
             PG+LG LPVF+ +FA PI++GGYANA  +QV TAY+CA +LRD+I PYLLRRMK+DV   
Sbjct  469   PGRLGTLPVFQTQFATPINLGGYANANNVQVQTAYKCACILRDMISPYLLRRMKSDVATD  528

Query  2135  LPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLERE  2314
             LPKK+E V+FC L+  QR  Y+ FL+S +++ I +G    L GIDV+RKICNHPDLLER 
Sbjct  529   LPKKSEQVLFCRLSDAQRREYEKFLSSKELKGILEGKLRILAGIDVLRKICNHPDLLERN  588

Query  2315  HSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRR  2494
             ++    +YG   RSGKM VV  +L++WK QGHRVL F QT+QMLDILE F+   GY Y R
Sbjct  589   NADFSANYGAVSRSGKMIVVKALLQMWKRQGHRVLLFCQTRQMLDILELFIKNEGYAYLR  648

Query  2495  MDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQA  2674
             MDG+T ++QR  ++D +N     F+F+LTT+VGGLG NLT ANRVIIFDPDWNPS DMQA
Sbjct  649   MDGSTSIQQRSKIVDCYNEDESYFVFLLTTKVGGLGINLTSANRVIIFDPDWNPSTDMQA  708

Query  2675  RERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDL  2854
             RERAWR+GQKK VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QRR FK+ DL DL
Sbjct  709   RERAWRLGQKKSVTIYRLMTSGTIEEKIYHRQIFKQFLTNKILKDPRQRRFFKSNDLHDL  768

Query  2855  FVLNDDGENGSTESSSIFSQLSEDVN-----ITGPQHPDQEKDKSIKTNPADHGTAMERD  3019
             F+L    E+ +TE+ ++F  +  +V+       G      ++ K  +    D    +   
Sbjct  769   FMLGSK-EDDTTETGNLFEGMDVEVHAGSSGANGALSSHTKRTKKPRRPYCDTQAELNTI  827

Query  3020  NNSGSNGEEK--ADNNNGDV-----DEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK  3178
                    E K   +++N ++     D+D+ IL+ LF   G+HSA+ HDAI+ A   E L 
Sbjct  828   QGIAKVDEYKPTPESSNQNLTNPYNDDDSGILQALFSKTGVHSALKHDAIMEASTPEALI  887

Query  3179  LEEQASRVAQRAAEALRQSR  3238
             +E++A++VA  A  AL++SR
Sbjct  888   VEKEATKVANDAIAALKKSR  907



>gb|EHN06219.1| Rad26p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=1085

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/706 (50%), Positives = 466/706 (66%), Gaps = 51/706 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  I+  LF+YQK  VQWL+EL+ Q  GGIIGDEMGLGKT+QV+AF+ +
Sbjct  279   PDAKLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAA  338

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E   W+P     ILH   +     +K         
Sbjct  339   LHHSGLLTGPVLIVCPATVMKQWCNEFHHWWPPLRTVILHSMGSGMASDQKFKMDENDLE  398

Query  1628  eseelldvdvekNLSFRN---TKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEK  1777
                            ++N   TKK        DKLI+ V+ +D  +LITTY  LR+  +K
Sbjct  399   NLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVV-TDGHILITTYVGLRIHSDK  457

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP+++++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  458   LLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFP  517

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI+IG YANAT +QV T Y+CAV LRDLI PYLLRR+KADV   L
Sbjct  518   GKLGTLPVFQQQFVIPINIGCYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDL  577

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P+K E V+FC LT  QRS Y  FL S+D+ QI +G +N L+GID++RKICNHPDLL+R+ 
Sbjct  578   PQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDT  637

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGY  2482
                +PDYG+P+RSGKM+VV ++L LW  QG++ L F+Q++QMLDILE F+ T        
Sbjct  638   KRHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL  697

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIF-IFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
              Y RMDG T +K R +L+D FNN  E F +F+LTTRVGGLG NLTGANR+IIFDPDWNPS
Sbjct  698   NYLRMDGTTNIKGRQSLVDRFNN--ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS  755

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTN+IL +P+Q+R FK  
Sbjct  756   TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIH  815

Query  2840  DLKDLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER  3016
             +L DLF L   GENG STE      +L+E+V         Q+  +++K + ++     E+
Sbjct  816   ELHDLFSLG--GENGYSTE------ELNEEV---------QKHTENLKNSKSEESDDFEQ  858

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH--DE  3166
               N        S  NG+EK +N+    ++D  I   L     + + M HD++VN+H    
Sbjct  859   LVNLSGVSKLESFYNGKEKKENSK--TEDDRLIEGLLGGESNLETVMSHDSVVNSHAGSS  916

Query  3167  EKLKLEEQASRVAQRAAEALRQSR-MLRSQESVAIPTWTGRSGTAG  3301
                 + ++ASRVA  A  ALR+SR  +  Q  +  PTWTGR G AG
Sbjct  917   SSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGKAG  962



>ref|XP_001643913.1| hypothetical protein Kpol_1067p28 [Vanderwaltozyma polyspora 
DSM 70294]
 gb|EDO16055.1| hypothetical protein Kpol_1067p28 [Vanderwaltozyma polyspora 
DSM 70294]
Length=1053

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/897 (42%), Positives = 539/897 (60%), Gaps = 83/897 (9%)
 Frame = +2

Query  827   ETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQDNGDLVSTSLANAIQSISEAAQ  1006
             E+E D L+R G +T F    GF+ + +E   S    + DN       LAN  Q +   + 
Sbjct  127   ESEHDYLIRTGQITAFGSKTGFKLENEE---SDLEHISDN----DFKLANQ-QMVENISD  178

Query  1007  SRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRND-----KRKRRPTPGKKWR  1171
                   +LD +    ++     F+T    V+I       R+D      +KR     KKW 
Sbjct  179   KSDGEYVLDGNE-EDIDFIEDEFETNEDLVEIKSQPGETRDDGDELVYQKRL----KKWI  233

Query  1172  VKVSRENK-DEGPDVEISSYedekddedmddeGPPFV---MLEGGLKIPETIFDKLFDYQ  1339
              + S + K D+ PD+                +  P +    L    +IP  I+  LF+YQ
Sbjct  234   QQRSSDRKVDKYPDL------------PEWRKPHPHISDAKLNDEFRIPGDIYSLLFNYQ  281

Query  1340  KVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYK-PSIIVCPLTLLQQW  1516
             K  VQWL+EL+ QK GGIIGDEMGLGKT+Q++A+L SLH S     P +IVCP T+++QW
Sbjct  282   KTCVQWLYELNQQKCGGIIGDEMGLGKTIQIIAYLASLHHSGLLDGPILIVCPATVMKQW  341

Query  1517  KREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLS--------  1672
               E   W+P     ILH        KKK S+    +               +        
Sbjct  342   CNELHHWWPPLRTVILHAMGAGMSAKKKISEEELENLIMTSNAADFSYDEFTSSSKVKSQ  401

Query  1673  FRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVT  1852
               +++   +LI+ V+ +D  ++ITTY  LRL  +KLL + W YAVLDEGH+IRNP+++++
Sbjct  402   LESSRSIQELIDKVV-NDGHVIITTYVGLRLHSDKLLKVNWSYAVLDEGHKIRNPDSEIS  460

Query  1853  LVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANA  2032
             L CK+L+T +RII++G+PIQN L+ELWSLFDF+FPGKLG LPVF+ +F +PI++GGYANA
Sbjct  461   LTCKKLRTRNRIILSGTPIQNNLNELWSLFDFIFPGKLGTLPVFQQQFVMPINMGGYANA  520

Query  2033  TPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLA  2212
             T +QV T Y+CAV LRDL+ PYLLRR+KADV   LP K E V+FC LT  QR+ Y  FL 
Sbjct  521   TNIQVQTGYKCAVALRDLVSPYLLRRIKADVAKDLPDKREMVLFCKLTQFQRNKYIEFLN  580

Query  2213  STDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKL  2392
             S ++ QI +G +  LYGID++RKICNHPDLLE+E+   +  YG+P+RSGKM+VV ++L L
Sbjct  581   SKELGQIQNGKRQVLYGIDILRKICNHPDLLEKENRTLNKAYGDPKRSGKMQVVKQLLLL  640

Query  2393  WKDQGHRVLFFSQTQQMLDILENFLV-----TGGYKYRRMDGATPVKQRMALIDEFNNTV  2557
             WK +GH+ L F+Q++QMLD+LE+F+        G+KY RMDG T +  R +L+D+FNN  
Sbjct  641   WKKEGHKTLLFTQSRQMLDVLEDFISFKDEDLKGFKYLRMDGTTNISHRQSLVDKFNNE-  699

Query  2558  EIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITR  2737
                +F+LTTRVGGLG NLTGA+R+IIFDPDWNPS DMQARERAWRIGQK++V++YRL+  
Sbjct  700   NYDVFLLTTRVGGLGVNLTGADRIIIFDPDWNPSTDMQARERAWRIGQKREVSIYRLLIT  759

Query  2738  GTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQL  2917
             GTIEEK+YHRQ++K  LTNKIL +P+Q+R FK  +L DLF L  D   G+        QL
Sbjct  760   GTIEEKIYHRQLFKQFLTNKILTDPKQKRFFKMNELHDLFSLGSDSGYGT-------DQL  812

Query  2918  SEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNN--------SGSNGEEKADNNNGDV  3073
             +E+V     +H D     ++K++  +     E+  N        S  NG+EK + +    
Sbjct  813   NEEVQ----KHTD-----ALKSSRTEESDDFEQVVNIAGVSKLESFYNGKEKLEKSKT--  861

Query  3074  DEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK-LEEQASRVAQRAAEALRQSRMLRS  3250
              ED  ++  L   + + SA  H+ ++N+H +     +E +A++VA +A  AL++SR    
Sbjct  862   -EDDRLMEGLLGDNFVESAKSHEEMINSHAKSSFTIIEREATKVANQAINALKESRKATK  920

Query  3251  QESVAIPTWTGRSGTAG---APPSIKKKFG--STLNPQLVTSSKPLEESSMISSRRN  3406
             +  V  PTWTG+ G AG    P   K KFG  S  + Q++ + K  ++ + I S+ N
Sbjct  921   KYKVGTPTWTGKFGKAGKIIKPVQSKNKFGKPSIGSQQILANIKQTQKEASIQSKIN  977



>ref|XP_002618591.1| hypothetical protein CLUG_02050 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ37927.1| hypothetical protein CLUG_02050 [Clavispora lusitaniae ATCC 42720]
Length=1186

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/873 (44%), Positives = 516/873 (59%), Gaps = 104/873 (12%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
              +L+   ++P  I   LF+YQK  VQWLWEL+CQK GGI+GDEMGLGKT+QV+AFL  LH
Sbjct  385   AVLDSRFRLPGDIHPALFEYQKTCVQWLWELYCQKTGGILGDEMGLGKTIQVIAFLAGLH  444

Query  1457  FSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             +S    KP ++V P T++ QW  E  +W+P     ILH   +   +  +  +  E   + 
Sbjct  445   YSGLLDKPVLLVVPATVMNQWVNEFHRWWPPLRCVILHSIGSGMKNMARMEEELEEHLDE  504

Query  1634  eelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLD  1813
             E   ++ V    +  N  +   ++  VL     +L+TTY  LR+  + +L  EWGYAVLD
Sbjct  505   EGEGELSVRAANAQANASE---MVQRVL-QHGHVLVTTYVGLRVYAKHILPHEWGYAVLD  560

Query  1814  EGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAE  1993
             EGH+IRNPN+ ++L CK+++T +R+I++G+PIQN L ELWSLFDFVFPG+LG LPVFE +
Sbjct  561   EGHKIRNPNSAISLACKRIKTHNRVILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFEQQ  620

Query  1994  FAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSL  2173
             FA+PI++GGYANA+ LQV T Y+CAVVLRDLI PYLLRR+KADV   LPKK+E V+F  L
Sbjct  621   FAIPINMGGYANASNLQVQTGYKCAVVLRDLISPYLLRRLKADVAQDLPKKSEMVLFVKL  680

Query  2174  TSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSC--RDPDYGNP  2347
             T  Q  +Y+ FL S D   I  G +  L G+D++RKICNHPDL++R      +  +YG+P
Sbjct  681   TQYQHDMYEKFLGSEDAAAIMKGRRRVLMGVDILRKICNHPDLVDRTALLHKKGYNYGSP  740

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV------------TGGYKYR  2491
              RSGKM+V  ++L+LW+ QGHR L F QT+QMLDILE F+             +   +Y 
Sbjct  741   ARSGKMQVARQLLQLWQAQGHRTLLFCQTRQMLDILERFVARMSCIDAQGAETSNPMRYL  800

Query  2492  RMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQ  2671
             RMDG+TP+ +R  L+D FN      +F+LTT+VGGLG NLTGA+RVIIFDPDWNPS D+Q
Sbjct  801   RMDGSTPIGKRQQLVDTFNANEYYHVFLLTTKVGGLGVNLTGADRVIIFDPDWNPSTDIQ  860

Query  2672  ARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKD  2851
             ARERAWR+GQK+D+T+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QRR FK+ DL D
Sbjct  861   ARERAWRLGQKRDITIYRLMTAGTIEEKIYHRQIFKTFLTNKILKDPKQRRFFKSADLHD  920

Query  2852  LFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADH---GTAMERDN  3022
             LF L D  E G TE++ +F+    +   +G +     + +    N  D     T M    
Sbjct  921   LFTLGDPDEKG-TETAEMFN--GSEKTFSGTKDRQSRRLEGGPKNDDDLYRVATLM----  973

Query  3023  NSGSNGEEKADNNNGDVD------EDTSILRTLFDAHGIHSAMDHDAIV-NAHDEEKLKL  3181
                  G  K D   GD D      ED  ++  LF   G+HSA+ HD IV   H EE L  
Sbjct  974   -----GVSKLDKFAGDDDEKNGAKEDDRLMEGLFS--GVHSALQHDEIVGQTHSEESLA-  1025

Query  3182  EEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTS  3361
             E++A+RVA+ AA ALR+SR+   + ++  PTWTG+ G AG     KK  G    P  V S
Sbjct  1026  EKEANRVAKEAAAALRKSRLAARKTAIGTPTWTGKFGVAGRFGPKKKANG----PLKVPS  1081

Query  3362  SKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSS  3541
             S    E+S+ S+                              AI   L  +        S
Sbjct  1082  ST--NENSLSST------------------------------AILGELRQRRSVPEREPS  1109

Query  3542  NSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRV---PSK  3712
             NSR                    ++L R V   ++  GG   S  I+      V     K
Sbjct  1110  NSRQ-------------------DLLERIVGVLMKEPGGFAKSGKILGALSKLVDLKQEK  1150

Query  3713  DLALFKNLLKEIATLKKNPNGSFWILKPEYQEE  3811
             +L + ++LL+E+A  +K+  G  W LK E ++E
Sbjct  1151  ELVMVRSLLREVADWQKDEKG--WKLKSELKDE  1181



>emb|CCG84055.1| protein of unknown function [Taphrina deformans PYCC 5710]
Length=1164

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/683 (51%), Positives = 453/683 (66%), Gaps = 47/683 (7%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
               GG ++P  I   LFDYQK  VQWLWELH Q  GGIIGDEMGLGKTVQV++FL  LH S
Sbjct  407   FSGGFRVPGDIHPSLFDYQKTCVQWLWELHSQGCGGIIGDEMGLGKTVQVISFLAGLHHS  466

Query  1463  -NAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
              N   P +IV P T+++ W +E  KW+P   V ILH S                      
Sbjct  467   KNLRGPVLIVAPATVMKMWVKEFHKWWPPLRVCILHSS----------------------  504

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                 +  K+ S R   +   +++ V+ S+  +L+TTY  L    E +  + W YAVLDEG
Sbjct  505   ---GEASKSGSMRKAAR--DVVDKVV-SEGHVLVTTYSGLTTYQEIMNPVAWSYAVLDEG  558

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP+ +V+L  KQL+TVHRII++G+PIQN L+ELWSLFDFVFPG+LG LP+F  +FA
Sbjct  559   HKIRNPDAEVSLAAKQLRTVHRIILSGTPIQNNLTELWSLFDFVFPGRLGTLPIFHTQFA  618

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYANA+ +QV TAY+CA VLRDLI PYLLRRMKADV A LPKK+E V+FC LT 
Sbjct  619   LPINIGGYANASNVQVQTAYKCACVLRDLINPYLLRRMKADVAADLPKKSEQVLFCKLTD  678

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDY--GNPER  2353
              QR  Y+ FLAS D++ I +G +  LYG+DV+RKICNHPDL +R+   +   Y  G+P +
Sbjct  679   QQREEYEIFLASGDMDSILNGKRQVLYGVDVLRKICNHPDLTQRDVLLQKKGYNFGDPSK  738

Query  2354  SGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQRMA  2530
             SGKM VV  +L+LWK+QGHR L F+Q +QMLDIL+ ++ +   +K  RMDG TP+ QR  
Sbjct  739   SGKMVVVKALLELWKNQGHRTLLFTQGRQMLDILQKYVSSLDSFKSLRMDGTTPISQRQV  798

Query  2531  LIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKD  2710
             L+D+FNN   I +F+LTTRVGGLG NLTGA+RVIIFDPDWNPS D+QARERAWR+GQK++
Sbjct  799   LVDDFNNNTSIDVFLLTTRVGGLGVNLTGADRVIIFDPDWNPSTDVQARERAWRLGQKRE  858

Query  2711  VTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGST  2890
             VT+YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QRR FK  DL DLF L  +  +G T
Sbjct  859   VTIYRLMTSGTIEEKIYHRQIFKQFLTNKILRDPKQRRFFKMNDLHDLFTLGSENVDG-T  917

Query  2891  ESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPA---DHGTAMERDNNSG------SNGE  3043
             E+  +F   +E        H D E  K+ +T      D+G      +  G      + G 
Sbjct  918   ETGDMFLG-TETTYKKKTSHNDGEDGKTSETRKKRRQDNGDDPRMLSQIGGVAGLENFGN  976

Query  3044  EKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEA  3223
              +A+   G    D ++L ++F   G+ S + HD I++A   E L ++ +A RVA+ AA A
Sbjct  977   FEAEQQTG----DQNVLESIFSKSGVQSTLQHDQIMDAARPEILLVDREAERVAKAAAAA  1032

Query  3224  LRQSRMLRSQESVAIPTWTGRSG  3292
             L+QSR    +  +  PT+TGR G
Sbjct  1033  LKQSRRETQRNPIGTPTFTGRFG  1055



>gb|EGA82189.1| Rad26p [Saccharomyces cerevisiae Lalvin QA23]
Length=1085

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/706 (50%), Positives = 465/706 (66%), Gaps = 51/706 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  I+  LF+YQK  VQWL+EL+ Q  GGIIGDEMGLGKT+QV+AF+ +
Sbjct  279   PDAKLNNQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAA  338

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E   W+P     ILH   +     +K         
Sbjct  339   LHHSGLLTGPVLIVCPATVMKQWCNEFHHWWPPLRTVILHSMGSGMASDQKFKMDENDLE  398

Query  1628  eseelldvdvekNLSFRN---TKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEK  1777
                            ++N   TKK        DKLI+ V+ +D  +LITTY  LR+  +K
Sbjct  399   NLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVV-TDGHILITTYVGLRIHSDK  457

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP+++++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  458   LLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFP  517

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI+IG YANAT +QV T Y+CAV LRDLI PYLLRR+KADV   L
Sbjct  518   GKLGTLPVFQQQFVIPINIGXYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDL  577

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P K E V+FC LT  QRS Y  FL S+D+ QI +G +N L+GID++RKICNHPDLL+R+ 
Sbjct  578   PXKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDT  637

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGY  2482
                +PDYG+P+RSGKM+VV ++L LW  QG++ L F+Q++QMLDILE F+ T        
Sbjct  638   KRHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL  697

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIF-IFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
              Y RMDG T +K R +L+D FNN  E F +F+LTTRVGGLG NLTGANR+IIFDPDWNPS
Sbjct  698   NYLRMDGTTNIKGRQSLVDRFNN--ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS  755

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTN+IL +P+Q+R FK  
Sbjct  756   TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIH  815

Query  2840  DLKDLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER  3016
             +L DLF L   GENG STE      +L+E+V         Q+  +++K + ++     E+
Sbjct  816   ELHDLFSLG--GENGYSTE------ELNEEV---------QKHTENLKNSKSEESDDFEQ  858

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH--DE  3166
               N        S  NG+EK +N+    ++D  I   L     + + M HD++VN+H    
Sbjct  859   LVNLSGVSKLESFYNGKEKKENSK--TEDDRLIEGLLGGESNLETVMSHDSVVNSHAGSS  916

Query  3167  EKLKLEEQASRVAQRAAEALRQSR-MLRSQESVAIPTWTGRSGTAG  3301
                 + ++ASRVA  A  ALR+SR  +  Q  +  PTWTGR G AG
Sbjct  917   SSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGKAG  962



>gb|EPY50589.1| SNF2 family helicase Rhp26 [Schizosaccharomyces cryophilus OY26]
Length=991

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/730 (49%), Positives = 472/730 (65%), Gaps = 47/730 (6%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
              EGG  +P  I   LF YQ   VQWLWEL+ Q+AGGIIGDEMGLGKT+Q+++FL SLH S
Sbjct  277   FEGGFTVPGDIRPHLFRYQVTCVQWLWELYSQEAGGIIGDEMGLGKTIQIVSFLSSLHHS  336

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
               Y KP++IVCP TL++QW  E  +W+    V +LH + +     ++  +    + E   
Sbjct  337   RMYEKPALIVCPATLMKQWVNEFHQWWGPLRVVVLHATGSGALATREKRQYRSLEEEDTV  396

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                 +V  N S ++   + K +   + ++  +LITTY  LRL  + LL  EWGY VLDEG
Sbjct  397   EEAANVNPNAS-KSFHSYAKALVDSVFTEGHVLITTYAGLRLYSDLLLPREWGYCVLDEG  455

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++++++ CKQ++T HRII++G+PIQN L ELW+LFDFVFPG+LG LPVF+ +FA
Sbjct  456   HKIRNPDSEMSVNCKQVRTPHRIILSGTPIQNNLIELWNLFDFVFPGRLGTLPVFQNQFA  515

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI+IGGYANA+ +QV TAY+CA +LRDLI PYLLRRMK DV A LPKK+E V+FC LT 
Sbjct  516   LPINIGGYANASNVQVQTAYKCACMLRDLISPYLLRRMKLDVAADLPKKSEQVLFCKLTP  575

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPD--YGNPER  2353
             +QR  YQ FL  +D+++I +G +  LYGID++RKICNHPDL+ RE   +  D  YG+P++
Sbjct  576   LQRKAYQDFLNGSDMQKILNGKRQMLYGIDILRKICNHPDLVVREFLSQKKDYHYGDPKK  635

Query  2354  SGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV-TGGYKYRRMDGATPVKQRMA  2530
             SGK++VV  +L+LWK Q HR L FSQT+QMLDILEN +      +Y RMDG T +  R  
Sbjct  636   SGKLEVVNSLLQLWKKQKHRTLLFSQTRQMLDILENSIKGIPEIRYCRMDGGTSIGLRQG  695

Query  2531  LIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKD  2710
             L+D FN      +F+LTTRVGGLG NLTGA+RVI+FDPDWNPS D QARERAWR+GQKKD
Sbjct  696   LVDNFNKNDIYDVFLLTTRVGGLGINLTGADRVILFDPDWNPSTDAQARERAWRLGQKKD  755

Query  2711  VTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGST  2890
             V VYRL+T GTIEEK+YHRQI+K  LTNKILK+P+QRR FK  DL DLF L +D E G T
Sbjct  756   VVVYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRRFFKMTDLHDLFSLGNDKEEG-T  814

Query  2891  ESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDN----------------  3022
             E+ ++F   +E V    P   D+EK K  ++     G   +  N                
Sbjct  815   ETGNMFLG-AERVFKKQPSSHDEEKSKKQRSREDVEGNPQKDKNRKVFDKIGIASIEKFK  873

Query  3023  ---NSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQA  3193
                +SG      + N +G    D S+L  +F + GI S + HD I+ A   E L +E++A
Sbjct  874   PPEDSGVTKPTSSKNTHG----DESVLDDIFASAGIQSTLKHDEIMEASQPETLLVEKEA  929

Query  3194  SRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSK--  3367
             S+VA  A  A+  SR  R Q S         +    APPS+     S+      TSSK  
Sbjct  930   SKVANDALRAVANSR--RQQLSA--------NRNRAAPPSM----NSSRQNSASTSSKAS  975

Query  3368  -PLEESSMIS  3394
              P+  S++++
Sbjct  976   GPVNSSTLLA  985



>emb|CAY80752.1| Rad26p [Saccharomyces cerevisiae EC1118]
Length=1085

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/706 (50%), Positives = 465/706 (66%), Gaps = 51/706 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  I+  LF+YQK  VQWL+EL+ Q  GGIIGDEMGLGKT+QV+AF+ +
Sbjct  279   PDAKLNNQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAA  338

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E   W+P     ILH   +     +K         
Sbjct  339   LHHSGLLTGPVLIVCPATVMKQWCNEFHHWWPPLRTVILHSMGSGMASDQKFKMDENDLE  398

Query  1628  eseelldvdvekNLSFRN---TKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEK  1777
                            ++N   TKK        DKLI+ V+ +D  +LITTY  LR+  +K
Sbjct  399   NLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVV-TDGHILITTYVGLRIHSDK  457

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP+++++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  458   LLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFP  517

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI+IG YANAT +QV T Y+CAV LRDLI PYLLRR+KADV   L
Sbjct  518   GKLGTLPVFQQQFVIPINIGCYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDL  577

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P K E V+FC LT  QRS Y  FL S+D+ QI +G +N L+GID++RKICNHPDLL+R+ 
Sbjct  578   PPKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDT  637

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGY  2482
                +PDYG+P+RSGKM+VV ++L LW  QG++ L F+Q++QMLDILE F+ T        
Sbjct  638   KRHNPDYGDPKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHL  697

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIF-IFILTTRVGGLGTNLTGANRVIIFDPDWNPS  2659
              Y RMDG T +K R +L+D FNN  E F +F+LTTRVGGLG NLTGANR+IIFDPDWNPS
Sbjct  698   NYLRMDGTTNIKGRQSLVDRFNN--ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS  755

Query  2660  NDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKAR  2839
              DMQARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTN+IL +P+Q+R FK  
Sbjct  756   TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIH  815

Query  2840  DLKDLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMER  3016
             +L DLF L   GENG STE      +L+E+V         Q+  +++K + ++     E+
Sbjct  816   ELHDLFSLG--GENGYSTE------ELNEEV---------QKHTENLKNSKSEESDDFEQ  858

Query  3017  DNN--------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH--DE  3166
               N        S  NG+EK +N+    ++D  I   L     + + M HD++VN+H    
Sbjct  859   LVNLSGVSKLESFYNGKEKKENSK--TEDDRLIEGLLGGESNLETVMSHDSVVNSHAGSS  916

Query  3167  EKLKLEEQASRVAQRAAEALRQSR-MLRSQESVAIPTWTGRSGTAG  3301
                 + ++ASRVA  A  ALR+SR  +  Q  +  PTWTGR G AG
Sbjct  917   SSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGKAG  962



>gb|EPX70945.1| SNF2 family helicase Rhp26 [Schizosaccharomyces octosporus yFS286]
Length=989

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/670 (51%), Positives = 450/670 (67%), Gaps = 24/670 (4%)
 Frame = +2

Query  1286  EGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSN  1465
             +GG  IP  I   LF YQ   VQWLWEL+ Q+AGGIIGDEMGLGKT+Q+++F+ SLH S 
Sbjct  278   KGGFTIPGDIRPHLFRYQVTCVQWLWELYSQEAGGIIGDEMGLGKTIQIVSFISSLHHSR  337

Query  1466  AY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseel  1642
              Y KP++IVCP TL++QW  E  +W+    V +LH + +     ++  +    + E    
Sbjct  338   MYEKPALIVCPATLMKQWVNEFHQWWGPLRVVVLHATGSGAVATREKRQYQSLEEEDNAE  397

Query  1643  ldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGH  1822
               ++   + SF +  K   L++ V  +   +LITTY  LRL  + LL  EWGY VLDEGH
Sbjct  398   DVINPNASKSFHSYAK--ALVDSVF-TKGHVLITTYAGLRLYSDLLLPREWGYCVLDEGH  454

Query  1823  RIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAV  2002
             +IRNP++++++ CKQ++T HRII++G+PIQN L ELW+LFDFVFPG+LG LPVF+ +FA+
Sbjct  455   KIRNPDSEMSVNCKQVKTPHRIILSGTPIQNNLIELWNLFDFVFPGRLGTLPVFQNQFAL  514

Query  2003  PISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSV  2182
             PI+IGGYANA+ +QV TAY+CA +LRDLI PYLLRRMK DV + LPKK+E V+FC LT +
Sbjct  515   PINIGGYANASNVQVQTAYKCACMLRDLISPYLLRRMKLDVASDLPKKSEQVLFCKLTPL  574

Query  2183  QRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPD--YGNPERS  2356
             QR  YQ FL  +D+++I +G +  LYGID++RKICNHPDL+ RE   +  D  YG+PE+S
Sbjct  575   QRKAYQDFLNGSDMQKILNGKRQMLYGIDILRKICNHPDLVMREFMSQKKDYYYGDPEKS  634

Query  2357  GKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV-TGGYKYRRMDGATPVKQRMAL  2533
             GK+KVV  +LKLWK Q HR L FSQT+QMLDILE  +    G +Y RMDG T +  R  L
Sbjct  635   GKLKVVISLLKLWKKQKHRTLLFSQTRQMLDILETSIKDIPGLRYCRMDGGTSIGLRHGL  694

Query  2534  IDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDV  2713
             +D FN      +F+LTTRVGGLG NLTGA+RVI+FDPDWNPS D QARERAWR+GQK+DV
Sbjct  695   VDNFNKNGIYDVFLLTTRVGGLGINLTGADRVILFDPDWNPSTDAQARERAWRLGQKRDV  754

Query  2714  TVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTE  2893
              VYRL+T GTIEEK+YHRQI+K  LTNKILK+P+QRR FK  DL DLF L  D E G TE
Sbjct  755   VVYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRRFFKMTDLHDLFSLGSDKEEG-TE  813

Query  2894  SSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNS-----GSNGEEK---  3049
             + ++F  + E V    P+  ++E  +  K+     G + E  N       G    EK   
Sbjct  814   TGNMFLGV-ERVFKKHPKGNEEEGSRKQKSRKEVDGKSSEEKNRKVFDKIGIASMEKFKP  872

Query  3050  -------ADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQ  3208
                     D ++ +   D S+L  +F + GI S + HD I+ A   E L +E++AS+VA 
Sbjct  873   PEDTNVTKDKSSKNTRGDESVLEDIFASAGIQSTLKHDEIMEASQPETLLVEKEASKVAN  932

Query  3209  RAAEALRQSR  3238
              A  A+  SR
Sbjct  933   EALRAVANSR  942



>ref|XP_003169974.1| DNA repair and recombination protein RAD26 [Microsporum gypseum 
CBS 118893]
 gb|EFR05139.1| DNA repair and recombination protein RAD26 [Microsporum gypseum 
CBS 118893]
Length=1226

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/877 (43%), Positives = 526/877 (60%), Gaps = 65/877 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L+GG ++P  I   LFDYQK GV+WLWEL+ Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  379   PDTVLDGGYQLPGDIHPYLFDYQKTGVKWLWELYQQQVGGIIGDEMGLGKTIQVIAFLAG  438

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             +H+S   K P I+VCP T+++QW  E  +W+P F V ILH S +   + K  S++ +  +
Sbjct  439   IHYSKKLKGPIIVVCPPTVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIKSESQAEDRYT  498

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                           S R  K   +++  VL  D  +L+TTY  L+     L+ ++WG AV
Sbjct  499   SGVWGDRNAT----SQRGNKAARRILKRVL-EDGHVLVTTYAGLQTYSSLLIPVDWGIAV  553

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  554   LDEGHKIRNPDTSITIHCKELRTSHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  613

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F +PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC
Sbjct  614   NQFELPIRTGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKMDVAADLPKKSEQVLFC  673

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLERE--HSCRDPDYG  2341
              LT VQR+ Y+AFLAS ++  I  G + ALYGID++RKICNHPDL + +      D +YG
Sbjct  674   KLTKVQRAAYEAFLASGEMSSILRGRREALYGIDMLRKICNHPDLTQHKILSQKTDYNYG  733

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             +  +SGKM+VV  +L+LWK+ GH+ L F+Q + MLDILE F+    G+ YRRMDG TP+K
Sbjct  734   SGAKSGKMQVVKSLLELWKETGHKTLLFAQHRIMLDILERFIRGFDGFNYRRMDGNTPIK  793

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R +++DEFNN  ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS DMQARERAWR+G
Sbjct  794   ARQSMVDEFNNDPDLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDMQARERAWRLG  853

