BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22751_g2_i1 len=342 path=[546:0-21 568:22-57 1558:58-60 1561:61-69
615:70-130 676:131-169 1593:170-174 719:175-250 795:251-341]

Length=342
                                                                      Score     E

ref|XP_004244272.1|  PREDICTED: cytochrome P450 CYP72A219-like          143   1e-37   
ref|XP_006348303.1|  PREDICTED: secologanin synthase-like               143   1e-37   
gb|ABC69422.1|  CYP72A58                                                142   2e-37   Nicotiana tabacum [American tobacco]
ref|XP_009797873.1|  PREDICTED: cytochrome P450 CYP72A219-like          142   2e-37   
ref|XP_006360179.1|  PREDICTED: secologanin synthase-like               141   5e-37   
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          140   1e-36   
ref|XP_004244273.1|  PREDICTED: cytochrome P450 CYP72A219-like          140   1e-36   
ref|XP_009781171.1|  PREDICTED: cytochrome P450 CYP72A219-like          139   2e-36   
emb|CBI39895.3|  unnamed protein product                                134   3e-36   
ref|XP_006348302.1|  PREDICTED: secologanin synthase-like               139   3e-36   
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      139   3e-36   
ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like          138   6e-36   
gb|KDO52098.1|  hypothetical protein CISIN_1g038814mg                   132   6e-36   
ref|XP_006348304.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    137   1e-35   
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    137   2e-35   
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    137   2e-35   
ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like          137   2e-35   
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like          136   2e-35   
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like          136   2e-35   
emb|CAN63404.1|  hypothetical protein VITISV_001871                     135   4e-35   Vitis vinifera
emb|CBI22139.3|  unnamed protein product                                134   6e-35   
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          134   9e-35   
gb|KEH38478.1|  cytochrome P450 family 72 protein                       134   1e-34   
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like          134   1e-34   
emb|CAN72247.1|  hypothetical protein VITISV_024665                     130   2e-34   Vitis vinifera
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like               132   6e-34   
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      132   7e-34   
ref|XP_006348911.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      132   9e-34   
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like          131   1e-33   
ref|XP_009790250.1|  PREDICTED: cytochrome P450 CYP72A219-like          131   2e-33   
ref|XP_004244274.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    131   2e-33   
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like               131   2e-33   
ref|XP_006477888.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      130   2e-33   
gb|KDO52111.1|  hypothetical protein CISIN_1g046539mg                   130   2e-33   
ref|XP_006442317.1|  hypothetical protein CICLE_v10023602mg             130   2e-33   
ref|XP_004244382.2|  PREDICTED: cytochrome P450 CYP72A219-like          130   3e-33   
gb|AJD25168.1|  cytochrome P450 CYP72A327                               130   4e-33   
ref|XP_009411225.1|  PREDICTED: cytochrome P450 72A15-like              125   5e-33   
gb|ABC69393.1|  CYP72A55v2                                              129   9e-33   Nicotiana tabacum [American tobacco]
emb|CDP19609.1|  unnamed protein product                                129   1e-32   
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219               129   1e-32   
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like          129   1e-32   
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219               129   1e-32   Vitis vinifera
gb|EYU31631.1|  hypothetical protein MIMGU_mgv1a004628mg                127   1e-32   
emb|CBI39916.3|  unnamed protein product                                128   1e-32   
emb|CDP15975.1|  unnamed protein product                                128   2e-32   
emb|CDP06076.1|  unnamed protein product                                128   2e-32   
ref|XP_010465361.1|  PREDICTED: cytochrome P450 72A13-like              128   2e-32   
ref|XP_002263609.1|  PREDICTED: cytochrome P450 CYP72A219               128   2e-32   Vitis vinifera
gb|KHN44056.1|  Secologanin synthase                                    128   2e-32   
ref|XP_006598136.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    127   2e-32   
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    128   2e-32   
emb|CBI39886.3|  unnamed protein product                                128   2e-32   
gb|KGN55013.1|  hypothetical protein Csa_4G622230                       123   2e-32   
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like          127   3e-32   
gb|EYU31630.1|  hypothetical protein MIMGU_mgv1a004628mg                127   3e-32   
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    127   3e-32   
ref|XP_010676733.1|  PREDICTED: cytochrome P450 CYP72A219-like          127   3e-32   
gb|KHN44057.1|  Secologanin synthase                                    127   3e-32   
ref|XP_010683653.1|  PREDICTED: cytochrome P450 CYP72A219-like          127   4e-32   
ref|XP_010683652.1|  PREDICTED: cytochrome P450 CYP72A219-like          127   5e-32   
emb|CBI22134.3|  unnamed protein product                                127   5e-32   
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219               127   6e-32   Vitis vinifera
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             127   6e-32   
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             127   6e-32   
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                    126   7e-32   
ref|XP_006364092.1|  PREDICTED: secologanin synthase-like               126   7e-32   
gb|KEH38473.1|  cytochrome P450 family 72 protein                       125   8e-32   
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like          126   8e-32   
gb|ABC69417.1|  CYP72A54                                                126   8e-32   Nicotiana tabacum [American tobacco]
gb|ABC69392.1|  CYP72A55v1                                              126   1e-31   Nicotiana tabacum [American tobacco]
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    125   1e-31   
ref|XP_009411224.1|  PREDICTED: cytochrome P450 72A15-like              124   2e-31   
ref|XP_010327256.1|  PREDICTED: cytochrome P450 CYP72A219-like          124   2e-31   
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like               125   3e-31   
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like          125   3e-31   
ref|XP_004488669.1|  PREDICTED: secologanin synthase-like               125   3e-31   
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like          124   3e-31   
ref|XP_004248734.1|  PREDICTED: cytochrome P450 CYP72A219               124   4e-31   
ref|XP_011082965.1|  PREDICTED: cytochrome P450 CYP72A219-like          124   4e-31   
gb|KHN36820.1|  Secologanin synthase                                    124   4e-31   
emb|CAN71976.1|  hypothetical protein VITISV_042685                     120   4e-31   Vitis vinifera
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      124   5e-31   
gb|ABC59078.1|  cytochrome P450 monooxygenase CYP72A59                  124   5e-31   Medicago truncatula
ref|XP_004151605.1|  PREDICTED: secologanin synthase-like               122   5e-31   
ref|XP_010487266.1|  PREDICTED: cytochrome P450 72A13-like              124   6e-31   
gb|KGN55015.1|  hypothetical protein Csa_4G622740                       123   6e-31   
gb|ADO16184.1|  cytochrome P450 mono-oxygenase                          124   6e-31   
gb|EYU30744.1|  hypothetical protein MIMGU_mgv1a004594mg                124   7e-31   
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    124   8e-31   
ref|XP_009394606.1|  PREDICTED: cytochrome P450 CYP72A219-like          119   8e-31   
dbj|BAL45198.1|  cytochrome P450 monooxygenase                          123   9e-31   
emb|CDP15982.1|  unnamed protein product                                123   9e-31   
gb|KGN66156.1|  hypothetical protein Csa_1G574240                       118   9e-31   
ref|XP_004248200.1|  PREDICTED: cytochrome P450 CYP72A219-like          123   9e-31   
ref|XP_004168302.1|  PREDICTED: secologanin synthase-like               123   1e-30   
ref|XP_004242635.1|  PREDICTED: cytochrome P450 CYP72A219-like          123   1e-30   
ref|XP_006442316.1|  hypothetical protein CICLE_v10024206mg             123   1e-30   
ref|XP_006343585.1|  PREDICTED: secologanin synthase-like               123   1e-30   
ref|XP_004146006.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    123   1e-30   
ref|XP_010644766.1|  PREDICTED: cytochrome P450 CYP72A219-like          122   2e-30   
dbj|BAL45206.1|  cytochrome P450 monooxygenase                          123   2e-30   
ref|XP_010465357.1|  PREDICTED: cytochrome P450 72A13-like              122   2e-30   
gb|KEH38475.1|  cytochrome P450 family 72 protein                       122   2e-30   
emb|CDY32348.1|  BnaC01g36670D                                          122   2e-30   
emb|CDP15981.1|  unnamed protein product                                122   2e-30   
ref|XP_006477887.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      122   2e-30   
gb|AAZ07706.1|  cytochrome P450 monooxygenase                           122   2e-30   Sesamum indicum [beniseed]
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              122   2e-30   
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like          122   2e-30   
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like          122   2e-30   
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               122   3e-30   
emb|CDP19599.1|  unnamed protein product                                122   3e-30   
ref|XP_011082966.1|  PREDICTED: cytochrome P450 CYP72A219-like          122   4e-30   
gb|KHN47456.1|  Secologanin synthase                                    122   4e-30   
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      122   4e-30   
ref|XP_010502032.1|  PREDICTED: cytochrome P450 72A13-like isofor...    122   4e-30   
ref|XP_002268319.1|  PREDICTED: cytochrome P450 CYP72A219               122   4e-30   Vitis vinifera
ref|XP_006349622.1|  PREDICTED: secologanin synthase-like               121   4e-30   
ref|XP_010465366.1|  PREDICTED: cytochrome P450 72A13-like              121   4e-30   
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    122   4e-30   
gb|AJD25171.1|  cytochrome P450 CYP72A330                               121   5e-30   
ref|XP_010502020.1|  PREDICTED: cytochrome P450 72A13 isoform X2        121   5e-30   
ref|XP_006364094.1|  PREDICTED: secologanin synthase-like               121   5e-30   
emb|CDP19600.1|  unnamed protein product                                121   5e-30   
emb|CDP15986.1|  unnamed protein product                                121   5e-30   
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like          121   5e-30   Vitis vinifera
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like          121   6e-30   
ref|XP_010676732.1|  PREDICTED: cytochrome P450 CYP72A219-like          121   6e-30   
emb|CBI39884.3|  unnamed protein product                                120   7e-30   
ref|XP_002263652.1|  PREDICTED: cytochrome P450 CYP72A219-like          120   8e-30   Vitis vinifera
ref|XP_006364093.1|  PREDICTED: secologanin synthase-like               121   9e-30   
ref|XP_010465353.1|  PREDICTED: cytochrome P450 72A13-like              120   9e-30   
ref|XP_009628921.1|  PREDICTED: cytochrome P450 CYP72A219-like          120   9e-30   
gb|ABC69389.1|  CYP72A52v1                                              120   9e-30   Nicotiana tabacum [American tobacco]
emb|CDP19607.1|  unnamed protein product                                120   9e-30   
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like          120   9e-30   Vitis vinifera
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          120   1e-29   
ref|XP_010676734.1|  PREDICTED: cytochrome P450 CYP72A219-like          120   1e-29   
emb|CDP15985.1|  unnamed protein product                                120   1e-29   
gb|EYU43426.1|  hypothetical protein MIMGU_mgv1a018638mg                119   1e-29   
ref|XP_009594691.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    119   1e-29   
ref|XP_010926817.1|  PREDICTED: cytochrome P450 72A15-like isofor...    120   1e-29   
ref|XP_009594690.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    120   1e-29   
ref|XP_010926808.1|  PREDICTED: cytochrome P450 72A15-like isofor...    120   2e-29   
emb|CBI22133.3|  unnamed protein product                                121   2e-29   
gb|KGN55010.1|  hypothetical protein Csa_4G621220                       115   2e-29   
ref|XP_008367417.1|  PREDICTED: cytochrome P450 CYP72A219-like          116   2e-29   
ref|XP_010327096.1|  PREDICTED: cytochrome P450 CYP72A219-like          117   2e-29   
ref|XP_010926800.1|  PREDICTED: cytochrome P450 72A15-like isofor...    120   2e-29   
ref|XP_007022099.1|  Cytochrome P450, family 72, subfamily A, pol...    120   2e-29   
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg             119   2e-29   
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like               119   3e-29   
gb|EPS69403.1|  hypothetical protein M569_05363                         119   3e-29   
gb|KHG14489.1|  Secologanin synthase                                    119   3e-29   
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    119   4e-29   
ref|XP_006477947.1|  PREDICTED: secologanin synthase-like               116   4e-29   
gb|AJD25169.1|  cytochrome P450 CYP72A328                               119   4e-29   
ref|XP_008226302.1|  PREDICTED: cytochrome P450 CYP72A219-like          119   5e-29   
ref|XP_002882888.1|  CYP72A15                                           119   5e-29   
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    119   5e-29   
ref|XP_010645072.1|  PREDICTED: cytochrome P450 CYP72A219-like          118   5e-29   
gb|EPS61578.1|  hypothetical protein M569_13218                         118   5e-29   