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+ F+  D++DLF L +D  
Sbjct  854   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFQMSDIQDLFTLGND--  911

Query  2879  NGSTESSSIFSQL----------SEDVNITGPQH--------PDQEKDKSIKTNPADHGT  3004
              G TE+S +F              ++V   G Q         P +E+D+ I       G 
Sbjct  912   -GPTETSQMFKDADVVYEDDAAKGKNVGPAGRQQRRRQPENKPVKEEDQKISRVTGVAGM  970

Query  3005  AMERDNNSGSNG--EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK  3178
                 D  SG     EEK    +     D  ++  +F   G+ +A++HD I++     K  
Sbjct  971   EEYHDEASGPGTPQEEKEGEGDSKGKTDARLMENIFSRSGVLTALEHDQIIHGKRTVKAD  1030

Query  3179  ---LEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQ  3349
                +E +A RVA  AA  L ++  +        PTWTG+ GTAG P       G  + P 
Sbjct  1031  PKIIETEAKRVAAEAARELLKAEEVARTVPAGTPTWTGQFGTAGRP-------GLDVAPS  1083

Query  3350  LVTSSKPLEESSMISSRRNgiaagasagkalssaellakiR-GNQERAISDGLEHQHQFN  3526
               +S   +      ++RR      +++  A  ++   A  R G Q  + S          
Sbjct  1084  GTSS---IYSGGGSTARRAMGGPSSASLLANLASRNAAGGRAGTQSASGSPSASASASTA  1140

Query  3527  SGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVP  3706
             +  +   RT       S P+    G +   +IR    +I   GG+  +  +V+HF     
Sbjct  1141  ASRTGTPRT-------STPT----GREFLAMIRD---YIITHGGAVYTQMLVDHFNRFCD  1186

Query  3707  S-KDLALFKNLLKEIATLKKNPNGSF----WILKPEY  3802
             S +  A FK +L+ IA L K+  G+     W+LKPEY
Sbjct  1187  SPRATAEFKEILRTIAVLDKSGTGTRARGKWVLKPEY  1223



>gb|ESZ99345.1| putative DNA repair and recombination protein RAD26 [Sclerotinia 
borealis F-4157]
Length=1192

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/697 (49%), Positives = 461/697 (66%), Gaps = 25/697 (4%)
 Frame = +2

Query  1265  GPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFL  1444
             G P    E GLK+P  IF  LFDYQK GVQWL EL+ Q+ GGIIGDEMGLGKT+Q+++FL
Sbjct  406   GQPDHQFENGLKLPGDIFPALFDYQKTGVQWLSELYNQQVGGIIGDEMGLGKTIQIISFL  465

Query  1445  GSLHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshes  1621
              +LH+S    KP I+V P T+L+QW  E  +W+P+  V ILH S +   + K   +  + 
Sbjct  466   AALHYSKKLTKPIIVVAPATVLRQWVNEFHRWWPALRVSILHSSGSGMLNMKNEGRLEDE  525

Query  1622  dseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGY  1801
             + E                  K  D+++ H       +L+TTY  L+   + L++++W Y
Sbjct  526   EDEILYGQPTKKAPKSQKLAQKIVDRVVKH-----GHVLVTTYAGLQTYSDTLINVDWDY  580

Query  1802  AVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPV  1981
             AVLDEGH+IRNPNT VT+ CK+L+T +R+I++G+P+QN L ELWSLFDFVFP +LG L  
Sbjct  581   AVLDEGHKIRNPNTAVTIYCKELRTPNRVILSGTPMQNGLIELWSLFDFVFPMRLGTLVN  640

Query  1982  FEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVI  2161
             F   F VPI IGGYANAT LQV TA +CA  L+D I PYLL+R+K DV A LPKK+E V+
Sbjct  641   FRQSFEVPIKIGGYANATNLQVLTATKCAETLKDAISPYLLQRLKVDVAADLPKKSEQVL  700

Query  2162  FCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDY-  2338
             FC LT  QR  Y+ FL+S D++ I + S+ +LYGID++RKICNHPDLL++    R PDY 
Sbjct  701   FCKLTRPQRDAYEMFLSSDDMKSILNHSRQSLYGIDILRKICNHPDLLDKRLKTR-PDYK  759

Query  2339  -GNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATP  2512
              GN  +SGKM+VV  +L++WK  GH+ L FSQ  QMLDILE F+   GG+ Y RMDG T 
Sbjct  760   WGNGNKSGKMQVVKALLQMWKGYGHKTLLFSQGVQMLDILEEFVKKLGGFNYLRMDGGTA  819

Query  2513  VKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWR  2692
             +K R  L+D+FNN  +I +F+LTT+VGGLG NLTGANRVIIFDPDWNPS D+QARERAWR
Sbjct  820   IKDRQTLVDQFNNDPDIHVFLLTTKVGGLGVNLTGANRVIIFDPDWNPSTDVQARERAWR  879

Query  2693  IGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDD  2872
             +GQKK+VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F  +DL DLF L D 
Sbjct  880   LGQKKEVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFAMKDLYDLFTLGDQ  939

Query  2873  GENGSTESSSIFSQLSEDVNITGPQHPDQEKD-KSIKTNPADHGTAMERDNNSGSNGEEK  3049
              E G+TE+  +F     +V  +    P  + D +S   N A  G A     N  S  +EK
Sbjct  940   -EGGTTETGEMFK--GTEVQFSKTSSPSTQGDSESDLRNLA--GVAELEQFNDPSEEKEK  994

Query  3050  ADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDE---EKLKLEEQASRVAQRAAE  3220
               N      +++ ++  +F   G+HSA++HD I+N   +   ++  +E +A R+A  +A 
Sbjct  995   ESN------DESRLMEGIFARSGVHSALEHDQIINGKRKIAADRGMIEREAKRIAAESAT  1048

Query  3221  ALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFG  3331
             ALR++       +    TWTG  G+AG P ++++  G
Sbjct  1049  ALRRAGEAARSIAPGTVTWTGEYGSAGRPTNVRRGAG  1085



>ref|XP_007919986.1| hypothetical protein MYCFIDRAFT_46188 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME88518.1| hypothetical protein MYCFIDRAFT_46188 [Pseudocercospora fijiensis 
CIRAD86]
Length=1208

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/694 (48%), Positives = 452/694 (65%), Gaps = 37/694 (5%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
              EGG +IP  I+  LFDYQK GVQWLWEL+ Q+ GGIIGDEMGLGKT+Q+++FL  LH+S
Sbjct  390   FEGGFRIPGDIYPSLFDYQKTGVQWLWELYSQQVGGIIGDEMGLGKTIQIISFLAGLHYS  449

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP I+VCP T+++QW  E  +W+P   V ILH S +   D  + ++  E+    + 
Sbjct  450   GKIQKPIIVVCPATVMKQWVNEFHRWWPPLRVSILHTSGSGMLDVGRENRYEEALEAEDY  509

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                       +    +K  K I   +     +L+TTY  L+   E L+  +W YAVLDEG
Sbjct  510   SSKK------TLSKGQKAAKRILDTVTKQGHVLVTTYSGLQTYAELLIPTDWEYAVLDEG  563

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNPNT +T+ CK+L T +R+I++G+P+QN L+ELWSLFDFVFP +LG L  F+ +F 
Sbjct  564   HKIRNPNTAITIYCKELCTHNRVILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFKNQFE  623

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC LT 
Sbjct  624   IPIKHGGYANASNLQVETAMKCAETLKDAISPYLLQRFKVDVAADLPKKSERVLFCKLTK  683

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCR--DPDYGNPER  2353
             +QR  YQ FL S D++ I +G + ALYG+D++RKICNHPDL+E     +  + +YG+  +
Sbjct  684   LQREAYQWFLDSEDMKSIMNGKRQALYGVDILRKICNHPDLVEHRTLSKKSEYNYGDGRK  743

Query  2354  SGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQRMA  2530
             SGKM+VV  +L+ WK  GH+ L F+Q + MLDILE F+    G+ YRRMDG TP+K+R  
Sbjct  744   SGKMQVVKSLLQEWKRDGHKTLLFAQHRIMLDILERFIGNMAGFSYRRMDGTTPIKERQN  803

Query  2531  LIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKD  2710
             L+DEFNN  ++ +F+LTT+VGGLG NLTGANRVII+DPDWNPS D+QARERAWR+GQK++
Sbjct  804   LVDEFNNDPDLHVFLLTTKVGGLGVNLTGANRVIIYDPDWNPSTDVQARERAWRLGQKRE  863

Query  2711  VTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGST  2890
             V +YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F+ +DL DLF L D   +G T
Sbjct  864   VLIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFQLKDLHDLFTLGDSA-DGQT  922

Query  2891  ESSSIF---------SQLSEDVNITGPQHPDQEKDKSIKTNPADHGT-AMERDNNSGSNG  3040
             E+ +IF           LS   + T P   D  K   I      HG    + DN+ GSN 
Sbjct  923   ETGNIFKGTEVKFKQGNLSTPEDGTAPAGDDLSKVAGISRQEEFHGEDDGQEDNSKGSNK  982

Query  3041  EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK---LEEQASRVAQR  3211
             E++             +L ++F  +G+ S  DHDAI+N     +     ++ +A RVA  
Sbjct  983   EDR-------------MLSSIFAGNGVASVQDHDAIINGRKTVRADPTIIQREAKRVAAE  1029

Query  3212  AAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPS  3313
             AA  L ++  +       +PTWTG+ GTAG  PS
Sbjct  1030  AARELERAGEIARSLPAGVPTWTGQVGTAGRSPS  1063



>ref|XP_001262421.1| DNA repair protein Rhp26/Rad26, putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW20524.1| DNA repair protein Rhp26/Rad26, putative [Neosartorya fischeri 
NRRL 181]
Length=1214

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/865 (42%), Positives = 508/865 (59%), Gaps = 77/865 (9%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P V  + G ++P  +   LFDYQK GVQWLWEL+ QK GGIIGDEMGLGKT+Q +AFL  
Sbjct  402   PDVSYDNGYRLPGDLNPYLFDYQKTGVQWLWELYQQKVGGIIGDEMGLGKTIQTIAFLAG  461

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S     P I+VCP T+++QW  E  +W+P F V ILH S +   + +  S   ++  
Sbjct  462   LHYSKKLDGPVIVVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIRSESSREDALL  521

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +    N K   K++  V+  +  +L+TTY  L+     L+ +EWG A+
Sbjct  522   AQTYSSSSRGFTS----NQKAARKVVKRVV-EEGHVLVTTYSGLQTYSHFLIPVEWGCAI  576

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+ CK+L+T HRII++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  577   LDEGHKIRNPNTSITIHCKELRTPHRIILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  636

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKKTE V+FC
Sbjct  637   NQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKTEQVLFC  696

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT  QR  Y++FL S ++E I  G +  LYG+D++RKICNHPDL   +       YGN 
Sbjct  697   KLTKPQRMAYESFLKSEEMESILKGRRQILYGVDILRKICNHPDLQNHKLQSHQLGYGNA  756

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
              +SGKM+VV  +L+LW+D GH+ L F+Q + MLDILE F+ +  G+ +RRMDG TP++ R
Sbjct  757   NKSGKMQVVKSLLELWRDTGHKTLLFAQHRIMLDILEKFVRSLSGFNHRRMDGTTPIQNR  816

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               ++DEFNN   I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  817   QTMVDEFNNDPNIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLGQK  876

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRL-FKARDLKDLFVLNDDGEN  2881
             +DV+VYRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+  F+  DL DLF L D+ + 
Sbjct  877   RDVSVYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTSFQLSDLYDLFALGDE-KP  935

Query  2882  GSTESSSIFSQLSEDVNITG---PQHPDQEKDKSIKTNPADHG-------TAMERDNNSG  3031
             G+TE+S +F +        G    Q P + +D S       +G       +++ER     
Sbjct  936   GATETSKLFQEAQVTFQGDGDGNTQQPTKAEDASSDMQAEKNGISKVVGVSSVERYQGES  995

Query  3032  SNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK---LEEQASRV  3202
                 ++ +   G V  ++ I+  +F   G+HSA++HD IVN     +     +E +A RV
Sbjct  996   EQPSDQ-EKGAGGVKSESRIMEGIFARSGVHSALEHDQIVNGKRVVRADPKIIEAEAKRV  1054

Query  3203  AQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPS--IKKKFGSTLNPQLVTSSKPLE  3376
             A  AAE LR++        +  PTWTG+ G AG P    +   FG   +    T++ P  
Sbjct  1055  AAEAAEELRRAGEAARSVPIGTPTWTGQFGVAGRPEERPLPSAFGGRSSTARRTAAGPSS  1114

Query  3377  ESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTR  3556
              S + +                                              S+    +R
Sbjct  1115  ASILANL---------------------------------------------SARTPSSR  1129

Query  3557  AAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF-RSRVPSKDLALFKN  3733
             +A N  + PS    G+    +IR    +I  +GG+  +  +++HF R     +  A FK 
Sbjct  1130  SATNSPA-PSRTPTGVDFMTMIRD---YILSQGGAVYTQMLIDHFNRYCTTPQRSAEFKE  1185

Query  3734  LLKEIATLKKNP-NG-SFWILKPEY  3802
             +LK IA L+K   NG   W LKPE+
Sbjct  1186  MLKTIAVLEKGGRNGRGRWSLKPEF  1210



>emb|CDM26849.1| DNA repair and recombination protein RAD26 [Penicillium roqueforti 
FM164]
Length=1117

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/855 (44%), Positives = 510/855 (60%), Gaps = 72/855 (8%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P + L+ GL++P  I   LF YQK GVQWLWELH Q  GGIIGDEMGLGKT+Q +++L +
Sbjct  315   PAMELDNGLRVPGDISRFLFPYQKTGVQWLWELHQQTVGGIIGDEMGLGKTIQAISYLAA  374

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH SN   KP+I+VCP TL++QW  E  +W+P F V ILH S +   +  K S    + S
Sbjct  375   LHHSNKLTKPAIVVCPATLMKQWVNEFHRWWPPFRVSILHSSGSGMINLGKESSRENALS  434

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +   +  KK  K +      +  +L+TTY  L+   + L+D+EWG A+
Sbjct  435   SEMMSSRSSRHLSAGQKAAKKIIKRVT----EEGHVLVTTYSGLQSYADALVDVEWGCAI  490

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+  +T  CK+L+T HRII++G+P+QN L +LWSLFDFVFP +LG L  F+
Sbjct  491   LDEGHKIRNPDAGITFSCKELRTPHRIILSGTPMQNSLVDLWSLFDFVFPMRLGNLVTFK  550

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F +PI  GGYA+A+ LQV TA +CA  L+D I PYLL+R KADV + LP K+E VIFC
Sbjct  551   NQFEIPIRQGGYASASNLQVQTAAKCAETLKDAISPYLLQRFKADVTSDLPMKSEQVIFC  610

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT +QR+IY+ FL S D++ I  G +N+L+GID++RKI NHPDL +     RD DYG+ 
Sbjct  611   KLTQLQRTIYKRFLGSDDMKSIIRGKRNSLFGIDILRKISNHPDLADHTLRSRDADYGDA  670

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL-VTGGYKYRRMDGATPVKQR  2524
             ERSGKMKV+  +L++W+D GH+ L F+Q + MLDI+E FL   GG+ Y RMDG TP+K+R
Sbjct  671   ERSGKMKVLKGLLEVWRDTGHKTLVFTQGRLMLDIIEKFLGALGGFNYLRMDGTTPIKER  730

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               L+D FNN   I +F+LTTRVGG+G NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  731   QNLVDTFNNDPNIHVFLLTTRVGGIGVNLTGADRVIIYDPDWNPSTDLQARERAWRLGQK  790

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             +DVT++RL+T+GTIEEK+YHRQI+K  LTNKI ++P QR  F+  DL DLF L D+ ++ 
Sbjct  791   RDVTIFRLMTKGTIEEKIYHRQIFKQFLTNKITRDPHQREGFQLSDLYDLFTLTDENDD-  849

Query  2885  STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEE----KA  3052
               E++ +F    ++  +T  +   +      K  P         D N  +N EE      
Sbjct  850   ELETTKLF----KNAEVTYQEEAKEAHGSKSKPAPTLKEEDGITDINGIANVEEFQNAAE  905

Query  3053  DNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAH---DEEKLKLEEQASRVAQRAAEA  3223
             ++NN    ED  I+  +F   G+HSA+ HD IVN       +   +E +A RVA  AAE 
Sbjct  906   EDNNAKTSED-RIMHGIFARSGVHSAVQHDQIVNGKRVLRADPKMIEAEARRVANEAAEE  964

Query  3224  LRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESSMISSRR  3403
             LR++        + +PTWTGR G  G      +  GS+  P     S     SS + +R 
Sbjct  965   LRKAEETARALPIGLPTWTGRFGMGGREDP--RTGGSSARPAGAGPS-----SSDLLARL  1017

Query  3404  NgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRP  3583
             N  AA A+                              Q  SGS S S         +R 
Sbjct  1018  NPAAAAAAG-----------------------------QRTSGSDSPS---------ARM  1039

Query  3584  SHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS-KDLALFKNLLKEIATLK  3760
               G   M    LIR    ++  + G T S SIV HF     + + +A F+  LK++ATL+
Sbjct  1040  PRGKEFMP---LIRD---YLASQRGPTLSQSIVHHFNHYCSNPQRVAEFQESLKKVATLE  1093

Query  3761  KNPN-GSFWILKPEY  3802
                +    W LKPE+
Sbjct  1094  HGRDRRGRWTLKPEF  1108



>ref|XP_008729393.1| hypothetical protein G647_06852 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI22776.1| hypothetical protein G647_06852 [Cladophialophora carrionii CBS 
160.54]
Length=1197

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/868 (42%), Positives = 530/868 (61%), Gaps = 64/868 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L+ G ++P  I+  LFDYQK GVQWL ELH Q+ GGIIGDEMGLGKT+Q+++FL  
Sbjct  370   PDTVLDAGYRLPGDIYPSLFDYQKTGVQWLHELHIQQVGGIIGDEMGLGKTIQIISFLAG  429

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP I+VCP T+++QW  E  +W+P F V ILH S +   + +  +   +S  
Sbjct  430   LHYSKKLDKPIIVVCPATVMKQWVNEFHRWWPPFRVTILHSSGSGMVNVRNEASKEDSLL  489

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
             + E   +     N      +K  + I   +    G+L+TTY  L+     L+ ++W YAV
Sbjct  490   DLEWDPNAG---NRPLTGAQKAAQKILRPILEKGGVLVTTYSGLQTYAPLLIPVDWQYAV  546

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+ CK+L+T +RII++G+P+QN L ELWSLFDFVFP +LG L  F 
Sbjct  547   LDEGHKIRNPNTAITIYCKELRTPNRIILSGTPMQNNLIELWSLFDFVFPMRLGTLVNFR  606

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F +PI  GGYANA+ LQV TA++CA  L+D I PYLL+R K DV + LPKK+E V+FC
Sbjct  607   NQFEIPIRQGGYANASNLQVQTAFKCAETLKDAISPYLLQRFKIDVASDLPKKSEQVLFC  666

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DYG  2341
              LTS+QR  YQ F++S +++ I  G +  LYGID++RKICNHPDL + +     P  DYG
Sbjct  667   KLTSLQRKEYQKFISSGEMDAIMTGKRQVLYGIDLLRKICNHPDLTDHKRLSGKPGYDYG  726

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             NP +SGKM+VV  +L+LW+D GH+ L F+Q + MLDILE ++ +  G++YRRMDG TP++
Sbjct  727   NPAKSGKMQVVGSLLELWRDTGHKTLLFAQHRIMLDILEKYVRSLSGFRYRRMDGNTPIQ  786

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R +++DEFN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  787   MRQSMVDEFNTDPDLHVFLLTTKVGGLGINLTGADRVIIYDPDWNPSTDLQARERAWRLG  846

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+ F   DL DLF L ++G+
Sbjct  847   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFHLNDLHDLFSLGNEGD  906

Query  2879  NGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTN-----PADHGTAME-------RDN  3022
                TE+S +F    +D  +     P         TN     PA+  T +E        + 
Sbjct  907   --ETETSKLF----QDAQVKHSTKPADAPTAVRTTNENLPAPANSDTKIEALPGISSMEQ  960

Query  3023  NSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK-----LEE  3187
              +G   EE+    +   + +  ++  +F   GIHSA++HDAI++    +K+      +E+
Sbjct  961   YAGEVEEEEQAKKDPTNNSEDRVMEGIFSRAGIHSAVEHDAIIDGKAPKKVAADPVMIEQ  1020

Query  3188  QASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSK  3367
             +A +VA  AA  LR++  +     +  PTWTG+ G AG P     +   + N +  +   
Sbjct  1021  EARKVAAEAARELRRAGEVARTVPIGTPTWTGQFGVAGRPQETTARNAFSSNSR--SRGG  1078

Query  3368  PLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNS  3547
              L+ SS++++                      + +GN     S G   + +  + SS ++
Sbjct  1079  GLQSSSLLAN---------------------LQRQGNH--IPSRGGTPRTESPARSSGSA  1115

Query  3548  RTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF-RSRVPSKDLAL  3724
              + + E   + P     G     LIR    ++   GGS  +  +++HF R    ++  A 
Sbjct  1116  ASASREGTPNLPRGKDFGK----LIRD---YLTTHGGSVYTQMLIDHFNRYCTTAQATAE  1168

Query  3725  FKNLLKEIATLKKNPNG-SFWILKPEYQ  3805
             FK  LK IA L+K   G   W+LK EY+
Sbjct  1169  FKETLKLIARLEKGSRGRGRWVLKDEYK  1196



>ref|XP_009160484.1| DNA excision repair protein ERCC-6 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY60023.1| DNA excision repair protein ERCC-6 [Exophiala dermatitidis NIH/UT8656]
Length=1204

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/870 (42%), Positives = 526/870 (60%), Gaps = 64/870 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +     KIP  I+  LF YQK GVQWL+EL+ Q+ GGII DEMGLGKTVQ++AFL  
Sbjct  375   PDTVFTHDYKIPGDIYPSLFGYQKTGVQWLYELYTQQVGGIIADEMGLGKTVQIIAFLAG  434

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP I+VCP T+++QW  E  +W+P F V ILH S +   + +  +   +   
Sbjct  435   LHYSKKLRKPIIVVCPATVMKQWVNEFHRWWPPFRVTILHSSGSGMINIRNEASKEDKLL  494

Query  1628  eseelldvdvekNLSFRNTKKW-DKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYA  1804
             +      V    N    +T+K   K+I  +L  + G+L+TTY  L+     L+ +EW YA
Sbjct  495   DLAFDPTVR---NKPLTSTQKAAQKMIRPIL-EEGGVLVTTYTGLQTYAPLLIPVEWDYA  550

Query  1805  VLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVF  1984
             +LDEGH+IRNPNT +T+ CK+L+T +RII++G+P+QN L ELWSLFDFVFP +LG L  F
Sbjct  551   ILDEGHKIRNPNTAITIYCKELRTPNRIILSGTPMQNNLIELWSLFDFVFPMRLGTLVNF  610

Query  1985  EAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIF  2164
               +F +PI  GGYANA+ LQV TA++CA  L++ I PYLL+R K DV + LPKK+E V+F
Sbjct  611   RNQFEIPIRQGGYANASNLQVQTAFKCAETLKEAISPYLLQRFKVDVASDLPKKSEKVVF  670

Query  2165  CSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DY  2338
             C+LT +QR+ YQ FL S ++E I +G +  LYGID++RKICNHPDL   ++    P   Y
Sbjct  671   CNLTPLQRAEYQRFLDSKEMEAIINGRRQPLYGIDILRKICNHPDLANHKYLAHKPGYKY  730

Query  2339  GNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPV  2515
             G+P +SGKM VV  +LK WK +GH+ L F+Q + MLDILE F+ +  G+KYRRMDG TP+
Sbjct  731   GDPAKSGKMTVVGALLKSWKGEGHKTLLFAQHRIMLDILEKFVKSLDGFKYRRMDGNTPI  790

Query  2516  KQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRI  2695
               R +++DEFN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+
Sbjct  791   PLRQSMVDEFNTDPDLHVFLLTTKVGGLGINLTGADRVIIYDPDWNPSTDLQARERAWRL  850

Query  2696  GQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDG  2875
             GQK++VT+ RL+  GTIEEK+YHRQI+K  LTNKILK+P+QR+ F   DL DLF L ++G
Sbjct  851   GQKREVTICRLMIAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFHLNDLHDLFSLGNEG  910

Query  2876  ENGSTESSSIF--SQLSEDVNITGPQHPDQEKD-KSIKTNPADHGTAM-----ERDNNSG  3031
                 TE+SS+F  +Q       T    P + KD K +  +  D            +  +G
Sbjct  911   --APTETSSLFKEAQFKYSDKPTKALEPGELKDAKGVTPDTGDTNIKALPGISSVEQYAG  968

Query  3032  SNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEK------LKLEEQA  3193
                EE   N  G  + +  ++  +F   GIHSA++HD IV+ +   K      + +E++A
Sbjct  969   EVEEEAKANKEGGTNSEERMMEAIFSRSGIHSAVEHDTIVDGYRTSKTVAADPVLIEQEA  1028

Query  3194  SRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP--PSIKKKFGSTLNPQLVTSSK  3367
              +VA  AA+ L+++  +     V  PTWTG+ G +G P   + ++ FGS+      +   
Sbjct  1029  RKVAAEAAKELKRAGEVARHVPVGTPTWTGQFGVSGRPQETTAQRAFGSSGR----SREG  1084

Query  3368  PLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNS  3547
              ++ S+++++ +                    + + +  RA + G     +    ++SNS
Sbjct  1085  AMQSSNLLANLQQ------------------RQAQASGSRAATPGNSSPARSTGSAASNS  1126

Query  3548  RTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFR--SRVPSKDLA  3721
             R      G      G    Q   LIR    F+   GG+  +  +++HF    R P   L 
Sbjct  1127  RA-----GTPTLPQGKDFGQ---LIRD---FLIAHGGAAYTQMLIDHFNRYCRTPQATLE  1175

Query  3722  LFKNLLKEIATLKKNPNG-SFWILKPEYQE  3808
              FK  LK IATL+K   G   W+LK EY++
Sbjct  1176  -FKETLKLIATLQKAGQGRGRWVLKDEYKK  1204



>ref|XP_002556477.1| KLTH0H14300p [Lachancea thermotolerans]
 emb|CAR30615.1| KLTH0H14300p [Lachancea thermotolerans CBS 6340]
Length=1037

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/873 (43%), Positives = 524/873 (60%), Gaps = 92/873 (11%)
 Frame = +2

Query  827   ETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQDNGDLVSTSLANAIQSIS----  994
             E+E+D L+R G  T F    GF              +  +GD   T L++  +S++    
Sbjct  126   ESERDYLIRTGKTTAFGTESGF-------------ILDRDGDEDPTVLSDGHESVTSDNE  172

Query  995   -----EAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRKRRPTPG  1159
                  EA +S  +++ L S      E    P        K +   ++G     ++R    
Sbjct  173   EDYQVEADKSDASSEGLASEFSESAEDKEAP--------KAASFIDDGDELNYQKRL---  221

Query  1160  KKW-RVKVSRENKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDY  1336
             K W R + SR  KD  P++E         +    + G P   L    +IP  IF  LF+Y
Sbjct  222   KNWVRERSSRRLKDPNPELE---------EYRKPNPGLPDATLNDDFRIPGEIFQSLFNY  272

Query  1337  QKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYK-PSIIVCPLTLLQQ  1513
             QK  VQWL+EL+ Q+ GGIIGDEMGLGKT+Q++AFL SLH S     P ++VCP T+L+Q
Sbjct  273   QKTCVQWLYELYQQQCGGIIGDEMGLGKTIQIIAFLASLHHSGKLNGPILVVCPATVLRQ  332

Query  1514  WKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKW  1693
             W +E   W+P F   ILH S+     +K+     + +         +   + ++ N+K+ 
Sbjct  333   WCKEFHTWWPPFRAIILH-SIGAGMTQKENLSEQKLEELFMNSNPEEFSFD-AYTNSKRT  390

Query  1694  ----------DKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNT  1843
                       D LIN V+ +D  +LITTY  LR+  +KLL++ WGYAVLDEGH+IRNP+ 
Sbjct  391   KSILESSLTRDNLINKVV-TDGHVLITTYVGLRIHSDKLLNVRWGYAVLDEGHKIRNPDA  449

Query  1844  DVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGY  2023
             D++L CKQL+T +RII++G+PIQN L+ELWSLFDF+FPG+LG LPVF+ +F+VPI++GGY
Sbjct  450   DISLTCKQLKTKNRIILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQQQFSVPINMGGY  509

Query  2024  ANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQA  2203
             ANAT +QV T Y+CAV LR+LI PYLLRR+KADV   LP+K E V+FC LT  QR+ Y  
Sbjct  510   ANATNIQVQTGYKCAVALRNLISPYLLRRIKADVAKDLPRKNEMVLFCKLTQYQRNKYLQ  569

Query  2204  FLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEV  2383
             FL S D+ +I +G +  L+GID++RKICNHPDLLERE    +  YG+P+RSGKM+VV ++
Sbjct  570   FLNSEDLVKIKNGKRQVLFGIDILRKICNHPDLLEREQRQNEDSYGDPKRSGKMQVVKQL  629

Query  2384  LKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYK--------YRRMDGATPVKQRMALID  2539
             LKLW  QGH+ L F+Q++QMLDILE F+    YK        Y RMDG T +  R AL+D
Sbjct  630   LKLWHSQGHKTLLFTQSRQMLDILERFI---SYKDPELEELTYLRMDGTTSIGARQALVD  686

Query  2540  EFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTV  2719
              FNN     +F+LTTRVGGLG NLTGANR+IIFDPDWNPS DMQARERAWRIGQ+++VT+
Sbjct  687   SFNNG-SYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWRIGQRREVTI  745

Query  2720  YRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESS  2899
             YRL+  G+IEEK+YHRQI+K  LTNKIL +P+Q+R FK  +L+DLF L   GE G T  +
Sbjct  746   YRLMIAGSIEEKIYHRQIFKQFLTNKILTDPKQKRFFKMNELQDLFTLG--GETGLTNEN  803

Query  2900  SIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNN-SGSNGEEKADNNNGDVD  3076
                  L  +V         Q++ ++IK + +D     ++    SG +  E       + +
Sbjct  804   -----LESEV---------QKQTENIKKSRSDESDDFDKVVQLSGVSKLEGFFGGKENEE  849

Query  3077  EDTSILRTLFD---AHGIHSAMDHDAIVNAHDEEKLK-LEEQASRVAQRAAEALRQSRML  3244
             ++      L D      +     H +++  H +     +  +A++VA+ A  AL++SR  
Sbjct  850   KNKGEEERLMDGLFGGNVEGVKSHSSVIEQHSKPSTDIITREATKVAEEALAALKKSRKT  909

Query  3245  RSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLN  3343
               +  +  PTWTG+ G AG     KKK  ++L+
Sbjct  910   TKKFEIGTPTWTGKFGAAGR--VTKKKSATSLS  940



>gb|KFX51723.1| DNA repair and recombination protein RAD26 [Talaromyces marneffei 
PM1]
Length=1157

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/862 (43%), Positives = 510/862 (59%), Gaps = 76/862 (9%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P    +GG ++P  IF  LFDYQK GVQWLWEL+ Q+ GGIIGDEMGLGKT+QV++FL  
Sbjct  351   PDAEYDGGYRVPGDIFPILFDYQKTGVQWLWELYQQQVGGIIGDEMGLGKTIQVISFLAG  410

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S    KP I+V P T+++QW  E  +W+P F V ILH S +   + +  S    + +
Sbjct  411   LHHSRKLTKPVIVVAPATVMKQWVTEFHRWWPPFRVSILHTSGSGMINVRNESNRENALN  470

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
             +             + +  K   K++  V+  +  +L+TTY  L+     L+ ++W  A+
Sbjct  471   DEMWDPSRPYTMTKAQKTAK---KIVQRVV-EEGHVLVTTYSGLQTYAPVLIPVDWDCAI  526

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+ CK+L+T HR+I++G+P+QN LSELWSLFDFVFP +LG L  F 
Sbjct  527   LDEGHKIRNPNTSITIHCKELRTPHRLILSGTPMQNNLSELWSLFDFVFPMRLGTLVDFR  586

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA RCA  L++ I PYLL+R K DV + LPKK+E V+FC
Sbjct  587   NQFEFPIRQGGYANASNLQVQTAARCAETLKEAISPYLLQRFKVDVASDLPKKSEQVLFC  646

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              L+ +QR  Y+ FL S +   I  G +  LYG+D++RKICNHPDL+  +       YG P
Sbjct  647   KLSPLQRKAYEQFLNSQECNSILAGRRQVLYGVDMLRKICNHPDLVTHKLFSATTGYGEP  706

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
              +SGKMKVV  +L+LW+D GH+ L F+Q + ML+ILE F+ T  G+ YRRMDG TP+ +R
Sbjct  707   SKSGKMKVVKALLELWRDTGHKTLLFAQHRIMLNILEKFVNTLSGFNYRRMDGETPIHRR  766

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               L+DEFNN+ +I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS DMQARERAWR+GQK
Sbjct  767   QLLVDEFNNSPDIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDMQARERAWRLGQK  826

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             ++V +YRL+T GTIEEK+YHRQI+K  LTNK+LK+P+QR+ F+  +L DLF L   GE G
Sbjct  827   REVAIYRLMTAGTIEEKIYHRQIFKQFLTNKVLKDPKQRQTFEMSNLHDLFSL---GEEG  883

Query  2885  STESSSIFSQ--------LSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNG  3040
              TE+SS+F           S+   I   Q P +  DK I+           RD+   ++G
Sbjct  884   QTETSSMFKTEVTYQEKGESKQDKIKTEQTPPKTDDKEIQKVEGIAAVEHFRDDADEADG  943

Query  3041  EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHD---EEKLKLEEQASRVAQR  3211
             +    ++NG    +  ++ T+F   G+HSA++HD IVN       +K  +E +A R+A  
Sbjct  944   K---GDDNGVPRSEARLMETIFAQSGVHSALEHDRIVNGKKIIAPDKSIIEAEAKRLAAE  1000

Query  3212  AAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPS-IKKKFGSTLNPQLVTSSKPLEESSM  3388
             AAE LR++  +     V  PTWTG+ G AG P    +  FG   +      + P   +S+
Sbjct  1001  AAEKLRKAEQIARSVPVGTPTWTGQFGIAGRPEERPRSAFGGAASIARGAGAGP-SSASI  1059

Query  3389  ISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAEN  3568
             +++  N   AG                                     S +NS   +   
Sbjct  1060  LANLANRTGAGR------------------------------------SRTNSPRDSPVP  1083

Query  3569  GASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF-RSRVPSKDLALFKNLLKE  3745
             G  RP   S       +IR    ++  +GGS  +  +++HF R     +  A FK  LK 
Sbjct  1084  GGGRPDFMS-------MIRD---YMIAQGGSAYTQMLIDHFNRFCTTPQRSAEFKETLKT  1133

Query  3746  IATLKK---NPNGSFWILKPEY  3802
             +A L+K   N  G  W LK EY
Sbjct  1134  VANLEKGGRNGRGK-WSLKKEY  1154



>ref|XP_003679873.1| hypothetical protein TDEL_0B05330 [Torulaspora delbrueckii]
 emb|CCE90662.1| hypothetical protein TDEL_0B05330 [Torulaspora delbrueckii]
Length=1057

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/867 (43%), Positives = 519/867 (60%), Gaps = 100/867 (12%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    KIP  IF  LF+YQK  VQWL+EL+ QK GGIIGDEMGLGKT+QV+AFL +LH S
Sbjct  265   LNDDFKIPGDIFSLLFNYQKTCVQWLYELYQQKCGGIIGDEMGLGKTIQVIAFLAALHHS  324

Query  1463  NAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
             +    P +IVCP T+++QW  E   W+P     ILH   +   +KK  ++          
Sbjct  325   DMLDGPVLIVCPATVMKQWCNELHHWWPPLRAVILHAIGSGMGNKKSIAEEDLEGLIMSS  384

Query  1640  lldvdvekNLSFRNTKK----------WDKLINHVLGSDSGLLITTYEQLRLLGEKLLDI  1789
                    ++  F N+ K             L++ V+ +D  +LITTY  LR+  + LL++
Sbjct  385   DPSQFSYED--FNNSAKVKGKLESNNNMQSLVDKVV-NDGHILITTYVGLRIHRDILLNV  441

Query  1790  EWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLG  1969
              WGYAVLDEGH+IRNP++D++L CK+L+T HRII++G+PIQN L+ELWSLFDF+FPGKLG
Sbjct  442   NWGYAVLDEGHKIRNPDSDISLTCKRLKTHHRIILSGTPIQNNLNELWSLFDFIFPGKLG  501

Query  1970  VLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKT  2149
              LPVF+ +F  PIS+GGYANAT +QV   Y+CAV LRDLI PYLLRR+KADV   LP+K 
Sbjct  502   TLPVFQQQFVQPISMGGYANATNVQVQAGYKCAVALRDLISPYLLRRVKADVAKDLPEKK  561

Query  2150  EHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRD  2329
             E V+FC LT  QR  Y  FL S +++QI  G +  L+GID++RKICNHPDLL+RE     
Sbjct  562   EMVLFCKLTQFQRKKYLEFLHSKELDQIKTGKRQVLFGIDILRKICNHPDLLDREEKRHQ  621

Query  2330  PDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL-----VTGGYKYRR  2494
               YG+P+RSGKM+VV ++L LW  Q H+ L F+Q++QMLDILE F+        G K+ R
Sbjct  622   ASYGDPKRSGKMQVVKQLLLLWHKQHHKTLLFTQSRQMLDILEEFVSFKDESLSGLKFLR  681

Query  2495  MDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQA  2674
             MDG T +  R +L+DEFNN  +  +F+LTTRVGGLG NLTGANR+IIFDPDWNPS DMQA
Sbjct  682   MDGTTNISTRQSLVDEFNNG-DYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQA  740

Query  2675  RERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDL  2854
             RERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTNKIL +P+Q+R FK  +L+DL
Sbjct  741   RERAWRIGQKREVSIYRLMVTGSIEEKIYHRQIFKQFLTNKILSDPKQKRFFKVNELQDL  800

Query  2855  FVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADH-----GTAMERD  3019
             F L   GE+G         +L E+V     +H +    KS KT  +D      G A    
Sbjct  801   FSLG--GESGHA-----IEELEEEVQ----KHTNSL--KSSKTEESDDFEQVVGMAGVSK  847

Query  3020  NNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQAS  3196
               S  +G+E  + +     ED  ++  L     + +A  H+A+V+AH +    + E++A 
Sbjct  848   LESFYSGKESKEQSQ---TEDERLIEGLLGESNLENAATHEALVDAHAKSSTAIVEKEAK  904

Query  3197  RVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             ++A  A +ALR+SR    + S+  PTWTG+ G AG    + KK   +  PQL  S     
Sbjct  905   KIADDALDALRKSRKAAKKFSIGTPTWTGKFGQAG---KVAKKTRKSKTPQLTGS-----  956

Query  3377  ESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTR  3556
              S+++++ RN                                   Q Q     + ++   
Sbjct  957   -SAILANLRNA----------------------------------QQQAKKLPAQSTAFG  981

Query  3557  AAENGASRPSHGSAGMQPEVLIRQVCTFI-QRKGGSTSSASIVEHFRSRVPSKDLAL-FK  3730
               E+GAS           E L+R++  F+  R      S  ++EH   ++  ++  +  +
Sbjct  982   ENESGAS-----------ETLLRKLQVFLNNRPDFFAPSLDVIEHAGVQLKDREETVKVR  1030

Query  3731  NLLKEIATLKKNPNGSFWILKPEYQEE  3811
              LLK IA+  K+  G  W+L  E++++
Sbjct  1031  ALLKSIASFNKDRKG--WVLNEEFRDD  1055



>ref|XP_002148405.1| DNA repair protein Rhp26/Rad26, putative [Talaromyces marneffei 
ATCC 18224]
 gb|EEA24894.1| DNA repair protein Rhp26/Rad26, putative [Talaromyces marneffei 
ATCC 18224]
Length=1157

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/862 (43%), Positives = 510/862 (59%), Gaps = 76/862 (9%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P    +GG ++P  IF  LFDYQK GVQWLWEL+ Q+ GGIIGDEMGLGKT+QV++FL  
Sbjct  351   PDAEYDGGYRVPGDIFPILFDYQKTGVQWLWELYQQQVGGIIGDEMGLGKTIQVISFLAG  410

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S    KP I+V P T+++QW  E  +W+P F V ILH S +   + +  S    + +
Sbjct  411   LHHSRKLTKPVIVVAPATVMKQWVTEFHRWWPPFRVSILHTSGSGMINVRNESNRENALN  470

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
             +             + +  K   K++  V+  +  +L+TTY  L+     L+ ++W  A+
Sbjct  471   DEMWDPSRPYTMTKAQKTAK---KIVQRVV-EEGHVLVTTYSGLQTYAPVLIPVDWDCAI  526

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+ CK+L+T HR+I++G+P+QN LSELWSLFDFVFP +LG L  F 
Sbjct  527   LDEGHKIRNPNTSITIHCKELRTPHRLILSGTPMQNNLSELWSLFDFVFPMRLGTLVDFR  586

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA RCA  L++ I PYLL+R K DV + LPKK+E V+FC
Sbjct  587   NQFEFPIRQGGYANASNLQVQTAARCAETLKEAISPYLLQRFKVDVASDLPKKSEQVLFC  646

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              L+ +QR  Y+ FL S +   I  G +  LYG+D++RKICNHPDL+  +       YG P
Sbjct  647   KLSPLQRKAYEQFLNSQECNSILAGRRQVLYGVDMLRKICNHPDLVTHKLFSATTGYGEP  706

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
              +SGKMKVV  +L+LW+D GH+ L F+Q + ML+ILE F+ T  G+ YRRMDG TP+ +R
Sbjct  707   SKSGKMKVVKALLELWRDTGHKTLLFAQHRIMLNILEKFVNTLSGFNYRRMDGETPIHRR  766

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               L+DEFNN+ +I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS DMQARERAWR+GQK
Sbjct  767   QLLVDEFNNSPDIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDMQARERAWRLGQK  826

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             ++V +YRL+T GTIEEK+YHRQI+K  LTNK+LK+P+QR+ F+  +L DLF L   GE G
Sbjct  827   REVAIYRLMTAGTIEEKIYHRQIFKQFLTNKVLKDPKQRQTFEMSNLHDLFSL---GEEG  883

Query  2885  STESSSIFSQ--------LSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNG  3040
              TE+SS+F           S+   I   Q P +  DK I+           RD+   ++G
Sbjct  884   QTETSSMFKTEVTYQEKGESKQDKIKTEQTPPKTDDKEIQKVEGIAAVEHFRDDADEADG  943

Query  3041  EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHD---EEKLKLEEQASRVAQR  3211
             +    ++NG    +  ++ T+F   G+HSA++HD IVN       +K  +E +A R+A  
Sbjct  944   K---GDDNGVPRSEARLMETIFAQSGVHSALEHDRIVNGKKIIAPDKSIIEAEAKRLAAE  1000

Query  3212  AAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPS-IKKKFGSTLNPQLVTSSKPLEESSM  3388
             AAE LR++  +     V  PTWTG+ G AG P    +  FG   +      + P   +S+
Sbjct  1001  AAEKLRKAEQIARSVPVGTPTWTGQFGIAGRPEERPRSAFGGAASIARGAGAGP-SSASI  1059

Query  3389  ISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAEN  3568
             +++  N   AG                                     S +NS   +   
Sbjct  1060  LANLANRTGAGR------------------------------------SRTNSPRDSPVP  1083

Query  3569  GASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF-RSRVPSKDLALFKNLLKE  3745
             G  RP   S       +IR    ++  +GGS  +  +++HF R     +  A FK  LK 
Sbjct  1084  GGGRPDFMS-------MIRD---YMIAQGGSAYTQMLIDHFNRFCTTPQRSAEFKETLKT  1133

Query  3746  IATLKK---NPNGSFWILKPEY  3802
             +A L+K   N  G  W LK EY
Sbjct  1134  VANLEKGGRNGRGK-WSLKKEY  1154



>ref|XP_003855543.1| SNF2 family DNA repair and recombination protein, partial [Zymoseptoria 
tritici IPO323]
 gb|EGP90519.1| SNF2 family DNA repair and recombination protein [Zymoseptoria 
tritici IPO323]
Length=1207

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/729 (47%), Positives = 475/729 (65%), Gaps = 32/729 (4%)
 Frame = +2

Query  1196  DEGPDVEISSYedekddedmddeGP----PFVMLEGGLKIPETIFDKLFDYQKVGVQWLW  1363
             DE  DV+++S  ++      + + P    P    +GG +IP  I+  LFDYQK GVQWLW
Sbjct  352   DEEEDVDVTSIPEDIQGGQPEWQMPHPSRPDAGFDGGFRIPGDIYPSLFDYQKTGVQWLW  411

Query  1364  ELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAY-KPSIIVCPLTLLQQWKREAKKWY  1540
             EL  Q+ GGIIGDEMGLGKT+Q+++FL  LH+SN   KP I+VCP T+++QW  E  +W+
Sbjct  412   ELFSQQVGGIIGDEMGLGKTIQIISFLAGLHYSNKLTKPIIVVCPATVMKQWVNEFHRWW  471

Query  1541  PSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLG  1720
             P   V ILH S +   D ++ +   +   E          K     N+ K  +++N V+ 
Sbjct  472   PPLRVSILHTSGSGMLDLRRETSFEDELEEDSFQRKRTHSKGY---NSAK--RILNRVV-  525

Query  1721  SDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTG  1900
              D  +L+TTY  L+   E L+  +W YAVLDEGH+IRNPNT +T+ CK+L+T +R+I++G
Sbjct  526   RDGHVLVTTYSGLQTYAELLIPTDWEYAVLDEGHKIRNPNTSITIFCKELRTHNRVILSG  585

Query  1901  SPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLR  2080
             +P+QN L+ELWSLFDFVFP +LG L  F+++F VPI  GGYANA+ LQV TA +CA  L+
Sbjct  586   TPMQNNLTELWSLFDFVFPMRLGTLVNFKSQFEVPIKQGGYANASNLQVETAMKCAETLK  645

Query  2081  DLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALY  2260
             D I PYLL+R K DV A LPKK+E V+FC LT +QR  Y+ FL S D+  I +G + ALY
Sbjct  646   DTISPYLLQRFKVDVAADLPKKSERVLFCKLTKLQRDAYEWFLRSDDMSSIMNGKRQALY  705

Query  2261  GIDVMRKICNHPDLLEREHSCRDPD--YGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQT  2434
             GID++RKICNHPDL+E +   +     YG   +SGKM+VV  +L++WK  GH+ L F+Q 
Sbjct  706   GIDILRKICNHPDLVEHKTLSKKTSYAYGTGSKSGKMQVVKALLEIWKRNGHKTLLFAQH  765

Query  2435  QQMLDILENFLV-TGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNL  2611
             + MLDILE+F+    G+ YRRMDG T +K R  L+DEFN    + +F+LTT+VGGLG NL
Sbjct  766   RIMLDILESFIQGMKGFNYRRMDGNTSIKDRQDLVDEFNKDQNLHVFLLTTKVGGLGVNL  825

Query  2612  TGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLT  2791
             TGA+RVII+DPDWNPS D+QARERAWR+GQK++V +YRL+T GTIEEK+YHRQI+K  LT
Sbjct  826   TGADRVIIYDPDWNPSTDVQARERAWRLGQKREVEIYRLMTAGTIEEKIYHRQIFKQFLT  885

Query  2792  NKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQH-------  2950
             NKIL++P+QR+ F  +DL DLF L  D  +G TE+ SIF     +V ++GP+        
Sbjct  886   NKILRDPKQRQTFHLKDLHDLFTLG-DASDGPTETGSIFK--GTEVQLSGPKASTNNLPT  942

Query  2951  PDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGD----VDEDTSILRTLFDAHG  3118
             P ++ +K+      +    + R  +     EE A+ +N D     + D  +L ++F   G
Sbjct  943   PPEDAEKAQDRAAVNDIFGISRQEDWQGEEEETAEASNPDGTTSTNRDDRVLSSIFARTG  1002

Query  3119  IHSAMDHDAIVNAH----DEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGR  3286
             + SA DHDAI+N        + + +E +A RVA +AA+ L+++  +       +PTWTG+
Sbjct  1003  VQSAQDHDAIINGARAPLRADPVMIEREAKRVASQAAKELQRAGEIARSLPAGVPTWTGQ  1062

Query  3287  SGTAGAPPS  3313
              G AG  PS
Sbjct  1063  MGRAGRTPS  1071



>ref|XP_007787806.1| hypothetical protein EPUS_03186 [Endocarpon pusillum Z07020]
 gb|ERF74802.1| hypothetical protein EPUS_03186 [Endocarpon pusillum Z07020]
Length=1210

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/862 (43%), Positives = 515/862 (60%), Gaps = 59/862 (7%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
              +GG +IP  I+  LFDYQK GVQWLWEL+ QK GGIIGDEMGLGKT+Q++AFL  LH+S
Sbjct  384   FDGGYRIPGDIYPSLFDYQKTGVQWLWELYSQKVGGIIGDEMGLGKTIQIIAFLAGLHYS  443

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
             N   KP I+VCP T+++QW  E  +W+P F V ILH S +   +  + S   E   +   
Sbjct  444   NMLTKPIIVVCPATVMKQWVNEIHRWWPPFRVTILHSSGSGMINLHRESTQEERLLQQMW  503

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
               +    K  + + + K  K++N +L    G+L+TTY  L+     L+ + W YA+LDEG
Sbjct  504   DPNASRVKLTAGQKSAK--KVLNPIL-EHGGVLVTTYSGLQTYAPLLIPVSWQYAILDEG  560

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNPNT +T+ CK+L+T +R+I++G+P+QN L ELWSLFDFVFP +LG L  F  +F 
Sbjct  561   HKIRNPNTAITIYCKELRTPNRVILSGTPMQNNLVELWSLFDFVFPMRLGTLVNFRTQFE  620

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC LT+
Sbjct  621   IPIRQGGYANASNLQVQTALKCAETLKDAISPYLLQRFKIDVAADLPKKSEQVLFCRLTA  680

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DYGNPER  2353
             +QR  Y+ FLAS +++ I  G +  LYGID++RKICNHPDL + ++       DYGNP +
Sbjct  681   LQRKAYEDFLASEEMKSILSGKRQVLYGIDILRKICNHPDLQDHKNLAGKSGYDYGNPAK  740

Query  2354  SGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQRMA  2530
             SGKM+VV  +L+LWK+ GH+ L F+Q + MLDILE ++ +  G  YRRMDG TP++ R +
Sbjct  741   SGKMQVVGSLLELWKESGHKTLLFAQHRIMLDILEKYIKSMRGLTYRRMDGNTPIQLRQS  800

Query  2531  LIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKD  2710
             ++DEFNN+ E+ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQK++
Sbjct  801   MVDEFNNSPELHVFLLTTKVGGLGINLTGADRVIIYDPDWNPSTDLQARERAWRLGQKRE  860

Query  2711  VTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGST  2890
             VT+YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+ F   DL DLF L D  E   T
Sbjct  861   VTIYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFHLSDLHDLFTLAD--EKAPT  918

Query  2891  ESSSIFSQLSEDVNITGPQHP------------DQEKDKSIKTNPADHGTAMERDNNSGS  3034
             E++++F            +HP            D++ D  +K  P    T    +  +G 
Sbjct  919   ETTTLFKDAEVKYLTNTSKHPPAQIQDGQQPIKDEKIDLDLKNVPGIRFT----EQFAGE  974

Query  3035  NGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHD---EEKLKLEEQASRVA  3205
               EEK     G  + ++ ++  +F   GI SA++HD IV        +   +E++A +VA
Sbjct  975   ATEEKQAATQGSTNSESRVMEGIFARSGIRSAVEHDQIVGGKKVITADPQMIEQEAKKVA  1034

Query  3206  QRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLEESS  3385
               AA+ LR++  +        PTWTG+ G  G P  +        + +    + PL  S 
Sbjct  1035  AEAAKELRRAGEVARTVPAGTPTWTGQFGVVGKPQEVSAASAFGASARY--RAGPLSSSL  1092

Query  3386  MISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAE  3565
             +   +R           A          RG+  R             + + + S T  + 
Sbjct  1093  LAGLQR-----------AQGVNVNTTPDRGDSGRV----------SRASTPTGSITGGSR  1131

Query  3566  NGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLAL-FKNLLK  3742
              G S P  G    +   LIR    ++   GGS  +  +++HF     +    + FK  LK
Sbjct  1132  PGTSTPPRGRDFGK---LIRD---YLMGHGGSAYTQMLIDHFNRLCTTPQATMDFKETLK  1185

Query  3743  EIATLKKNPNG-SFWILKPEYQ  3805
              IATL K       W+LK EY+
Sbjct  1186  VIATLDKGSRARGKWVLKDEYK  1207



>ref|XP_007751653.1| DNA excision repair protein ERCC-6 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ54983.1| DNA excision repair protein ERCC-6 [Cladophialophora psammophila 
CBS 110553]
Length=1199

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/874 (42%), Positives = 525/874 (60%), Gaps = 76/874 (9%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L+ G K+P  I+  LFDYQK GVQWL+EL+ Q+ GGIIGDEMGLGKT+Q++AFL  
Sbjct  372   PDTLLDDGYKLPGDIYPSLFDYQKTGVQWLYELYTQQVGGIIGDEMGLGKTIQIIAFLAG  431

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP I+VCP T+++QW  E  +W+P F V ILH S +   + +  S   E   
Sbjct  432   LHYSKKLDKPIIVVCPATVMKQWVNEFHRWWPPFRVTILHSSGSGMVNLRNESNKEERLL  491

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
             +         +   + +   +  K++  +L    G+L+TTY  L+     L+ ++W YA+
Sbjct  492   DLAWDPTRRKQPLTAAQKAAR--KILRPIL-EKGGVLVTTYSGLQTYAPLLIPVDWQYAI  548

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+ CK+L+T +RII++G+P+QN L ELWSLFDFVFP +LG L  F 
Sbjct  549   LDEGHKIRNPNTAITIYCKELRTPNRIILSGTPMQNNLIELWSLFDFVFPMRLGTLVNFR  608

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F +PI  GGYANA+ LQV TA++CA  L+D I PYLL+R K DV + LPKK+E V+FC
Sbjct  609   NQFEIPIRQGGYANASNLQVQTAFKCAETLKDAISPYLLQRFKIDVASDLPKKSEQVLFC  668

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DYG  2341
              LT +QR  Y+ F+ S +++ I +G +  LYG+D++RKICNHPDL + +     P  +YG
Sbjct  669   KLTPLQRDEYKRFIGSGEMDAIMNGKRQVLYGVDILRKICNHPDLTDHKRLSIKPGYNYG  728

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             +P +SGKM+VV  +L+LWK+ GH+ L F+Q + MLDILE ++ +  G+KYRRMDG TP++
Sbjct  729   DPSKSGKMQVVGSLLELWKETGHKTLLFAQHRIMLDILEKYVKSLSGFKYRRMDGNTPIQ  788

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R +++DEFNN   + +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  789   LRQSMVDEFNNDPNLHVFLLTTKVGGLGINLTGADRVIIYDPDWNPSTDLQARERAWRLG  848

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++V +YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F   DL DLF L +DGE
Sbjct  849   QKREVAIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFHLADLHDLFSLGNDGE  908

Query  2879  NGSTESSSIFSQLSEDVNITGPQHP-DQEK----DKSIKTNPADHGTAM-------ERDN  3022
                TE+S +F    +D  +     P D  K    D   ++ P +  T +         + 
Sbjct  909   --PTETSILF----KDAQVKHTSKPADAPKTAGMDAEKQSAPVEGDTTIGALPGISSMEQ  962

Query  3023  NSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK-----LEE  3187
              +G   EE+     G   ED  ++  +F   GIHSA++HDAI++    +K+      +E+
Sbjct  963   YAGEIEEEQHAKKEGPNSED-KMMEGIFSRAGIHSAVEHDAIIDGKAGKKVAADPVLIEQ  1021

Query  3188  QASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSK  3367
             +A +VA  AA  LR++  +     +  PTWTG+ G +G              PQ  T+ K
Sbjct  1022  EARKVAAEAARELRRAGEVARTVPIGTPTWTGQFGISG-------------RPQETTAQK  1068

Query  3368  PLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEH-QHQFNSGSSSN  3544
                 +S     RN                      G Q  ++   L+  Q    S     
Sbjct  1069  AFSSNS-----RNRGG-------------------GLQSSSLLANLQQRQGSLASSRDGT  1104

Query  3545  SRT----RAAENGASRPSHGSAGM-QPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS  3709
              RT    R+A++ AS    G+  + Q +   + +  ++   GGS  +  +++HF     +
Sbjct  1105  PRTASPARSADSTASVSRDGTPSLPQGKDFGKLIRDYLTTHGGSVYTQMLIDHFNRFCTT  1164

Query  3710  KDLAL-FKNLLKEIATLKKNPNG-SFWILKPEYQ  3805
                 L FK  LK IA L+K   G   W+LK EY+
Sbjct  1165  PQATLEFKETLKLIARLEKGSRGRGRWVLKDEYK  1198



>ref|XP_003236151.1| DNA repair protein Rhp26/Rad26 [Trichophyton rubrum CBS 118892]
 gb|EGD86946.1| hypothetical protein TERG_03200 [Trichophyton rubrum CBS 118892]
 gb|EZF17179.1| hypothetical protein H100_05477 [Trichophyton rubrum MR850]
 gb|EZF40588.1| hypothetical protein H102_05443 [Trichophyton rubrum CBS 100081]
 gb|EZF51257.1| hypothetical protein H103_05470 [Trichophyton rubrum CBS 288.86]
 gb|EZF61782.1| hypothetical protein H104_05459 [Trichophyton rubrum CBS 289.86]
 gb|EZF72440.1| hypothetical protein H105_05486 [Trichophyton soudanense CBS 
452.61]
 gb|EZF83148.1| hypothetical protein H110_05466 [Trichophyton rubrum MR1448]
 gb|EZF93857.1| hypothetical protein H113_05514 [Trichophyton rubrum MR1459]
 gb|EZG05075.1| hypothetical protein H106_05308 [Trichophyton rubrum CBS 735.88]
 gb|EZG15379.1| hypothetical protein H107_05609 [Trichophyton rubrum CBS 202.88]
 gb|KDB32345.1| hypothetical protein H112_05460 [Trichophyton rubrum D6]
Length=1225

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/706 (48%), Positives = 462/706 (65%), Gaps = 35/706 (5%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L+GG ++P  I+  LFDYQK GV+WLWEL+ Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  377   PDTVLDGGYQLPGDIYPYLFDYQKTGVKWLWELYQQQVGGIIGDEMGLGKTIQVIAFLAG  436

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             +H+S   K P I+VCP T+++QW  E  +W+P F V ILH S +   + K  S++ +  +
Sbjct  437   IHYSKKLKGPIIVVCPPTVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIKSESQAEDRYT  496

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         + S R  K   +++  VL  D  +L+TTY  L+     L+ ++WG AV
Sbjct  497   SGVWGDRN----STSQRGNKAARRILKRVL-EDGHVLVTTYAGLQTYSSLLIPVDWGIAV  551

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  552   LDEGHKIRNPDTSITIHCKELRTSHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  611

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  LRD I PYLL+R K DV A LPKK+E V+FC
Sbjct  612   NQFEFPIRTGGYANASNLQVQTAAKCAETLRDAISPYLLQRFKIDVAADLPKKSEQVLFC  671

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLERE--HSCRDPDYG  2341
              LT VQR+ Y+AFLAS ++  I  G + ALYGID++RKICNHPDL + +   +  D +YG
Sbjct  672   KLTKVQRAAYEAFLASGEMSSILRGRREALYGIDMLRKICNHPDLTQHKILSTKTDYNYG  731

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             +  +SGKM+VV  +L+LWKD GH+ L F+Q + MLDILE F+    G+ YRRMDG TP+K
Sbjct  732   SGAKSGKMQVVKSLLELWKDTGHKTLLFAQHRIMLDILERFIGGFNGFNYRRMDGNTPIK  791

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R +++DEFNN  ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  792   VRQSMVDEFNNDPDLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLG  851

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+ F+  D++DLF L   G 
Sbjct  852   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFQMSDIQDLFTL---GN  908

Query  2879  NGSTESSSIF----------SQLSEDVNITGPQH--------PDQEKDKSIKTNPADHGT  3004
             +G TE+S +F          +   ++   +G Q         P +E+D+ I       G 
Sbjct  909   DGPTETSQMFKDADIVFEDNAAKGKNTGFSGRQQRRRQPENKPVKEEDQKISRVTGVAGM  968

Query  3005  AMERDNNSGSNG--EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK  3178
                 D  SG     +EK          D  ++  +F   G+ SA++HD I++     K  
Sbjct  969   EEYHDETSGPGTPQQEKEAEGESKSKTDARLMENIFSRSGVLSAVEHDQIIHGKRAVKAD  1028

Query  3179  ---LEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
                +E +A RVA  AA  L +++ +        PTWTG+ GTAG P
Sbjct  1029  PKIIETEAKRVAAEAARELLKAKEVARAVPAGTPTWTGQFGTAGRP  1074



>ref|XP_001211380.1| hypothetical protein ATEG_02202 [Aspergillus terreus NIH2624]
 gb|EAU37164.1| hypothetical protein ATEG_02202 [Aspergillus terreus NIH2624]
Length=1192

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/870 (44%), Positives = 521/870 (60%), Gaps = 84/870 (10%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P V  + G ++P  I   LFDYQK GVQWLWEL  Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  375   PDVEYDNGYRLPGDIHPLLFDYQKTGVQWLWELQQQQVGGIIGDEMGLGKTIQVIAFLAG  434

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP+I+VCP T+++QW  E   W+P+F V ILH S +   + +  S+  E+  
Sbjct  435   LHYSKKLTKPAIVVCPATVMKQWVTEFHTWWPAFRVSILHTSGSGMVNIRNESRREEALL  494

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                           S    K   +++  V+  +  +L+TTY  L      L+ +EWG A+
Sbjct  495   SQTWDSRA------SSSGLKAGRRVVKRVV-EEGHVLVTTYSGLLSYASLLIPVEWGCAI  547

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+  K+L+T HRII++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  548   LDEGHKIRNPNTAITIHAKELRTPHRIILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  607

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC
Sbjct  608   NQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKSEQVLFC  667

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              LT +QR  Y+AFLAS +++ I  G + ALYGID++RKICNHPDL   + S     YG  
Sbjct  668   RLTKLQRQSYKAFLASQEMQSILRGRRQALYGIDILRKICNHPDLQSHKFSAHKAAYGGA  727

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
             E+SGKM+VV  +L+LW+D GH+ L F+Q + MLDILE F+ +  G  YRRMDG TP+ QR
Sbjct  728   EKSGKMQVVRSLLELWRDTGHKTLLFAQHRIMLDILEKFVNSLSGINYRRMDGTTPIAQR  787

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
              +++DEFN    + +F+LTT+VGGLG NLTGA+RVII+DPDWNPS DMQARERAWR+GQK
Sbjct  788   QSMVDEFNKDPSLHLFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDMQARERAWRLGQK  847

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             ++VT+YRL+T GTIEEK+YHRQ++K  LTNKIL++P+QR+ F+  DL DLF L DD E+G
Sbjct  848   REVTIYRLMTAGTIEEKIYHRQVFKQFLTNKILRDPKQRQTFQMSDLHDLFSLGDD-EHG  906

Query  2885  STESSSIFSQ----LSEDVNITGPQHPDQE--KDKSIKTNPADHGTAMERDNNSGSNGEE  3046
              TE+S IF+      +ED N    + P  E   D S K N          +  +     E
Sbjct  907   PTETSKIFNNADITYNED-NQGTTRQPKSETNTDVSAKDNREGEKDIRRVEGVAAVENFE  965

Query  3047  KADNNNGDVDEDTS--------ILRTLFDAHGIHSAMDHDAIVNA----HDEEKLKLEEQ  3190
             + +   GD +++ +        I++ +F   G+HSA++HD IVN       + K+ +E +
Sbjct  966   QDEKEPGDQNQEAAPASNSEARIMQGIFARSGVHSALEHDQIVNGKRVIRADPKI-IEAE  1024

Query  3191  ASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP--PSIKKKFGSTLNPQLVTSS  3364
             A RVA  AAE LR++        +  PTWTG+ G AG P  P I+  FG T +       
Sbjct  1025  AKRVAAEAAEELRRAGEAARNVPIGTPTWTGQFGLAGRPEEPPIRSPFGGTSS-------  1077

Query  3365  KPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSN  3544
                      S+RR G                     G    +I   L         S+ N
Sbjct  1078  ---------SARRAGA--------------------GPSSASILANL---------SARN  1099

Query  3545  SRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHF-RSRVPSKDLA  3721
               +R+A N  + P    +G+    +IR    FI   GG+  +  +++HF R     +  A
Sbjct  1100  PVSRSASNSPA-PGRSPSGVDFITMIRD---FITSHGGAVYTQMLIDHFNRYCTTPQRSA  1155

Query  3722  LFKNLLKEIATLKKNP-NG-SFWILKPEYQ  3805
              FK +LK IA L+K   NG   W LKPEY+
Sbjct  1156  EFKEMLKTIAVLEKGGRNGRGKWSLKPEYR  1185



>gb|EMR85305.1| putative dna repair protein rhp26 protein [Botrytis cinerea BcDW1]
Length=1188

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/707 (49%), Positives = 456/707 (64%), Gaps = 36/707 (5%)
 Frame = +2