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             119   5e-29   
ref|XP_009394211.1|  PREDICTED: cytochrome P450 CYP72A219-like          114   6e-29   
ref|XP_009790251.1|  PREDICTED: cytochrome P450 CYP72A219-like          118   6e-29   
ref|XP_008226213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    118   7e-29   
ref|XP_008226215.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    118   7e-29   
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             118   8e-29   
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          118   8e-29   
ref|XP_007213922.1|  hypothetical protein PRUPE_ppa004271mg             118   9e-29   
ref|XP_006407058.1|  hypothetical protein EUTSA_v10021993mg             117   9e-29   
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like              118   1e-28   
ref|XP_008386157.1|  PREDICTED: cytochrome P450 CYP72A219-like          118   1e-28   
emb|CDX97593.1|  BnaA05g24860D                                          117   1e-28   
gb|ABC69390.1|  CYP72A53v1                                              117   1e-28   Nicotiana tabacum [American tobacco]
ref|XP_007022096.1|  Cytochrome P450, family 72, subfamily A, pol...    117   1e-28   
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...    117   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116708.1|  PREDICTED: cytochrome P450 72A15-like isofor...    117   1e-28   
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             117   1e-28   
gb|EPS70870.1|  hypothetical protein M569_03891                         117   1e-28   
gb|EYU31635.1|  hypothetical protein MIMGU_mgv1a025572mg                117   2e-28   
gb|EYU31636.1|  hypothetical protein MIMGU_mgv1a004595mg                117   2e-28   
ref|XP_010910666.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    114   2e-28   
gb|AHK60841.1|  CYP72A225                                               117   2e-28   
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g             117   2e-28   
ref|XP_009116688.1|  PREDICTED: cytochrome P450 72A15-like              117   2e-28   
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              117   2e-28   
ref|XP_006830578.1|  hypothetical protein AMTR_s00117p00135230          114   2e-28   
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like          117   2e-28   
emb|CDP19608.1|  unnamed protein product                                116   2e-28   
emb|CAN72443.1|  hypothetical protein VITISV_032856                     114   2e-28   Vitis vinifera
ref|XP_008226210.1|  PREDICTED: cytochrome P450 CYP72A219-like          117   3e-28   
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          117   3e-28   
ref|XP_008226216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    116   3e-28   
ref|XP_008226217.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    116   3e-28   
ref|XP_004294187.1|  PREDICTED: secologanin synthase-like               116   3e-28   
emb|CDY20078.1|  BnaA01g29240D                                          116   3e-28   
gb|AIA82924.1|  SLS1                                                    116   4e-28   
ref|XP_004488695.1|  PREDICTED: secologanin synthase-like               116   4e-28   
ref|XP_009790240.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    116   4e-28   
emb|CDY51038.1|  BnaA06g03010D                                          116   4e-28   
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like          116   4e-28   
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    116   4e-28   
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    116   5e-28   
ref|XP_009339350.1|  PREDICTED: cytochrome P450 CYP72A219-like          116   5e-28   
ref|XP_009394809.1|  PREDICTED: cytochrome P450 72A13-like              116   5e-28   
gb|AJD25167.1|  cytochrome P450 CYP72A326                               116   5e-28   
ref|XP_002458199.1|  hypothetical protein SORBIDRAFT_03g028600          116   5e-28   Sorghum bicolor [broomcorn]
emb|CDY32349.1|  BnaC01g36680D                                          115   5e-28   
ref|NP_188084.1|  cytochrome P450, family 72, subfamily A, polype...    115   5e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDP15983.1|  unnamed protein product                                116   5e-28   
ref|XP_007224159.1|  hypothetical protein PRUPE_ppa016446mg             115   6e-28   
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like          116   6e-28   
emb|CDP15978.1|  unnamed protein product                                115   6e-28   
ref|XP_006442293.1|  hypothetical protein CICLE_v10024650mg             110   7e-28   
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               115   7e-28   
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like              115   7e-28   
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              115   7e-28   
ref|XP_010502013.1|  PREDICTED: cytochrome P450 72A13 isoform X1        115   7e-28   
emb|CDP15972.1|  unnamed protein product                                114   7e-28   
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    115   7e-28   
emb|CDP15977.1|  unnamed protein product                                111   7e-28   
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              115   8e-28   
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...    115   8e-28   
ref|XP_003605472.1|  Cytochrome P450 monooxygenase CYP72A61             114   8e-28   
emb|CDY65330.1|  BnaC03g73760D                                          114   8e-28   
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like              115   8e-28   
ref|XP_006364091.1|  PREDICTED: secologanin synthase-like               115   8e-28   
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    115   9e-28   
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...    115   9e-28   
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          115   9e-28   
gb|KFK38821.1|  hypothetical protein AALP_AA3G164800                    115   9e-28   
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    115   1e-27   
ref|XP_010694548.1|  PREDICTED: cytochrome P450 CYP72A219-like          115   1e-27   
emb|CDP15976.1|  unnamed protein product                                115   1e-27   
ref|XP_010275244.1|  PREDICTED: cytochrome P450 CYP72A219-like          115   1e-27   
ref|XP_006442299.1|  hypothetical protein CICLE_v100199322mg            111   1e-27   
gb|KHN14193.1|  Secologanin synthase                                    115   1e-27   
emb|CDP19601.1|  unnamed protein product                                115   1e-27   
emb|CAN72865.1|  hypothetical protein VITISV_029731                     114   1e-27   Vitis vinifera
ref|XP_006495010.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      114   2e-27   
ref|XP_003605471.1|  Cytochrome P450 monooxygenase CYP72A61             114   2e-27   
ref|XP_009339373.1|  PREDICTED: cytochrome P450 CYP72A219-like          114   2e-27   
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    114   2e-27   
ref|XP_008226211.1|  PREDICTED: cytochrome P450 CYP72A219-like          114   2e-27   
gb|AGX93046.1|  secologanin synthase-like protein                       114   2e-27   
ref|XP_003605470.1|  Cytochrome P450 monooxygenase CYP72A61             114   2e-27   
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          114   2e-27   
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219               114   2e-27   
dbj|BAL45199.1|  cytochrome P450 monooxygenase                          114   2e-27   
ref|XP_002262693.1|  PREDICTED: cytochrome P450 CYP72A219               114   2e-27   Vitis vinifera
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    114   2e-27   
ref|XP_008776863.1|  PREDICTED: cytochrome P450 72A15-like isofor...    114   2e-27   
ref|XP_006299550.1|  hypothetical protein CARUB_v10015724mg             114   2e-27   
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          114   2e-27   
ref|XP_011083293.1|  PREDICTED: cytochrome P450 CYP72A219-like          114   2e-27   
ref|XP_003543172.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      114   2e-27   
ref|XP_003531823.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    114   2e-27   
ref|XP_007212438.1|  hypothetical protein PRUPE_ppa016770mg             114   3e-27   
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like          114   3e-27   Vitis vinifera
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              114   3e-27   
gb|AJD25170.1|  cytochrome P450 CYP72A329                               114   3e-27   
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    114   3e-27   
ref|XP_010092742.1|  Secologanin synthase                               114   3e-27   
ref|XP_010502007.1|  PREDICTED: cytochrome P450 72A15-like              114   3e-27   
ref|XP_007131275.1|  hypothetical protein PHAVU_011G000200g             114   4e-27   
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...    114   4e-27   
ref|XP_006442294.1|  hypothetical protein CICLE_v10024650mg             111   4e-27   
ref|XP_006495015.1|  PREDICTED: secologanin synthase-like               112   4e-27   
emb|CBI22131.3|  unnamed protein product                                113   4e-27   
gb|KDO52097.1|  hypothetical protein CISIN_1g039833mg                   108   4e-27   
gb|AJD25172.1|  cytochrome P450 CYP72A331                               113   4e-27   
emb|CDX82471.1|  BnaA03g33500D                                          113   5e-27   
ref|XP_008386384.1|  PREDICTED: cytochrome P450 CYP72A219-like          113   5e-27   
ref|XP_010487267.1|  PREDICTED: cytochrome P450 72A15-like              114   5e-27   
ref|XP_010678727.1|  PREDICTED: cytochrome P450 CYP72A219-like          113   5e-27   
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like               113   5e-27   
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like               113   5e-27   
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    113   5e-27   
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    113   6e-27   
dbj|BAL45208.1|  cytochrome P450 monooxygenase                          113   6e-27   
emb|CDX98486.1|  BnaC05g38890D                                          113   7e-27   
emb|CDP15988.1|  unnamed protein product                                113   7e-27   
ref|XP_008219216.1|  PREDICTED: cytochrome P450 CYP72A219-like          112   7e-27   
sp|H2DH21.1|C7A29_PANGI  RecName: Full=Cytochrome P450 CYP72A219;...    112   8e-27   
ref|XP_006495011.1|  PREDICTED: cytochrome P450 72C1-like isoform X1    108   8e-27   
ref|XP_006297414.1|  hypothetical protein CARUB_v10013438mg             112   9e-27   
gb|AFK42047.1|  unknown                                                 112   9e-27   
emb|CDP15973.1|  unnamed protein product                                112   1e-26   
ref|XP_008366858.1|  PREDICTED: cytochrome P450 CYP72A219-like          112   1e-26   
emb|CDP15980.1|  unnamed protein product                                112   1e-26   
ref|XP_011082818.1|  PREDICTED: cytochrome P450 CYP72A219-like          112   1e-26   
sp|Q05047.1|C72A1_CATRO  RecName: Full=Secologanin synthase; Shor...    112   1e-26   
ref|XP_009146335.1|  PREDICTED: cytochrome P450 72A15-like              112   1e-26   
ref|XP_006495016.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    112   1e-26   
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          112   1e-26   
emb|CDX98484.1|  BnaC05g38910D                                          112   1e-26   
ref|XP_008226214.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    112   1e-26   
ref|XP_006495017.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    112   1e-26   
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          112   1e-26   
gb|KEH38469.1|  cytochrome P450 family 709 protein                      112   1e-26   
ref|XP_009343589.1|  PREDICTED: cytochrome P450 CYP72A219-like          112   1e-26   
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          112   1e-26   
gb|EPS71634.1|  hypothetical protein M569_03124                         108   1e-26   
ref|NP_188083.1|  cytochrome P450, family 72, subfamily A, polype...    112   1e-26   
ref|XP_006477952.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      112   1e-26   
gb|EYU30753.1|  hypothetical protein MIMGU_mgv1a004802mg                112   1e-26   
ref|NP_001140686.1|  putative cytochrome P450 superfamily protein       112   1e-26   
ref|XP_010487268.1|  PREDICTED: cytochrome P450 72A13-like              112   2e-26   
ref|XP_007133274.1|  hypothetical protein PHAVU_011G165900g             107   2e-26   
gb|KFK38825.1|  hypothetical protein AALP_AA3G165400                    114   2e-26   
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like          112   2e-26   
gb|KFK38824.1|  hypothetical protein AALP_AA3G165400                    114   2e-26   
ref|XP_010694547.1|  PREDICTED: cytochrome P450 72A15-like              112   2e-26   
ref|XP_009758460.1|  PREDICTED: cytochrome P450 CYP72A219-like          112   2e-26   
emb|CDX97591.1|  BnaA05g24880D                                          111   2e-26   
ref|XP_004243257.1|  PREDICTED: cytochrome P450 CYP72A219-like          111   2e-26   
ref|XP_004294188.1|  PREDICTED: secologanin synthase-like               111   2e-26   
ref|XP_009343590.1|  PREDICTED: cytochrome P450 CYP72A219-like          111   2e-26   
ref|XP_009394810.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    111   2e-26   
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like               111   2e-26   
gb|AFW83339.1|  putative cytochrome P450 superfamily protein            110   3e-26   
emb|CAN67740.1|  hypothetical protein VITISV_015554                     111   3e-26   
gb|AAA17732.1|  cytochrome P450                                         111   3e-26   
ref|XP_004146075.1|  PREDICTED: secologanin synthase-like               111   3e-26   
ref|XP_009135394.1|  PREDICTED: cytochrome P450 72A15-like              111   3e-26   
ref|XP_004248201.1|  PREDICTED: cytochrome P450 CYP72A219-like          111   3e-26   
gb|KEH28455.1|  cytochrome P450 family 72 protein                       110   3e-26   
ref|XP_009593498.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      111   3e-26   
emb|CBI39938.3|  unnamed protein product                                110   4e-26   
ref|XP_010535012.1|  PREDICTED: cytochrome P450 72A13-like              110   4e-26   