Query  1265  GPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFL  1444
             G P    E GLK+P  IF  LFDYQK GVQWL ELH Q+ GGIIGDEMGLGKT+Q+++FL
Sbjct  393   GQPDHEFENGLKLPGDIFPALFDYQKTGVQWLSELHNQQVGGIIGDEMGLGKTIQMISFL  452

Query  1445  GSLHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshes  1621
               LH+S    KP I+V P T+L+QW  E  +W+P+  V ILH S     +     +  + 
Sbjct  453   AGLHYSKKLTKPVIVVAPATVLRQWVNEFHRWWPALRVSILHSSGTGMLNVGNEDRLEDD  512

Query  1622  dseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGY  1801
             D E                  K  D+++ H       +L+TTY  L+     L++++W Y
Sbjct  513   DDEILYGQTTKKAPKSQKLAQKIVDRVVKH-----GHVLVTTYAGLQTYSNTLINVDWDY  567

Query  1802  AVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPV  1981
             AVLDEGH+IRNPNT VT+ CK+L+T +R+I++G+P+QN L ELWSLFDFVFP +LG L  
Sbjct  568   AVLDEGHKIRNPNTAVTIYCKELRTPNRVILSGTPMQNGLVELWSLFDFVFPMRLGTLVN  627

Query  1982  FEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVI  2161
             F   F VPI IGGYANAT LQV TA +CA  L+D I PYLL+R+K DV A LPKK+E V+
Sbjct  628   FRQAFEVPIKIGGYANATNLQVLTATKCAETLKDAISPYLLQRLKVDVAADLPKKSEQVL  687

Query  2162  FCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDY-  2338
             FC LT  QR  Y+ FLAS D++ I + S+ +LYGID++RKICNHPDLL++    + PDY 
Sbjct  688   FCKLTRPQRDAYEMFLASDDMKSILNRSRQSLYGIDILRKICNHPDLLDKRLKNK-PDYK  746

Query  2339  -GNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATP  2512
              GN  +SGKM+VV  +L++WK  GH+ L FSQ  QMLDILE F+   GG+ Y RMDG T 
Sbjct  747   WGNGNKSGKMQVVKALLQMWKGYGHKTLLFSQGVQMLDILEEFVKKLGGFNYLRMDGGTA  806

Query  2513  VKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWR  2692
             VK R  L+D+FNN  E+ +F+LTT+VGGLG NLTGANRVIIFDPDWNPS D+QARERAWR
Sbjct  807   VKDRQTLVDQFNNDPEMHVFLLTTKVGGLGVNLTGANRVIIFDPDWNPSTDVQARERAWR  866

Query  2693  IGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDD  2872
             +GQKK+VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F  +DL DLF L D 
Sbjct  867   LGQKKEVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFAMKDLYDLFTLGDQ  926

Query  2873  GENGSTESSSIFSQLSEDVNIT-----------GPQHPDQEKDKSIKTNPADHGTAMERD  3019
              + G TE+  +F         T            P   D E D       A+    +E+ 
Sbjct  927   -DGGITETGEMFKGTEVQFKKTSSPLSSRSLSVDPGQGDSESDLRNLAGVAE----LEQF  981

Query  3020  NNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDE---EKLKLEEQ  3190
             N+     EEK  +NN    E++ ++  +F   G+HSA++HD I+N   +   ++  +E +
Sbjct  982   NDP---SEEKDKDNN----EESRLMEGIFARSGVHSALEHDQIINGKMKVAADRGMIERE  1034

Query  3191  ASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFG  3331
             A R+A  +A ALR++       +    TWTG  G+AG P ++++  G
Sbjct  1035  AKRIAAESATALRRAGEAARSIAPGTVTWTGEYGSAGRPTNVRRGAG  1081



>ref|XP_007679886.1| hypothetical protein BAUCODRAFT_42604, partial [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC92968.1| hypothetical protein BAUCODRAFT_42604, partial [Baudoinia compniacensis 
UAMH 10762]
Length=1182

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/697 (48%), Positives = 467/697 (67%), Gaps = 31/697 (4%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
              + EGGL++P  I+  LFDYQK GVQWLWEL+ Q+ GGIIGDEMGLGKT+Q+++FL SLH
Sbjct  358   TVFEGGLRVPGDIYPSLFDYQKTGVQWLWELYSQQVGGIIGDEMGLGKTIQIISFLASLH  417

Query  1457  FSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             +S+   KP I+VCP T+++QW  E  +W+P   V ILH S +   D K+ ++  +     
Sbjct  418   YSDKLTKPIIVVCPATVMKQWVNEFHRWWPPLRVSILHTSGSGMLDIKREARIEDDLEVD  477

Query  1634  eelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLD  1813
                           +  K   ++++ V+  D  +L+TTY  L+   E L+  +W YAVLD
Sbjct  478   MYGRKKATMN----KGHKAAKRIVDRVV-RDGHVLVTTYSGLQTYAELLIPTDWEYAVLD  532

Query  1814  EGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAE  1993
             EGH+IRNPNT +T+ CK+L+T +R+I++G+P+QN L+ELWSLFDFVFP +LG L  F ++
Sbjct  533   EGHKIRNPNTAITIYCKELRTHNRVILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFRSQ  592

Query  1994  FAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSL  2173
             F +PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC L
Sbjct  593   FEIPIKQGGYANASNLQVETAMKCAETLKDTISPYLLQRFKVDVAADLPKKSERVLFCKL  652

Query  2174  TSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DYGNP  2347
             T +QR  Y+ FLAS +++ I  G + ALYG+D++RKICNHPDL+E +   +    +YG+ 
Sbjct  653   TKLQREAYEWFLASEEMKSILSGKRQALYGVDILRKICNHPDLVEHKTLSKKAGYNYGSG  712

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV-TGGYKYRRMDGATPVKQR  2524
              +SGKM+VV  +L++WK  GH+ L F+Q + MLDILE F+    G+ YRRMDG T +K R
Sbjct  713   HKSGKMQVVKALLEIWKRDGHKTLLFAQHRIMLDILETFIQGMDGFNYRRMDGNTSIKDR  772

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               L+DEFN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  773   QDLVDEFNKDQDLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLGQK  832

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             ++V +YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+ F+ RDL DLF L  +  +G
Sbjct  833   REVEIYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPRQRQTFQLRDLHDLFTLG-ESRDG  891

Query  2885  STESSSIFSQLSEDVNITGPQHPDQEKD-KSIKTNPADHGTAMERDNNSGSNGEEKADNN  3061
              TE+ SIF     +V ++G +   + KD +S+ T P D G A     + G  G  + +N 
Sbjct  892   ETETGSIFK--GTEVQLSGAKKTARVKDEESLPTPPEDRGHA---GVSEGIAGVSRQENY  946

Query  3062  NGDVD------------EDTSILRTLFDAHGIHSAMDHDAIVNAHD---EEKLKLEEQAS  3196
              G+VD            ++  +L ++F   G+ SA++HDAI+       E+   +  +A 
Sbjct  947   RGNVDEDKDDEEQDSEAKNDRMLSSIFARTGVQSALEHDAILTGKKIAREDPETIAREAK  1006

Query  3197  RVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
             RVA +AA+ L+++  +       +PTWTG  GTAG P
Sbjct  1007  RVAAQAAKELQRAGEIARTVPAGVPTWTGTFGTAGRP  1043



>ref|XP_447327.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG60264.1| unnamed protein product [Candida glabrata]
Length=1071

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/705 (49%), Positives = 468/705 (66%), Gaps = 38/705 (5%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  IF  LF+YQK GVQWL+EL  Q+ GGIIGDEMGLGKT+QV AFL +
Sbjct  279   PDAKLNNEFKIPGEIFSLLFNYQKTGVQWLYELFQQRRGGIIGDEMGLGKTIQVTAFLAA  338

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHD---SVNDFhdkkkgskshe  1618
             LH SN    P +IVCP T+++QW  E  +W+P F   ILH     +ND  +  +    + 
Sbjct  339   LHHSNLLSGPVLIVCPATVMKQWCNEIHQWWPPFRAVILHSIGAGMNDKSNLTEDEIENM  398

Query  1619  sdseseelldvdvekNLSFRNTK-----KWDKLINHVLGSDSGLLITTYEQLRLLGEKLL  1783
                   E  D    +N S   +K         LI+ V+ +D  ++ITTY  LR+  +KLL
Sbjct  399   IIKSELENTDFHDYENASKLKSKVETGMHMQNLISKVV-ADGHIIITTYVGLRIHSDKLL  457

Query  1784  DIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGK  1963
             ++ W Y VLDEGH+IRNP+++++L CK+L+  +RII++G+PIQN L ELWSLFDF++PG+
Sbjct  458   NVNWSYCVLDEGHKIRNPDSEISLTCKKLKCKNRIILSGTPIQNNLVELWSLFDFIYPGR  517

Query  1964  LGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPK  2143
             LG LPVF+ +F  PI++GGYANAT  QV T YRCAV LRDLI PYLLRR+KADV   LPK
Sbjct  518   LGTLPVFQQQFVQPINMGGYANATNTQVQTGYRCAVALRDLISPYLLRRVKADVAKDLPK  577

Query  2144  KTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSC  2323
             K E V+FC LT  QR  Y  FL+S ++ QI  G ++ LYGID++RKICNHPDLL+R++  
Sbjct  578   KKEMVLFCKLTEFQRRKYLEFLSSDELSQIKGGKRHVLYGIDILRKICNHPDLLDRDYIK  637

Query  2324  RDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV-----TGGYKY  2488
                 YG+P+RSGKM+VV ++LKLWK +GH+ L F+Q++QMLDILE F+          +Y
Sbjct  638   NTSGYGDPKRSGKMQVVKQLLKLWKSEGHKTLLFTQSRQMLDILEEFIKFKEPELSDIRY  697

Query  2489  RRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDM  2668
              RMDG T ++ R  L+D FNN     +F+LTTRVGGLG NLTGANR+II+DPDWNPS D+
Sbjct  698   LRMDGTTSIQVRQTLVDRFNNE-SYDVFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDL  756

Query  2669  QARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLK  2848
             QARERAWRIGQK++V++YRL+  GTIEEK+YHRQI+K  L NK+L +P+Q+R FK ++L+
Sbjct  757   QARERAWRIGQKREVSIYRLMISGTIEEKIYHRQIFKQFLMNKVLSDPKQKRFFKTKELQ  816

Query  2849  DLFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIK-TNPADHGTAMERDN  3022
             DLF L   GE G STE+      L+E+V     +H  + KD+S K ++  D  T ++  +
Sbjct  817   DLFSLG--GEQGYSTET------LNEEV----EKHTKKLKDESTKDSDDLDQVTNLDGVS  864

Query  3023  --NSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKL-EEQA  3193
                S  +G+E +++N  D   D  ++  L     + +   H+ ++ +H     K+ + +A
Sbjct  865   KLESFYDGKEVSESNKED---DERLMEGLLGEKSLENIATHEQMIKSHSVGSSKIVKREA  921

Query  3194  SRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGA--PPSIKK  3322
              R+A +A EALR SR    +  +  PTWTG+ GTAG    P++KK
Sbjct  922   ERIANQALEALRISRKETKKYDIGTPTWTGKFGTAGKVNKPNLKK  966



>emb|CCD51337.1| similar to DNA repair protein Rhp26/Rad26 [Botrytis cinerea T4]
Length=1209

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/707 (49%), Positives = 456/707 (64%), Gaps = 36/707 (5%)
 Frame = +2

Query  1265  GPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFL  1444
             G P    E GLK+P  IF  LFDYQK GVQWL ELH Q+ GGIIGDEMGLGKT+Q+++FL
Sbjct  414   GQPDHEFENGLKLPGDIFPALFDYQKTGVQWLSELHNQQVGGIIGDEMGLGKTIQMISFL  473

Query  1445  GSLHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshes  1621
               LH+S    KP I+V P T+L+QW  E  +W+P+  V ILH S     +     +  + 
Sbjct  474   AGLHYSKKLTKPVIVVAPATVLRQWVNEFHRWWPALRVSILHSSGTGMLNVGNEDRLEDD  533

Query  1622  dseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGY  1801
             D E                  K  D+++ H       +L+TTY  L+     L++++W Y
Sbjct  534   DDEILYGQTTKKAPKSQKLAQKIVDRVVKH-----GHVLVTTYAGLQTYSNTLINVDWDY  588

Query  1802  AVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPV  1981
             AVLDEGH+IRNPNT VT+ CK+L+T +R+I++G+P+QN L ELWSLFDFVFP +LG L  
Sbjct  589   AVLDEGHKIRNPNTAVTIYCKELRTPNRVILSGTPMQNGLVELWSLFDFVFPMRLGTLVN  648

Query  1982  FEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVI  2161
             F   F VPI IGGYANAT LQV TA +CA  L+D I PYLL+R+K DV A LPKK+E V+
Sbjct  649   FRQAFEVPIKIGGYANATNLQVLTATKCAETLKDAISPYLLQRLKVDVAADLPKKSEQVL  708

Query  2162  FCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDY-  2338
             FC LT  QR  Y+ FLAS D++ I + S+ +LYGID++RKICNHPDLL++    + PDY 
Sbjct  709   FCKLTRPQRDAYEMFLASDDMKSILNRSRQSLYGIDILRKICNHPDLLDKRLKNK-PDYK  767

Query  2339  -GNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATP  2512
              GN  +SGKM+VV  +L++WK  GH+ L FSQ  QMLDILE F+   GG+ Y RMDG T 
Sbjct  768   WGNGNKSGKMQVVKALLQMWKGYGHKTLLFSQGVQMLDILEEFVKKLGGFNYLRMDGGTA  827

Query  2513  VKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWR  2692
             VK R  L+D+FNN  E+ +F+LTT+VGGLG NLTGANRVIIFDPDWNPS D+QARERAWR
Sbjct  828   VKDRQTLVDQFNNDPEMHVFLLTTKVGGLGVNLTGANRVIIFDPDWNPSTDVQARERAWR  887

Query  2693  IGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDD  2872
             +GQKK+VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F  +DL DLF L D 
Sbjct  888   LGQKKEVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFAMKDLYDLFTLGDQ  947

Query  2873  GENGSTESSSIFSQLSEDVNIT-----------GPQHPDQEKDKSIKTNPADHGTAMERD  3019
              + G TE+  +F         T            P   D E D       A+    +E+ 
Sbjct  948   -DGGITETGEMFKGTEVQFKKTSSPSSSRSLSVDPGQGDSESDLRNLAGVAE----LEQF  1002

Query  3020  NNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDE---EKLKLEEQ  3190
             N+     EEK  +NN    E++ ++  +F   G+HSA++HD I+N   +   ++  +E +
Sbjct  1003  NDP---SEEKDKDNN----EESRLMEGIFARSGVHSALEHDQIINGKMKVAADRGMIERE  1055

Query  3191  ASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFG  3331
             A R+A  +A ALR++       +    TWTG  G+AG P ++++  G
Sbjct  1056  AKRIAAESATALRRAGEAARSIAPGTVTWTGEYGSAGRPTNVRRGAG  1102



>emb|CDF90213.1| ZYBA0S06-03334g1_1 [Zygosaccharomyces bailii CLIB 213]
Length=1038

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/873 (42%), Positives = 520/873 (60%), Gaps = 79/873 (9%)
 Frame = +2

Query  827   ETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQDNGDLVSTSLANAIQ----SIS  994
             E+++D LVR G LT F   +GFE    E  Q S +  Q   D V  S  +  +    SI 
Sbjct  129   ESDRDFLVRTGQLTAFGTKRGFEIA-SESDQESSNETQGETDAVDQSPKSDTEYKEESIV  187

Query  995   EAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRKRRPTPGKKWRV  1174
              +++      L  S++  K +   Y +Q      ++ Q ++N   D++        +W  
Sbjct  188   YSSEDESDVILKPSAV--KDDGDEYYYQK-----RLRQWSKNRAEDRKSDSNPDWPEWWK  240

Query  1175  KVSRENKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQ  1354
             K         PD                    P   L+   KIP  I+  LFDYQ+  VQ
Sbjct  241   K--------HPDF-------------------PDAKLDDQFKIPGEIYSLLFDYQRTCVQ  273

Query  1355  WLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYK-PSIIVCPLTLLQQWKREAK  1531
             WL+EL+ QK GGIIGDEMGLGKT+Q++AFL +LH SN    P+I+VCP T+++QW  E  
Sbjct  274   WLYELYQQKCGGIIGDEMGLGKTIQIIAFLAALHHSNLLNGPTIVVCPATVMKQWCNEFH  333

Query  1532  KWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINH  1711
              W+P F   ILH             K   S++E EE++        S+ + +  DK  +H
Sbjct  334   HWWPPFRTVILHS-----IGAGMSGKKKMSEAELEEVIMSSEPSQFSYEDFQNSDKTKSH  388

Query  1712  V------------LGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTL  1855
             +            + +   ++ITTY  LR+  + LL + W YA+LDEGH+IRNP++D++L
Sbjct  389   IESNNLLQSLIDKVVTKGHIIITTYVGLRVHADMLLKVNWAYAILDEGHKIRNPDSDISL  448

Query  1856  VCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANAT  2035
              CK L+T +RII++G+PIQN L+ELWSLFDF+FPGKLG LP+F+ +F  PI++GGYANA+
Sbjct  449   TCKALKTPNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPIFQQQFVQPINMGGYANAS  508

Query  2036  PLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLAS  2215
              +QV T Y+CAV LRDLI PYLLRR+KADV   LP+K E V+FC LT +QR  Y  FL S
Sbjct  509   NIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPEKKEMVLFCKLTQIQRRKYLEFLHS  568

Query  2216  TDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLW  2395
              ++++I  G +  L+GID++RKICNHPDLLER     +  YG+P+RSGKM+VV ++L LW
Sbjct  569   RELDEIKGGKRKVLFGIDILRKICNHPDLLERNERRNETSYGDPKRSGKMQVVKQLLLLW  628

Query  2396  KDQGHRVLFFSQTQQMLDILENFLV-----TGGYKYRRMDGATPVKQRMALIDEFNNTVE  2560
             K +GH+ L F+Q++QMLDILE F+          K+ RMDG T +  R +L+DEFN    
Sbjct  629   KKEGHKALLFTQSRQMLDILEEFIAFKDEELSALKFLRMDGTTSISVRQSLVDEFNKG-N  687

Query  2561  IFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRG  2740
               +F+LTTRVGGLG NLTGANR+IIFDPDWNPS DMQARERAWRIGQ ++V++YRL+  G
Sbjct  688   YDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWRIGQTREVSIYRLMVTG  747

Query  2741  TIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLS  2920
             +IEEK+YHRQI+K  LTNKIL +P+Q+R FK  +L+DLF L  +  + + E  S   + +
Sbjct  748   SIEEKIYHRQIFKQFLTNKILSDPKQKRFFKMNELQDLFTLGGENGHATEELESEVQKRT  807

Query  2921  EDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRT  3100
             E +  +  +  D + ++ I  N    G +      +G   + K         ED  ++  
Sbjct  808   EGLKSSKTEESD-DFEEVISLN----GVSKLESFYTGKEPQSKFKK------EDDRLIEG  856

Query  3101  LFDAHGIHSAMDHDAIVNAHDEEKLK-LEEQASRVAQRAAEALRQSRMLRSQESVAIPTW  3277
             L    G+ SA  HD+++ +H +     +  +AS++A+ A +ALR+SR  R +  +  PTW
Sbjct  857   LLGESGLASAASHDSMIESHSKGSSDIISREASKLAEAAVKALRKSRRERKKFDIETPTW  916

Query  3278  TGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             TGR G AG    I KK  +T N + + SS  LE
Sbjct  917   TGRFGQAG---KIGKKSSAT-NRRSIGSSAILE  945



>gb|EZF36106.1| hypothetical protein H101_00388 [Trichophyton interdigitale H6]
 gb|KDB24182.1| hypothetical protein H109_03922 [Trichophyton interdigitale MR816]
Length=1225

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/706 (48%), Positives = 462/706 (65%), Gaps = 35/706 (5%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L+GG ++P  I+  LFDYQK GV+WLWEL+ Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  377   PDTVLDGGYQLPGDIYPYLFDYQKTGVKWLWELYQQQVGGIIGDEMGLGKTIQVIAFLAG  436

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             +H+S   K P I+VCP T+++QW  E  +W+P F V ILH S +   + K  S++ +  +
Sbjct  437   IHYSKKLKGPIIVVCPPTVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIKSESQAEDRYT  496

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         + S R  K   +++  VL  D  +L+TTY  L+     L+ ++WG AV
Sbjct  497   SGVWGDRN----STSQRGNKAARRILKRVL-EDGHVLVTTYAGLQTYSSLLIPVDWGIAV  551

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  552   LDEGHKIRNPDTSITIHCKELRTSHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  611

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC
Sbjct  612   NQFEFPIRTGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKMDVAADLPKKSEQVLFC  671

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLERE--HSCRDPDYG  2341
              LT VQR+ Y+AFLAS ++  I  G + ALYGID++RKICNHPDL + +   +  D +YG
Sbjct  672   KLTKVQRAAYEAFLASGEMSSILRGRREALYGIDMLRKICNHPDLTQHKVLSTKTDYNYG  731

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             +  +SGKM+VV  +L+LWKD GH+ L F+Q + MLDILE F+    G+ YRRMDG TP+K
Sbjct  732   SGAKSGKMQVVKSLLELWKDTGHKTLLFAQHRIMLDILERFIRGFDGFNYRRMDGNTPIK  791

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R +++DEFNN  ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  792   VRQSMVDEFNNDPDLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLG  851

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+ F+  D++DLF L   G 
Sbjct  852   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFQMSDIQDLFTL---GN  908

Query  2879  NGSTESSSIFSQ---LSEDVNITG--------------PQH-PDQEKDKSIKTNPADHGT  3004
             +G TE+S +F     + ED    G              P++ P +E+D+ I       G 
Sbjct  909   DGPTETSQMFKDADIVYEDDAAKGKNAKSSGRQKGRRQPENKPVKEEDQKISRVTGVAGM  968

Query  3005  AMERDNNSGSNG--EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK  3178
                 D  SG     +EK          D  ++  +F   G+ SA++HD I++     K  
Sbjct  969   EEYHDETSGPGTPQQEKEAEGESKTKTDARLMENIFSRSGVLSAVEHDQIIHGKRAVKAD  1028

Query  3179  ---LEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
                +E +A RVA  AA  L ++  +        PTWTG+ GTAG P
Sbjct  1029  PKIIETEAKRVAAEAARELLKAEEVARTVPAGTPTWTGQFGTAGRP  1074



>emb|CCJ28090.1| unnamed protein product, partial [Pneumocystis jirovecii]
Length=876

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/693 (48%), Positives = 447/693 (65%), Gaps = 51/693 (7%)
 Frame = +2

Query  1319  DKLFDYQKV-----GVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYK-PS  1480
             D+ + YQ       G+QWLWELHCQ  GGII DEMGLGKT+Q++ FLG LH+S     P 
Sbjct  213   DQTYQYQDFSCIDDGIQWLWELHCQGVGGIIADEMGLGKTIQIVGFLGGLHYSQKLSGPI  272

Query  1481  IIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdve  1660
             +IVCP T+++QW  E  KW+P F V ILH +                + E +   D  ++
Sbjct  273   LIVCPATIMRQWVAEFHKWWPPFRVVILHTT------GSALIDIKHEELEKQFEDDKFLK  326

Query  1661  kNLSFRNTKKWDKLINHVLGSDSG-LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNP  1837
               +SF++    +           G  LI TY  LR+  E L   +W Y +LDEGH+IRNP
Sbjct  327   NTVSFKSKVIKNIKKIIEKVKTLGHALIITYSGLRVYREYLFPNKWAYCILDEGHKIRNP  386

Query  1838  NTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIG  2017
             ++DV+ +CKQ++T HRII++G+PIQN L ELWSLFDF+FPG LG LP+F+++FA+PI+IG
Sbjct  387   DSDVSFICKQIKTPHRIILSGTPIQNNLEELWSLFDFIFPGHLGTLPIFQSQFAIPINIG  446

Query  2018  GYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIY  2197
             GYANAT +QV TAY+CA VLRDLI PYLLRRMKAD+   LP K+E V+FC LT  Q+  Y
Sbjct  447   GYANATNIQVQTAYKCACVLRDLISPYLLRRMKADMAVDLPSKSEQVLFCKLTEFQKEAY  506

Query  2198  QAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCR--DPDYGNPERSGKMKV  2371
             ++FL S D++ I +G K  LYGID++RKICNHPDL+ RE   +  D +YG+P +SGKM V
Sbjct  507   RSFLNSKDMDLILEGKKQILYGIDILRKICNHPDLIYRETFLKNNDIEYGDPRKSGKMLV  566

Query  2372  VAEVLKLWKDQGHRVLFFSQTQQMLDILENFL-VTGGYKYRRMDGATPVKQRMALIDEFN  2548
             + E+LKLWK QGHR L F+QT+QMLDILE F+     + Y RMDG T +  R +L+D+FN
Sbjct  567   IKEILKLWKKQGHRTLLFAQTKQMLDILEKFIKKMDQFSYCRMDGGTSISSRQSLVDKFN  626

Query  2549  NTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRL  2728
             N+ +I IF+LTT+VGGLG NLTGANRVIIFDPDWNPS D+QARERAWR+GQKKDV +YRL
Sbjct  627   NSNDIDIFLLTTKVGGLGINLTGANRVIIFDPDWNPSTDLQARERAWRLGQKKDVIIYRL  686

Query  2729  ITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIF  2908
             +T GTIEEK+YHRQI+K  LTNKILK+P+QRR FKA DL DLF L  D  +G TE+  IF
Sbjct  687   MTSGTIEEKIYHRQIFKQFLTNKILKDPKQRRFFKATDLYDLFSLKSDDTDG-TETGEIF  745

Query  2909  -------SQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNN-  3064
                     ++   +NI+  ++ +   +  +K  P             G  G E   N+  
Sbjct  746   IGTERIYHKVKSSLNIS--ENKNTNDNDKLKFIP-------------GVTGLENFINDTL  790

Query  3065  GDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRML  3244
                D +T IL  +F   G+ SA+ HD I+N+  +E   +E++      ++ E ++     
Sbjct  791   SKKDNETQILEDIFVKSGVCSALQHDVIMNSSHQEVTLIEKEGQVSDHKSTELVK-----  845

Query  3245  RSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLN  3343
                   +I  +    G   +   I ++FG+++N
Sbjct  846   ------SICEFISMKGGKVSSADIVERFGTSVN  872



>ref|XP_002482676.1| DNA repair protein Rhp26/Rad26, putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED18684.1| DNA repair protein Rhp26/Rad26, putative [Talaromyces stipitatus 
ATCC 10500]
Length=1210

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/691 (48%), Positives = 453/691 (66%), Gaps = 19/691 (3%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P    +GG ++P  IF  LFDYQK GVQWLWEL+ Q+ GGIIGDEMGLGKT+QV++FL  
Sbjct  404   PDAEYDGGYRVPGDIFPVLFDYQKTGVQWLWELYQQQVGGIIGDEMGLGKTIQVISFLAG  463

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S    KP I+V P T+++QW  E  +W+P F V ILH S +   + +  S    + +
Sbjct  464   LHHSRLLNKPVIVVAPATVMKQWVTEFHRWWPPFRVSILHTSGSGMINVRSESNRENALT  523

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                           + +  K   K++  V+  +  +L+TTY  L+     L+ ++W  A+
Sbjct  524   NEMWDPSRPYTMTKAQKTAK---KIVQRVV-EEGHVLVTTYSGLQTYAPVLIPVDWDCAI  579

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+ CK+L+T HR+I++G+P+QN LSELWSLFDFVFP +LG L  F 
Sbjct  580   LDEGHKIRNPNTSITIHCKELRTPHRLILSGTPMQNNLSELWSLFDFVFPMRLGTLVDFR  639

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA RCA  L+D I PYLL+R K DV + LPKK+E V+FC
Sbjct  640   NQFEFPIRQGGYANASNLQVQTAARCAETLKDAISPYLLQRFKVDVASDLPKKSEQVLFC  699

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNP  2347
              L+ +QR  Y+ FL S +   IF G +  LYG+D++RKICNHPDL+  +       YG+ 
Sbjct  700   KLSPLQRKAYEQFLNSQECNSIFAGRRQVLYGVDMLRKICNHPDLVTHKLFSTTTGYGDA  759

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
              +SGKM+VV  +L+LWKD GH+ L F+Q + ML+ILE F+ T  G+ YRRMDG TP+ +R
Sbjct  760   SKSGKMQVVKALLELWKDTGHKTLLFAQHRIMLNILEKFVNTLSGFNYRRMDGDTPIHRR  819

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               L+DEFNN+ +I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS DMQARERAWR+GQK
Sbjct  820   QLLVDEFNNSPDIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDMQARERAWRLGQK  879

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             ++VT+YRL+T GTIEEK+YHRQI+K  LTNK+LK+P+QR+ F+  +L DLF L   GE G
Sbjct  880   REVTIYRLMTAGTIEEKIYHRQIFKQFLTNKVLKDPKQRQTFEMSNLHDLFSL---GEEG  936

Query  2885  STESSSIFSQ--LSEDVNITGPQHPDQEKDKSIK----TNPADHGTAMERDNNSGSNGEE  3046
              TE+S++F      ++   T  + P  E+  SI         +   A+E  +      E+
Sbjct  937   QTETSNMFKTEVTYQEKGETKEKKPGTEQAVSISDEKDIQKVEGIAAVEHFHEDVDEAED  996

Query  3047  KADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHD---EEKLKLEEQASRVAQRAA  3217
             K + +NG    +  ++ T+F   G+HSA++HD I+N       ++  +E +A R+A  AA
Sbjct  997   KGE-DNGAPRSEARLMETIFAQSGVHSALEHDRIINGKKIIAPDRTIIEAEAKRLAAEAA  1055

Query  3218  EALRQSRMLRSQESVAIPTWTGRSGTAGAPP  3310
             E LR++        V  PTWTG+ G AG PP
Sbjct  1056  EKLRKAEQTARSVPVGTPTWTGQFGIAGRPP  1086



>emb|CDK25202.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=1104

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/696 (49%), Positives = 467/696 (67%), Gaps = 25/696 (4%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
              +L    ++P  I   LFDYQK  VQWLWEL+ QK GGI+GDEMGLGKT+Q++AFL  LH
Sbjct  336   AVLNDDYRLPGDIHPALFDYQKTCVQWLWELYTQKTGGIVGDEMGLGKTIQIIAFLAGLH  395

Query  1457  FSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             +S    KP+IIVCP T+L QW  E  +W+P+F V ILH   +    K  GS S E + + 
Sbjct  396   YSGKLTKPAIIVCPATVLNQWSNEFHRWWPAFRVVILHSIGSGLSGKAGGSASAEDEEQM  455

Query  1634  eelldvdvekN--------LSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDI  1789
              E++ +D E           S +   +   L + V      +++TTY  LR+  + LL+ 
Sbjct  456   LEMMMMDQEYEDPGIRKSAASMKTEMRIRDLTDRVF-EKGHVILTTYAGLRIYAKTLLNR  514

Query  1790  EWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLG  1969
             +WGYAVLDEGH+IRNP+++V+LVCK+L+T +RII++G+PIQN L ELWSLFDFVFPG+LG
Sbjct  515   QWGYAVLDEGHKIRNPDSEVSLVCKRLRTYNRIILSGTPIQNNLVELWSLFDFVFPGRLG  574

Query  1970  VLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKT  2149
              LPVF+ +FA PI++GG+ANAT +QV   Y+CAVVLRDLI  YLLRR+KADV   LPKK 
Sbjct  575   TLPVFQQQFADPINVGGFANATNVQVQAGYKCAVVLRDLISAYLLRRVKADVAKDLPKKN  634

Query  2150  EHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCR-  2326
             E V+FC LTS QR++Y+ FL S ++  I+   +N L+G+DV+RKICN PDL+E     + 
Sbjct  635   EMVLFCKLTSYQRALYERFLKSEEMMSIWGRKRNMLFGVDVLRKICNFPDLVEPNMQKKL  694

Query  2327  --DPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL------VTGG-  2479
               D      E+SGK+ VV  +L+LW+ +GH+ L F+QT+QML+++E F+       T G 
Sbjct  695   QADTTIKFTEKSGKLAVVKMLLELWRKEGHKALIFTQTRQMLNVMERFISSLNNECTDGS  754

Query  2480  --YKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWN  2653
               ++Y RMDGAT +  R  L+D FN   E  +F+LTTRVGGLG NLTGANRVII+DPDWN
Sbjct  755   KPFRYLRMDGATSIGNRQDLVDTFNTDPEYSVFLLTTRVGGLGVNLTGANRVIIYDPDWN  814

Query  2654  PSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFK  2833
             PS D+QARERAWR+GQKKDV+++RL+  G+IEEK+YHRQI+K  L+NKILK+P+Q+R FK
Sbjct  815   PSTDVQARERAWRLGQKKDVSIFRLMIAGSIEEKIYHRQIFKQFLSNKILKDPKQKRFFK  874