emb|CDX98485.1|  BnaC05g38900D                                          110   4e-26   
ref|XP_010535013.1|  PREDICTED: cytochrome P450 72A13-like              110   4e-26   
ref|XP_004969231.1|  PREDICTED: secologanin synthase-like               110   4e-26   
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          110   5e-26   
ref|XP_010241317.1|  PREDICTED: cytochrome P450 CYP72A219-like          110   5e-26   
dbj|BAF98466.1|  cytochrome P450                                        110   5e-26   
ref|XP_010465360.1|  PREDICTED: cytochrome P450 72A15                   110   5e-26   
gb|EPS65653.1|  hypothetical protein M569_09124                         110   5e-26   
gb|AGX93049.1|  secologanin synthase-like protein                       110   6e-26   
gb|AGX93047.1|  secologanin synthase-like protein                       110   7e-26   
gb|EYU38228.1|  hypothetical protein MIMGU_mgv1a004669mg                110   7e-26   
ref|XP_010465358.1|  PREDICTED: cytochrome P450 72A13-like isofor...    110   7e-26   
ref|XP_008784422.1|  PREDICTED: cytochrome P450 CYP72A219-like          110   7e-26   
ref|XP_006377672.1|  hypothetical protein POPTR_0011s101202g            109   7e-26   
emb|CDX82470.1|  BnaA03g33510D                                          107   8e-26   
ref|XP_006348982.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      112   8e-26   
gb|AEI59770.1|  cytochrome P450                                         110   8e-26   
ref|XP_004243638.1|  PREDICTED: cytochrome P450 CYP72A219-like          110   8e-26   
emb|CDP15979.1|  unnamed protein product                                110   9e-26   
gb|AGX93048.1|  secologanin synthase-like protein                       110   9e-26   
gb|KEH36886.1|  cytochrome P450 family monooxygenase                    108   9e-26   
ref|XP_008219294.1|  PREDICTED: cytochrome P450 CYP72A219-like          110   9e-26   
ref|XP_010678723.1|  PREDICTED: cytochrome P450 CYP72A219-like          109   9e-26   
emb|CDX82468.1|  BnaA03g33530D                                          110   1e-25   
gb|AAA17746.1|  cytochrome P450                                         109   1e-25   
gb|AEI59771.1|  cytochrome P450                                         109   1e-25   
ref|XP_010465355.1|  PREDICTED: cytochrome P450 72A15-like              109   1e-25   
ref|XP_009356829.1|  PREDICTED: cytochrome P450 CYP72A219-like          109   1e-25   
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like          109   1e-25   
gb|AGX93064.1|  secologanin synthase                                    109   1e-25   
ref|XP_006300449.1|  hypothetical protein CARUB_v10020157mg             109   1e-25   
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    109   1e-25   
ref|XP_009361686.1|  PREDICTED: cytochrome P450 72A15-like              109   1e-25   
ref|XP_010685026.1|  PREDICTED: cytochrome P450 CYP72A219-like          109   1e-25   
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              109   1e-25   
ref|XP_004295683.1|  PREDICTED: secologanin synthase-like               109   1e-25   
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like          109   1e-25   
gb|ABC69419.1|  CYP72A56                                                109   2e-25   
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59             109   2e-25   
ref|XP_010542332.1|  PREDICTED: cytochrome P450 72A13-like              109   2e-25   
ref|XP_010041835.1|  PREDICTED: cytochrome P450 72A15-like              108   2e-25   
gb|KEH37984.1|  cytochrome P450 family 72 protein                       108   2e-25   
emb|CDP15984.1|  unnamed protein product                                108   2e-25   
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like          109   2e-25   
ref|XP_004307203.1|  PREDICTED: secologanin synthase-like               109   2e-25   
ref|XP_006442298.1|  hypothetical protein CICLE_v10019876mg             108   2e-25   
emb|CBI22129.3|  unnamed protein product                                108   2e-25   
ref|NP_001170729.1|  uncharacterized protein LOC100384816 precursor     108   2e-25   
dbj|BAL45203.1|  cytochrome P450 monooxygenase                          108   2e-25   
ref|XP_006848523.1|  hypothetical protein AMTR_s00013p00262850          107   2e-25   
gb|AAM77716.1|AF465265_1  cytochrome P450 monooxygenase CYP72A16        108   2e-25   
gb|AFO67231.1|  putative cytochrome P450                                103   2e-25   
gb|AFW83341.1|  putative cytochrome P450 superfamily protein            108   3e-25   
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...    108   3e-25   
ref|NP_188086.1|  cytochrome P450, family 72, subfamily A, polype...    108   3e-25   
ref|XP_008450912.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    108   3e-25   
ref|XP_008450911.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    108   3e-25   
ref|XP_007227257.1|  hypothetical protein PRUPE_ppa017915mg             108   3e-25   
ref|XP_006357881.1|  PREDICTED: secologanin synthase-like               108   3e-25   
gb|ABC59075.1|  cytochrome P450 monooxygenase CYP72A67                  108   3e-25   
ref|XP_002458200.1|  hypothetical protein SORBIDRAFT_03g028610          108   3e-25   
emb|CBI39937.3|  unnamed protein product                                107   3e-25   
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     108   3e-25   
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              108   4e-25   
ref|XP_008784485.1|  PREDICTED: cytochrome P450 CYP72A219-like          108   4e-25   
gb|EPS59034.1|  hypothetical protein M569_15776                         103   5e-25   
ref|XP_011098148.1|  PREDICTED: cytochrome P450 CYP72A219-like          108   5e-25   
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like              107   5e-25   
ref|XP_003569397.1|  PREDICTED: cytochrome P450 72A15-like              108   5e-25   
gb|EAY75694.1|  hypothetical protein OsI_03601                          108   5e-25   
ref|NP_001044129.1|  Os01g0728300                                       108   5e-25   
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like              107   5e-25   
ref|XP_009790241.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    107   5e-25   
emb|CDY28093.1|  BnaC06g02740D                                          107   5e-25   
ref|XP_009790804.1|  PREDICTED: secologanin synthase-like               107   6e-25   
ref|XP_011091092.1|  PREDICTED: cytochrome P450 CYP72A219-like          107   6e-25   
dbj|BAL45204.1|  cytochrome P450 monooxygenase                          107   6e-25   
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    107   7e-25   
ref|XP_004969235.1|  PREDICTED: secologanin synthase-like               107   8e-25   
ref|XP_010501993.1|  PREDICTED: cytochrome P450 72A13-like              107   8e-25   
emb|CDY20076.1|  BnaA01g29260D                                          107   8e-25   
ref|XP_010926871.1|  PREDICTED: cytochrome P450 72A15-like isofor...    107   8e-25   
ref|XP_011098146.1|  PREDICTED: cytochrome P450 CYP72A219-like          107   8e-25   
gb|KEH37983.1|  cytochrome P450 family 72 protein                       107   8e-25   
ref|XP_009116716.1|  PREDICTED: cytochrome P450 72A15-like isofor...    107   9e-25   
gb|AFO67233.1|  putative cytochrome P450 monooxygenase                  102   1e-24   
ref|XP_009394609.1|  PREDICTED: cytochrome P450 72A15-like              107   1e-24   
gb|EMS67452.1|  Secologanin synthase                                    107   1e-24   
ref|XP_010678917.1|  PREDICTED: cytochrome P450 72A15-like              107   1e-24   
gb|ABC68405.1|  cytochrome P450 monooxygenase CYP72A68                  106   1e-24   
gb|ABC59077.1|  cytochrome P450 monooxygenase CYP72A68                  107   1e-24   
emb|CDX97592.1|  BnaA05g24870D                                          107   1e-24   
ref|XP_003525967.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      107   1e-24   
ref|XP_009615908.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    107   1e-24   
gb|EMS61128.1|  Secologanin synthase                                    104   1e-24   
emb|CBI39929.3|  unnamed protein product                                106   1e-24   
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              106   1e-24   
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like              106   1e-24   
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like          106   1e-24   
ref|XP_006830579.1|  hypothetical protein AMTR_s00117p00135700          106   2e-24   
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                   106   2e-24   
ref|NP_188082.1|  cytochrome P450, family 72, subfamily A, polype...    106   2e-24   
dbj|BAJ98958.1|  predicted protein                                      106   2e-24   
dbj|BAB02396.1|  cytochrome P450                                        106   2e-24   
gb|AGX93044.1|  secologanin synthase-like protein                       106   2e-24   
ref|XP_010275158.1|  PREDICTED: cytochrome P450 CYP72A219-like          106   2e-24   
ref|XP_010470433.1|  PREDICTED: cytochrome P450 72A13-like              105   3e-24   
ref|XP_010233466.1|  PREDICTED: cytochrome P450 72A15-like              106   3e-24   
ref|XP_006307236.1|  hypothetical protein CARUB_v10008841mg             106   3e-24   
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          105   3e-24   
ref|XP_010487262.1|  PREDICTED: cytochrome P450 72A13-like              105   3e-24   
gb|KHG20902.1|  Secologanin synthase                                    105   3e-24   
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like               105   3e-24   
gb|KEH38470.1|  cytochrome P450 family monooxygenase                    105   3e-24   
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    105   3e-24   
emb|CBI21825.3|  unnamed protein product                                102   4e-24   
ref|XP_009339365.1|  PREDICTED: cytochrome P450 CYP72A219-like          105   4e-24   
tpg|DAA58482.1|  TPA: putative cytochrome P450 superfamily protein      102   4e-24   
ref|NP_188079.1|  cytochrome P450, family 72, subfamily A, polype...    105   4e-24   
ref|XP_009116734.1|  PREDICTED: cytochrome P450 72A13-like isofor...    105   4e-24   
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g             105   4e-24   
emb|CDY20075.1|  BnaA01g29270D                                          105   4e-24   
emb|CDY51036.1|  BnaA06g02990D                                          105   4e-24   
gb|KHG18227.1|  Secologanin synthase                                    105   5e-24   
ref|XP_010540137.1|  PREDICTED: cytochrome P450 72C1-like               105   5e-24   
ref|XP_010535014.1|  PREDICTED: cytochrome P450 72A13-like              105   5e-24   
ref|XP_006830577.1|  hypothetical protein AMTR_s00117p00134960          105   5e-24   
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like          105   5e-24   
gb|EPS71635.1|  hypothetical protein M569_03125                         101   5e-24   
ref|XP_011091091.1|  PREDICTED: cytochrome P450 CYP72A219-like          105   6e-24   
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like              104   6e-24   
ref|XP_010068175.1|  PREDICTED: cytochrome P450 CYP72A219-like          104   7e-24   
gb|KCW62993.1|  hypothetical protein EUGRSUZ_G00593                     104   7e-24   
ref|XP_004295684.1|  PREDICTED: secologanin synthase-like               104   7e-24   
ref|XP_009339348.1|  PREDICTED: cytochrome P450 CYP72A219-like          104   8e-24   
ref|NP_001055361.1|  Os05g0372300                                       104   9e-24   
gb|AFO67228.1|  putative cytochrome P450 72A                          99.4    1e-23   
ref|XP_009116727.1|  PREDICTED: cytochrome P450 72A13-like isofor...    104   1e-23   
ref|XP_002882887.1|  CYP72A7                                            104   1e-23   
gb|EAZ12763.1|  hypothetical protein OsJ_02680                          103   1e-23   
ref|XP_010242111.1|  PREDICTED: cytochrome P450 CYP72A219-like          103   1e-23   
ref|XP_008656689.1|  PREDICTED: cytochrome P450 72A14-like              104   1e-23   
gb|EAY75040.1|  hypothetical protein OsI_02936                          103   1e-23   
emb|CDP11335.1|  unnamed protein product                                103   1e-23   
ref|XP_009800506.1|  PREDICTED: cytochrome P450 72A15-like              103   1e-23   
ref|XP_010068176.1|  PREDICTED: cytochrome P450 CYP72A219-like          100   1e-23   
gb|EPS61172.1|  hypothetical protein M569_13627                         103   1e-23   
ref|XP_010465352.1|  PREDICTED: cytochrome P450 72A13-like              103   2e-23   
ref|XP_010666256.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    103   2e-23   
ref|XP_006495012.1|  PREDICTED: cytochrome P450 72C1-like isoform X2  98.6    2e-23   
ref|XP_010552411.1|  PREDICTED: cytochrome P450 72A13-like              103   2e-23   
ref|NP_001043632.1|  Os01g0627500                                       103   2e-23   
ref|XP_006299313.1|  hypothetical protein CARUB_v10015468mg             103   2e-23   
gb|EYU26282.1|  hypothetical protein MIMGU_mgv1a026663mg                103   2e-23   
emb|CBI39923.3|  unnamed protein product                                102   2e-23   
ref|XP_004243255.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X1    103   2e-23   
ref|XP_002892932.1|  CYP72C1                                            103   2e-23   
ref|XP_006646125.1|  PREDICTED: secologanin synthase-like               103   2e-23   
gb|AAK38091.1|  putative cytochrome P450                                103   2e-23   
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like          103   2e-23   
ref|XP_009596805.1|  PREDICTED: cytochrome P450 72A15-like              103   2e-23   
gb|EMT21522.1|  Secologanin synthase                                    103   2e-23   
ref|XP_002870785.1|  CYP72C1                                            102   2e-23   
ref|NP_173149.1|  cytochrome p450 72c1                                  102   2e-23   
gb|EMT23021.1|  Secologanin synthase                                    103   2e-23   
ref|XP_010459266.1|  PREDICTED: cytochrome P450 72C1 isoform X1         103   3e-23   
gb|AAK38092.1|  putative cytochrome P450                                103   3e-23   
emb|CDX98481.1|  BnaC05g38940D                                          105   3e-23   



>ref|XP_004244272.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=514

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSD-NVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR L GD K+F+KM  +A SKPM + D ++APR+ P+F+    KYGK C+ WMGP P + 
Sbjct  46   YRFLYGDMKDFSKMIKEANSKPMNMDDHDLAPRMVPFFLETIKKYGKKCFTWMGPRPQIL  105

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPELIKEVL+K+ ++QKP  +PLG   V+GLVSYEK++WAKHR++INPAF+
Sbjct  106  IMDPELIKEVLSKTYVYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFH  158



>ref|XP_006348303.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=519

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YRIL GD K+F+ M  +A SKPM +S D+++PR+ P+F+ +  KYGK C+ WMGP P + 
Sbjct  51   YRILYGDMKDFSGMIKEANSKPMNISNDDLSPRLVPFFLEIIKKYGKKCFTWMGPRPQIL  110

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPELIKEVL+K+ ++QKP  +PLG   V+GLV+YEK++WAKHR++INPAF+
Sbjct  111  IMDPELIKEVLSKTYVYQKPHANPLGTLFVQGLVTYEKDKWAKHRKIINPAFH  163



>gb|ABC69422.1| CYP72A58 [Nicotiana tabacum]
Length=513

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KEF+ M  +A SKPM+LSD+VAPR+ P+F+    KYGK  + W GP P+V +
Sbjct  46   YKVLYGDMKEFSGMIKEAYSKPMSLSDDVAPRLMPFFLETIKKYGKRSFIWFGPRPLVLI  105

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEVL+K  L+QKP  +PL   LV+G+ +YE+++WAKHR++INPAF+
Sbjct  106  MDPELIKEVLSKIHLYQKPGGNPLATLLVQGIATYEEDKWAKHRKIINPAFH  157



>ref|XP_009797873.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=519

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KEF+ M  +A SKPM+LSD+VAPR+ P+F+    KYGK  + W GP P+V +
Sbjct  52   YKVLYGDMKEFSGMIKEAYSKPMSLSDDVAPRLMPFFLETIKKYGKRSFIWFGPRPLVLI  111

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEVL+K  L+QKP  +PL   LV+G+ +YE+++WAKHR++INPAF+
Sbjct  112  MDPELIKEVLSKIHLYQKPGGNPLATLLVQGIATYEEDKWAKHRKIINPAFH  163



>ref|XP_006360179.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=514

 Score =   141 bits (355),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSD-NVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR+L GD K+  +M  +A SKPM +SD ++APR+ P+F+    KYGK C+ WMGP P V 
Sbjct  48   YRLLYGDMKDVTRMIKEANSKPMNMSDHDLAPRMMPFFLETINKYGKKCFTWMGPKPQVL  107

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPELIKEVL+K+ L+QKP  +PLG   V+GLVSYEK++WAK+R++INPAF+
Sbjct  108  IMDPELIKEVLSKTYLYQKPGGNPLGSLFVQGLVSYEKDKWAKNRKIINPAFH  160



>ref|XP_009797437.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=515

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GDTKE A++T +A+ KP+ L+D++ PR+ P++ H   KYG +CYAW+GP P +F+
Sbjct  48   YRTLYGDTKEMAELTKEAMLKPIKLTDDILPRIFPFYHHTLNKYGNHCYAWIGPEPRIFV  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             +PELIKE++  + +F+KPK +PL + LV G+ SYE E+WAKHR++IN AFY+
Sbjct  108  MEPELIKEIVTNNTIFKKPKPAPLVQLLVSGISSYEDEKWAKHRKIINTAFYA  160



>ref|XP_004244273.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+IL GD  +F  M  +A SKPM LSD++APR+ P+F+    KYGK C+ W+GP P V +
Sbjct  51   YKILYGDLNDFIGMIREASSKPMNLSDDIAPRLVPFFLETTKKYGKKCFIWLGPKPQVII  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEVL+K+ L+QKP  +P    LV+GL +YE+++WAKHR++INPAF+
Sbjct  111  MDPELIKEVLSKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFH  162



>ref|XP_009781171.1| PREDICTED: cytochrome P450 CYP72A219-like, partial [Nicotiana 
sylvestris]
Length=449

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDN-VAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+++ GD KE +K   +  SKP+ +SD+ + PR+ PYF+    KYGKNC+ W+GP P+VF
Sbjct  49   YKLIFGDLKELSKSIEEVKSKPLNVSDDDIPPRILPYFIEAIKKYGKNCFVWLGPNPLVF  108

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            +R+PE+IK+VL +  L+QKPK++PL R L +G+VSYE+++WAKHR+++NPAF+
Sbjct  109  VREPEVIKDVLTRHALYQKPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFH  161



>emb|CBI39895.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE + M  +A S+P++LSD+  PRV P+  H   KYGKN +AW GP PMV +
Sbjct  48   YRLLHGDFKEMSMMLKEAYSRPISLSDDTTPRVLPFHFHFIKKYGKNSFAWFGPNPMVNI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PELI++VL KS++FQKP   PLG+ LV GLV+ E E+WAK R++INPAF+
Sbjct  108  MEPELIRDVLLKSNVFQKPPPHPLGKLLVSGLVTLEGERWAKRRKIINPAFH  159



>ref|XP_006348302.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+IL GD  +F  M  +A SKPM LSD++APR+ P+F+    KYGK C+ W+GP P V +
Sbjct  51   YKILYGDLNDFIGMIREATSKPMNLSDDIAPRLVPFFLETIKKYGKKCFIWLGPKPQVII  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP+LIKEVL+K+ L+QKP  +P    LV+GL +YE+++WAKHR++INPAF+
Sbjct  111  MDPKLIKEVLSKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFH  162



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDN-VAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+++ GD KE +K   DA SKP+ +SD+ + PR+ PYFV    KYGKNC+ W+GP P+V 
Sbjct  49   YKLIYGDIKELSKSIEDAESKPLNVSDDDLTPRILPYFVQTIKKYGKNCFIWIGPKPLVI  108

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPE+I++V NK  L+QKPK++PL + L +G+VSYE+++WAKHR+++NPAF+
Sbjct  109  VGDPEVIRDVFNKHALYQKPKSTPLTKLLAQGIVSYEEDKWAKHRKILNPAFH  161



>ref|XP_009617254.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE + M  +A SKPM LSD++APR+ P+F+    KYGK  + W+GP P+VF+
Sbjct  51   YRILYGDMKELSGMIKEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFV  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEV +K+ L+QKP ++PL + L +GLVS E+++WAKHR+++ PAF+
Sbjct  111  MDPELIKEVFSKNYLYQKPHSNPLTKLLAQGLVSQEEDKWAKHRKIVTPAFH  162



>gb|KDO52098.1| hypothetical protein CISIN_1g038814mg, partial [Citrus sinensis]
Length=189

 Score =   132 bits (332),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD +E A +++ A SKP++  D++APRV P +  L   YGK CY W+GPIPM+ +
Sbjct  32   YRFLFGDVREHAVLSNQAKSKPISFEDDIAPRVVPLYDQLVKLYGKICYWWVGPIPMINI  91

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             DP+ +KEV  K + FQKPK++PLG+ L  GL S+E E+WAKHR++INPAF+ 
Sbjct  92   MDPDQLKEVFTKINDFQKPKSNPLGKILTTGLASHEGEKWAKHRKIINPAFHQ  144



>ref|XP_006348304.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSD-NVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR+L GD K+ + M  +A SKPM +SD N+APR+ P+F+    KYGK  + WMGP P + 
Sbjct  51   YRLLYGDMKDLSGMIKEANSKPMNMSDHNLAPRMVPFFLETIKKYGKKSFIWMGPRPQIL  110

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPELIKEVL+K+ ++QKP  +PLG   V+GLVSYEK++WAKHR++INPAF+
Sbjct  111  IMDPELIKEVLSKNYVYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFH  163



>ref|XP_009789309.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE + M  +A SKPM LSD++APR+ P+F+    KYGK  + W+GP P+VF+
Sbjct  51   YRILYGDMKELSGMIEEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEV +K+ L++KP ++PL + L +GLVS E ++WAKHR++I PAF+
Sbjct  111  MDPELIKEVFSKNYLYEKPHSNPLTKLLAQGLVSQEGDKWAKHRKIITPAFH  162



>ref|XP_009789316.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=516

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE + M  +A SKPM LSD++APR+ P+F+    KYGK  + W+GP P+VF+
Sbjct  51   YRILYGDMKELSGMIEEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEV +K+ L++KP ++PL + L +GLVS E ++WAKHR++I PAF+
Sbjct  111  MDPELIKEVFSKNYLYEKPHSNPLTKLLAQGLVSQEGDKWAKHRKIITPAFH  162



>ref|XP_009620491.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDN-VAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+++ GD KE +K   +A SKP+ +SD+ + PR+ PYF+    KYGKN + W+GP P+VF
Sbjct  48   YKLIFGDLKELSKSIEEAKSKPLNVSDDDIPPRILPYFIEAIKKYGKNSFIWLGPNPLVF  107

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            +RDP+++K+VL K  L+QKPK++PL R L +G+VSYE+++WAKHR+++NPAF+
Sbjct  108  VRDPDVLKDVLTKHSLYQKPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFH  160



>ref|XP_011082820.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=519

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GDT + AKM  +A SKP+ LSD+V PRV P   H+  KYGK C+ W+GP+  V +
Sbjct  45   YRILYGDTNDMAKMIKEANSKPIKLSDDVLPRVIPLHHHIVRKYGKACFVWIGPVARVVI  104

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PELIKEVLN + +F+KP  +PL R LV G+  YE ++W+KHR++INPAFY
Sbjct  105  MEPELIKEVLNNNHIFKKPTPNPLARFLVCGINGYEDDKWSKHRKIINPAFY  156



>ref|XP_009617253.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum]
Length=518

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+IL GD KE + M  +A SKPM LSD++APR+ P+F+    KYGK  + W+GP P+V +
Sbjct  51   YKILYGDMKELSGMIKEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVLI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKE+ +K  L+QKP  +P+ + LV+GLVS E+++WAKHR++INPAF+
Sbjct  111  MDPELIKEIFSKYYLYQKPHGNPVTKLLVQGLVSLEEDKWAKHRKIINPAFH  162



>emb|CAN63404.1| hypothetical protein VITISV_001871 [Vitis vinifera]
Length=471

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE + M  +A S+P++LSD++APRV P+  H   KYGKN +AW GP PMV +
Sbjct  48   YRLLHGDFKEMSMMLKEAYSRPISLSDDIAPRVLPFHCHFIKKYGKNSFAWFGPNPMVNI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +P LI++VL KS++FQKP   PLG+ LV GLV+ E E+WAK R++INPAF+
Sbjct  108  MEPGLIRDVLLKSNVFQKPPPHPLGKLLVSGLVTLEGERWAKRRKIINPAFH  159



>emb|CBI22139.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE + M  +A S+P++LSD++APRV P+  H   KYGKN +AW GP PMV +
Sbjct  48   YRLLHGDFKEMSMMLKEAYSRPISLSDDIAPRVLPFHCHFIKKYGKNFFAWFGPNPMVNI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PELI+++L KS++FQKP   PLG+ LV GLV+ E E+WAK R+ INPAF+
Sbjct  108  MEPELIRDILLKSNVFQKPPPHPLGKLLVSGLVTLEGERWAKRRKNINPAFH  159



>ref|XP_009602242.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=513

 Score =   134 bits (338),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GDTKE A+MT +A  KP+ L+D++ PR+ P++ H   KYG +C+AW+GP P +F+
Sbjct  47   YRTLYGDTKEMAEMTKEAKFKPIKLTDDILPRIFPFYHHTFNKYGNHCFAWIGPEPRIFV  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
              PELIKE++  + +F+KPK +PL + LV G+ SYE ++WAKHR+++N AFY+
Sbjct  107  MKPELIKEIVTNNTIFKKPKPAPLVQLLVSGISSYEDDKWAKHRKILNTAFYA  159



>gb|KEH38478.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD ++  KM  +  SKPM LSD++APRV  YF H   KYGKN + W GP P V +
Sbjct  48   YRLLVGDIRDLLKMRKETTSKPMNLSDDIAPRVFSYFHHSVAKYGKNSFMWFGPTPRVNI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             DPELIK VLNK   FQKP  SPL R L  GLV+ E E+W+KHR+LINPAF
Sbjct  108  SDPELIKYVLNKIYDFQKPNASPLVRLLANGLVNLEGEKWSKHRKLINPAF  158



>ref|XP_004243845.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDN-VAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+++ GD KE +K   DA SKP+ +SD+ + PR+ PYFV    KYGKNC+ W+G  P+V 
Sbjct  49   YKLIFGDIKELSKSIEDAESKPLDVSDDDLTPRILPYFVQTIKKYGKNCFIWIGTKPLVI  108

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPE+I++V NK  L+QKPK++PL + L +G+VSYE+ +WAKHR+++NPAF+
Sbjct  109  VGDPEVIRDVFNKHALYQKPKSTPLTKLLAQGIVSYEEVKWAKHRKILNPAFH  161