Query  2834  ARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAME  3013
               DL DLF L D    G TE+  +F+   +       +   + K+  ++      G + +
Sbjct  875   MNDLHDLFSLGDTDGKG-TETGDMFAGSEKSFGKESKRSSRKRKNSGLEEVSGISGVS-K  932

Query  3014  RDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQA  3193
                    + E+  ++  GD   D+SI+  LF   GIHSA+ HDAI+ +  E+ L ++ ++
Sbjct  933   VQKFKEEDEEKPKESTEGDSKGDSSIMADLFSETGIHSALQHDAIMESSHEQIL-VDRES  991

Query  3194  SRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAG  3301
             S++A+RA +ALR+SR+   +  +  PTWTGRSG AG
Sbjct  992   SQIAERAKQALRESRIETRRAGIGKPTWTGRSGEAG  1027



>ref|XP_003288733.1| hypothetical protein DICPUDRAFT_153008 [Dictyostelium purpureum]
 gb|EGC34733.1| hypothetical protein DICPUDRAFT_153008 [Dictyostelium purpureum]
Length=1544

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/892 (41%), Positives = 524/892 (59%), Gaps = 115/892 (13%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             ++   KIP  I+  LF+YQ  GV+WL+ELHCQ+AGGI+GDEMGLGKT+Q+++FL SLH+S
Sbjct  713   IDENFKIPFDIYKNLFEYQVTGVRWLYELHCQEAGGIVGDEMGLGKTIQIVSFLASLHYS  772

Query  1463  NAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                  P++IV P TLL  W +E  KW+P F V + H S +                    
Sbjct  773   RRLGGPALIVAPATLLSNWVKEFHKWWPPFRVGLFHSSSS--------------------  812

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                           +   D ++  +  S   +L+TT+EQ+R+  + LL+  W Y +LDEG
Sbjct  813   --------------SLSKDDIVKKI-ASKGHILLTTFEQIRIHQDILLEHHWDYVILDEG  857

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP+ +VTL CKQ QT HRII++GSPIQNKL+ELWSLFDFV+PGKLG LP+F+ +F+
Sbjct  858   HKIRNPDAEVTLSCKQFQTCHRIILSGSPIQNKLTELWSLFDFVYPGKLGTLPIFKTQFS  917

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PIS+GG+ANA+P+QV TAY+CAV LRDLI PY+LRR+KADV   LP K E V+ C LT+
Sbjct  918   LPISVGGFANASPIQVQTAYKCAVALRDLISPYMLRRIKADVLKSLPSKNEQVLMCPLTN  977

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRD--PDYGNPER  2353
              Q  +Y  FL S D++ + +G +NALYGID+++KI NHPD+L  +    D   DYGN  R
Sbjct  978   FQEKLYLEFLDSNDIKSVLEGRRNALYGIDILKKISNHPDILHMDPHDEDRPEDYGNINR  1037

Query  2354  SGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV-TGGYKYRRMDGATPVKQRMA  2530
             S K++VV ++L LW  QG +VL F QT+QMLDI+E ++  +  + Y RMDG T VK R +
Sbjct  1038  SAKLRVVDQILPLWYKQGDKVLLFCQTRQMLDIVEAYIRNSTTFNYLRMDGTTSVKHRQS  1097

Query  2531  LIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKD  2710
             L++EFN   ++FIF+LTT+VGGLG NLTGANRVI+FDPDWNPS D QARER +RIGQKK 
Sbjct  1098  LVEEFNLDEKLFIFLLTTKVGGLGLNLTGANRVILFDPDWNPSTDTQARERVYRIGQKKS  1157

Query  2711  VTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGST  2890
             VT+YRL+T GTIEEK+YHRQIYK  LTNKILK+P+Q+R FK++  K+LF  +    N  +
Sbjct  1158  VTIYRLVTLGTIEEKIYHRQIYKQFLTNKILKDPRQKRFFKSKHFKELFTYS--KSNKGS  1215

Query  2891  ESSSIFSQLSEDV-----------------------------NITGPQHPDQEKDKSIKT  2983
             E+ +IFS+ + ++                             +   P  P ++ +  I +
Sbjct  1216  ETGNIFSESNSEILPEHMKDSDNEEDINNNNNNNKSNKSKLSSSNLPSIPKKQNNDYIDS  1275

Query  2984  NPADHGTAMER----------DNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAM  3133
             +  +  T + +          D+ +G N E+   N     D+D+ IL+ LF+  G+ SA+
Sbjct  1276  SSDEEKTKVNKKRKSNKSNSIDDENGGNDEKSNSN-----DDDSYILKCLFEKEGLKSAL  1330

Query  3134  DHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRML--RSQESVAIPTWTGRSGTAGAP  3307
              HD I++    E   L  +A ++A +A   L++S+ L  R + S +  TWTGR G++G P
Sbjct  1331  RHDTIMDQSGPEHSLLVNEAEKIASKAVGILKKSKELIDRQRSSSSTLTWTGRFGSSGLP  1390

Query  3308  PSIKK-----KFG--STLNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellak  3466
               +       +FG  S L  QL     PL+  S I+   + I    S             
Sbjct  1391  TLMNSNNNTGRFGQKSKLQSQL----SPLQSISNITVDSDNILLNKSITNNN--------  1438

Query  3467  iRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQ  3646
                      ++     ++F+S    ++     E  A    +   G+    +I ++  FI 
Sbjct  1439  ----SNNTNNNNTNTNNKFSSTRILSTLNNKEEEDA---KNLFGGLNSNEIIEKIFNFIM  1491

Query  3647  RKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNPNGSFWILKPEY  3802
              KGGS ++ +I+ +F   +      LFK LL+ ++   K      W++K E+
Sbjct  1492  EKGGSVTTQTIINNFSLTINEDQAPLFKALLRSVSDFDK--VSKRWVVKSEF  1541



>gb|EGD95238.1| DNA repair and recombination protein RAD26 [Trichophyton tonsurans 
CBS 112818]
Length=1225

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/706 (48%), Positives = 462/706 (65%), Gaps = 35/706 (5%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L+GG ++P  I+  LFDYQK GV+WLWEL+ Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  377   PDTVLDGGYQLPGDIYPYLFDYQKTGVKWLWELYQQQVGGIIGDEMGLGKTIQVIAFLAG  436

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             +H+S   K P I+VCP T+++QW  E  +W+P F V ILH S +   + K  S++ +  +
Sbjct  437   IHYSKKLKGPIIVVCPPTVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIKSESQAEDRYT  496

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         + S R  K   +++  VL  D  +L+TTY  L+     L+ ++WG AV
Sbjct  497   SGVWGDRN----STSQRGNKAARRILKRVL-EDGHVLVTTYAGLQTYSSLLIPVDWGIAV  551

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  552   LDEGHKIRNPDTSITIHCKELRTSHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  611

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC
Sbjct  612   NQFEFPIRTGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKMDVAADLPKKSEQVLFC  671

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLERE--HSCRDPDYG  2341
              LT VQR+ Y+AFLAS ++  I  G + ALYGID++RKICNHPDL + +   +  D +YG
Sbjct  672   KLTKVQRAAYEAFLASGEMSSILRGRREALYGIDMLRKICNHPDLTQHKVLSTKTDYNYG  731

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             +  +SGKM+VV  +L+LWKD GH+ L F+Q + MLDILE F+    G+ YRRMDG TP+K
Sbjct  732   SGAKSGKMQVVKSLLELWKDTGHKTLLFAQHRIMLDILERFIRGFDGFNYRRMDGNTPIK  791

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R +++DEFNN  ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  792   VRQSMVDEFNNDPDLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLG  851

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+ F+  D++DLF L   G 
Sbjct  852   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFQMSDIQDLFTL---GN  908

Query  2879  NGSTESSSIFSQ---LSEDVNITG--------------PQH-PDQEKDKSIKTNPADHGT  3004
             +G TE+S +F     + ED    G              P++ P +E+D+ I       G 
Sbjct  909   DGPTETSQMFKDADIVYEDDAAKGKNAKSSGRQQGRRQPENKPVKEEDQKISRVTGVAGM  968

Query  3005  AMERDNNSGSNG--EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK  3178
                 D  SG     +EK          D  ++  +F   G+ SA++HD I++     K  
Sbjct  969   EEYHDETSGPGTPQQEKEAEGESKSKTDARLMENIFSRSGVLSAVEHDQIIHGKRAVKAD  1028

Query  3179  ---LEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
                +E +A RVA  AA  L ++  +        PTWTG+ GTAG P
Sbjct  1029  PKIIETEAKRVAAEAARELLKAEEVARTVPAGTPTWTGQFGTAGRP  1074



>dbj|GAD94405.1| DNA repair protein Rhp26/Rad26 [Byssochlamys spectabilis No. 
5]
Length=1216

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/714 (47%), Positives = 463/714 (65%), Gaps = 34/714 (5%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P    +GG +IP  I+  LFDYQK GVQWLWEL+ Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  399   PDAEFDGGYRIPGDIYPYLFDYQKTGVQWLWELYQQQVGGIIGDEMGLGKTIQVIAFLAG  458

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH SN   KP I+VCP T+++QW  E  +W+P F V ILH S +   + K  S   +   
Sbjct  459   LHHSNKLTKPVIVVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMINVKSESSREDRLI  518

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         +   +  K   K++  V+  D  +L+TTY  L+     L+ ++WG A+
Sbjct  519   SQMWDPTHSHGAS---KGQKAAKKIVKRVV-EDGHVLVTTYSGLQTYASHLISVDWGCAI  574

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HRII++G+P+QN LSELWSLFDFVFP +LG L  F 
Sbjct  575   LDEGHKIRNPDTAITIHCKELRTPHRIILSGTPMQNNLSELWSLFDFVFPMRLGTLVNFR  634

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC
Sbjct  635   NQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKVDVAADLPKKSEQVLFC  694

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCR--DPDYG  2341
              LT +QR  Y+AFL S D++ I +G +  LYG+D++RKICNHPDL   +   +  D DYG
Sbjct  695   KLTKLQRKAYEAFLGSEDMQSILNGKRQVLYGVDILRKICNHPDLQNHKLLSQKTDYDYG  754

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL-VTGGYKYRRMDGATPVK  2518
             NP +SGKM+VV  +L+LW+D GH+ L F+Q + MLDILE ++    G+ YRRMDG+TP++
Sbjct  755   NPSKSGKMQVVKALLELWRDTGHKTLLFAQHRIMLDILERYIRALSGFNYRRMDGSTPIQ  814

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R  ++DEFNN   + +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  815   HRQTMVDEFNNDPNLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLG  874

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F+  DL DLF L D+ +
Sbjct  875   QKREVTIYRLMTTGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFQMSDLYDLFSLGDENQ  934

Query  2879  NGSTESSSIF--SQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKA  3052
              G TE+S +F  ++++ D N  G      E   + K++P       E+ + S   G    
Sbjct  935   -GPTETSKLFKDAEVTYDENRRGESQKQAEPTTTEKSSP---DLQDEKKDISKVVGVASM  990

Query  3053  DNNNGDVDEDTS------------ILRTLFDAHGIHSAMDHDAIVNA----HDEEKLKLE  3184
             +N  G+ ++ T             ++  +F   G+HSA++HD I+N       + K+   
Sbjct  991   ENFRGEPEQSTDQESPGTSTSEARLMEGIFARSGVHSALEHDQIINGKRVVKADPKIIEA  1050

Query  3185  EQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAG---APPSIKKKFGST  3337
             E     A+ AAE  +     RS   +  PTWTG+ G AG    PPS++  FG +
Sbjct  1051  EARKVAAEAAAELRKAGEAARSV-PIGTPTWTGQFGVAGRPEEPPSMRPAFGGS  1103



>ref|XP_003018145.1| hypothetical protein TRV_07841 [Trichophyton verrucosum HKI 0517]
 gb|EFE37500.1| hypothetical protein TRV_07841 [Trichophyton verrucosum HKI 0517]
Length=1240

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/706 (48%), Positives = 462/706 (65%), Gaps = 35/706 (5%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +L+GG ++P  I+  LFDYQK GV+WLWEL+ Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  392   PDTVLDGGYQLPGDIYPYLFDYQKTGVKWLWELYQQQVGGIIGDEMGLGKTIQVIAFLAG  451

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             +H+S   K P I+VCP T+++QW  E  +W+P F V ILH S +   + K  S++ +  +
Sbjct  452   IHYSKKLKGPIIVVCPPTVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIKSESQAEDRYT  511

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         + S R  K   +++  VL  D  +L+TTY  L+     L+ ++WG AV
Sbjct  512   SGVWGDRN----STSQRGNKAARRILKRVL-EDGHVLVTTYAGLQTYSSLLIPVDWGIAV  566

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  567   LDEGHKIRNPDTSITIHCKELRTSHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  626

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC
Sbjct  627   NQFEFPIRTGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKMDVAADLPKKSEQVLFC  686

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLERE--HSCRDPDYG  2341
              LT VQR+ Y+AFLAS ++  I  G + ALYGID++RKICNHPDL + +   +  D +YG
Sbjct  687   KLTKVQRAAYEAFLASGEMSSILRGRREALYGIDMLRKICNHPDLTQHKILSTKTDYNYG  746

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             +  +SGKM+VV  +L+LWKD GH+ L F+Q + MLDILE F+    G+ YRRMDG TP+K
Sbjct  747   SGAKSGKMQVVKSLLELWKDTGHKTLLFAQHRIMLDILERFIRGFDGFNYRRMDGNTPIK  806

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R +++DEFNN  ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  807   VRQSMVDEFNNDPDLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLG  866

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+ F+  D++DLF L   G 
Sbjct  867   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFQMSDIQDLFTL---GN  923

Query  2879  NGSTESSSIFSQ---LSEDVNITG--------------PQH-PDQEKDKSIKTNPADHGT  3004
             +G TE+S +F     + ED    G              P++ P +E+D+ I       G 
Sbjct  924   DGPTETSQMFKDADIVYEDDAAKGKNARSSDRQQRRRQPENKPVKEEDQKISRVTGVAGM  983

Query  3005  AMERDNNSGSNG--EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK  3178
                 D  SG     +EK          D  ++  +F   G+ SA++HD I++     K  
Sbjct  984   EEYHDETSGPGTPQQEKEAGGESKSKTDARLMENIFSRSGVLSAVEHDQIIHGKRAVKAD  1043

Query  3179  ---LEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
                +E +A RVA  AA  L ++  +        PTWTG+ GTAG P
Sbjct  1044  PKIIETEAKRVAAEAARELLKAEEVARTVPAGTPTWTGQFGTAGRP  1089



>emb|CEI92616.1| hypothetical protein RMCBS344292_06870 [Rhizopus microsporus]
Length=624

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/589 (54%), Positives = 415/589 (70%), Gaps = 27/589 (5%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             LEGGL++P  ++  LFDYQK  +QWLWELH Q+ GGI+GDEMGLGKT+Q +AFL SLH+S
Sbjct  32    LEGGLRVPGELWSCLFDYQKTCIQWLWELHRQEVGGILGDEMGLGKTIQAVAFLASLHYS  91

Query  1463  NAYKP---SIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             N   P    ++VCP T+++QW +E   W+P   V ILH S +        S   E   + 
Sbjct  92    NMLGPGKACVVVCPATVMKQWVQEFHSWWPPLRVAILHSSGSGVKTGTYTSSEDEEMEDV  151

Query  1634  eelldvdvekN----LSFRNTKKWDKLINHVLGSDSG---------------LLITTYEQ  1756
             E++ + D E N    L F+  K   K    +LG+ +G               +LITTY  
Sbjct  152   EDVKEDDFEFNSRGKLVFKKKKT--KKKKSILGTKAGRRVSALVKKYIKLGGVLITTYSG  209

Query  1757  LRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWS  1936
             ++   E LL  +WGY +LDEGH+IRNP+++ TL  KQ +T HRII++G+PIQN L ELWS
Sbjct  210   VQSYREVLLKHQWGYVILDEGHKIRNPDSETTLAVKQFKTPHRIILSGTPIQNNLKELWS  269

Query  1937  LFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMK  2116
             LFDFVFPG+LG LP+F+++F+VPISIGGYANAT +QV TAY+CA +LRDLI PYLLRRMK
Sbjct  270   LFDFVFPGRLGTLPIFQSQFSVPISIGGYANATNIQVQTAYKCACMLRDLINPYLLRRMK  329

Query  2117  ADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHP  2296
              DV A LPKK E V+FC LT  QR  Y  F+ S +++ I +  +  LYGID++RKICNHP
Sbjct  330   VDVAADLPKKNEQVLFCKLTKPQREAYLQFIHSKEMDAILERRRQVLYGIDIVRKICNHP  389

Query  2297  DLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTG  2476
             DL++   +  +PDYGNPERSGKM VV  +LK+WK Q HRVL F QT+QMLDI+E  +   
Sbjct  390   DLVDLTITEGNPDYGNPERSGKMVVVRALLKMWKQQHHRVLLFCQTRQMLDIMETMIRYL  449

Query  2477  GYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNP  2656
              Y+Y RMDG TPV QRMAL++E+N    IF+F+LTT+VGGLG NLTGA+RVI+FDPDWNP
Sbjct  450   DYRYLRMDGTTPVSQRMALVNEYNGNKHIFVFLLTTKVGGLGLNLTGADRVILFDPDWNP  509

Query  2657  SNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKA  2836
             S D+QARERAWR+GQKKDVT+YRL+T GTIEEK+YHRQIYK  LTNKILK+P+Q+R F A
Sbjct  510   STDVQARERAWRLGQKKDVTIYRLMTSGTIEEKIYHRQIYKQFLTNKILKDPKQKRFFDA  569

Query  2837  RDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKT  2983
              +L+ LF L  + ++  TE+  +F     +V+    +   Q+++  +K+
Sbjct  570   SNLQSLFTLATE-DSTETETGRLFK--GTEVSYNKKKQTSQDEEGQLKS  615



>ref|XP_002175235.1| SNF2 family helicase Rhp26 [Schizosaccharomyces japonicus yFS275]
 gb|EEB08942.1| SNF2 family helicase Rhp26 [Schizosaccharomyces japonicus yFS275]
Length=983

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/686 (49%), Positives = 451/686 (66%), Gaps = 34/686 (5%)
 Frame = +2

Query  1280  MLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHF  1459
             + + G  IP  I  KLF YQ   + WLWEL+CQ AGGIIGDEMGLGKTVQ++A+L SLH+
Sbjct  257   VFDDGFSIPGDIRPKLFRYQVTCILWLWELYCQGAGGIIGDEMGLGKTVQIVAYLASLHY  316

Query  1460  SNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILH------DSVNDFhdkkkgskshe  1618
             S  + KP+++VCP TL++QW  E  +W+  F V ILH      +S  +  D K  +   E
Sbjct  317   SRKFDKPTLVVCPATLMKQWVGEFHRWWAPFRVVILHSTGSGLNSKREGRDYKDSASEGE  376

Query  1619  sdseseelldvdvekNLSFRNTKKWDKLINHVLGSD---SGLLITTYEQLRLLGEKLLDI  1789
              + E   L   D   N   R++  + K    ++ S      +LITTY  LR+  + LL  
Sbjct  377   DEEEESVLEAEDERVNPLRRSSASFHKFAEKLIDSTFERGHILITTYAGLRIYSDLLLPR  436

Query  1790  EWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLG  1969
             EWGY +LDEGH+IRNP+ +++++ KQL+TV+RII++G+PIQN L+ELW+LFDF+FPG+LG
Sbjct  437   EWGYCILDEGHKIRNPDAEISILSKQLRTVNRIILSGTPIQNNLTELWNLFDFIFPGRLG  496

Query  1970  VLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKT  2149
              LPVF+ +FA+PI+IGGYANAT +QV T+Y+CA +LRDLI PYLLRRMK DV A LPKK+
Sbjct  497   TLPVFQNQFALPINIGGYANATNIQVQTSYKCACMLRDLISPYLLRRMKLDVAADLPKKS  556

Query  2150  EHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLERE--HSC  2323
             E V+FC LT  QR  YQ FL S D+ +I +G +  L+G+DV+RKICNHPDL+ RE     
Sbjct  557   EQVLFCKLTPEQRIAYQQFLNSGDMNKILNGKRQVLFGVDVLRKICNHPDLVMREFLEHK  616

Query  2324  RDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMD  2500
                +YG+P++SGK+KVV  +LKLWK Q HR L FSQT+QMLDILE  + + G   Y RMD
Sbjct  617   EGYEYGDPKKSGKLKVVQALLKLWKSQNHRTLLFSQTRQMLDILEKAIGSMGDISYCRMD  676

Query  2501  GATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARE  2680
             G T +  R  L+DEFN T    +F+LTTRVGGLG NLTGA+RVIIFDPDWNPS D QARE
Sbjct  677   GTTSIGLRQGLVDEFNKTSRYDVFLLTTRVGGLGINLTGADRVIIFDPDWNPSTDAQARE  736

Query  2681  RAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFV  2860
             RAWR+GQK+DV VYRL++ GTIEEK+YHRQI+K  LTNKILK+P QRR FK  DL DLF 
Sbjct  737   RAWRLGQKRDVVVYRLMSSGTIEEKIYHRQIFKQFLTNKILKDPNQRRFFKMNDLHDLFT  796

Query  2861  LNDDGENGSTESSSIF-------------SQLSEDVNITGPQHPDQEKDKSIKTNPADHG  3001
             L++D E+  T +  +F                ++  N +  Q   + K K   +NP D  
Sbjct  797   LDEDKEDEGTATGDMFLGEERIFATKKKPQTFTKPPNTSHSQVQQRRKRKPRHSNPDDPA  856

Query  3002  TAMERDNNSGSNGEEKADN--------NNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNA  3157
                + +  +G    + A+           G    + S+L  +F + G+ S+++HD + N 
Sbjct  857   EFKKLEGVAGLEAYKPAEEEAKRLKKPKQGSTYGEESMLSGIFASAGVKSSLEHDNLFNN  916

Query  3158  HDEEKLKLEEQASRVAQRAAEALRQS  3235
              +      +++A+R+A+ AA+ + QS
Sbjct  917   DNPADRMAQQEANRIAKEAAQTVLQS  942



>gb|EMF11036.1| SNF2_N-domain-containing protein [Sphaerulina musiva SO2202]
Length=1270

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/866 (42%), Positives = 528/866 (61%), Gaps = 61/866 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P    +GG ++P  ++  LFDYQK GVQWLWEL+ Q+ GGI+GDEMGLGKT QV++FL  
Sbjct  445   PDAEFDGGFRVPGDVYPSLFDYQKTGVQWLWELYSQQVGGIVGDEMGLGKTCQVISFLAG  504

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP I++CP TLL+QW  E  +W+P   V ILH S +   D K+ ++  +   
Sbjct  505   LHYSGKITKPIIVLCPATLLKQWVDEFHRWWPPLRVTILHSSGSGMLDVKREARFEDDLD  564

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
             +           N S RN      +I+ V+  D  +L+TTY  L    ++LL + W Y V
Sbjct  565   DDRRKKSRGRP-NPSVRN------VIDRVV-QDGHVLVTTYAGLVNYADQLLPVNWEYCV  616

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPN ++T+ CK++ T +R+I++G+P+QN L ELW+LFDFVFP +LG L  F+
Sbjct  617   LDEGHKIRNPNAEITIFCKEIMTHNRVILSGTPMQNNLEELWTLFDFVFPMRLGTLVNFK  676

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +FA+PI  GGYANA+ LQV TA +CA  L+D I PYLL+R KADV   LPKK E V+FC
Sbjct  677   NQFAIPIKQGGYANASNLQVETAMKCAETLKDAISPYLLQRFKADVATDLPKKIERVLFC  736

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DYG  2341
              LT +QR  YQ FL S D++ I +G + ALYGID++RKICNHPDL+E +   +    +YG
Sbjct  737   KLTKLQRDAYQWFLDSEDMKSIMNGKRQALYGIDILRKICNHPDLVEHKTLSKKAGYEYG  796

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
                +SGKM+VV E+LK+WKD+GH+ L F+Q + MLDILE F+ +  G  YRRMDG T +K
Sbjct  797   IGTKSGKMQVVKELLKIWKDKGHKTLLFAQHRIMLDILERFIGSMSGINYRRMDGTTDIK  856

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R  L++EFN+  ++ +F+LTT+VGGLG NLTGANR+II+DPDWNPS D+QARERAWR+G
Sbjct  857   HRQDLVNEFNHDPDLHVFLLTTKVGGLGVNLTGANRIIIYDPDWNPSTDVQARERAWRLG  916

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++V +YRL+T GTIEEK+YHRQ++K  LTNKIL++P+QR+ F+ +DL DLF L  +  
Sbjct  917   QKREVEIYRLMTAGTIEEKIYHRQLFKLFLTNKILRDPKQRQNFQLKDLHDLFTLG-ESV  975

Query  2879  NGSTESSSIFS----QLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEE  3046
             +G TE+ +IF     +L    ++  P   D+++ ++ +    D      +++  G   E 
Sbjct  976   DGQTETGTIFKGTEVKLKRGNSLPTPPDEDEKQKETERVAINDFAGVSRQEDFRGDKDEH  1035

Query  3047  KADNNNGDVDEDTS--ILRTLFDAHGIHSAMDHDAIVNAH-----DEEKLKLEEQASRVA  3205
               +N +   D+ +S  +L  +F   G+  A DH+AIV+       D E ++ E  A ++A
Sbjct  1036  NKNNKSEGADQSSSDRVLSGIFARAGVQGAQDHEAIVSGRRAPRADPEMIRKE--AKKIA  1093

Query  3206  QRAAEALRQSRMLRSQESVAIPTWTGRSGTAG---APPSIKKKFGSTLNPQLVTSSKPLE  3376
               AA  L+++  +       IPTWTG+ GTAG   +PP  +                P  
Sbjct  1094  DEAARELKRAAEIARSLPAGIPTWTGQVGTAGRPDSPPPRRGGGSMRGGMSSRGRGGP-S  1152

Query  3377  ESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTR  3556
              SS++++ ++  A  ++   A +S+               DG       N G+++    R
Sbjct  1153  SSSVLANLQHRQANASNTTMATTSSR--------------DG-------NIGTATRGGRR  1191

Query  3557  AAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPS--KDLALFK  3730
             AA +  + P     G+    LIR    +I   GG+  S  +V+HF     +  K  A F 
Sbjct  1192  AANDDRNLPQ----GLDFMTLIRD---YISSHGGAVYSQMLVDHFNRYCNNSPKRTAEFS  1244

Query  3731  NLLKEIATLKKNPN-GSFWILKPEYQ  3805
              +LK+IA ++K     + W+L+ EY+
Sbjct  1245  EMLKKIAVMEKGGRMRAKWVLREEYK  1270



>ref|XP_002946233.1| hypothetical protein VOLCADRAFT_120230 [Volvox carteri f. nagariensis]
 gb|EFJ53228.1| hypothetical protein VOLCADRAFT_120230 [Volvox carteri f. nagariensis]
Length=1596

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/530 (59%), Positives = 392/530 (74%), Gaps = 25/530 (5%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
             V+ EGG ++P  ++ +LFDYQ+  V+WLWELH Q+AGGI+GDEMGLGKTVQV+A+L  LH
Sbjct  437   VVFEGGFRVPSRLYGRLFDYQQTAVKWLWELHTQRAGGILGDEMGLGKTVQVIAYLAGLH  496

Query  1457  FSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsese  1636
              S  Y+PS+IVCP T+L+QW RE + W+P F V +LH+S                     
Sbjct  497   HSGLYRPSLIVCPATVLRQWMRELRSWWPPFRVVLLHES---------------------  535

Query  1637  elldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDE  1816
                        + R  +    L+   L S SGL++TTY+ LRL  + LL + WG AVLDE
Sbjct  536   --GRSPPAAATAVRPDRP--ALLEVALSSPSGLVLTTYDNLRLQRDLLLRVRWGVAVLDE  591

Query  1817  GHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEF  1996
             GH+IRNP++++TLVCKQL TVHR+IM+GSPIQN+LSELWSLFDF+FPGKLG LPVF+A+F
Sbjct  592   GHKIRNPDSEITLVCKQLHTVHRLIMSGSPIQNRLSELWSLFDFIFPGKLGTLPVFQAQF  651

Query  1997  AVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLT  2176
             AVPI +GGY+NA+ LQV+TAY+CAVVLRDL  PYLLRR KADV AQLP K E V+FC+L 
Sbjct  652   AVPIQVGGYSNASSLQVTTAYKCAVVLRDLTAPYLLRRRKADVAAQLPAKMEQVLFCTLV  711

Query  2177  SVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERS  2356
             S Q  +Y+A+LAST+V +I +GS+ AL GID++RKICNHPDLLER  +    DYGNP RS
Sbjct  712   SEQLELYRAYLASTEVGEILEGSRRALCGIDILRKICNHPDLLERVTAQDAEDYGNPARS  771

Query  2357  GKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPVKQRMALI  2536
             GK++V   VL  W     + L F QTQQMLDILE  +   G+ Y RMDG TPV  R  LI
Sbjct  772   GKLRVAERVLTSWHTARQKALLFCQTQQMLDILEKLVAGRGWSYHRMDGGTPVAVRPRLI  831

Query  2537  DEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVT  2716
             D+FN   ++F+F+LTT+VGGLG NLTGA RV+++DPDWNPS D+QARERAWRIGQ   VT
Sbjct  832   DDFNTNPDVFVFLLTTKVGGLGVNLTGATRVMLYDPDWNPSTDIQARERAWRIGQSHSVT  891

Query  2717  VYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLN  2866
             +YRLIT GTIEEK+YHRQIYK  LTNK+L++P+Q+R F ARD+ +LFVL 
Sbjct  892   IYRLITAGTIEEKIYHRQIYKSFLTNKVLRDPRQKRFFTARDISELFVLG  941


 Score = 80.9 bits (198),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +2

Query  3041  EEKADNNNGDVDEDTSILRTLFDA-HGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAA  3217
             +E  D   G   +++ +LR L D   GI   +DH  I  A+D E + +  +A RVAQRAA
Sbjct  1089  DEVHDGGGGAEADESRVLRELLDGGAGIRGLVDHSKIEGANDPEVIAVHAEAQRVAQRAA  1148

Query  3218  EALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
             EALR+SR+  +  S+A PTWTGR G AGAP
Sbjct  1149  EALRRSRLACAAASIATPTWTGRHGRAGAP  1178


 Score = 63.9 bits (154),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = +2

Query  3524  NSGSSSNSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRV  3703
              +G+S+++  R+   G    + G+A    E L  ++ +F++  GG   S  +VE FRSRV
Sbjct  1250  TAGASTSTSGRSHGGGDCSSAGGTAA---ERLAGELVSFLEEHGGLVGSEELVEAFRSRV  1306

Query  3704  PSKDLALFKNLLKEIATLKKNPNGSFWILKPEY  3802
              S+ + LFK +L+++A L++   G  W+LKP +
Sbjct  1307  VSEQMPLFKQVLRQVAGLRRRAGGGEWVLKPAF  1339



>ref|XP_002669658.1| DEAD/DEAH box helicase [Naegleria gruberi]
 gb|EFC36914.1| DEAD/DEAH box helicase [Naegleria gruberi]
Length=1029

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/721 (46%), Positives = 448/721 (62%), Gaps = 88/721 (12%)
 Frame = +2

Query  1196  DEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHC  1375
             DEG ++E++                P + + G   IP+ I+DKLF YQK  ++W+ EL+ 
Sbjct  259   DEGEEMEVTKVNYG-----------PSIQIAGSYSIPKEIYDKLFGYQKTTLKWMCELNR  307

Query  1376  QKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYKPSIIVCPLTLLQQWKREAKKWYPSFHV  1555
             Q  GGI+GDEMGLGKTVQ+  FL  LHFS  ++PSII+ P T+++QW+ E   W+P   V
Sbjct  308   QGVGGILGDEMGLGKTVQITTFLAGLHFSGLFEPSIIIAPATVMKQWQEEINTWWPELRV  367

Query  1556  EILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTK-KWDKLINHVLGSDSG  1732
              I+H S                                  + TK  ++ LI  V    +G
Sbjct  368   VIMHTS----------------------------------QGTKANFESLIEKVSSCPNG  393

Query  1733  LLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQ  1912
             +LITTYE LR+  + L   +WGY +LDEGH+IRNP+  +TL CK+ +T HRII+TG+PIQ
Sbjct  394   VLITTYESLRIYQDVLTSKKWGYIILDEGHKIRNPDAALTLACKRFETPHRIILTGTPIQ  453

Query  1913  NKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIM  2092
             N L ELWSLFDF +PGKLG LPVF  +F++PI+ GGY+NAT  QV TAY+C+ VLRDLI 
Sbjct  454   NNLKELWSLFDFCYPGKLGTLPVFLTQFSIPITQGGYSNATKFQVQTAYKCSCVLRDLIK  513

Query  2093  PYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDV  2272
             PYLLRRMK DV  QLP+K E+VIFC LT  Q  IY  +L S +V    DG       I  
Sbjct  514   PYLLRRMKKDVKHQLPEKKENVIFCKLTDKQVKIYDEYLKSREVTGTLDGEHLLFKAITN  573