>emb|CAN72247.1| hypothetical protein VITISV_024665 [Vitis vinifera]
Length=288

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE + M  +A S+P++LSD++APRV P+  H   KYGKN +AW GP PMV +
Sbjct  89   YRLLHGDFKEMSMMLKEAYSRPISLSDDIAPRVLPFHCHFIKKYGKNFFAWFGPNPMVNI  148

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PELI++ L KS++FQ P   PLG+ LV GLV+ E E+WAK R+ INPAF+
Sbjct  149  MEPELIRDXLLKSNVFQXPPPHPLGKLLVSGLVTLEGERWAKRRKNINPAFH  200



>ref|XP_006495013.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=536

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD +E A ++  A SKP++  D++APRV P +  L   YGK CY W+GPIPM+ +
Sbjct  68   YRFLFGDVREHAVLSKQAKSKPISFEDDIAPRVVPLYDQLVKLYGKICYWWVGPIPMINI  127

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             DP+ +KEV  K + FQKPK++PLG+ L  GL S+E E+WAKHR++INPAF+ 
Sbjct  128  MDPDQLKEVFTKINDFQKPKSNPLGKILTTGLASHEGEKWAKHRKIINPAFHQ  180



>ref|XP_006363756.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=519

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPM-ALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+++ GD KE +K   DA SKP+ A  D++ PR+ PYFV    KYGKNC+ W+GP P+V 
Sbjct  50   YKLIYGDIKELSKSIEDAKSKPLNASDDDLTPRILPYFVQTIKKYGKNCFIWVGPKPLVI  109

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPE+I++V NK  L+QKPK  P  + L +G++SYE ++WAKHRR++NPAF+
Sbjct  110  VGDPEVIRDVFNKHALYQKPKYPPQTKLLAKGILSYEDDKWAKHRRILNPAFH  162



>ref|XP_006348911.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   132 bits (331),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDN-VAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+++ GD KE AK   DA SKP+ +SD+ + PR+ PYFV    K+GKNC+ W+GP PMV 
Sbjct  49   YKLIFGDLKELAKSFEDANSKPLKVSDDDICPRIVPYFVDTIKKHGKNCFIWIGPKPMVL  108

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            +R+PE+I++V NK  L+QKPK++P+ + L +G+ SYE+++W  HR+++NPAF+
Sbjct  109  VREPEVIRDVFNKYVLYQKPKSTPITKLLAQGVSSYEEDKWEMHRKILNPAFH  161



>ref|XP_009607556.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KE   M  +A +KPM  +++   RV P+F  L  +YGKNC+ W+GP P +F+
Sbjct  50   YKLLLGDMKEINTMVEEAKTKPMNFTNDYVARVLPHFTKLMLQYGKNCFMWLGPKPTMFI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI+E+L+KS ++QK + +P+ + L +GL SYE E+WAKHRR+INPAF+
Sbjct  110  TDPELIREILSKSYIYQKIQGNPITKLLAQGLASYETEKWAKHRRIINPAFH  161



>ref|XP_009790250.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD  E  KM  +A+SKP+  S N+ PRV P+F      YGKNC AW GP P + +
Sbjct  52   YRFLFGDVNEMMKMGKEALSKPIDFSHNIWPRVMPFFHKTITTYGKNCLAWYGPRPAIVI  111

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI+EVL K+ +FQKP  +PL +    GL  YE ++WAKHRRLINPAF+
Sbjct  112  VDPELIREVLTKNYIFQKPPGTPLTKLAANGLAGYEADKWAKHRRLINPAFH  163



>ref|XP_004244274.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD K+F+KM  +A SKPM LS+++ PR+ P+F+    KYGK  + W+ P P V +
Sbjct  47   YRLLYGDMKDFSKMIKEANSKPMNLSNDITPRLVPFFLETIKKYGKKSFIWLCPKPQVLI  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEV +K+  +QKP  +P    LV+GL +YE+++WAKHR++INPAF+
Sbjct  107  MDPELIKEVFSKNYFYQKPHGNPFAALLVQGLAAYEEDKWAKHRKIINPAFH  158



>ref|XP_004488668.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=519

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD ++  K   +A SKPM LSD++ PRV  Y  H   KYGKN + W GPIP V +
Sbjct  49   YRLLVGDVRDLLKTRKEATSKPMNLSDDIGPRVFSYVHHSVTKYGKNSFMWFGPIPRVNI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IK+VLNK   F+KP ++PL R L  GLVSYE E+W KHR++INPAF+
Sbjct  109  TDPEQIKDVLNKIYDFRKPNSNPLVRLLANGLVSYEGEKWNKHRKIINPAFH  160



>ref|XP_006477888.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=512

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+I  GDTK+ + M  +A ++P++LSD++ PR+ PY  H+  KYGK  + WMGP P + +
Sbjct  46   YKIFHGDTKDMSMMLKEAKARPISLSDDIVPRILPYHHHIISKYGKKSFKWMGPRPSINV  105

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
            +DP+LI+E+L K D+FQKPK + LG+ +V G+V+YE EQW+K R++ NPAF+ 
Sbjct  106  QDPKLIREILLKHDIFQKPKGNSLGKLVVNGMVTYEGEQWSKVRKIANPAFHQ  158



>gb|KDO52111.1| hypothetical protein CISIN_1g046539mg [Citrus sinensis]
Length=484

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+I  GDTK+ + M  +A ++P++LSD++ PR+ PY  H+  KYGK  + WMGP P + +
Sbjct  46   YKIFHGDTKDMSMMLKEAKARPISLSDDIVPRILPYHHHIISKYGKKSFKWMGPRPSINV  105

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
            +DP+LI+E+L K D+FQKPK + LG+ +V G+V+YE EQW+K R++ NPAF+ 
Sbjct  106  QDPKLIREILLKHDIFQKPKGNSLGKLVVNGMVTYEGEQWSKVRKIANPAFHQ  158



>ref|XP_006442317.1| hypothetical protein CICLE_v10023602mg [Citrus clementina]
 gb|ESR55557.1| hypothetical protein CICLE_v10023602mg [Citrus clementina]
Length=512

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+I  GDTK+ + M  +A ++P++LSD++ PR+ PY  H+  KYGK  + WMGP P + +
Sbjct  46   YKIFHGDTKDMSMMLKEAKARPISLSDDIVPRILPYHHHIISKYGKKSFKWMGPRPSINV  105

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
            +DP+LI+E+L K D+FQKPK + LG+ +V G+V+YE EQW+K R++ NPAF+ 
Sbjct  106  QDPKLIREILLKHDIFQKPKGNSLGKLVVNGMVTYEGEQWSKVRKIANPAFHQ  158



>ref|XP_004244382.2| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=511

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GDTKE AK+T  A  KPM L+D++  RV P++ +   KYG NC+ W+GP P +F+
Sbjct  45   YRTLYGDTKEMAKLTKQAKLKPMKLTDDILTRVLPFYHYTLNKYGNNCFIWIGPEPRIFI  104

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             +PELI++++  +++F+KPK +PL + LV G+ SYE ++WAKHR+++N AFY+
Sbjct  105  MEPELIRDIVMNNNIFKKPKPTPLVQLLVSGISSYEDQKWAKHRKILNTAFYT  157



>gb|AJD25168.1| cytochrome P450 CYP72A327 [Salvia miltiorrhiza]
Length=518

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD ++F K T +A +KP+ L D++  RV P+FV+   K+GK+ + W GP P + +
Sbjct  49   YRLLIGDLRDFMKATEEAKTKPINLDDDIKTRVVPFFVNTLSKFGKDSFFWFGPHPTLIV  108

Query  160  RDPELIKEVLNKSDLFQKPKNS-PLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP+L KE+L KSDLF K ++S PL R LV+G++S+EKE+WAKHR++INPAF+
Sbjct  109  TDPDLAKEILGKSDLFSKARSSNPLSRLLVQGVLSHEKEKWAKHRKIINPAFH  161



>ref|XP_009411225.1| PREDICTED: cytochrome P450 72A15-like [Musa acuminata subsp. 
malaccensis]
Length=191

 Score =   125 bits (313),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR   GD KE  ++  +A+S PM L+ N+ P V P+      +YGK C+ W GP+P V +
Sbjct  66   YRFPKGDLKENVRLAEEALSTPMPLTHNIVPHVLPFLHRAIDEYGKICFTWFGPVPRVTI  125

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPEL++EVL NK   F KPK + LGR LVRGLVSYE E+W KHRR++NPAF+
Sbjct  126  MDPELVREVLSNKFGHFGKPKGNLLGRFLVRGLVSYEGEKWVKHRRIMNPAFH  178



>gb|ABC69393.1| CYP72A55v2 [Nicotiana tabacum]
Length=521

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMA-LSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR+  GD KE +K   +  SKP+  LS+ VAPR+ PY++ +  KYGK C+ W GP P + 
Sbjct  50   YRLFYGDMKELSKSLKEINSKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAIL  109

Query  163  LRDPELIKEVLNKSDLFQKPKN-SPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + +PELIKE+  K+ +FQKP N +PL + L RG+VSYE+E+WAKHR+++NPAF+
Sbjct  110  ITEPELIKEIFGKNYVFQKPNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFH  163



>emb|CDP19609.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KE + + ++A SK + LSD++ PRV P ++    KYGKN Y W GP P + +
Sbjct  54   YKLLHGDFKEMSTLYTEAQSKNLNLSDDIVPRVIPQYLGAVKKYGKNTYLWFGPRPALVI  113

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP LIK V  K D+FQKP+ +PLGR L +GLVSYE E+WAK R+L+NPAF+
Sbjct  114  MDPNLIKAVTQKVDVFQKPRVNPLGRLLAQGLVSYEGEKWAKQRKLLNPAFH  165



>ref|XP_004243253.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=518

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPM-ALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+++ GD KE AK   D  SKP+    D++ PR+ PYFV    K+GKNC+ W+GP PMV 
Sbjct  49   YKLIFGDLKELAKSFEDVKSKPLNVFDDDITPRIVPYFVDTIKKHGKNCFIWIGPKPMVL  108

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + D E+I++V NK  L+QKPK +PL + L +GL SYE+++WA HR+++NPAF+
Sbjct  109  VNDAEVIRDVFNKYVLYQKPKPTPLTKLLAQGLASYEEDKWAMHRKILNPAFH  161



>ref|XP_009618785.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=531

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMA-LSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR+  GD KE +K   +  SKP+  LS+ VAPR+ PY++ +  KYGK C+ W GP P + 
Sbjct  60   YRLFYGDMKELSKSLKEINSKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAIL  119

Query  163  LRDPELIKEVLNKSDLFQKPKN-SPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + +PELIKE+  K+ +FQKP N +PL + L RG+VSYE+E+WAKHR+++NPAF+
Sbjct  120  ITEPELIKEIFGKNYVFQKPNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFH  173



>ref|XP_002265455.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD +E ++M  +A S+P++LSD++  RV P+  H   KYGKNC+ WMGP P+V +
Sbjct  47   YRLLHGDFREMSRMIDEANSRPISLSDDIVQRVLPFHYHSIKKYGKNCFIWMGPKPVVNI  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PELI++VL K + FQKP   PLG+ L  G+++ E EQW K R++INPAF+
Sbjct  107  MEPELIRDVLLKHNAFQKPPVHPLGKLLATGVIALEGEQWTKRRKIINPAFH  158



>gb|EYU31631.1| hypothetical protein MIMGU_mgv1a004628mg [Erythranthe guttata]
Length=380

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD  E   M ++A+SKP+  SD+  PR+ P+       +G+NC+ W+GP P V +
Sbjct  48   YRFLVGDLNEMKNMGNEALSKPIDFSDDFVPRIIPFIHKTVTNHGENCFIWLGPYPAVLI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP++++EVL+K+ +FQKP N PL   L RGL SYE ++WAKHRRLINPAF+
Sbjct  108  FDPDIVREVLSKTYVFQKPYN-PLANVLARGLASYETDKWAKHRRLINPAFH  158



>emb|CBI39916.3| unnamed protein product [Vitis vinifera]
Length=505

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD +E ++M  +A S+P++LSD++  RV P+  H   KYGKNC+ WMGP P+V +
Sbjct  47   YRLLHGDFREMSRMIDEANSRPISLSDDIVQRVLPFHYHSIKKYGKNCFIWMGPKPVVNI  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PELI++VL K + FQKP   PLG+ L  G+++ E EQW K R++INPAF+
Sbjct  107  MEPELIRDVLLKHNAFQKPPVHPLGKLLATGVIALEGEQWTKRRKIINPAFH  158



>emb|CDP15975.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE + +  +A SKP+ LSD++ PR+ P F     KYGK+ Y W+GP PMV++
Sbjct  49   YRLLYGDFKEISTLIREAQSKPINLSDDILPRILPAFPDALKKYGKSTYVWLGPTPMVYI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PELI+EV+ K  LFQKP+ +PL   L+ GLV+Y+ ++WAK R+LINPAF+
Sbjct  109  LEPELIREVMQKIYLFQKPRLNPLSLLLIEGLVNYDGDKWAKQRKLINPAFH  160



>emb|CDP06076.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GDTKE   M   A SKP+ LSD++ PRV P+ +HL   YG+  + W+GP+  V +
Sbjct  49   YRLLYGDTKEIGSMIKAANSKPIKLSDDILPRVLPFQLHLIKTYGEKSFFWVGPVAKVLI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI+E+L ++ +F+KP  +PL + LV GL  YE E+WAKHRR++ PAFY
Sbjct  109  MDPELIREILARNAIFKKPIPNPLAKFLVAGLAGYEDEKWAKHRRIVTPAFY  160



>ref|XP_010465361.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K  + M ++A SKP+ L+D++ PRV P+ +H+   +G+  + W+GPIP V +
Sbjct  49   YTPLVGDVKRNSSMLAEARSKPIQLTDDITPRVVPFHLHMLKTHGRTFFTWLGPIPTVTI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEV N  + FQK  ++PLGR +  GLVSY+ ++WAKHRR+INPAF+
Sbjct  109  MDPELIKEVFNNVNDFQKAHSNPLGRLIATGLVSYDGDKWAKHRRIINPAFH  160



>ref|XP_002263609.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD+KE ++M  +A S+P++LSD++  RV P+  H   KYGKN + W+GP P V +
Sbjct  48   YRLLQGDSKEMSRMMKEAYSRPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PEL+++VL KS++FQK  + PL + LV GLV+ E EQWAK R++INPAF+
Sbjct  108  MEPELMRDVLLKSNIFQKTPSHPLVKLLVSGLVALEGEQWAKRRKIINPAFH  159



>gb|KHN44056.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y +  GD+KEF KM  +A+SKPM LSD++ PRV+ Y  H   K+GKN + W GP+P V +
Sbjct  48   YTLFFGDSKEFLKMRKEAVSKPMTLSDDIVPRVSAYVQHSVNKHGKNSFIWFGPMPRVTI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             DPE IK+V NK+  F KP  +PL + L  GL  YE E+W+KHRR+INPAF
Sbjct  108  LDPEQIKDVFNKNYDFPKPNLNPLVKLLATGLAGYEGEKWSKHRRIINPAF  158



>ref|XP_006598136.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Glycine 
max]
Length=389

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y +  GD+KEF KM  +A+SKPM LSD++ PRV+ Y  H   K+GKN + W+GPIP V +
Sbjct  48   YTLFVGDSKEFLKMRKEALSKPMNLSDDIIPRVSSYEQHSVNKHGKNSFIWLGPIPRVTI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             DPE IK+V NK   F KP  +PL + L  GL  YE E+W+KHRR+INPAF
Sbjct  108  LDPEQIKDVFNKIYDFPKPNMNPLVKLLATGLAGYEGEKWSKHRRIINPAF  158



>ref|XP_006598137.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y +  GD+KEF KM  +A+SKPM LSD++ PRV+ Y  H   K+GKN + W GP+P V +
Sbjct  48   YTLFFGDSKEFLKMRKEAVSKPMTLSDDIVPRVSAYVQHSVNKHGKNSFIWFGPMPRVTI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             DPE IK+V NK+  F KP  +PL + L  GL  YE E+W+KHRR+INPAF
Sbjct  108  LDPEQIKDVFNKNYDFPKPNLNPLVKLLATGLAGYEGEKWSKHRRIINPAF  158



>emb|CBI39886.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD+KE ++M  +A S+P++LSD++  RV P+  H   KYGKN + W+GP P V +
Sbjct  48   YRLLQGDSKEMSRMMKEAYSRPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PEL+++VL KS++FQK  + PL + LV GLV+ E EQWAK R++INPAF+
Sbjct  108  MEPELMRDVLLKSNIFQKTPSHPLVKLLVSGLVALEGEQWAKRRKIINPAFH  159



>gb|KGN55013.1| hypothetical protein Csa_4G622230 [Cucumis sativus]
Length=190

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE A M  +A+SKPM  S+++APRV P   H   +YGKN + W+GPIP V +
Sbjct  48   YRILHGDLKERAAMREEAMSKPMNFSNHIAPRVIPSIYHTIQRYGKNSFMWLGPIPRVHI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K V +  + FQKP  +P  + LV+G+V+ + E+W KHR++INPAF+
Sbjct  108  MDPEQLKTVFSFYNDFQKPTMNPFTKLLVQGIVNLDGEKWVKHRKIINPAFH  159



>ref|XP_009796418.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KE   M  +A +KPM  +++   RV P+F  L  +YGKN + W+GP P +F+
Sbjct  51   YKLLFGDMKEINTMVEEAKTKPMNFTNDYVARVLPHFTKLMLQYGKNSFMWLGPKPTMFI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI+E+L+KS ++QK + +P+ + L +GLVSYE E+WAKHR++INPAF+
Sbjct  111  TDPELIREILSKSYIYQKIQGNPITKLLAQGLVSYEAEKWAKHRKIINPAFH  162



>gb|EYU31630.1| hypothetical protein MIMGU_mgv1a004628mg [Erythranthe guttata]
Length=517

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD  E   M ++A+SKP+  SD+  PR+ P+       +G+NC+ W+GP P V +
Sbjct  48   YRFLVGDLNEMKNMGNEALSKPIDFSDDFVPRIIPFIHKTVTNHGENCFIWLGPYPAVLI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP++++EVL+K+ +FQKP N PL   L RGL SYE ++WAKHRRLINPAF+
Sbjct  108  FDPDIVREVLSKTYVFQKPYN-PLANVLARGLASYETDKWAKHRRLINPAFH  158



>ref|XP_003546751.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y +  GD+KEF KM  +A+SKPM LSD++ PRV+ Y  H   K+GKN + W+GPIP V +
Sbjct  48   YTLFVGDSKEFLKMRKEALSKPMNLSDDIIPRVSSYEQHSVNKHGKNSFIWLGPIPRVTI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             DPE IK+V NK   F KP  +PL + L  GL  YE E+W+KHRR+INPAF
Sbjct  108  LDPEQIKDVFNKIYDFPKPNMNPLVKLLATGLAGYEGEKWSKHRRIINPAF  158



>ref|XP_010676733.1| PREDICTED: cytochrome P450 CYP72A219-like [Beta vulgaris subsp. 
vulgaris]
Length=521

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE +++ S+A+ KP++ +++   R+ P+   L  K G NC+ WMGP+P + +
Sbjct  48   YRLLIGDMKENSRLRSEAMQKPISFTNDYYHRIQPFLHQLVSKSGSNCFTWMGPVPTILI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
              PELI+EV N+ + F+KPK +PL   L  GLVSYE E+WA H+RL+NPAF+
Sbjct  108  TQPELIREVFNRINEFRKPKMNPLTELLAPGLVSYEGEKWANHKRLVNPAFH  159



>gb|KHN44057.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y +  GD+KEF KM  +A+SKPM LSD++ PRV+ Y  H   K+GKN + W+GPIP V +
Sbjct  48   YTLFVGDSKEFLKMRKEALSKPMNLSDDIIPRVSSYEQHSVNKHGKNSFIWLGPIPRVTI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             DPE IK+V NK   F KP  +PL + L  GL  YE E+W+KHRR+INPAF
Sbjct  108  LDPEQIKDVFNKIYDFPKPNMNPLVKLLATGLAGYEGEKWSKHRRIINPAF  158



>ref|XP_010683653.1| PREDICTED: cytochrome P450 CYP72A219-like [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE +KM  +AIS P+ +SD++ PRV P+   +   +GKN + W GP+P V +
Sbjct  13   YRLLYGDMKESSKMAKEAISSPIEISDDIVPRVQPFTHQIVKNFGKNSFVWFGPVPCVNI  72

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +P++IKEVL + + FQKP  +P+ +  V+GLV YE ++WAKHR+++NPAF+
Sbjct  73   MEPQMIKEVLMRYEEFQKPNINPILKMFVKGLVVYEGQKWAKHRKILNPAFH  124



>ref|XP_010683652.1| PREDICTED: cytochrome P450 CYP72A219-like [Beta vulgaris subsp. 
vulgaris]
Length=481

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE +KM  +AIS P+ +SD++ PRV P+   +   +GKN + W GP+P V +
Sbjct  13   YRLLYGDMKESSKMAKEAISSPIEISDDIVPRVQPFTHQIVKNFGKNSFVWFGPVPCVNI  72

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +P++IKEVL + + FQKP  +P+ +  V+GLV YE ++WAKHR+++NPAF+
Sbjct  73   MEPQMIKEVLMRYEEFQKPNINPILKMFVKGLVVYEGQKWAKHRKILNPAFH  124



>emb|CBI22134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD +E  +M S+A S+P++LSD +  RV P+  H   KYGKN + WMGP P+V +
Sbjct  60   YRLLHGDVREMLRMISEANSRPISLSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNI  119

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI++V  + + F KP   PLG+ L  GLV+ E EQW KHR++INPAF+
Sbjct  120  MDPELIRDVFLRYNAFHKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFH  171



>ref|XP_002270326.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=516

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD +E  +M S+A S+P++LSD +  RV P+  H   KYGKN + WMGP P+V +
Sbjct  47   YRLLHGDVREMLRMISEANSRPISLSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNI  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI++V  + + F KP   PLG+ L  GLV+ E EQW KHR++INPAF+
Sbjct  107  MDPELIRDVFLRYNAFHKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFH  158



>ref|XP_007149353.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
 gb|ESW21347.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
Length=520

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD+KEF KM  +A+SKPM LSD++ PRV+ Y  H    +GKN + W+GP P V +
Sbjct  48   YKLLVGDSKEFLKMRKEALSKPMDLSDDIVPRVSSYINHSVKSHGKNSFIWLGPTPRVTI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             DPE IK++ NK   F KP  +PL + L  GL  YE E+W+KHRRLINPAF
Sbjct  108  LDPEQIKDIFNKIYDFPKPDINPLFKLLATGLAGYEGEKWSKHRRLINPAF  158



>ref|XP_007149352.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
 gb|ESW21346.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
Length=520

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD+KEF KM  +A+SKPM LSD++ PRV+ Y  H    +GKN + W+GP P V +
Sbjct  48   YKLLVGDSKEFLKMRKEALSKPMDLSDDIVPRVSSYINHSVKSHGKNSFIWLGPTPRVTI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             DPE IK++ NK   F KP  +PL + L  GL  YE E+W+KHRRLINPAF
Sbjct  108  LDPEQIKDIFNKIYDFPKPDINPLLKLLATGLADYEGEKWSKHRRLINPAF  158



>gb|KFK38823.1| hypothetical protein AALP_AA3G165300 [Arabis alpina]
Length=512

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y +L GD K  + M  +A SKP+ L+D++A RV PY + +A  +G+N + W+GPIP + L
Sbjct  49   YTLLVGDVKRNSNMLLEARSKPIKLTDDIASRVVPYPLQMAKTHGRNFFTWLGPIPSITL  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEV NK   FQKP   PLGR +  GL SY+ ++WAKHRR+INPAF+
Sbjct  109  MDPELIKEVFNKIYNFQKPNVFPLGRLVATGLFSYDDDKWAKHRRIINPAFH  160



>ref|XP_006364092.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=521

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+ L GD KE  KM  +A+SKP+  S D + PRV P+F      YGKNC+AW GP P V 
Sbjct  54   YKFLFGDVKEMMKMGKEALSKPIDFSHDMIWPRVMPFFHKTINNYGKNCFAWYGPRPAVV  113

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPELI+EVL K+ ++QKP  +PL R    GL  YE ++WAKHRR++NPAF+
Sbjct  114  IVDPELIREVLTKNYIYQKPPGNPLTRLAANGLAGYEADKWAKHRRIVNPAFH  166



>gb|KEH38473.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=416

 Score =   125 bits (315),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD  +  KM  +A SKPM LSD++ PRV  +      K+GKN + W GP P V +
Sbjct  48   YRLLVGDMNDLLKMRKEATSKPMNLSDDIVPRVFSFVQQSVAKHGKNSFIWFGPTPRVNI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP++I++V NK   FQKP  +PLG+ L  GL S+E EQW+KHR++INPAF+
Sbjct  108  TDPDMIRDVFNKMYDFQKPNANPLGKLLANGLASHEGEQWSKHRKIINPAFH  159



>ref|XP_011082968.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR++ GD KE  KM  D  SKP+ L D++ PRV  +      KYG   + W+GP P V +
Sbjct  48   YRLVYGDLKEMLKMMEDGRSKPINLDDDIKPRVLHFVFKTVQKYGTESFLWLGPRPTVTI  107

Query  160  RDPELIKEVLNKSDLFQKPKN-SPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPEL+KEV+NK D++QKP N +PL + L +G+VSYE ++WAKHR+LINPAF+
Sbjct  108  SDPELVKEVMNKYDIYQKPNNPNPLTKLLAQGVVSYEMDKWAKHRKLINPAFH  160