Query  2273  MRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDI  2452
             +RK+CNHPDL+  E   +  D+G  E+SGKM VV ++L LWK+Q HRVL FSQ+++MLD+
Sbjct  574   LRKVCNHPDLICTEK--KPDDFGAVEKSGKMMVVEKLLSLWKEQNHRVLLFSQSKKMLDV  631

Query  2453  LENFLVTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVI  2632
              E FL    Y Y RMDG TPVK+R  LI++FN+  +IF+F+LTT+VGGLG NL GANR+I
Sbjct  632   FEPFLQERDYTYSRMDGDTPVKERSVLINQFNSDDKIFVFLLTTKVGGLGVNLIGANRII  691

Query  2633  IFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNP  2812
             +FDPDWNPS D+QA ERAWR+GQ K VTVYRL+T GTIEEK+YHRQI+K  L+NK+LK+P
Sbjct  692   LFDPDWNPSTDLQALERAWRLGQTKQVTVYRLMTSGTIEEKMYHRQIFKQFLSNKVLKDP  751

Query  2813  QQRRLFKARDLKDLFVL------------------NDDGENGSTESSSIFSQLSEDVNIT  2938
             +Q+R FK+ DL +LF L                  +DD EN  TE+ ++FS  SE +   
Sbjct  752   RQKRFFKSNDLYELFTLGKEYDSVRRKNGNKSIPYDDDEEN--TETGNLFSN-SEILRQD  808

Query  2939  GPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHG  3118
              P    ++KD   +            +   GS  + K D        +T IL+ LFD   
Sbjct  809   MPTIKKKKKDVEYRV-----------EKFKGSEDDSKKD--------ETYILQCLFDEKS  849

Query  3119  IHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTA  3298
             + S  +HD++VN    E   LE+QA ++A+ A + L++S  LR    +++PT+TG++G  
Sbjct  850   VKSIFNHDSVVNTTSSETSILEKQAKQIAEIAVKELKKSGELRKSMPLSVPTFTGQNGLG  909

Query  3299  G  3301
             G
Sbjct  910   G  910



>emb|CDH11563.1| probable DNA repair and recombination protein RAD26 [Zygosaccharomyces 
bailii ISA1307]
Length=1038

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/873 (42%), Positives = 519/873 (59%), Gaps = 79/873 (9%)
 Frame = +2

Query  827   ETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQDNGDLVSTSLANAIQ----SIS  994
             E+++D LVR G LT F   +GFE    E  Q S +  Q   D V  S  +  +    SI 
Sbjct  129   ESDRDFLVRTGQLTAFGTKRGFEIA-SESDQESSNETQGETDAVDQSPKSDTEYKEESIV  187

Query  995   EAAQSRPTTKLLDSSLLPKLEPPTYPFQTPRKHVKISQSAENGRNDKRKRRPTPGKKWRV  1174
              +++      L  S++  K +   Y +Q      ++ Q ++N   D++        +W  
Sbjct  188   YSSEDESDVILKPSAV--KDDGDEYYYQK-----RLRQWSKNRAEDRKSDSNPDWPEWWK  240

Query  1175  KVSRENKDEGPDVEISSYedekddedmddeGPPFVMLEGGLKIPETIFDKLFDYQKVGVQ  1354
             K         PD                    P   L+   KIP  I+  LFDYQ+  VQ
Sbjct  241   K--------HPDF-------------------PDAKLDDQFKIPGEIYSLLFDYQRTCVQ  273

Query  1355  WLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYK-PSIIVCPLTLLQQWKREAK  1531
             WL+EL+ QK GGIIGDEMGLGKT+Q++AFL +LH SN    P+I+VCP T+++QW  E  
Sbjct  274   WLYELYQQKCGGIIGDEMGLGKTIQIIAFLAALHHSNLLNGPTIVVCPATVMKQWCNEFH  333

Query  1532  KWYPSFHVEILHDSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINH  1711
              W+P F   ILH             K   S++E EE++        S+ + +  DK  +H
Sbjct  334   HWWPPFRTVILHS-----IGAGMSGKKKMSEAELEEVIMSSEPSQFSYEDFQNSDKTKSH  388

Query  1712  V------------LGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTL  1855
             +            + +   ++ITTY  LR+  + LL + W YA+LDEGH+IRNP++D++L
Sbjct  389   IESNNLLQSLIDKVVTKGHIIITTYVGLRVHADMLLKVNWAYAILDEGHKIRNPDSDISL  448

Query  1856  VCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANAT  2035
              CK L+T +RII++G+PIQN L+ELWSLFDF+FPGKLG LP+F+ +F   I++GGYANA+
Sbjct  449   TCKALKTPNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPIFQQQFVQSINMGGYANAS  508

Query  2036  PLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLAS  2215
              +QV T Y+CAV LRDLI PYLLRR+KADV   LP+K E V+FC LT +QR  Y  FL S
Sbjct  509   NIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPEKKEMVLFCKLTQIQRRKYLEFLHS  568

Query  2216  TDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLW  2395
              ++++I  G +  L+GID++RKICNHPDLLER     +  YG+P+RSGKM+VV ++L LW
Sbjct  569   RELDEIKGGKRKVLFGIDILRKICNHPDLLERNERRNETSYGDPKRSGKMQVVKQLLLLW  628

Query  2396  KDQGHRVLFFSQTQQMLDILENFLV-----TGGYKYRRMDGATPVKQRMALIDEFNNTVE  2560
             K +GH+ L F+Q++QMLDILE F+          K+ RMDG T +  R +L+DEFN    
Sbjct  629   KKEGHKALLFTQSRQMLDILEEFIAFKDEELSALKFLRMDGTTSISVRQSLVDEFNKG-N  687

Query  2561  IFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRG  2740
               +F+LTTRVGGLG NLTGANR+IIFDPDWNPS DMQARERAWRIGQ ++V++YRL+  G
Sbjct  688   YDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWRIGQTREVSIYRLMVTG  747

Query  2741  TIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESSSIFSQLS  2920
             +IEEK+YHRQI+K  LTNKIL +P+Q+R FK  +L+DLF L  +  + + E  S   + +
Sbjct  748   SIEEKIYHRQIFKQFLTNKILSDPKQKRFFKMNELQDLFTLGGENGHATEELESEVQKRT  807

Query  2921  EDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRT  3100
             E +  +  +  D + ++ I  N    G +      +G   + K         ED  ++  
Sbjct  808   EGLKSSKTEESD-DFEEVISLN----GVSKLESFYTGKEPQSKFKK------EDDRLIEG  856

Query  3101  LFDAHGIHSAMDHDAIVNAHDEEKLK-LEEQASRVAQRAAEALRQSRMLRSQESVAIPTW  3277
             L    G+ SA  HD+++ +H +     +  +AS++A+ A +ALR+SR  R +  +  PTW
Sbjct  857   LLGESGLASAASHDSMIESHSKGSSDIISREASKLAEAAVKALRKSRRERKKFDIETPTW  916

Query  3278  TGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             TGR G AG    I KK  +T N + + SS  LE
Sbjct  917   TGRFGQAG---KIGKKSSAT-NRRSIGSSAILE  945



>ref|XP_001536381.1| DNA repair and recombination protein RAD26 [Histoplasma capsulatum 
NAm1]
 gb|EDN05048.1| DNA repair and recombination protein RAD26 [Histoplasma capsulatum 
NAm1]
Length=1275

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/887 (42%), Positives = 531/887 (60%), Gaps = 74/887 (8%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  +++GG +IP  I+  LFDYQK GVQWLWEL+ QK GGIIGDEMGLGKT+QV+AFL  
Sbjct  410   PDKVIDGGFRIPGDIYPYLFDYQKTGVQWLWELYQQKVGGIIGDEMGLGKTIQVIAFLAG  469

Query  1451  LHFSNAYKPSIIV-CPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     S+IV CP T+++QW  E  +W+  F V ILH S +   + +  S +     
Sbjct  470   LHHSKKLTKSVIVVCPPTVMKQWVNEFHRWWAPFRVSILHSSGSGMVNLRSESFADARLE  529

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                   D         +  K   +++  VL  +  +L+TTY  L+     L+ ++WG A+
Sbjct  530   SQLWEPDQPRRLP---KEQKAAKRILKRVL-EEGHVLVTTYSGLQTYRSLLIPVDWGCAI  585

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDF FP +LG L  F 
Sbjct  586   LDEGHKIRNPDTAITIHCKELRTAHRLILSGTPMQNNLTELWSLFDFAFPMRLGTLVNFR  645

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC
Sbjct  646   NQFEFPIRTGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKSEQVLFC  705

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DYG  2341
              LT +QRS Y+AFL S ++  I  G + ALYGID++RKICNHPDL E +   + P  +YG
Sbjct  706   KLTKLQRSAYEAFLGSNEMSSILRGRREALYGIDMLRKICNHPDLPEHKVLSKKPSYNYG  765

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             +  +SGKM+VV  +L+LW+D GH+ L F+Q + MLDILE F+++ GG+KY+RMDG TP+K
Sbjct  766   SASKSGKMQVVKSLLELWRDTGHKTLLFTQHRIMLDILERFIISMGGFKYQRMDGNTPIK  825

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R  ++DEFNN  +I +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  826   FRQKMVDEFNNNPDIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLG  885

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F+  DL DLF L +DG 
Sbjct  886   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFQMSDLHDLFTLGNDGR  945

Query  2879  NGSTESSSIFSQL---------------------SEDVNITGPQHPDQEKDKSIK--TNP  2989
                TE+  +F  +                     + + ++TGP   +QEK   +   ++ 
Sbjct  946   T-ETETIELFKNVEVTFQESKGAQIASPEGTTNPAAEASVTGPDREEQEKISRVTGVSSL  1004

Query  2990  ADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNA----  3157
                  A E  N S ++G  +A N+      +  ++  +F   G+HSA++H+ I+N     
Sbjct  1005  ERFHEAPETPNASKTDG-ARAPNS------EARLMEGIFARSGVHSALEHEQIINGKRVI  1057

Query  3158  HDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGST  3337
               + K+   E     A+ A E LR   + +S   V  PTWTG+ G AG P         T
Sbjct  1058  KADPKIIEAEAKKVAAEAARELLRAGELAKSI-PVGTPTWTGQFGVAGRPE-------DT  1109

Query  3338  LNPQLVTSSKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQH  3517
             + P   T + PL      + RR      +++  A  +            R + DG     
Sbjct  1110  MQPPRGTVASPLPFGRGSAIRRATGGPSSASLLANLT-----------NRTVGDGGSGWS  1158

Query  3518  QFNSGSSSNS-RTRAAENGA------SRPSHGSAGMQP--EVLIRQVCTFIQRKGGSTSS  3670
               +  S +N+ R+ +   GA         S GS+  QP  +  ++ +  +I  +GGS  +
Sbjct  1159  NSSHASGTNTPRSGSTPGGAIDGGSHLGSSGGSSSSQPRGKDFLKMIRDYIMAQGGSVRT  1218

Query  3671  ASIVEHFRSRVPSKDLAL-FKNLLKEIATLKKNPNGSF--WILKPEY  3802
              ++++HF     +    + FK +L+ IA L+K    +   W+L+PEY
Sbjct  1219  QNLIDHFNRFCDTPRATMEFKEMLRTIAVLEKTGGRARGKWVLRPEY  1265



>gb|AGO12295.1| AaceriAEL065Cp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=1028

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/707 (48%), Positives = 454/707 (64%), Gaps = 44/707 (6%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  IFDKLF+YQK  VQWL+ELH Q  GGI+GDEMGLGKT+Q+++FL S
Sbjct  246   PDAKLHDDFKIPGDIFDKLFNYQKTCVQWLYELHQQNCGGIVGDEMGLGKTIQIVSFLAS  305

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHD-SVNDFhdkkkgskshesd  1624
             LH S   K P I+VCP T+++QW  E + W+P F V ILH       + K+   +  E  
Sbjct  306   LHHSGKLKGPVIVVCPATVMKQWCSEFQTWWPPFRVIILHSIGAGMINRKRMTEEQLEEM  365

Query  1625  seseelldvdvekNLSFRNTKKW-------DKLINHVLGSDSGLLITTYEQLRLLGEKLL  1783
                ++  +   E+  +   TKK        + L+  V+  D  +LITTY  L++  + LL
Sbjct  366   LMRDQSNEFSYEQYANLGRTKKQLEARRGIESLVQKVI-DDGHILITTYVGLQIHSDLLL  424

Query  1784  DIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGK  1963
              ++WGYAVLDEGH+IRNP+  ++L CK+L+T HRII++G+PIQN L+ELWSLFDF+FPGK
Sbjct  425   QVKWGYAVLDEGHKIRNPDAGISLTCKRLRTPHRIILSGTPIQNNLTELWSLFDFIFPGK  484

Query  1964  LGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPK  2143
             LG LPVF+ +F  PI+ GGYANAT +QV T Y+CAV LRDLI PYLLRR+K+DV   LPK
Sbjct  485   LGTLPVFQQQFTNPINAGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKSDVAKDLPK  544

Query  2144  KTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSC  2323
             K E V+FC +T  Q+  Y  FL S D+ +I +G +  LYGID++RKICNHPDLLERE   
Sbjct  545   KNEFVLFCKMTQFQKDKYMQFLNSEDMIKIKNGRRQVLYGIDILRKICNHPDLLEREFRK  604

Query  2324  RDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV-----TGGYKY  2488
              +  +G+P RSGKM V+ ++L  WK QGH+ L F+Q++QMLDILE ++          +Y
Sbjct  605   HESSFGDPRRSGKMTVIKQLLLTWKKQGHKALLFTQSRQMLDILEAYISRKDPELAELQY  664

Query  2489  RRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDM  2668
              RMDG T +  R AL+D FNN     +F+LTTRVGGLG NLTGANR+IIFDPDWNPS D+
Sbjct  665   LRMDGTTNIAHRQALVDRFNNG-PYHLFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDL  723

Query  2669  QARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLK  2848
             QARERAWRIGQK+DVT+Y L+  G+IEEK+YHRQI+K  LTNK+L +P+Q+R FK  +L 
Sbjct  724   QARERAWRIGQKRDVTIYLLMVAGSIEEKIYHRQIFKQFLTNKVLSDPKQKRFFKMNELH  783

Query  2849  DLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNS  3028
             DLF     G   +  S S  S++             +++  S++   + HGT  + D   
Sbjct  784   DLFSF---GSGTAATSESFASEI-------------EQQTASLRQQRSAHGTD-DYDTVQ  826

Query  3029  GSNGEEK-------ADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK-LE  3184
             G  G  K        D  + + DED  ++  L     + +A+ HD++V +H       + 
Sbjct  827   GFEGVSKLEGFFSAKDKADREKDEDARLMDGLLGGGNLATAIQHDSVVQSHTTPSDDIIA  886

Query  3185  EQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK  3325
              +AS VA+ A   LR+SR L  +  V+ PTWTG+ G AG    +KKK
Sbjct  887   REASLVARNALATLRKSRSLTRKYDVSTPTWTGKFGQAG---RVKKK  930



>ref|XP_003016834.1| hypothetical protein ARB_05127 [Arthroderma benhamiae CBS 112371]
 gb|EFE36189.1| hypothetical protein ARB_05127 [Arthroderma benhamiae CBS 112371]
Length=1220

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/706 (47%), Positives = 461/706 (65%), Gaps = 35/706 (5%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L+GG ++P  ++  LFDYQK GV+WLWEL+ Q+ GGIIGDEMGLGKT+QV+AFL  
Sbjct  372   PDTELDGGYRLPGDVYPYLFDYQKTGVKWLWELYQQQVGGIIGDEMGLGKTIQVIAFLAG  431

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             +H+S   K P I+VCP T+++QW  E  +W+P F V ILH S +   + K  S++ +  +
Sbjct  432   IHYSKKLKGPIIVVCPPTVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIKSESQAEDRYT  491

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                         + + R  K   +++  VL  D  +L+TTY  L+     L+ ++WG AV
Sbjct  492   SGVWGDRN----STTQRGNKAARRILKRVL-EDGHVLVTTYAGLQTYSSLLIPVDWGIAV  546

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  547   LDEGHKIRNPDTSITIHCKELRTSHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  606

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC
Sbjct  607   NQFEFPIRTGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKMDVAADLPKKSEQVLFC  666

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLERE--HSCRDPDYG  2341
              LT VQR+ Y+AFLAS ++  I  G + ALYGID++RKICNHPDL + +   +  D +YG
Sbjct  667   KLTKVQRAAYEAFLASGEMSSILRGRREALYGIDMLRKICNHPDLTQHKILSTKTDYNYG  726

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             +  +SGKM+VV  +L+LWKD GH+ L F+Q + MLDILE F+    G+ YRRMDG TP+K
Sbjct  727   SGAKSGKMQVVKSLLELWKDTGHKTLLFAQHRIMLDILERFIRGFDGFNYRRMDGNTPIK  786

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R +++DEFNN  ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  787   VRQSMVDEFNNNPDLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLG  846

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+ F+  D++DLF L   G 
Sbjct  847   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFQMSDIQDLFTL---GN  903

Query  2879  NGSTESSSIFSQ---LSEDVNITG--------------PQH-PDQEKDKSIKTNPADHGT  3004
             +G TE+S +F     + ED    G              P++ P +E+D+ I       G 
Sbjct  904   DGPTETSQMFKDADIVYEDDAAKGKNAGSSGRQQRRRQPENKPVKEEDQKISRVTGVAGM  963

Query  3005  AMERDNNSGSNG--EEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK  3178
                 D  SG     +EK          D  ++  +F   G+ SA++HD I++     K  
Sbjct  964   EEYHDETSGPGTPQQEKEAEGESKSKTDARLMENIFSRSGVLSAVEHDQIIHGKRAVKAD  1023

Query  3179  ---LEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
                +E +A RVA  AA  L ++  +        PTWTG+ GTAG P
Sbjct  1024  PKIIETEAKRVAAEAARELLKAEEVARTVPAGTPTWTGQFGTAGRP  1069



>ref|XP_003644419.1| hypothetical protein Ecym_1369 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET37602.1| hypothetical protein Ecym_1369 [Eremothecium cymbalariae DBVPG#7215]
Length=1037

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/715 (48%), Positives = 469/715 (66%), Gaps = 39/715 (5%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    KIP  IF  LFDYQK  VQWL+EL+ QK+GGIIGDEMGLGKT+Q+++FL SLH S
Sbjct  258   LNNDFKIPGDIFPLLFDYQKTCVQWLYELYQQKSGGIIGDEMGLGKTIQIISFLASLHHS  317

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 +P +++CP T+L+QW  E  KW+P F   ILH       +KKK ++    +   + 
Sbjct  318   GKLNRPVLVICPATVLKQWCTEFHKWWPPFRTIILHSIGTGMVNKKKLTEQEIEEIIMKS  377

Query  1640  lldvdvekNLS-FRNTKK-------WDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEW  1795
               +     + S F  TKK          LI+ VL     +LITTY  L++  ++LL ++W
Sbjct  378   KAEEFSYDDYSNFERTKKEIESNYNIKSLIDKVLNL-GHVLITTYVGLKIHADELLKVDW  436

Query  1796  GYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVL  1975
             GY VLDEGH+IRNPN++++L CK+L+T HRII++G+PIQN L+ELWSLFDF+FPGKLG L
Sbjct  437   GYVVLDEGHKIRNPNSEISLTCKRLKTHHRIILSGTPIQNNLTELWSLFDFIFPGKLGTL  496

Query  1976  PVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEH  2155
             PVF+ +FAVPI+  GYANAT +QV T ++CAV LRDLI PYLLRR+K D+   LPKKTE 
Sbjct  497   PVFQQQFAVPINSAGYANATNIQVQTGFKCAVALRDLISPYLLRRLKVDLARDLPKKTEM  556

Query  2156  VIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPD  2335
             V+FC +T VQ+  Y  FL S D+ +I +G K  L+GID++RKICNHPDLLERE    +  
Sbjct  557   VLFCKMTQVQKDKYLQFLNSDDLVKIKNGKKQVLFGIDILRKICNHPDLLEREFKKHNIS  616

Query  2336  YGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-----GGYKYRRMD  2500
             YG+P+RSGKM+VV  +L++W +QGH+ L F+Q++QMLDILE+F+ +         Y RMD
Sbjct  617   YGDPKRSGKMQVVKRLLQIWHEQGHKALLFTQSRQMLDILESFISSKDPDLSHLTYLRMD  676

Query  2501  GATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARE  2680
             G T +  R ALI +FN      +F+LTTRVGGLG NLTGANR+IIFDPDWNPS D+QARE
Sbjct  677   GMTDIGHRHALISKFNKE-PYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDIQARE  735

Query  2681  RAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFV  2860
             RAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTNKIL +P Q+R FK  +L DLF 
Sbjct  736   RAWRIGQKREVSIYRLMVAGSIEEKIYHRQIFKQFLTNKILSDPNQKRFFKMNELHDLFT  795

Query  2861  LNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNN--SGS  3034
             L +D  +G+       S+ +E +          +KD S   +  +    +E  +      
Sbjct  796   LGNDCSSGNEAFMQEVSKQTEKL----------KKDSSEGADDFNQVINIEGVSKLEGFY  845

Query  3035  NGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK-LEEQASRVAQR  3211
             N +EK   N   ++ED  ++ + F    + +++ H ++++ H       + ++A+ VAQ 
Sbjct  846   NAKEKEVEN---MNEDDRLMNSFFGGGDLTNSLGHSSMLDMHTTPTNDIIAKEAALVAQN  902

Query  3212  AAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKPLE  3376
             A   L +SR L  +  + IPTWTG+ G AG    IKKK     +PQ+  SSK LE
Sbjct  903   AVNVLNKSRKLTKRYEIGIPTWTGKFGQAGI---IKKK----RHPQIQRSSKILE  950



>ref|XP_002499080.1| ZYRO0E03190p [Zygosaccharomyces rouxii]
 emb|CAR30825.1| ZYRO0E03190p [Zygosaccharomyces rouxii]
Length=1052

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/708 (48%), Positives = 462/708 (65%), Gaps = 47/708 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L+   +IP  I+  LF+YQ+  VQWL+EL+ QK GGIIGDEMGLGKT+QV+AFL +
Sbjct  262   PDAKLDDEFRIPGEIYSLLFNYQRTCVQWLYELYQQKCGGIIGDEMGLGKTIQVIAFLAA  321

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH SN    P +IVCP T+++QW  E   W+P F   ILH        KKK S+    D 
Sbjct  322   LHHSNQLDGPVLIVCPATVMKQWCTEFHHWWPPFRTVILHSIGAGMASKKKMSEDELEDM  381

Query  1628  eseelldvdvekNLSFRNTKKW----DKLINHVL---GSDSGLLITTYEQLRLLGEKLLD  1786
                   +     +L   +  K     D L+  ++     D  +LITTY  LR+  +KLL 
Sbjct  382   IMSGDPNQFSYGDLENSSKTKAQVESDNLLQTLIDKVAKDGHVLITTYVGLRIHADKLLK  441

Query  1787  IEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKL  1966
             I W Y +LDEGH+IRNP++D++L CK+L+T +R+I++G+PIQN L+ELWSLFDF+FPGKL
Sbjct  442   INWAYGILDEGHKIRNPDSDISLTCKKLKTPNRLILSGTPIQNNLTELWSLFDFIFPGKL  501

Query  1967  GVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKK  2146
             G LP+F+ +F  PI++GGYANAT +QV T Y+CAV LRDLI PYLLRR+KADV   LP+K
Sbjct  502   GTLPIFQQQFVQPINMGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPEK  561

Query  2147  TEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCR  2326
              E V+FC LT VQR  Y  FL S ++E I  G +  LYGID++RKICNHPDLL+R+   +
Sbjct  562   KEMVLFCKLTQVQRRKYLEFLHSRELEDIKGGKRRVLYGIDILRKICNHPDLLDRDERSK  621

Query  2327  DPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV-----TGGYKYR  2491
             +  YG+P+RSGKM+VV ++L LW+ +GH+ L F+Q++QMLDIL+ F+        G K+ 
Sbjct  622   EASYGDPKRSGKMQVVKQLLLLWRKEGHKALLFTQSRQMLDILQEFIAFKDQELTGLKFL  681

Query  2492  RMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQ  2671
             RMDG T +  R +L+DEFN   +  +F+LTTRVGG+G NLTGANR+IIFDPDWNPS DMQ
Sbjct  682   RMDGTTTISIRQSLVDEFNRG-DYNVFLLTTRVGGIGVNLTGANRIIIFDPDWNPSTDMQ  740

Query  2672  ARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKD  2851
             ARERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTNKIL +P+Q+R FK  +L D
Sbjct  741   ARERAWRIGQKREVSIYRLMVTGSIEEKIYHRQIFKQFLTNKILSDPKQKRFFKMNELHD  800

Query  2852  LFVLNDDGENG-STESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNN-  3025
             LF L   GENG +TE      +L  +V         Q++ + +K + +D     E+  N 
Sbjct  801   LFTLG--GENGHATE------ELESEV---------QQRTEGLKNSKSDESDDFEKVVNL  843

Query  3026  -------SGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK-L  3181
                    S   G+E  +N+  D   D  ++  L    G+  A  H++++++H       +
Sbjct  844   IGVSKLESFYTGKESQENSKKD---DDRLIEGLLGESGLAGAATHESMMSSHSNGSSDII  900

Query  3182  EEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK  3325
               +AS++A  A  ALR+SR  R +  V  PTWTG+ G AG    I+KK
Sbjct  901   TREASKLADAAVNALRKSRRARKKFDVGTPTWTGKFGQAG---KIRKK  945



>gb|EDK39551.2| hypothetical protein PGUG_03649 [Meyerozyma guilliermondii ATCC 
6260]
Length=1117

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/692 (49%), Positives = 458/692 (66%), Gaps = 26/692 (4%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
              +L    ++P  I+  LF YQ+  VQWLWEL+ QK GGIIGDEMGLGKT+QV++F+  LH
Sbjct  304   AVLNSQFRLPGDIYPSLFQYQRTCVQWLWELYSQKTGGIIGDEMGLGKTIQVVSFIAGLH  363

Query  1457  FSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             +S    KP I+V P T++ QW  E   W+P     ILH   +        S+    +  +
Sbjct  364   YSGLLDKPVIVVVPATVMMQWVNEFHTWWPPLRCAILHSIGSGMSKSALTSEEKIENMMA  423

Query  1634  eelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLD  1813
              +  D++ +K L+ +      K I   + S   +LITTY  LR+  + +L  +WGYAVLD
Sbjct  424   NDDFDLNEDKFLAQQKGLSNAKNIVDRVVSKGHVLITTYVGLRVYSKYILPHQWGYAVLD  483

Query  1814  EGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAE  1993
             EGH+IRNPN+ +TL CKQL+T +RII++G+PIQN L ELWSLFDFVFPG+LG LPVFE +
Sbjct  484   EGHKIRNPNSHITLTCKQLKTHNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFEQQ  543

Query  1994  FAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSL  2173
             F++PI++GGYANA+ +QV T Y+CAVVLRDLI PYLLRR+K+DV   LPKK E V+F  L
Sbjct  544   FSIPINMGGYANASNVQVQTGYKCAVVLRDLISPYLLRRLKSDVAQDLPKKEEMVLFVKL  603

Query  2174  TSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DYGNP  2347
             T  Q+ +Y+ FL+S D+  I  G +N L G+D +RKICNHPDL++RE   R    +YG P
Sbjct  604   TQYQQDMYEKFLSSEDLHAILKGKRNMLTGVDTLRKICNHPDLVDRELLLRKKGYNYGIP  663

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV--------TGGYKYRRMDG  2503
              +SGKM V+  +L+LW+ QGHR L F QT+QMLDILE  LV        T  + Y RMDG
Sbjct  664   NKSGKMLVLKGLLQLWQSQGHRTLLFCQTKQMLDILEKLLVNLTRISDGTEYFNYMRMDG  723

Query  2504  ATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARER  2683
             +TP+ +R  L+D FNN     +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARER
Sbjct  724   STPISKRQGLVDMFNNNTNYDVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARER  783

Query  2684  AWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVL  2863
             AWR+GQK+D+ +YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QRR FK  DL DLF L
Sbjct  784   AWRLGQKRDIVIYRLMTAGTIEEKIYHRQIFKTFLTNKILKDPKQRRFFKVNDLHDLFTL  843

Query  2864  NDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGE  3043
              D  E G TE+  +F+    ++N +G +       K+   N  D  +       +  NG 
Sbjct  844   GDPEEKG-TETGDMFN--GSEINYSGSRERKPTNLKNTNKNDDDFYSV------AKLNGV  894

Query  3044  EKADN-NNGDVDEDT-----SILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVA  3205
              K D    GD DED       I+  LF    IHS + HD+I+++ ++E   +E++A+++A
Sbjct  895   SKLDKFQGGDEDEDARPDEDRIMEGLFSNDNIHSTVKHDSIIDSSNQEISIIEKEANKLA  954

Query  3206  QRAAEALRQSRMLRSQESVAIPTWTGRSGTAG  3301
               AAEAL+ SR    + ++  PTWTG+ G AG
Sbjct  955   AEAAEALKNSRKQTRKNTIGTPTWTGKFGLAG  986



>ref|XP_004336014.1| SNF2 family Nterminal domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR14001.1| SNF2 family Nterminal domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=1293

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/714 (49%), Positives = 460/714 (64%), Gaps = 79/714 (11%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
             V+  GG ++P  ++D LFDYQK GV+W+WELH Q AGGIIGDEMGLGKTVQV++FL  LH
Sbjct  458   VLFSGGYRLPAQLYDNLFDYQKTGVRWMWELHRQNAGGIIGDEMGLGKTVQVMSFLAGLH  517

Query  1457  FSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
              S     P +IVCP T++QQW RE  KW+P F V +LHD+                    
Sbjct  518   HSEMLNGPILIVCPATVMQQWVRECHKWWPPFRVAVLHDTGT------------------  559

Query  1634  eelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLD  1813
                             +     LI  +  +D  +LITTY   RL  E + +++W YAVLD
Sbjct  560   ---------------YSGSASDLIERI-ATDGHVLITTYSGTRLNQEVMCEVDWEYAVLD  603

Query  1814  EGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAE  1993
             EG +IRNP+ D+TL CK+L+T HR+I+TGSPIQN L+ELWSLFDFVFPGKLG       E
Sbjct  604   EGDKIRNPDADITLACKRLRTHHRLILTGSPIQNNLTELWSLFDFVFPGKLGT------E  657

Query  1994  FAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSL  2173
             FA+PIS+GGY+NAT LQV TAY+CAVVLRDLI PYLLRRMKAD                L
Sbjct  658   FALPISMGGYSNATKLQVQTAYKCAVVLRDLIKPYLLRRMKAD----------------L  701

Query  2174  TSVQRSIYQAFLASTDVEQIFDGSK------NALYGIDVMRKICNHPDLLEREHSCRDPD  2335
             T+ QR  Y+ +L S DV+ I    +        L  I  +RKICNHPDL+         D
Sbjct  702   TAEQRMDYEDYLGSKDVQDILGKERRDRMTNKVLACIMNLRKICNHPDLM-LPFEKWPQD  760

Query  2336  YGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYKYRRMDGATPV  2515
             YG   RSGK+KV  ++L++W++QGHRVL FSQT+QMLDI+E F+V  GY Y RMDG T +
Sbjct  761   YGYWGRSGKLKVTEQLLQMWREQGHRVLLFSQTRQMLDIVERFVVEKGYDYLRMDGTTSI  820

Query  2516  KQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRI  2695
              +RM L+DEFNN    F+F+LTTRVGGLG NL GA+RV+I+DPDWNPS DMQARERAWRI
Sbjct  821   GRRMGLVDEFNNNPRHFLFLLTTRVGGLGVNLIGADRVLIYDPDWNPSTDMQARERAWRI  880

Query  2696  GQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDG  2875
             GQK++VTVYRLIT G +EEK+YHRQI+K  L+NKILK+P+QRR FK+ DL+DLF L   G
Sbjct  881   GQKREVTVYRLITAGAVEEKIYHRQIFKQFLSNKILKDPKQRRFFKSSDLRDLFTL---G  937

Query  2876  ENGSTESSSIFSQL---------SEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNS  3028
             + G  E++ +F  +         +E           +++ +  K    D     + +  +
Sbjct  938   KEGKAETTELFDDIRAQMQKAEEAERAKEQLELEEKEKEKEKGKEKAVDDDDDDDDEAKA  997

Query  3029  GSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQ  3208
              + G ++A + +    +D  ILR+LFD   +  A+ HD+IV     E++ +EEQAS++A 
Sbjct  998   RTTGPDEAKSKSE--KDDAFILRSLFDNANVQGAVCHDSIVEKAGHEQVIIEEQASKIAA  1055

Query  3209  RAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIK-KKFGSTLNPQLVTSSK  3367
             RAA+ALR+SR +   + V +PTWTGRSG AG P  +K K+FG+ LN +L+ +S+
Sbjct  1056  RAAQALRRSRRVCQSDDVNVPTWTGRSGAAGMPQQLKQKRFGAQLNSKLLQASE  1109



>ref|XP_001484268.1| hypothetical protein PGUG_03649 [Meyerozyma guilliermondii ATCC 
6260]
Length=1117

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/692 (49%), Positives = 458/692 (66%), Gaps = 26/692 (4%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
              +L    ++P  I+  LF YQ+  VQWLWEL+ QK GGIIGDEMGLGKT+QV++F+  LH
Sbjct  304   AVLNSQFRLPGDIYPSLFQYQRTCVQWLWELYLQKTGGIIGDEMGLGKTIQVVSFIAGLH  363

Query  1457  FSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             +S    KP I+V P T++ QW  E   W+P     ILH   +        S+    +  +
Sbjct  364   YSGLLDKPVIVVVPATVMMQWVNEFHTWWPPLRCAILHSIGSGMSKSALTSEEKIENMMA  423

Query  1634  eelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLD  1813
              +  D++ +K L+ +      K I   + S   +LITTY  LR+  + +L  +WGYAVLD
Sbjct  424   NDDFDLNEDKFLAQQKGLSNAKNIVDRVVSKGHVLITTYVGLRVYSKYILPHQWGYAVLD  483

Query  1814  EGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAE  1993
             EGH+IRNPN+ +TL CKQL+T +RII++G+PIQN L ELWSLFDFVFPG+LG LPVFE +
Sbjct  484   EGHKIRNPNSHITLTCKQLKTHNRIILSGTPIQNNLIELWSLFDFVFPGRLGTLPVFEQQ  543

Query  1994  FAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSL  2173
             F++PI++GGYANA+ +QV T Y+CAVVLRDLI PYLLRR+K+DV   LPKK E V+F  L
Sbjct  544   FSIPINMGGYANASNVQVQTGYKCAVVLRDLISPYLLRRLKSDVAQDLPKKEEMVLFVKL  603

Query  2174  TSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DYGNP  2347
             T  Q+ +Y+ FL+S D+  I  G +N L G+D +RKICNHPDL++RE   R    +YG P
Sbjct  604   TQYQQDMYEKFLSSEDLHAILKGKRNMLTGVDTLRKICNHPDLVDRELLLRKKGYNYGIP  663

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV--------TGGYKYRRMDG  2503
              +SGKM V+  +L+LW+ QGHR L F QT+QMLDILE  LV        T  + Y RMDG
Sbjct  664   NKSGKMLVLKGLLQLWQSQGHRTLLFCQTKQMLDILEKLLVNLTRISDGTEYFNYMRMDG  723

Query  2504  ATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARER  2683
             +TP+ +R  L+D FNN     +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARER
Sbjct  724   STPISKRQGLVDMFNNNTNYDVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARER  783

Query  2684  AWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVL  2863
             AWR+GQK+D+ +YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QRR FK  DL DLF L
Sbjct  784   AWRLGQKRDIVIYRLMTAGTIEEKIYHRQIFKTFLTNKILKDPKQRRFFKVNDLHDLFTL  843

Query  2864  NDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGE  3043
              D  E G TE+  +F+    ++N +G +       K+   N  D  +       +  NG 
Sbjct  844   GDPEEKG-TETGDMFN--GSEINYSGSRERKPTNLKNTNKNDDDFYSV------AKLNGV  894

Query  3044  EKADN-NNGDVDEDT-----SILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVA  3205
              K D    GD DED       I+  LF    IHS + HD+I+++ ++E   +E++A+++A
Sbjct  895   SKLDKFQGGDEDEDARPDEDRIMEGLFSNDNIHSTVKHDSIIDSSNQEISIIEKEANKLA  954

Query  3206  QRAAEALRQSRMLRSQESVAIPTWTGRSGTAG  3301
               AAEAL+ SR    + ++  PTWTG+ G AG
Sbjct  955   AEAAEALKNSRKQTRKNTIGTPTWTGKFGLAG  986



>ref|XP_001523570.1| DNA repair and recombination protein RAD26 [Lodderomyces elongisporus 
NRRL YB-4239]
 gb|EDK47235.1| DNA repair and recombination protein RAD26 [Lodderomyces elongisporus 
NRRL YB-4239]
Length=1159

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/714 (46%), Positives = 460/714 (64%), Gaps = 43/714 (6%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             L    K+P  I+  LFDYQK  VQWLWEL+ QK GGIIGDEMGLGKT+Q+++F+  LH+S
Sbjct  315   LNDTFKLPGDIYPSLFDYQKTCVQWLWELYLQKTGGIIGDEMGLGKTIQIISFIAGLHYS  374

Query  1463  NAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                 KP ++V P T+L QW  E  +W+P     ILH S+     K K     + +   E+
Sbjct  375   GLLEKPVLVVVPATVLNQWVNEFHRWWPPLRCVILH-SIGSGMSKDKKISEEKLEEFMED  433

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                   + +L    ++   + I   +     +L+TTY  LR+  + +L  +WGY +LDEG
Sbjct  434   WDPKTSKSSLKGIKSQINAREILDKVQEKGHVLVTTYVGLRMYSKYILPRQWGYCILDEG  493

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP++D++L CKQ++TV+R+I++G+PIQN L+ELWSLFDFVFPG+LG LPVFE +F+
Sbjct  494   HKIRNPDSDISLTCKQIKTVNRVILSGTPIQNNLTELWSLFDFVFPGRLGTLPVFEQQFS  553

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             VPI IGGYAN+  LQV TAY+CAVVLRDLI PYLLRR+K DV   LPKK E V+F  LT 
Sbjct  554   VPIKIGGYANSNNLQVKTAYKCAVVLRDLISPYLLRRLKKDVAQDLPKKNEMVLFVRLTK  613

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSG  2359
              Q+ +Y+ FL S +++ I  G +N L G+D +RKICNHPDL+ RE      +YG+P +SG
Sbjct  614   EQQELYEKFLDSEEMDSIVKGKRNVLVGVDTLRKICNHPDLIYREALMHRANYGDPSKSG  673

Query  2360  KMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV--------TGGYKYRRMDGATPV  2515
             KM+V+  +L+LW+ + H+ L F QT+QMLDILE F+         +  + Y RMDG TP+
Sbjct  674   KMQVLKNLLQLWQSEDHKTLLFCQTRQMLDILEKFVANLHLLGDESKKFNYLRMDGNTPI  733

Query  2516  KQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRI  2695
              +R  L+D FNN+ ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+
Sbjct  734   SRRQQLVDTFNNSPDLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDIQARERAWRL  793

Query  2696  GQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDG  2875
             GQKKD+T+YRL+T G+IEEK+YHRQI+K  L NKILK+P+QRRLFK  DL DLF L D  
Sbjct  794   GQKKDITIYRLMTTGSIEEKIYHRQIFKTFLQNKILKDPKQRRLFKNSDLHDLFSLGDQT  853

Query  2876  ENGSTESSSIFSQLSED------VNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSN  3037
             E G TE+  +F+  +E+      +  +      + K+       A      + D  +   
Sbjct  854   EQG-TETGDMFNAATEEKYGGSKIRKSTSLMKKKYKNDDDFYQVAKITGVSKLDKFADGE  912

Query  3038  GEEKADNNNGDV--------------------------DEDTSILRTLFDAHGIHSAMDH  3139
              E++A+N    V                          D+D+  ++ +F   G+HS + H
Sbjct  913   DEDQANNKGHSVTGGGRRSARALRDNDNGSNNNNNNNDDDDSRFIKGIFSQSGVHSTIKH  972

Query  3140  DAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAG  3301
             D IVN++D E   +E++A++ A +A  AL++SR    +  +  PTWTGR G+AG
Sbjct  973   DDIVNSNDHEVSIVEQEANKYASQAVAALKESRQNARKTKIGTPTWTGRFGSAG  1026



>emb|CEI91751.1| hypothetical protein RMCBS344292_06032 [Rhizopus microsporus]
Length=896

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/591 (53%), Positives = 416/591 (70%), Gaps = 28/591 (5%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             LEGGL+IP  ++  LFDYQK  +QWLWELH Q+ GGI+GDEMGLGKT+Q +AFL SLH+S
Sbjct  301   LEGGLRIPGELWSCLFDYQKTCIQWLWELHRQEVGGILGDEMGLGKTIQAVAFLASLHYS  360

Query  1463  NAYKP---SIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             N   P    ++VCP T+++QW +E   W+P   V ILH S +        + S + + E 
Sbjct  361   NMLGPGKACVVVCPATVMKQWVQEFHSWWPPLRVAILHSSGSGV-KTGTYTSSEDEEMED  419

Query  1634  eelldvdvekNLSFRNTKKW------DKLINHVLGSDSG---------------LLITTY  1750
              E ++   E +  F +  K        K    +LG+ +G               +LITTY
Sbjct  420   VEDVEDVKEDDFEFNSRGKLVFKKKKTKKKKSILGTKAGRRVSALVKKYIKLGGVLITTY  479

Query  1751  EQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSEL  1930
               ++   E LL  +WGY VLDEGH+IRNP+++ TL  KQ +T HRII++G+PIQN L EL
Sbjct  480   SGVQSYREVLLKHQWGYVVLDEGHKIRNPDSETTLAVKQFKTPHRIILSGTPIQNNLKEL  539

Query  1931  WSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRR  2110
             WSLFDF+FPG+LG LP+F+++F+VPISIGGYANAT +QV TAY+CA +LRDLI PYLLRR
Sbjct  540   WSLFDFIFPGRLGTLPIFQSQFSVPISIGGYANATNIQVQTAYKCACMLRDLINPYLLRR  599

Query  2111  MKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICN  2290
             MK DV A LPKK E V+FC LT  QR  Y  F+ S +++ I +  +  LYGID++RKICN
Sbjct  600   MKVDVAADLPKKNEQVLFCKLTKPQREAYLQFIHSKEMDAILERRRQVLYGIDIVRKICN  659

Query  2291  HPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV  2470
             HPDL++   +  +PDYGNPERSGKM VV  +L++WK Q HRVL F QT+QMLDI+E  + 
Sbjct  660   HPDLVDLTITEGNPDYGNPERSGKMVVVRALLRMWKQQHHRVLLFCQTRQMLDIMETMIR  719

Query  2471  TGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDW  2650
                Y+Y RMDG TPV QRMAL++E+N+   IF+F+LTT+VGGLG NLTGA+RVI+FDPDW
Sbjct  720   YLDYRYLRMDGTTPVNQRMALVNEYNDNKHIFVFLLTTKVGGLGLNLTGADRVILFDPDW  779

Query  2651  NPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLF  2830
             NPS D+QARERAWR+GQKKDVT+YRL+T GTIEEK+YHRQIYK  LTNKILK+P+Q+R F
Sbjct  780   NPSTDVQARERAWRLGQKKDVTIYRLMTSGTIEEKIYHRQIYKQFLTNKILKDPKQKRFF  839

Query  2831  KARDLKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKT  2983
              A +L+ LF L  + ++  TE+  +F     +V+    +H  Q+++  +K+
Sbjct  840   DASNLQSLFTLATE-DSTETETGRLFK--GTEVSYNKKKHTSQDEEGQLKS  887



>ref|NP_984796.2| AEL065Cp [Ashbya gossypii ATCC 10895]
 gb|AAS52620.2| AEL065Cp [Ashbya gossypii ATCC 10895]
 gb|AEY96924.1| FAEL065Cp [Ashbya gossypii FDAG1]
Length=1025

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/709 (48%), Positives = 452/709 (64%), Gaps = 50/709 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    KIP  IFDKLF YQK  VQWL+ELH Q  GGI+GDEMGLGKT+Q+++FL S
Sbjct  245   PDAKLYDDFKIPADIFDKLFSYQKTCVQWLYELHQQNCGGIVGDEMGLGKTIQIVSFLAS  304

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHD-SVNDFhdkkkgskshesd  1624
             LH S   K P ++VCP T+++QW  E + W+P F   ILH         KK   +  E  
Sbjct  305   LHHSGKLKGPVLVVCPATVMKQWCSEFQTWWPPFRAVILHSIGAGMITRKKMTEEQLEEL  364

Query  1625  seseelldvdvekNLSFRNTKKW-------DKLINHVLGSDSGLLITTYEQLRLLGEKLL  1783
                +E  +   E+  +   TKK        + L+  V+  D  +LITTY  L++  + LL
Sbjct  365   LMRDESNEFSYEQYANLGRTKKQLEARRGIESLVQKVV-DDGHILITTYLGLQIHSDLLL  423

Query  1784  DIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGK  1963
              + W YAVLDEGH+IRNP+  ++L CK+L+T HRII++G+PIQN L+ELWSLFDF+FPGK
Sbjct  424   HVNWDYAVLDEGHKIRNPDAGISLTCKRLRTPHRIILSGTPIQNNLTELWSLFDFIFPGK  483

Query  1964  LGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPK  2143
             LG LPVF+ +FA PI+ GGYANAT +QV T Y+CAV LRDLI PYLLRR+K DV   LPK
Sbjct  484   LGTLPVFQQQFANPINAGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKNDVAKDLPK  543

Query  2144  KTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSC  2323
             K E V+FC +T  Q+  Y  FL S D+ +I +G +  LYGID++RKICNHPDLLER+   
Sbjct  544   KNEFVLFCKMTQFQKEKYLQFLNSEDMIKIKNGRRQVLYGIDILRKICNHPDLLERDFRK  603

Query  2324  RDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV-----TGGYKY  2488
              +P +G+P RSGKM V+ ++L  WK QGH+ L F+Q++QMLDILE ++        G +Y
Sbjct  604   HEPSFGDPRRSGKMTVIKQLLLTWKKQGHKALLFTQSRQMLDILEAYISHKDPELAGLQY  663

Query  2489  RRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDM  2668
              RMDG T +  R AL+D FNN     +F+LTTRVGGLG NLTGANR+IIFDPDWNPS D+
Sbjct  664   LRMDGTTNIAHRQALVDRFNNG-PYHLFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDL  722

Query  2669  QARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLK  2848
             QARERAWRIGQK+DVT+Y L+  G+IEEK+YHRQI+K  LTNK+L +P+Q+R FK  +L 
Sbjct  723   QARERAWRIGQKRDVTIYLLMVAGSIEEKIYHRQIFKQFLTNKVLSDPKQKRFFKMNELH  782

Query  2849  DLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGT----AMER  3016
             DLF        G   +S  F+   E            ++  S++  PA HGT    +++R
Sbjct  783   DLFSF------GPGAASDSFASEIE------------QQTASLRRQPAAHGTDDYDSVQR  824

Query  3017  DNNSGS-----NGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK-  3178
                        N +++AD      DED  ++  L     + +A+ HD++V AH       
Sbjct  825   FEGVSKLEGFFNAKDRADREK---DEDARLMDGLLGGGSLATAVHHDSVVQAHATPSDDI  881

Query  3179  LEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK  3325
             +  +A+ VA+ A  ALR+SR L     V+ PTWTG+ G AG    +KKK
Sbjct  882   IAREAALVARNALAALRKSRALTKNYDVSTPTWTGKFGQAG---RVKKK  927



>gb|ESX01880.1| DNA excision repair protein ERCC-6 [Ogataea parapolymorpha DL-1]
Length=1003

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/707 (47%), Positives = 452/707 (64%), Gaps = 55/707 (8%)
 Frame = +2

Query  1280  MLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHF  1459
             +L    ++P  I+  LFDYQ+ GVQWLWEL+  K GGIIGDEMGLGKTVQV++FL  LH+
Sbjct  245   ILNDEFRVPGDIYPSLFDYQRTGVQWLWELYSHKTGGIIGDEMGLGKTVQVISFLAGLHY  304

Query  1460  SNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsese  1636
             S    KP ++VCP T+L QW +E  +W+P+  V ILH        K+      + +    
Sbjct  305   SGKLTKPVLVVCPATVLSQWCKEFHRWWPALRVVILHSIGTGMTGKRVEDSDDDEEDADL  364

Query  1637  elldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDE  1816
                        S  +  +  +L++ V+ ++  ++ITTY  +R+    LL + W Y VLDE
Sbjct  365   S----------SLPSDGRAKELVDSVI-NNGHVIITTYVGVRIYSRYLLPVRWNYVVLDE  413

Query  1817  GHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEF  1996
             GH+IRNP++ VTL CKQL+T +RII++G+PIQN L ELWSLFDFVFPG+LG LPVF+ +F
Sbjct  414   GHKIRNPDSHVTLACKQLKTPNRIILSGTPIQNNLVELWSLFDFVFPGRLGTLPVFQKQF  473

Query  1997  AVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLT  2176
              VPI+IGGYANAT +QV T Y+CAV+LRDLI PYLLRR+KADV   LPKK+E V+FC LT
Sbjct  474   CVPINIGGYANATNVQVQTGYKCAVILRDLISPYLLRRVKADVAKDLPKKSEMVLFCKLT  533

Query  2177  SVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLE---REHSCRDPDYGNP  2347
              VQR +Y+ FL S D+ +I  G +NAL+GIDV+RKICNHPDL++   R+   R  +    
Sbjct  534   DVQRKLYEDFLNSEDINKILRGKRNALFGIDVLRKICNHPDLVDLKLRKKHQRTAEQLEA  593

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTGGYK------YRRMDGAT  2509
              R+GK++VV  +L +W  +G + L F+QT+QMLDIL++F+    Y+      + RMDG T
Sbjct  594   -RAGKLQVVHALLDVWFSEGRKTLIFTQTRQMLDILQDFMEALNYETESKFSFMRMDGTT  652

Query  2510  PVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAW  2689
             P+ QR +++D+FN      +F+LTTRVGGLG NLTGA+RVII+DPDWNPS D+QARERAW
Sbjct  653   PISQRQSMVDQFNTNPMYNVFLLTTRVGGLGVNLTGASRVIIYDPDWNPSTDVQARERAW  712

Query  2690  RIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLND  2869
             R+GQKKDV +YRL+  G+IEEK+YHRQI+K  LTNKILK+P+Q+R FK  DL +LF L  
Sbjct  713   RLGQKKDVVIYRLMMAGSIEEKIYHRQIFKQLLTNKILKDPKQKRFFKMNDLHELFTLA-  771

Query  2870  DGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEK  3049
             +GE     S                        +S K N  D     +    SG    E 
Sbjct  772   EGETKFNNS------------------------RSTKKNDDDFLQVSKLKGVSGLQKYED  807

Query  3050  ADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALR  3229
              ++  G   ED  I+  L   + + SA++H++++N      L ++ +ASR+A  A +ALR
Sbjct  808   GEDEEGHT-EDKDIMAGLIGNNALQSALEHESVLNPSSSYSL-IDNEASRIANEAVKALR  865

Query  3230  QSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTSSKP  3370
             +SR L  Q  + +PTWTG+ G AG      +  G    P L  +S P
Sbjct  866   ESRKLARQTRINVPTWTGKFGEAG------RNVGRPRKPGLSGASTP  906



>ref|XP_001598010.1| hypothetical protein SS1G_00096 [Sclerotinia sclerotiorum 1980]
 gb|EDN90696.1| hypothetical protein SS1G_00096 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=1103

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/707 (47%), Positives = 457/707 (65%), Gaps = 37/707 (5%)
 Frame = +2

Query  1265  GPPFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFL  1444
             G P    E GLK+P  IF  LFDYQK GVQWL EL+ Q+ GGIIGDEMGLGKT+Q+++FL
Sbjct  396   GQPDHRFENGLKLPGDIFPALFDYQKTGVQWLSELYNQQVGGIIGDEMGLGKTIQIISFL  455

Query  1445  GSLHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshes  1621
               LH+S    KP I+V P T+L+QW  E  +W+P+  V ILH S     + +   +  + 
Sbjct  456   AGLHYSKKLTKPIIVVAPATVLRQWVNEFHRWWPALRVSILHSSGTGMLNVRNEGRLEDE  515

Query  1622  dseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGY  1801
             + +                  K  D+++ H       +L+TTY  L+   + L++++W Y
Sbjct  516   EDDIIYGQTTKKAPKSQKLAQKIVDRVVKH-----GHVLVTTYAGLQTYSDTLINVDWDY  570

Query  1802  AVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPV  1981
             AVLDEGH+IRNPNT VT+ CK+L+T +R+I++G+P+QN L ELWSLFDFVFP +LG L  
Sbjct  571   AVLDEGHKIRNPNTAVTIYCKELRTPNRVILSGTPMQNGLIELWSLFDFVFPMRLGTLVN  630

Query  1982  FEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVI  2161
             F   F VPI IGGYANAT LQV TA +CA  L+D I PYLL+R+K DV A LPKK+E V+
Sbjct  631   FRQSFEVPIKIGGYANATNLQVLTATKCAETLKDAISPYLLQRLKVDVAADLPKKSEQVL  690

Query  2162  FCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDY-  2338
             FC LT  QR  Y+ FLAS +++ I + ++ +LYGID++RKICNHPDLL++    + P+Y 
Sbjct  691   FCKLTRPQRDAYEMFLASDEMKSILNRTRQSLYGIDILRKICNHPDLLDKRLKTK-PNYK  749

Query  2339  -GNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATP  2512
              GN  +SGKM+VV  +L++WK  GH+ L FSQ  QMLDILE F+   GG+ Y RMDG T 
Sbjct  750   WGNGNKSGKMQVVKALLQMWKGYGHKTLLFSQGVQMLDILEEFVKKLGGFNYLRMDGGTA  809

Query  2513  VKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWR  2692
             +K R  L+D+FNN   + +F+LTT+VGGLG NLTGANRVIIFDPDWNPS D+QARERAWR
Sbjct  810   IKDRQTLVDQFNNDPNMHVFLLTTKVGGLGVNLTGANRVIIFDPDWNPSTDVQARERAWR  869

Query  2693  IGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDD  2872
             +GQKK+VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F  +DL DLF L D 
Sbjct  870   LGQKKEVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFAMKDLYDLFTLGDQ  929

Query  2873  GENGSTESSSIFS-----------QLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERD  3019
              + G+TE+  +F              +       P   D E D       A+    +E+ 
Sbjct  930   -DCGTTETGEMFKGTEVQFSKTSSPSTSRSLSVDPGQGDSESDLRNLAGVAE----LEQF  984

Query  3020  NNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDE---EKLKLEEQ  3190
             N+     EEK  +N     E++ ++  +F   G+HSA++HD I+N   +   ++  +E +
Sbjct  985   NDP---SEEKEKDN-----EESRLMEGIFARSGVHSALEHDQIINGKRKVAADRGMIERE  1036

Query  3191  ASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFG  3331
             A R+A  +A ALR++       +    TWTG  G+AG P ++++  G
Sbjct  1037  AKRIAAESATALRRAGEAARSITPGTVTWTGEYGSAGRPINVRRGAG  1083



>gb|KFH66590.1| hypothetical protein MVEG_07115 [Mortierella verticillata NRRL 
6337]
Length=1293

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/568 (55%), Positives = 402/568 (71%), Gaps = 26/568 (5%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   LEGG +IP  I+  LFDYQK   QWLWELHCQ AGGIIGDEMGLGKT+Q+++FL  
Sbjct  362   PDAELEGGFRIPGDIYSNLFDYQKTCTQWLWELHCQGAGGIIGDEMGLGKTIQIISFLAG  421

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILH--------------------  1567
             L +S+    P IIVCP TLL+QW +E  +W+P   V ILH                    
Sbjct  422   LLYSDKLDAPVIIVCPATLLKQWVKEFHRWWPPTRVAILHSSGSGMNGQYEDEDNQVDPE  481

Query  1568  DSVNDFhdkkkgskshesdseseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITT  1747
             DS +D +      K  +              K+     T   D +++ +  +   +L+TT
Sbjct  482   DSFSDEYGASTKKKKTKKRFGGSRKGGRGRGKDDKEERTVA-DNIVDRI-SAKGHVLVTT  539

Query  1748  YEQLRLLGEKLLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSE  1927
             Y  LR+   +LL   W Y VLDEGH+IRNP+ D+TL CKQ +T HRII++G+PIQN L+E
Sbjct  540   YAGLRIHSSRLLRKNWSYIVLDEGHKIRNPDADITLTCKQFRTPHRIILSGTPIQNNLNE  599

Query  1928  LWSLFDFVFPGKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLR  2107
             LWSLFDFVFPG+LG LPVF+++FA+PI++GGYANA+ +QV TAY+CAVVLRDLI PYLLR
Sbjct  600   LWSLFDFVFPGRLGTLPVFQSQFAIPINLGGYANASNVQVQTAYKCAVVLRDLINPYLLR  659

Query  2108  RMKADVNAQLPKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKIC  2287
             RMKADV   +PKK+E V+FC LT+ QR  Y+ FL S ++  I DG ++AL+GIDV+RKIC
Sbjct  660   RMKADVATDMPKKSEQVLFCKLTTPQRVAYEDFLRSNEMTSIMDGKRHALFGIDVVRKIC  719

Query  2288  NHPDLLEREHSCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL  2467
             NH D+L RE    DPDYG+  +SGKM VV  +L++W+   HRVL FSQT+ MLDILE F+
Sbjct  720   NHADILGRELHQDDPDYGDYTKSGKMVVVRALLQMWQKDKHRVLLFSQTRTMLDILEKFI  779

Query  2468  VTGGYKYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPD  2647
              + GY YRRMDG TP++ RM L+DEFN   +I++F+LTT+VGGLG NLT A+RVIIFDPD
Sbjct  780   KSEGYVYRRMDGTTPIQHRMGLVDEFNARDDIYVFLLTTKVGGLGVNLTEADRVIIFDPD  839

Query  2648  WNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRL  2827
             WNPS D+QARERAWR+GQ + VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QRR 
Sbjct  840   WNPSTDVQARERAWRLGQTRAVTIYRLMTSGTIEEKIYHRQIFKQFLTNKILKDPKQRRF  899

Query  2828  FKARDLKDLFVLNDDGENG-STESSSIF  2908
             FK+ D+ DLF L  +GE+   TE+  IF
Sbjct  900   FKSHDMADLFTL--EGEDAVGTETGGIF  925


 Score = 87.8 bits (216),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +2

Query  3023  NSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLKLEEQASRV  3202
             N+ S+G    D +N +  E  +IL +LF++ G+HSA+ HD I+++  +E L ++ +A+RV
Sbjct  1010  NAPSSGPSSTDGHNMEGSE-VNILSSLFESSGVHSALKHDEIMDSAKQEHLIVDREATRV  1068

Query  3203  AQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
             A+RA  AL++SR  R ++ + +PTWTG+SGTAGAP
Sbjct  1069  AERAMAALKESRKRRRRQDLDVPTWTGKSGTAGAP  1103



>ref|XP_002791752.1| DNA repair and recombination protein RAD26 [Paracoccidioides 
sp. 'lutzii' Pb01]
 gb|EEH35444.1| DNA repair and recombination protein RAD26 [Paracoccidioides 
sp. 'lutzii' Pb01]
Length=1234

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/720 (47%), Positives = 460/720 (64%), Gaps = 54/720 (8%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L+GG ++P  I+  LFDYQK GVQWLWEL+ QK GGIIGDEMGLGKT+QV+AFL  
Sbjct  405   PDTELDGGYRVPGDIYHYLFDYQKTGVQWLWELYQQKVGGIIGDEMGLGKTIQVIAFLAG  464

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP I+VCP T+++QW  E  +W+  F V ILH S +   + ++ S +     
Sbjct  465   LHYSKKLTKPIIVVCPPTVMKQWVNEFHRWWAPFRVSILHTSGSGMINLRRESYADARLE  524

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                   +   +     +  K   K+++ VL +   +L+TTY  L+     L+ +EWG ++
Sbjct  525   SQIWDPNQPRKAT---KEQKAAKKILDRVL-AKGHVLVTTYSGLQTYSSLLIPVEWGCSI  580

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  581   LDEGHKIRNPDTAITIHCKELRTAHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  640

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC
Sbjct  641   NQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKSEQVLFC  700

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DYG  2341
              LT +QRS YQAFL S ++  I  G + ALYGID++RKICNHPDL E +     P  +YG
Sbjct  701   KLTKIQRSAYQAFLGSNEMSSILRGRREALYGIDMLRKICNHPDLPEHKTLSTKPGYNYG  760

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             +  +SGKM+VV  +L+LWK+ GH+ L F+Q + MLDILE F+ +  G+KY+RMDG TP+K
Sbjct  761   SAAKSGKMQVVKALLELWKETGHKSLLFAQHRIMLDILERFIKSMTGFKYQRMDGNTPIK  820

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R +L+DEFNN  EI IF+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  821   LRQSLVDEFNNNPEIHIFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLG  880

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+ F   DL DLF L +D  
Sbjct  881   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFHMSDLHDLFTLGND--  938

Query  2879  NGSTESSSIFSQ----LSEDVNITGPQHP--------DQEKDKSIK-----------TNP  2989
              G TE+S +F +      E        +P        DQE+   I             +P
Sbjct  939   -GPTETSELFKEAEVKFQESAKHGATDNPAAGESTVVDQEEQNKISHVTGVASLEPFQSP  997

Query  2990  ADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEE  3169
             A+  TA E  + +  N E +             ++  +F   G+HSA++H+ IVN   + 
Sbjct  998   AETPTASETKSTAAPNSEAR-------------LMEGIFARSGVHSAVEHEQIVNG--KR  1042

Query  3170  KLKLEEQASRVAQRAAEALRQSRMLRSQE-----SVAIPTWTGRSGTAGAPPSIKKKFGS  3334
              +K + +      +   A     +LR+ E      V  PTWTG+ G AG P S  ++ G+
Sbjct  1043  IVKADPKIIEAEAKKVAAEAAKELLRAGELAKSIPVGTPTWTGQFGVAGRPESTLQRRGT  1102



>ref|XP_640679.1| SNF2-related domain-containing protein [Dictyostelium discoideum 
AX4]
 gb|EAL66702.1| SNF2-related domain-containing protein [Dictyostelium discoideum 
AX4]
Length=1655

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/911 (41%), Positives = 518/911 (57%), Gaps = 110/911 (12%)
 Frame = +2

Query  1283  LEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFS  1462
             ++   KIP  I+  LF+YQ   V+WL+ELHCQ+ GGI+GDEMGLGKTVQ+++FL SLH+S
Sbjct  781   IDENFKIPFDIYKNLFEYQVTCVRWLYELHCQETGGIVGDEMGLGKTVQIVSFLASLHYS  840

Query  1463  NAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdsesee  1639
                  P++IV P TLL  W +E  KW+P F V + H S                      
Sbjct  841   RRLGGPALIVAPATLLSNWIKEFHKWWPPFRVGLFHSSG---------------------  879

Query  1640  lldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEG  1819
                           + K D  I   +     +L+TT++ +R+  E LL   W Y +LDEG
Sbjct  880   ------SGGGGNDGSDKED--IVKKIAEKGHILLTTFDSIRINQEILLKYHWEYVILDEG  931

Query  1820  HRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFA  1999
             H+IRNP+ ++TL CKQLQT HR+I++GSPIQNKL+ELWSLFDFVFPG+LG LP+F+++F+
Sbjct  932   HKIRNPDAEITLSCKQLQTPHRVILSGSPIQNKLTELWSLFDFVFPGRLGTLPIFKSQFS  991

Query  2000  VPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTS  2179
             +PIS+GG+ANA+P+QV  AY+CAV LRDLI PY+LRR+K+DV   LP K E V+ C LT 
Sbjct  992   LPISVGGFANASPIQVQAAYKCAVALRDLISPYMLRRVKSDVLKSLPSKNEQVLMCPLTP  1051

Query  2180  VQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRD--PDYGNPER  2353
              Q  +Y  FL S D++ + DG +NALYGID+++KICNHPD+L  + S  D   DYGN ER
Sbjct  1052  FQEKLYLEFLDSNDIKSVLDGRRNALYGIDILKKICNHPDILHMDASDEDRPHDYGNIER  1111

Query  2354  SGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV-TGGYKYRRMDGATPVKQRMA  2530
             S K+KVV  +L LW  QG +VL F QT+QMLDI+E ++  +  + Y RMDG T ++QR  
Sbjct  1112  SAKLKVVETILPLWFKQGDKVLLFCQTRQMLDIVEQYIRDSTQFNYLRMDGTTSIRQRQC  1171

Query  2531  LIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKD  2710
             L+++FN    +FIF+LTT+VGGLG NLTGANRVI+FDPDWNPS DMQARER +RIGQKK 
Sbjct  1172  LVEQFNIDPSLFIFLLTTKVGGLGLNLTGANRVILFDPDWNPSTDMQARERVYRIGQKKA  1231

Query  2711  VTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDD---GEN  2881
             VT+YRLIT GTIEEK+YHRQIYK  LTNKILK+P+Q+R FK++  KDLF    +    E 
Sbjct  1232  VTIYRLITLGTIEEKIYHRQIYKQFLTNKILKDPRQKRFFKSKHFKDLFTYTKNKKGSET  1291