>gb|ABC69417.1| CYP72A54 [Nicotiana tabacum]
Length=517

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KE   M  +A +KPM  +++   RV P+F  L  +YGKN + W+GP P +F+
Sbjct  51   YKLLFGDMKEINTMVEEAKTKPMNFTNDYVARVLPHFTKLMLQYGKNSFMWLGPKPTMFI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI+E+L+KS ++Q+ + +P+ + L +GLVSYE E+WAKHR++INPAF+
Sbjct  111  TDPELIREILSKSYIYQEIQGNPITKLLAQGLVSYEAEKWAKHRKIINPAFH  162



>gb|ABC69392.1| CYP72A55v1 [Nicotiana tabacum]
Length=521

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 82/114 (72%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMA-LSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y +  GD KE +K   +  SKP+  LS+ VAPR+ PY++ +  KYGK C+ W GP P + 
Sbjct  50   YGLFYGDMKELSKSLKEINSKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAIL  109

Query  163  LRDPELIKEVLNKSDLFQKPKN-SPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + +PELIKE+  K+ +FQKP N +PL + L RG+VSYE+E+WAKHR+++NPAF+
Sbjct  110  ITEPELIKEIFGKNYVFQKPNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFH  163



>ref|XP_004166890.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=524

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE A M  +A+SKPM  S+++APRV P   H    YGKN + W+GP+P V +
Sbjct  56   YRILHGDLKESAAMRKEAMSKPMNFSNHIAPRVIPSVYHTIQIYGKNSFMWLGPMPRVHI  115

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IK V +  + FQKP  +PL R LV+G+ + E E+WAKHR++INPAF+
Sbjct  116  MDPEQIKTVFSFINDFQKPTMNPLTRLLVQGIANLEGEKWAKHRKIINPAFH  167



>ref|XP_009411224.1| PREDICTED: cytochrome P450 72A15-like [Musa acuminata subsp. 
malaccensis]
Length=378

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR   GD KE  ++  +A+S PM L+ N+ PRV P+      +YGK C+ W GP+P V +
Sbjct  56   YRFPKGDLKENVRLDKEALSTPMPLTHNIVPRVLPFLRRAIDEYGKICFTWFGPVPRVTI  115

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPEL++EVL NK   F KPK   LGR L RGLVSYE E+W KHRR++NPAF+
Sbjct  116  MDPELVREVLSNKFGHFGKPKGILLGRFLFRGLVSYEGEKWVKHRRIMNPAFH  168



>ref|XP_010327256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=399

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y++L GD KE  KM  +A SKP+ LS D + PR+NP+       YGKNC+ W+GP P V 
Sbjct  71   YKLLYGDMKEMKKMIEEATSKPINLSHDLIWPRINPFIHKTITNYGKNCFVWIGPKPAVL  130

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + +P+LI+EVL K+ ++QK + SPL + ++ GL ++EK++WA HRR++NPAF+
Sbjct  131  ITEPKLIREVLTKNYVYQKARGSPLSKLVISGLAAHEKDKWATHRRILNPAFH  183



>ref|XP_006495014.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=518

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD KE   ++  A SKP++L D++APRV P +      YGKN Y W+GPIPM+ +
Sbjct  49   YRFLFGDVKEHGILSRQAKSKPISLDDDIAPRVVPLYDQREKLYGKNTYWWIGPIPMINI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             DP+ IKEV    + FQKPK +PLG+ L  GL   E E+WAKHR++INPAF+ 
Sbjct  109  MDPDQIKEVFTNINDFQKPKTNPLGKILTTGLAIREGEKWAKHRKIINPAFHQ  161



>ref|XP_010644729.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=514

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD +E ++M ++A S P++ SD++  RV P+F H   KYGKN + W+GP P+V +
Sbjct  47   YRLLHGDFREMSRMNNEANSGPISFSDDIVKRVLPFFNHSIQKYGKNSFTWLGPKPVVNI  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PELI++VL K ++FQKP   PLG+ L  G+V+ E EQW K R++INPAF+
Sbjct  107  MEPELIRDVLLKHNVFQKPPPHPLGKLLATGVVALEGEQWTKRRKIINPAFH  158



>ref|XP_004488669.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=518

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KEF K    A SKPM LSD++  RV PY      K+GKN + W GP P V L
Sbjct  48   YRLLVGDMKEFFKSEMKARSKPMNLSDDIVSRVFPYGQQTVTKHGKNSFIWFGPTPRVIL  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPEL+K+V NK   FQKP ++PL R L  GL+++E+E+W  HR++INPAF+
Sbjct  108  TDPELVKDVFNKMYDFQKPNSNPLIRLLATGLITHEEEKWRMHRKIINPAFH  159



>ref|XP_004243254.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMA-LSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR+L GD KEF+K   +A SKP+  LS+++APR+ PYF+    KYGKNC+ W GP PM+ 
Sbjct  49   YRLLHGDLKEFSKSIKEAQSKPINNLSNDIAPRIIPYFIQTISKYGKNCFVWFGPKPMIL  108

Query  163  LRDPELIKEVLNKSDLFQKPKNS-PLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + + E I+E+  K+ ++QKP +S P+   L RG+ +YE+++WAKHR+++ PAF+
Sbjct  109  IMESEQIREIFAKNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFH  162



>ref|XP_004248734.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=516

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+ L GD KE +KM  +A SKP+  S D + PRVNP+   +   YGKNC+ W GP P V 
Sbjct  51   YKFLFGDMKEMSKMGEEAWSKPVNFSHDTIWPRVNPFIHKIITNYGKNCFVWFGPRPAVV  110

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPE+IKEV+ K+ +FQKP  +PL + L  G+  YE ++WA HRRL+NPAF+
Sbjct  111  IMDPEVIKEVMMKNYVFQKPGGNPLTKLLATGIADYEADKWAVHRRLLNPAFH  163



>ref|XP_011082965.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=514

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++  GD  E   MT +A SKPM+ S  + PRV P  +     YG+  + W GP P V +
Sbjct  48   YKLFFGDFNEMKAMTKEAKSKPMSFSHEIVPRVAPSIIKTVKNYGEQSFLWFGPRPAVIV  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE+++E+L+KS +FQKP  +P  R L RG+ SYE ++WAKHRRLINPAF+
Sbjct  108  LDPEMVREILSKSYVFQKPGGNPTSRMLARGIASYETDKWAKHRRLINPAFH  159



>gb|KHN36820.1| Secologanin synthase [Glycine soja]
Length=496

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE  K+  +A SKPM LS ++ PRV  +      K+GKN + W GP P V L
Sbjct  26   YRILVGDLKEIVKLQMEARSKPMNLSHDIVPRVFAHLHQSVLKHGKNSFIWFGPKPRVTL  85

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             DPELIK+VLNK   F+KP+ +PL + L  GLV+Y+ E+W KHRRLINPAF
Sbjct  86   TDPELIKDVLNKISDFRKPEANPLAKLLATGLVNYDGEKWNKHRRLINPAF  136



>emb|CAN71976.1| hypothetical protein VITISV_042685 [Vitis vinifera]
Length=228

 Score =   120 bits (302),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -3

Query  325  GDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFLRDPEL  146
            GD+KE ++M  +A S+P++LSD++  RV P+  H   KYGKN + W+GP P V + +PEL
Sbjct  34   GDSKEMSRMMKEAYSRPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPEL  93

Query  145  IKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            +++VL KS++FQK  + PL + LV GLV+ E EQWAK R++INPAF+
Sbjct  94   MRDVLLKSNIFQKTPSHPLVKLLVSGLVALEGEQWAKRRKIINPAFH  140



>ref|XP_006594768.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE  K+  +A SKPM LS ++ PRV  +      K+GKN + W GP P V L
Sbjct  53   YRILVGDLKEIVKLQMEARSKPMNLSHDIVPRVFAHLHQSVLKHGKNSFIWFGPKPRVTL  112

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             DPELIK+VLNK   F+KP+ +PL + L  GLV+Y+ E+W KHRRLINPAF
Sbjct  113  TDPELIKDVLNKISDFRKPEANPLAKLLATGLVNYDGEKWNKHRRLINPAF  163



>gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
Length=518

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD  +  KM  +A SKPM LSD++ PRV  +      K+GKN + W GP P V +
Sbjct  48   YRLLVGDMNDLLKMRKEATSKPMNLSDDIVPRVYSFVHQSVTKHGKNSFIWFGPTPRVNI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP+ IK+VLNK   FQKP  +PL R L  GLVS E EQW+KHR++INPAF+
Sbjct  108  TDPDQIKDVLNKIYDFQKPNANPLVRLLANGLVSLEGEQWSKHRKIINPAFH  159



>ref|XP_004151605.1| PREDICTED: secologanin synthase-like, partial [Cucumis sativus]
Length=336

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE A M  +A+SKPM  S+++APRV P   H   +YGKN + W+GP+P V +
Sbjct  48   YRILHGDLKERAAMREEAMSKPMNFSNHIAPRVIPSIYHTIQRYGKNSFMWLGPLPRVHI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K V +  + FQKP  +P  + LV+G+V+ + E+W KHR++INPAF+
Sbjct  108  MDPEQLKTVFSFYNDFQKPTMNPFTKLLVQGIVNLDGEKWVKHRKIINPAFH  159



>ref|XP_010487266.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K  + M ++A SKP+ L+D + PRV P+ +H+   +G+  + W+GP+P+V +
Sbjct  49   YTPLVGDLKRNSSMLAEARSKPINLTDEITPRVVPFPLHMLKTHGRTFFTWLGPVPVVTI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEV NK   FQKP   PLGR +  GLVSY+ ++WAK+RR+INPAF+
Sbjct  109  MDPELIKEVFNKVYDFQKPHTFPLGRIIAAGLVSYDGDKWAKYRRIINPAFH  160



>gb|KGN55015.1| hypothetical protein Csa_4G622740 [Cucumis sativus]
Length=364

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+IL GD KE A M  +A+SKPM  S+++APRV P   H   +YGKN   W+GP+P V +
Sbjct  55   YKILHGDMKESAAMRKEALSKPMKFSNHIAPRVIPSVYHTIQRYGKNSMMWLGPLPRVHI  114

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K V +  + FQ+P   P  R L+ GLVS E E+W KHR++INPAF+
Sbjct  115  MDPEQLKTVFSFFNDFQRPTTDPFIRLLIHGLVSLEGEKWVKHRKIINPAFH  166



>gb|ADO16184.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=516

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+ ++GD  E AKMT +A SKPM++S ++   V PY  H+  KYGK  Y W GP P V +
Sbjct  49   YKPITGDIMELAKMTKEARSKPMSISHDITQHVLPYEHHILNKYGKKVYMWFGPKPRVLI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            RDP+LIK++L++ + FQ+P++ PL   +V GLV  E E+W KHR +INPAF+
Sbjct  109  RDPQLIKDILSRPNEFQRPQHEPLRDSIVGGLVVSEGEKWTKHRHIINPAFH  160



>gb|EYU30744.1| hypothetical protein MIMGU_mgv1a004594mg [Erythranthe guttata]
Length=519

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPM-ALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR+L GD+KE + M  +A SKP+ A S+++  RV P   H    YG+ C  W GP P V 
Sbjct  48   YRVLFGDSKEMSNMIKEAKSKPISAFSNDIVARVIPAIHHAVSMYGEKCILWFGPKPAVL  107

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
            + D ELI+E+L+KS +FQK  N PLGR+L RG+ +YE ++WAKHRRLINPAF
Sbjct  108  VTDTELIREILSKSYVFQKNSN-PLGRQLARGVATYETDKWAKHRRLINPAF  158



>ref|XP_004166892.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=516

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE A M  +A+SKPM  S+++APRV P   H   +YGKN + W+GPIP V +
Sbjct  48   YRILHGDLKERAAMREEAMSKPMNFSNHIAPRVIPSIYHTIQRYGKNSFMWLGPIPRVHI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K V +  + FQKP  +P  + LV+G+V+ + E+W KHR++INPAF+
Sbjct  108  MDPEQLKTVFSFYNDFQKPTMNPFTKLLVQGIVNLDGEKWVKHRKIINPAFH  159



>ref|XP_009394606.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=188

 Score =   119 bits (297),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR   GD KE A+ + +A +KPM L+ N+ PR+ P+      +YGK  + W GP+P V +
Sbjct  40   YRFPYGDLKENARFSKEARAKPMPLAHNIIPRLLPFLNRAMDEYGKISFTWFGPVPQVTI  99

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             DPEL++EVL NK   F KPK  PLGR   RGL  YE E+W KHRR++NPAF++
Sbjct  100  TDPELVREVLSNKFGHFGKPKQHPLGRFFARGLAVYEGEKWVKHRRILNPAFHA  153



>dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=518

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD K+  K+  +A +KPM LSD++ PRV  +      K+GKN + W GP P V +
Sbjct  48   YRLLVGDIKDLLKIRKEATTKPMNLSDDIVPRVYSFVHQSVTKHGKNSFIWFGPTPRVNI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP+ IK+VLNK   FQKP  +PL R L  GLVS E EQW+KHR++INPAF+
Sbjct  108  TDPDQIKDVLNKIYDFQKPNANPLVRLLANGLVSLEGEQWSKHRKIINPAFH  159



>emb|CDP15982.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+++ GD K+ + +  +A SKP++LSD++ PR+ P+F+    KYGKN Y W GP PM+ +
Sbjct  51   YKLIYGDFKQISSLFQEANSKPISLSDDIVPRIVPHFLEAVNKYGKNTYLWFGPRPMMLI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             DPELI++V +K D+FQK +  P  R L+ G++ YE E+WAK R+L+N AF++
Sbjct  111  MDPELIRKVTHKMDIFQKVRFRPQARLLIGGILVYEGEKWAKQRKLLNQAFHT  163



>gb|KGN66156.1| hypothetical protein Csa_1G574240 [Cucumis sativus]
Length=172

 Score =   118 bits (296),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+ SGD K+   M+ +A SKPM  S ++APRV P   H   KYGKN + W+GPIP VF+
Sbjct  48   YRLYSGDLKDLVAMSEEAKSKPMNFSHDIAPRVIPSIHHTIEKYGKNSFVWLGPIPRVFI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K  L+  + FQKP  +PL + L  GL+++E E+W KHR+++N AF+
Sbjct  108  MDPEQLKAALSLYNDFQKPTINPLVKLLFDGLINHEGEKWVKHRKIVNHAFH  159



>ref|XP_004248200.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+ L GD KE  KM  +A+SKP+  S D   PRV P+F      YGKNC+ W GP P V 
Sbjct  56   YKFLFGDVKEMMKMGKEALSKPIDFSHDMTWPRVMPFFHKTINNYGKNCFGWYGPRPAVV  115

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPELI+EVL+K+ ++QKP  +PL R    GL  YE ++WAKHRR+INP F+
Sbjct  116  IVDPELIREVLSKNYIYQKPPGNPLTRLAANGLAGYEADKWAKHRRIINPGFH  168



>ref|XP_004168302.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=523

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+IL GD KE A M  +A+SKPM  S+++APRV P   H   +YGKN   W+GP+P V +
Sbjct  55   YKILHGDMKESAAMRKEALSKPMKFSNHIAPRVIPSVYHTIQRYGKNSMMWLGPLPRVHI  114

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K V +  + FQ+P   P  R L+ GLVS E E+W KHR++INPAF+
Sbjct  115  MDPEQLKTVFSFFNDFQRPTTDPFIRLLIHGLVSLEGEKWVKHRKIINPAFH  166



>ref|XP_004242635.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+ L GD KE   M  +A SKP+  +++   RV P+F  L  +YGKNCY W+GP P + +
Sbjct  50   YKFLLGDMKEINSMVEEAKSKPINFTNDYISRVFPHFNKLMMQYGKNCYTWLGPKPTMLI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE ++E+L+KS ++QK + +P+ + L +GL SYE ++WAKHRR+INPAF+
Sbjct  110  SEPEFVREILSKSYIYQKIQGNPITKLLAQGLASYETDKWAKHRRIINPAFH  161



>ref|XP_006442316.1| hypothetical protein CICLE_v10024206mg [Citrus clementina]
 gb|ESR55556.1| hypothetical protein CICLE_v10024206mg [Citrus clementina]
Length=512

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+I  GD K+ + M  +  ++P++LSD++ PR+ PY  H+  KYGK  + WMGP P + +
Sbjct  46   YKIFHGDMKDMSLMLKETKARPISLSDDIVPRILPYHHHIISKYGKKSFKWMGPRPSINV  105

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
            +DP+LI+E+L K D+FQKPK + L + +V G+V YE EQW+K R++ NPAF+ 
Sbjct  106  QDPKLIREILLKHDIFQKPKGNSLSKLVVNGMVMYEGEQWSKVRKIANPAFHQ  158



>ref|XP_006343585.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+ L GD KE   M  +A SKP+  +++   RV P+F     +YGKNCY W+GP P + +
Sbjct  50   YKFLLGDMKEMNSMVEEAKSKPINFTNDYISRVFPHFNKFMMQYGKNCYIWLGPKPTMLI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE I+E+L+KS ++QK + +P+ + L +GL SYE E+WAKHRR+INPAF+
Sbjct  110  SEPEFIREILSKSYIYQKIQGNPITKLLAQGLASYETEKWAKHRRIINPAFH  161



>ref|XP_004146006.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=510

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+IL GD KE A M  +A+SKPM  S+++APRV P   H   +YGKN   W+GP+P V +
Sbjct  55   YKILHGDMKESAAMRKEALSKPMKFSNHIAPRVIPSVYHTIQRYGKNSMMWLGPLPRVHI  114

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K V +  + FQ+P   P  R L+ GLVS E E+W KHR++INPAF+
Sbjct  115  MDPEQLKTVFSFFNDFQRPTTDPFIRLLIHGLVSLEGEKWVKHRKIINPAFH  166



>ref|XP_010644766.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=460

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -3

Query  301  MTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFLRDPELIKEVLNKS  122
            M  +A S+P++LSD +APRV P+  H   KYGKN +AW GP PMV + +PELI++VL KS
Sbjct  4    MLKEAYSRPISLSDEIAPRVLPFHCHFIKKYGKNFFAWFGPNPMVNIMEPELIRDVLLKS  63

Query  121  DLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            ++FQKP   PLG+ LV GLV+ E E+WAK R++INPAF+
Sbjct  64   NVFQKPPPHPLGKLLVSGLVTLEGERWAKRRKIINPAFH  102



>dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis]
Length=522

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR++ GD K+  KM  +A SKPM LSD++ PRV PY      K+GKN + W GPIP V L
Sbjct  52   YRLIVGDLKDLMKMRKEAKSKPMNLSDDILPRVFPYVQQSVTKHGKNSFIWFGPIPRVTL  111

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             DPE IK+VLNK   F K     L + L  GLVSYE E+W+KHRR+INPAF
Sbjct  112  TDPEQIKDVLNKIYDFPKSDGDRLVKLLATGLVSYEGEKWSKHRRIINPAF  162



>ref|XP_010465357.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K  A M ++A SKP+ L+D+  PR+ P+ +H+   +G+  + W+GPIP + +
Sbjct  49   YTPLVGDLKRNANMLAEARSKPIKLTDDTRPRIVPFPLHMLKTHGRTFFTWLGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEV NK   FQK    PLGR +V GLVSY+ ++W KHRR+INPAF+
Sbjct  109  MDPELIKEVFNKVYDFQKAHTFPLGRLIVPGLVSYDGDKWTKHRRIINPAFH  160



>gb|KEH38475.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD K+  K+  +A SKPM LSD++ PRV  +      K+GKN + W GP P V +
Sbjct  48   YRLLVGDIKDLLKIRKEATSKPMNLSDDIVPRVYSFVQQTVAKHGKNSFIWFGPTPRVNI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IK+V+NK   FQKP  +PL R L  GLV  E EQW+KHR++INPAF+
Sbjct  108  TDPEQIKDVINKIYDFQKPNVNPLVRLLGCGLVCLEGEQWSKHRKIINPAFH  159



>emb|CDY32348.1| BnaC01g36670D [Brassica napus]
Length=512

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y +L GD K    MT++A SKP+ L+D++ PRV P+  H+   YG+  + W GPIP + +
Sbjct  49   YTLLVGDVKREYSMTTEARSKPIKLTDDIVPRVLPFPSHMLKTYGRTFFTWRGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE IKEVLNK   FQKP   PL R +  GL SY+ ++WAKHRR+INPAF+
Sbjct  109  TNPEQIKEVLNKIYDFQKPNTFPLSRLVASGLFSYDGDKWAKHRRIINPAFH  160



>emb|CDP15981.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++  GD KE   +  +A SKP++LSD++ PRV P+F+    KYGKN Y W GP P + +
Sbjct  50   YKLFYGDFKEIGTLFQEAYSKPISLSDDIVPRVIPHFLGTVNKYGKNAYLWFGPKPTMLI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPEL ++V  K ++FQKP+  PL + L +G + YE ++WAKHR+L+N AF+
Sbjct  110  MDPELTRKVTQKMEIFQKPQFHPLSKLLAQGTLVYEGDKWAKHRKLLNQAFH  161



>ref|XP_006477887.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=512

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+I  GD K+ + M  +A ++P+++SD++ PR+ PY  H+  KYGK  + WMGP P + +
Sbjct  46   YKIFHGDMKDMSLMLKEAKARPISVSDDIVPRILPYHHHIISKYGKKSFKWMGPRPSINV  105

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
            +DP+LI+E+L K D+FQKP+ + L + +V G+V YE EQW+K R++ NPAF+ 
Sbjct  106  QDPKLIREILLKHDIFQKPRGNSLSKLVVNGMVMYEGEQWSKVRKIANPAFHQ  158



>gb|AAZ07706.1| cytochrome P450 monooxygenase [Sesamum indicum]
Length=514

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++  GD  E   MT +A SKPM+ S  + PRV P  +     YG+  + W GP P V +
Sbjct  48   YKLFFGDFNELKAMTKEAKSKPMSFSHEIVPRVAPSIIKTVKNYGEQSFLWFGPRPAVIV  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE+++E+L+KS +FQ P  +P  R L RG+ SYE ++WAKHRRLINPAF+
Sbjct  108  LDPEMVREILSKSYVFQMPGGNPTSRMLARGIASYETDKWAKHRRLINPAFH  159



>ref|XP_010927467.1| PREDICTED: cytochrome P450 72A15-like [Elaeis guineensis]
Length=522

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD KE+ ++  +A+SKPMA S  + PR+ P+      K GK  + W GP P V +
Sbjct  53   YRFLHGDQKEYHRLHKEALSKPMAFSHQIIPRILPHLHQAIKKNGKISFTWFGPKPRVII  112

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP L +E+L NK   F+KP ++PLGR LV GLV YE E+WAKHRR+INPAF+
Sbjct  113  MDPGLTREILSNKFGHFEKPHSNPLGRLLVAGLVRYEGEKWAKHRRIINPAFH  165



>ref|XP_009343587.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR +SGD KE +  T  A SKPM+LS ++APRV P+   L   YGKN + WMG IP V +
Sbjct  48   YRFMSGDMKEISMTTEQAYSKPMSLSHDIAPRVIPFHHRLVNTYGKNSFVWMGSIPRVII  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE +K +L K ++F +P+ +PL + L  G+  YE E+WAKHRR+INP F+
Sbjct  108  TNPEDLKYILTKMEVFPQPEPNPLVKLLATGIAFYEGEKWAKHRRIINPVFH  159



>ref|XP_009356840.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR +SGD KE +  T  A SKPM+LS ++APRV P+   L   YGKN + WMG IP V +
Sbjct  48   YRFMSGDMKEISMTTEQAYSKPMSLSHDIAPRVIPFHHRLVNTYGKNSFVWMGSIPRVII  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE +K +L K ++F +P+ +PL + L  G+  YE E+WAKHRR+INP F+
Sbjct  108  TNPEDLKYILTKMEVFPQPEPNPLVKLLATGIAFYEGEKWAKHRRIINPVFH  159



>ref|XP_006348906.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 82/114 (72%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMA-LSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR+L GD KEF+K   +A SKP+  LS+++APR+ PYF+    KYGK C+ W GP PM+ 
Sbjct  49   YRLLHGDLKEFSKSIKEAQSKPIDNLSNDIAPRIIPYFIQTISKYGKKCFVWFGPKPMIL  108

Query  163  LRDPELIKEVLNKSDLFQKPKNS-PLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + + E I+E+  K+ ++QKP +S P+   L RG+ +YE+++WAKHR+++ PAF+
Sbjct  109  IMESEQIREIFAKNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFH  162



>emb|CDP19599.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y ++ GD KE  +MT +A SKP+  ++++  RV P+       YG+N YAW GP+P V L
Sbjct  48   YNLVLGDMKETVRMTQEAKSKPINFTNDIVSRVMPFIDKTIKTYGENSYAWAGPMPAVLL  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV+NKS  + KP  +PL + L  GLVSYE ++W+KHR+LINPAF+
Sbjct  108  MDPEHIKEVMNKSFNYLKPPGNPLSKLLATGLVSYETDKWSKHRKLINPAFH  159



>ref|XP_011082966.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=515

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD+KE + M  +A SKP+  S+++  RV P+  H   KYG+NC+ W GP P   +
Sbjct  48   YRFLVGDSKEMSSMGEEAQSKPINFSNDIVHRVMPFIHHSLHKYGENCFIWFGPKPAALI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE+IKE+++K+ +FQK  N PL + L +G+ +YE ++W KHRRLINPAF+
Sbjct  108  SDPEMIKEIMSKNYVFQKISN-PLDQLLAKGVAAYEADKWDKHRRLINPAFH  158



>gb|KHN47456.1| Secologanin synthase [Glycine soja]
Length=537

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMAL-SDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y +  GD KEF KM ++A+SKPM L S ++APRV  +  H   K+GKN + W GPIP V 