Query  2882  GSTESSSIFSQLSEDVN--------------------ITGPQHPDQEKDKSIKTNP----  2989
             G   S S    L E +N                     + P  P ++KD           
Sbjct  1292  GDIFSGSNSEILPEHMNDKNDKNSIKNKNNNNNSILNSSSPLIPKKKKDDGDNNYSSSDE  1351

Query  2990  ----------ADHGTAMERDNNSGS-----NGEEKADNNNGDVDE--DTSILRTLFDAHG  3118
                        +HG  +  +NN+       + +   D NN    E  D+ IL+ LF+  G
Sbjct  1352  SDSKSKKRVRGNHGKRIIGNNNNNKIKNDVDADADIDGNNSPSGENDDSYILKCLFEKEG  1411

Query  3119  IHSAMDHDAIVNAHDEEKLKLEEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTA  3298
             + SA+ HD I++    E   L  +A ++A +A   L++S   R Q +   PTWTGR G+ 
Sbjct  1412  LKSALKHDTIMDQSGPEHSLLMNEAEKIASKAVSILKKS---REQITGNTPTWTGRFGSG  1468

Query  3299  GAPPSI-----------------------KKKFGSTLNPQLVTSSKPLEESSMISSRRNg  3409
             GAP  I                         +FG     +L T   PL++ S I+S  + 
Sbjct  1469  GAPSFITSPTSTTTSTSLAVSSPIGGGGGGGRFGQ--KSKLPTHLSPLQQISNITSLNDS  1526

Query  3410  iaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSSNSRTRAAENGASRPSH  3589
                  +     ++         N     ++   + ++F S S   S   A E   ++   
Sbjct  1527  TLLNNNNNNNNNNNNNNNNQSNNSNNNNNNKNNNNNRF-SSSKLLSTLNAEEEETAKTLF  1585

Query  3590  GSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVPSKDLALFKNLLKEIATLKKNP  3769
             G  G+    +I  +  FI  KGGS ++ SI+ +F+  +  +   LFK LLK ++   K  
Sbjct  1586  G--GLNSSEIIESIFNFIMEKGGSVTTQSIINNFQLTITEEQAPLFKVLLKSVSEFSK--  1641

Query  3770  NGSFWILKPEY  3802
                 W++K E+
Sbjct  1642  VSKRWVVKSEF  1652



>emb|CCK71833.1| hypothetical protein KNAG_0I00420 [Kazachstania naganishii CBS 
8797]
Length=1085

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/702 (48%), Positives = 457/702 (65%), Gaps = 34/702 (5%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L    K+P  I   LF+YQK  VQWL+EL+ Q  GGI+GDEMGLGKT+QV+AFL S
Sbjct  294   PTARLNDTFKVPGEIHSLLFNYQKTCVQWLYELYQQNCGGIVGDEMGLGKTIQVIAFLAS  353

Query  1451  LHFSNAYK-PSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH S     P +IVCP T+++QW  E   W+P F   ILH S+     + + + + E   
Sbjct  354   LHHSGLLNGPILIVCPATVMKQWCNEFHIWWPPFRAVILH-SMGSGMTQNRRTLNEEQLE  412

Query  1628  eseelldvdvekNLSFRNTKKW----------DKLINHVLGSDSGLLITTYEQLRLLGEK  1777
             E     + D       +N  K           D LI  ++ +D  ++ITTY  LR+  +K
Sbjct  413   EIIMNSNPDDISYSDLQNPSKLKTSIESGTAIDSLIEKIV-NDGHVVITTYVGLRIHSDK  471

Query  1778  LLDIEWGYAVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFP  1957
             LL ++W YAVLDEGH+IRNP++D++L CK+L+T +RII++G+PIQN L+ELWSLFDF+FP
Sbjct  472   LLKVKWAYAVLDEGHKIRNPDSDISLTCKKLKTPNRIILSGTPIQNNLNELWSLFDFIFP  531

Query  1958  GKLGVLPVFEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQL  2137
             GKLG LPVF+ +F +PI++GGYANA+ +QV T Y+CAV LRDLI PYLLRR+K+DV   L
Sbjct  532   GKLGTLPVFQQQFVLPINMGGYANASNVQVQTGYKCAVALRDLISPYLLRRVKSDVAKDL  591

Query  2138  PKKTEHVIFCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREH  2317
             P+K E V+FC LT  Q++ Y  FL S++++QI  G ++ LYGID++RKICNHPDLLE+  
Sbjct  592   PEKKEMVLFCKLTQYQKNKYMEFLNSSELDQIRGGKRHVLYGIDILRKICNHPDLLEKNE  651

Query  2318  SCRDPDYGNPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVTG-----GY  2482
                  DYGNP+RSGKM+VV +++ LWK QGH+ L F+Q++QMLDILE F+          
Sbjct  652   KQNTRDYGNPKRSGKMQVVKQLILLWKKQGHKTLLFTQSRQMLDILERFVSVNDPEFSDI  711

Query  2483  KYRRMDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSN  2662
             +Y RMDG T + +R  L+D+FN      +F+LTTRVGGLG NLTGANR+IIFDPDWNPS 
Sbjct  712   RYLRMDGTTNISKRQNLVDQFNKG-PFDLFLLTTRVGGLGINLTGANRIIIFDPDWNPST  770

Query  2663  DMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARD  2842
             D+QARERAWRIGQK++V++YRL+  GTIEEK+YHRQI+K  LTNKIL +P+Q+R FK  +
Sbjct  771   DLQARERAWRIGQKREVSIYRLMVSGTIEEKIYHRQIFKQFLTNKILNDPRQKRFFKMNE  830

Query  2843  LKDLFVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDN  3022
             L+DLF L  D    S E S    +L+  +  +     D + DK ++      G +     
Sbjct  831   LQDLFTLGGDDGLASEEMSQEVEKLTMKLKNSASAQSD-DLDKVVEI----AGVSKLESF  885

Query  3023  NSGSNGEEKADNNNGDVDEDTSILRTLF-DAHGIHSAMDHDAIVNAHDEEKLKLEEQASR  3199
              +G   +EKA N      ED  ++  L   ++ I     HD +V++H      + ++A R
Sbjct  886   YNGKEQKEKAKN------EDERLIDGLLGGSNNIEGISTHDQVVHSHMSSSKLVTKEAQR  939

Query  3200  VAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKK  3325
             +A+ A  ALR+SR    +  +  PTWTG+ G AG    IKK+
Sbjct  940   LAEEAVAALRKSRNSTKKFDIGTPTWTGKFGQAG---KIKKR  978



>ref|XP_003980143.1| hypothetical protein NDAI_0G04840 [Naumovozyma dairenensis CBS 
421]
 emb|CCK73467.1| hypothetical protein NDAI_0G04840 [Naumovozyma dairenensis CBS 
421]
Length=1090

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/883 (41%), Positives = 525/883 (59%), Gaps = 82/883 (9%)
 Frame = +2

Query  827   ETEKDQLVRKGILTPFHKLKGFERQIQEPGQSSRHSMQ-----DNGDLVSTSLAN--AIQ  985
             E+E+D L+R G +T F    GF  +   P +   + ++     D  ++ +  +AN   ++
Sbjct  142   ESERDFLIRTGKVTAFGSTTGFTLEETIPTKKDENKIKTKQEHDYDEVHAFEMANEQMVE  201

Query  986   SISEAAQSRPTTKLLDSSLLPKLEP----------PTYPFQT----PRKHVKISQSAENG  1123
             ++S+  +   T +  D   +P+ E           P    Q     P    K  ++ ++G
Sbjct  202   NLSDEDEPTITEEDKDQDFIPEKEEEETEDEDTYNPDEELQELEDDPSIISKPGETKDDG  261

Query  1124  RNDKRKRRPTPGKKWRVKVSRENK-DEGPDVEISSYedekddedmddeGPPFVMLEGGLK  1300
                  ++R    +KW  K S++ + D  PD++         +        P   L    K
Sbjct  262   DEFYYRKRL---QKWITKRSKDRQFDPFPDLD---------EWRKPHPNIPDAKLNDIFK  309

Query  1301  IPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSNAYK-P  1477
             IP  IF  LF+YQK  VQWL+ELH Q +GGIIGDEMGLGKT+Q++AFL SLH S     P
Sbjct  310   IPGDIFSLLFNYQKTCVQWLYELHQQNSGGIIGDEMGLGKTIQIIAFLASLHHSGLLDGP  369

Query  1478  SIIVCPLTLLQQWKREAKKWYPSFHVEILHD-----SVNDFhdkkkgskshesdseseel  1642
              +IVCP T+++QW  E   W+P F   ILH       +N   +       +   + +   
Sbjct  370   VLIVCPATVMKQWCNELHHWWPPFRTIILHSIGSGMGINQKKNLSDEEFENLLMNSNPND  429

Query  1643  ldvdvekNLSFRNTK-------KWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGY  1801
             +  +  +N + R TK           LIN V+     ++ITTY  LRL  +KLL++ W Y
Sbjct  430   ISYEDLQNNTKRKTKSHLENDINIQSLINTVI-EKGHIIITTYVGLRLHSDKLLNVNWSY  488

Query  1802  AVLDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPV  1981
             A+LDEGH+IRNP++D+++ CK+++T +RII++G+PIQN L ELWSLFDF++PGKLG LPV
Sbjct  489   AILDEGHKIRNPDSDISITCKKIKTHNRIILSGTPIQNNLIELWSLFDFIYPGKLGTLPV  548

Query  1982  FEAEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVI  2161
             F+ +F +PI+ GGYANA+ +QV T  +CA  LRDLI PYLLRR+K DV   LP+K E V+
Sbjct  549   FQQQFIIPINTGGYANASNIQVQTGIKCATALRDLISPYLLRRVKNDVAKDLPEKKEMVL  608

Query  2162  FCSLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYG  2341
             FC LT  QR  Y  FL S ++ QI  G ++ LYGID++RKICNHPDL++R     D DYG
Sbjct  609   FCKLTQYQRIKYLEFLNSNELTQIKGGKRHVLYGIDILRKICNHPDLIDRNEKQYDLDYG  668

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL---------VTGGYKYRR  2494
             NP+RSGKM+VV ++L LW ++ H+VL F+Q++QMLDILENF+          +   KY R
Sbjct  669   NPKRSGKMQVVKQLLLLWHNEKHKVLLFTQSRQMLDILENFINSELKSHSEFSTPLKYLR  728

Query  2495  MDGATPVKQRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQA  2674
             MDG T +  R  L+D+FNN  +  +F+LTTRVGGLG NLTGANR+IIFDPDWNPS DMQA
Sbjct  729   MDGTTNISNRQKLVDQFNNE-DYDVFLLTTRVGGLGINLTGANRIIIFDPDWNPSTDMQA  787

Query  2675  RERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDL  2854
             RERAWRIGQK++V++YRL+  G+IEEK+YHRQI+K  LTNKIL +P+Q+R FK  +L+DL
Sbjct  788   RERAWRIGQKREVSIYRLMVAGSIEEKIYHRQIFKQFLTNKILTDPKQKRFFKMNELRDL  847

Query  2855  FVLNDDGENGSTESSSIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGS  3034
             F L   G++G           SE++N    +H      +S+K    +       D  +G 
Sbjct  848   FTLG--GDDGLA---------SEELNNELEKHT-----QSLKKGQTEESDDF--DQVTGL  889

Query  3035  NGEEKADN--NNGDVDEDTSILRTLFDAH-GIHSAMDHDAIVNAHDEEKLKLEEQASRVA  3205
             NG  K ++  +  + +ED  ++  L  +   + +A  H+A+V  H      +  +A+++A
Sbjct  890   NGVSKLESFYSGKEKNEDERLIEGLLGSETALANAATHEAVVGTHTAPTNIIAREANKIA  949

Query  3206  QRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGS  3334
             Q A  ALR+SR    +  +  PTWTG+ G AG    I+KK  +
Sbjct  950   QEALGALRKSRKATMKYEIGTPTWTGKFGQAG---KIRKKMNN  989



>ref|XP_001400735.2| DNA repair protein Rhp26/Rad26 [Aspergillus niger CBS 513.88]
Length=1214

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/692 (48%), Positives = 450/692 (65%), Gaps = 25/692 (4%)
 Frame = +2

Query  1286  EGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLHFSN  1465
             + G +IP  I   LFDYQK GVQWLWEL  Q+ GGIIGDEMGLGKT+QV++FL  LH+S 
Sbjct  404   DNGYRIPGDIHPLLFDYQKTGVQWLWELQQQQVGGIIGDEMGLGKTIQVISFLAGLHYSK  463

Query  1466  AY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdseseel  1642
                +P I+VCP T+++QW  E  +W+P F V ILH S +   + +  S   ++       
Sbjct  464   KLTRPVIVVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIRNESSREDALLSQAWN  523

Query  1643  ldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLDEGH  1822
                        +  +K   ++  V+  +  +L+TTY  L+     ++ IEWG AVLDEGH
Sbjct  524   ASSTRGMPSGLKAARK---VVKRVV-EEGHVLVTTYSGLQTYASLVIPIEWGCAVLDEGH  579

Query  1823  RIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFAV  2002
             +IRNPNT +T+ CK+L+T HRII++G+P+QN L+ELWSLFDFVFP +LG L  F  +F  
Sbjct  580   KIRNPNTSITIHCKELRTPHRIILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFRNQFEF  639

Query  2003  PISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSLTSV  2182
             PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC LT  
Sbjct  640   PIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKSEQVLFCKLTKP  699

Query  2183  QRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDYGNPERSGK  2362
             QR  Y+AFL S +++ I +G +  L+G+D++RKICNHPDL   +       YG+  +SGK
Sbjct  700   QRQAYEAFLGSEEMKSILNGRRQVLFGVDILRKICNHPDLQNHKLMSSTTGYGSGSKSGK  759

Query  2363  MKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQRMALID  2539
             M+VV  +L+LWKD GH+ L F+Q + MLDILE F+ +  G+ YRRMDG TP++ R A++D
Sbjct  760   MQVVKSLLELWKDTGHKTLLFTQHRIMLDILEKFVNSLSGFSYRRMDGTTPIQHRQAMVD  819

Query  2540  EFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTV  2719
             EFNN   + +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQK+DVTV
Sbjct  820   EFNNDPSLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLGQKRDVTV  879

Query  2720  YRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENGSTESS  2899
             YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+ F+  DL DLF L D+G+ G TE+S
Sbjct  880   YRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFQLSDLHDLFSLGDEGQ-GPTETS  938

Query  2900  SIFSQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKADNNNGD---  3070
              IF     DV         ++ + +IK++ + H    E+ + S   G    +   GD   
Sbjct  939   KIFK--DADVTYEDSDGTSRKSNAAIKSSASSHSAQEEKKDISKVVGVAAVEQFQGDQEQ  996

Query  3071  ----------VDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK---LEEQASRVAQR  3211
                        + ++ I+  +F   G+HSA++HD IVN     +     +E +A RVA  
Sbjct  997   QSEQEKGTSGANSESRIMEGIFARSGVHSALEHDQIVNGKRVVRADPKIIEAEAKRVAAE  1056

Query  3212  AAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
             AAE LR++        +  PTWTG+ G AG P
Sbjct  1057  AAEELRRAGEAARSVPIGTPTWTGQFGLAGKP  1088



>gb|KEF59697.1| DNA excision repair protein ERCC-6 [Exophiala aquamarina CBS 
119918]
Length=1200

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/697 (47%), Positives = 463/697 (66%), Gaps = 27/697 (4%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
              + + G K+P  I+  LFDYQK GVQWL EL+ Q+ GGI+GDEMGLGKT+Q+++FL  L 
Sbjct  373   TLFDNGYKLPGDIYPSLFDYQKTGVQWLHELYTQQVGGIVGDEMGLGKTIQMISFLAGLQ  432

Query  1457  FSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             +S    KP I+VCP T+++QW  E  +W+P F V ILH S +   + +  S   +   + 
Sbjct  433   YSRKLDKPIIVVCPATVMKQWVNEFHRWWPPFRVTILHSSGSGMVNLRNESTKEDKLLDV  492

Query  1634  eelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLD  1813
                     +   S +   K  K++  +L  D G+L+TTY  L+     L+ ++W YA+LD
Sbjct  493   MWDSARKTQPLTSSQKAAK--KVLKPIL-EDGGVLVTTYSGLQTYAPLLIPVDWQYAILD  549

Query  1814  EGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAE  1993
             EGH+IRNPNT +T+ CK+L+T +RII++G+P+QN L ELWSLFDFVFP +LG L  F  +
Sbjct  550   EGHKIRNPNTAITIYCKELRTPNRIILSGTPMQNNLIELWSLFDFVFPMRLGTLVNFRNQ  609

Query  1994  FAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSL  2173
             F +PI  GGYANA+ LQV TA++CA  L+D I PYLL+R K DV + LPKK+E V+FC L
Sbjct  610   FEIPIRQGGYANASNLQVQTAFKCAETLKDAISPYLLQRFKVDVASDLPKKSEQVLFCKL  669

Query  2174  TSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DYGNP  2347
             + +QR+ Y  F++S +++ I +G +  LYG+D++RKICNHPDL + +     P  DYGNP
Sbjct  670   SKLQRAEYNHFISSGEMDAIMNGKRQVLYGVDILRKICNHPDLTDHKRLSIKPGYDYGNP  729

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVKQR  2524
              +SGKM+VV  +L+LWKD GH+ L F+Q + MLDILE F+ +  G+KYRRMDG TP+  R
Sbjct  730   VKSGKMQVVGSLLELWKDTGHKTLLFAQHRIMLDILEKFVRSLSGFKYRRMDGNTPIPTR  789

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
              +++DEFN   ++ +F+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+GQK
Sbjct  790   QSMVDEFNTDPDLHVFLLTTKVGGLGINLTGADRVIIYDPDWNPSTDLQARERAWRLGQK  849

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             ++VT+YRL+T GTIEEK+YHRQI+K  LTNKILK+P+QR+ F   DL DLF L ++G+  
Sbjct  850   REVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFHLNDLHDLFSLTNEGD--  907

Query  2885  STESSSIFSQLSEDVNITGP---QHPDQEK--------DKSIKTNPADHGTAMERDNNSG  3031
              TE+S++F     + + TG     HP + K        D  +        ++ME+   +G
Sbjct  908   PTETSTLFKDAQVNCSATGAADGAHPTESKVGKDATASDGQVDIKKLPGISSMEQ--YAG  965

Query  3032  SNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK-----LEEQAS  3196
                EEK  N  G  + +  ++  +F   GIHSA++HDAI++     K+      +E++A 
Sbjct  966   EVEEEKQANEEGATNSEARMMEGIFARSGIHSAVEHDAIIDGKSARKVAADPVMIEKEAK  1025

Query  3197  RVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAP  3307
             +VA  AA  LR++  +     +  PTWTG+ G +G P
Sbjct  1026  KVAAEAANELRRAGEVARTVPIGTPTWTGQVGVSGRP  1062



>gb|EEH20648.1| hypothetical protein PABG_02879 [Paracoccidioides brasiliensis 
Pb03]
Length=1236

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/725 (46%), Positives = 460/725 (63%), Gaps = 54/725 (7%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P   L GG ++P  I+  LFDYQK GVQWLWEL+ QK GGIIGDEMGLGKT+QV+AFL  
Sbjct  405   PDTELNGGYRVPGDIYPYLFDYQKTGVQWLWELYQQKVGGIIGDEMGLGKTIQVIAFLAG  464

Query  1451  LHFSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S    KP I+VCP T+++QW  E  +W+  F V ILH S +   + +  S +     
Sbjct  465   LHYSKKLTKPIIVVCPPTVMKQWVNEFHRWWAPFRVSILHTSGSGMINLRSESYADARLE  524

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
                   D         +  K   K+++ VL +   +L+TTY  L+     L+ ++WG ++
Sbjct  525   SQIWDPDQPRRAT---KEQKAAKKILDRVL-AKGHVLVTTYSGLQTYSSLLIPVDWGCSI  580

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNP+T +T+ CK+L+T HR+I++G+P+QN L+ELWSLFDFVFP +LG L  F 
Sbjct  581   LDEGHKIRNPDTAITIHCKELRTAHRLILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFR  640

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F  PI  GGYANA+ LQV TA +CA  L+D I PYLL+R K DV A LPKK+E V+FC
Sbjct  641   NQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKSEQVLFC  700

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DYG  2341
              LT +QRS YQAFL S ++  I  G + ALYGID++RKICNHPDL E +     P  +YG
Sbjct  701   KLTKIQRSAYQAFLGSNEMSSILRGRREALYGIDMLRKICNHPDLPEHKTLSTKPGYNYG  760

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLVT-GGYKYRRMDGATPVK  2518
             +  +SGKM+VV  +L+LWK+ GH+ L F+Q + MLDILE F+ +  G+KY+RMDG TP+K
Sbjct  761   SAAKSGKMQVVKALLELWKETGHKSLLFAQHRIMLDILERFIKSMTGFKYQRMDGNTPIK  820

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
              R +L+DEFNN  EI IF+LTT+VGGLG NLTGA+RVII+DPDWNPS D+QARERAWR+G
Sbjct  821   LRQSLVDEFNNNPEIHIFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLG  880

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNKIL++P+QR+ F+  DL DLF L +D  
Sbjct  881   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFQMSDLHDLFTLGND--  938

Query  2879  NGSTESSSIFSQ----LSEDVNITGPQHP--------DQEKDKSIK-----------TNP  2989
              G TE+S +F +      E V      +P        DQE+   I              P
Sbjct  939   -GPTETSELFKEAEVKFQESVKHGTTDNPAAGESTVADQEEQNKISHVTGVAALEPFQCP  997

Query  2990  ADHGTAMERDNNSGSNGEEKADNNNGDVDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEE  3169
             A+  TA E  + +  N E +             ++  +F   G+HSA++H+ +VN   + 
Sbjct  998   AETPTASETKSTAAPNSEAR-------------LMEGIFARSGVHSALEHEQVVNG--KR  1042

Query  3170  KLKLEEQASRVAQRAAEALRQSRMLRSQE-----SVAIPTWTGRSGTAGAPPSIKKKFGS  3334
              +K + +      +   A     +L++ E      V +PTWTG+ G AG P S  ++  +
Sbjct  1043  IVKADPKIIEAEAKKVAAEAAKELLKAGELAKSIPVGMPTWTGQFGVAGRPESTLQRRET  1102

Query  3335  TLNPQ  3349
               +P 
Sbjct  1103  ATSPH  1107



>ref|XP_003843573.1| similar to DNA repair protein Rhp26/Rad26 [Leptosphaeria maculans 
JN3]
 emb|CBY00094.1| similar to DNA repair protein Rhp26/Rad26 [Leptosphaeria maculans 
JN3]
Length=1224

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/696 (47%), Positives = 446/696 (64%), Gaps = 23/696 (3%)
 Frame = +2

Query  1277  VMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGSLH  1456
              + +GG +IP  I+  LFDYQK GVQWLWEL+ Q  GGIIGDEMGLGKT+Q ++F+  LH
Sbjct  399   TVFDGGFRIPGDIYPALFDYQKTGVQWLWELYSQNVGGIIGDEMGLGKTIQAISFVAGLH  458

Query  1457  FSNAY-KPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesdses  1633
             +S    KP I+VCP T+++QW  E  +W+P+  V ILH S +   D ++  +        
Sbjct  459   YSKLLTKPVIVVCPATVMKQWVNEFHRWWPALRVSILHTSGSGMLDTQREDRMERELELR  518

Query  1634  eelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAVLD  1813
                       + +     K  K I   +  D  +L+TTY  L+   E L+  EW  A+LD
Sbjct  519   SYGDY-----DTTLTGAGKAAKKILEKVKRDGHVLVTTYSGLQTYSEFLIPTEWECAILD  573

Query  1814  EGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFEAE  1993
             EGH+IRNPNT +T+ CK+L+T +RII++G+P+QN L+ELWSLFDFVFP +LG L  F  +
Sbjct  574   EGHKIRNPNTAITIHCKELRTPNRIILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFRNQ  633

Query  1994  FAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFCSL  2173
             F  PI  GGYANA+ L+  TA RCA  L+D + PYLL+R K DV   LP+K E V+FC L
Sbjct  634   FEFPIKRGGYANASNLEFETAVRCAETLKDAVSPYLLQRFKVDVATDLPQKKEQVLFCKL  693

Query  2174  TSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDP--DYGNP  2347
             T  QR+ Y+ FLAS D++ I DG +N L+G+D +RK+CNHPDL E +   + P  DYG P
Sbjct  694   TRQQRAAYEGFLASNDMKSITDGKRNMLFGVDYLRKVCNHPDLTEHKILSKKPGYDYGAP  753

Query  2348  ERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFLV-TGGYKYRRMDGATPVKQR  2524
              RSGKM+VV E+L LWK  GH+ L F+Q + MLDIL+ F+    G  +RRMDG TP+K+R
Sbjct  754   NRSGKMQVVKELLSLWKKGGHKTLLFAQHRIMLDILQKFVSHLPGINWRRMDGETPIKER  813

Query  2525  MALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIGQK  2704
               L+DEFNN  ++ +F+LTT+VGGLG NLTGANRVII+DPDWNPS D+QARER+WR+GQK
Sbjct  814   QNLVDEFNNNPDLDVFLLTTKVGGLGVNLTGANRVIIYDPDWNPSTDIQARERSWRLGQK  873

Query  2705  KDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGENG  2884
             ++V +YRL++ GTIEEK+YHRQI+K  LTNK+LK+P+QR+ F+  DL DLF L ++ E G
Sbjct  874   REVEIYRLMSAGTIEEKIYHRQIFKQFLTNKVLKDPKQRQTFQMSDLHDLFTLGENTE-G  932

Query  2885  STESSSIF--SQLS-EDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKAD  3055
              TE+ ++F  S++  E+   T         D +  T  +      E    +      K D
Sbjct  933   ETETGTLFRGSEVKFEEDGKTASNETTGASDLAAVTGISRTEAFQEPVAENEETAANKED  992

Query  3056  NNNGDVDE--DTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK--------LEEQASRVA  3205
                GD D   D+ ++ T+F   G+HS + HDAIVN+    + +        ++ +A R A
Sbjct  993   GAAGDKDAPTDSRLMSTIFAKTGVHSVLAHDAIVNSTAGGRKRKVQADPAFIQREAKRQA  1052

Query  3206  QRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPS  3313
               AAE L++S     Q    +PTWTG+ G AG P S
Sbjct  1053  ALAAEELKKSMEQARQVPAGVPTWTGQYGEAGRPDS  1088



>ref|XP_003655891.1| hypothetical protein THITE_2120135 [Thielavia terrestris NRRL 
8126]
 gb|AEO69555.1| hypothetical protein THITE_2120135 [Thielavia terrestris NRRL 
8126]
Length=1161

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/871 (40%), Positives = 506/871 (58%), Gaps = 93/871 (11%)
 Frame = +2

Query  1271  PFVMLEGGLKIPETIFDKLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTVQVLAFLGS  1450
             P  + E GL++P  I+  LFDYQK GVQWL EL+ Q+ GGI+GDEMGLGKTVQ+++F+ +
Sbjct  358   PDHVFENGLRLPGDIYPSLFDYQKTGVQWLAELYAQQVGGIVGDEMGLGKTVQLISFVAA  417

Query  1451  LHFSNA-YKPSIIVCPLTLLQQWKREAKKWYPSFHVEILHDSVNDFhdkkkgskshesds  1627
             LH+S   +KP I+V P T+L+QW  E  +W+P   V ILH S +   +     +  +   
Sbjct  418   LHYSKMLHKPVIVVAPATVLRQWVNEFHRWWPPLRVSILHSSGSGMFNVHDEGELEDHVD  477

Query  1628  eseelldvdvekNLSFRNTKKWDKLINHVLGSDSGLLITTYEQLRLLGEKLLDIEWGYAV  1807
             + +             R++K   K+++ V+  +  +L+TTY  L+  G+ L+ ++WGYAV
Sbjct  478   DWDNKKPT--------RSSKAAKKIVDRVV-KNGHVLVTTYAGLQTYGDILIPVDWGYAV  528

Query  1808  LDEGHRIRNPNTDVTLVCKQLQTVHRIIMTGSPIQNKLSELWSLFDFVFPGKLGVLPVFE  1987
             LDEGH+IRNPNT +T+ CK+L+T +RII++G+P+QN L+ELWSLFDF++P +LG L  F 
Sbjct  529   LDEGHKIRNPNTAITIYCKELRTPNRIILSGTPMQNNLTELWSLFDFIYPMRLGTLVAFR  588

Query  1988  AEFAVPISIGGYANATPLQVSTAYRCAVVLRDLIMPYLLRRMKADVNAQLPKKTEHVIFC  2167
              +F +PI +GGYANAT LQ+ TA +CA  L++ I PYLL+R+K DV A LPKK+E V+FC
Sbjct  589   NQFEIPIRLGGYANATNLQIMTAQKCAETLKETIRPYLLQRLKVDVAADLPKKSEQVLFC  648

Query  2168  SLTSVQRSIYQAFLASTDVEQIFDGSKNALYGIDVMRKICNHPDLLEREHSCRDPDY--G  2341
              L+  QR  Y+ FL S ++  I + ++ +LYGID++RKICNHPDLL+     + P Y  G
Sbjct  649   KLSRSQREAYELFLKSDEMASILNRTRQSLYGIDILRKICNHPDLLDPALKTK-PGYQWG  707

Query  2342  NPERSGKMKVVAEVLKLWKDQGHRVLFFSQTQQMLDILENFL-VTGGYKYRRMDGATPVK  2518
             +  +SGKM VV  +L +WK  GH+ L F Q  QMLDI+E F+       Y RMDG TPVK
Sbjct  708   DVSKSGKMAVVQSLLPMWKRLGHKTLLFCQGVQMLDIIEAFVRRLDNITYIRMDGKTPVK  767

Query  2519  QRMALIDEFNNTVEIFIFILTTRVGGLGTNLTGANRVIIFDPDWNPSNDMQARERAWRIG  2698
             QR AL+D+FN    + +F+LTT+VGGLG NLTGANRVIIFDPDWNPS D+QARERAWR+G
Sbjct  768   QRQALVDQFNTDAGLDVFLLTTKVGGLGVNLTGANRVIIFDPDWNPSTDVQARERAWRLG  827

Query  2699  QKKDVTVYRLITRGTIEEKVYHRQIYKHSLTNKILKNPQQRRLFKARDLKDLFVLNDDGE  2878
             QK++VT+YRL+T GTIEEK+YHRQI+K  LTNK+LK+P+Q+  F   DL+DLF L+   E
Sbjct  828   QKREVTIYRLMTAGTIEEKIYHRQIFKQFLTNKVLKDPKQQTTFHLNDLQDLFSLS-SYE  886

Query  2879  NGSTESSSIF-SQLSEDVNITGPQHPDQEKDKSIKTNPADHGTAMERDNNSGSNGEEKAD  3055
             +G TE+  +F   +++     GP+        +I   P   G   E   N+    E++ D
Sbjct  887   DGVTETGELFQGAVAKGSKRGGPKELILPGHDAIPIRPRQRGA--ENRPNAADADEKEED  944

Query  3056  NNNGD---------------VDEDTSILRTLFDAHGIHSAMDHDAIVNAHDEEKLK---L  3181
               + D                +E+  ++  +F   G+HS ++HD I+N     K     L
Sbjct  945   LRHVDGVAGLETYQGESAPPANEEARLMEGIFARSGVHSTLEHDEIINGKKTVKADRKML  1004

Query  3182  EEQASRVAQRAAEALRQSRMLRSQESVAIPTWTGRSGTAGAPPSIKKKFGSTLNPQLVTS  3361
             +++A R+A +AA +LR++        +   TWTG  G AG P +I++  G          
Sbjct  1005  QQEADRIAAQAALSLRRAGEQARTVPIGTVTWTGEVGEAGRPTNIRRGRG----------  1054

Query  3362  SKPLEESSMISSRRNgiaagasagkalssaellakiRGNQERAISDGLEHQHQFNSGSSS  3541
                                                  G    +I  G+ ++    +GS  
Sbjct  1055  -------------------------------------GPGSASILAGVANRQGLAAGSPG  1077

Query  3542  NSRTRAAENGASRPSHGSAGMQPEVLIRQVCTFIQRKGGSTSSASIVEHFRSRVP-SKDL  3718
             +SR+         P      +      + +  FI+R  G   S  +V+HF      S+  
Sbjct  1078  SSRS-------GTPGAAGQNLSARDFEKMIPAFIKRHSGRVPSKLLVDHFNQYCSGSRQA  1130

Query  3719  ALFKNLLKEIATLKKNPNG--SFWILKPEYQ  3805
               FK  L ++A ++K  +   + W LKPEYQ
Sbjct  1131  EEFKVALGKVAKMEKRGSSMRAIWTLKPEYQ  1161



>ref|XP_003673777.1| hypothetical protein NCAS_0A08380 [Naumovozyma castellii CBS 
4309]
 emb|CCC67396.1| hypothetical protein NCAS_0A08380 [Naumovozyma castellii CBS 
4309]
Length=1079

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities =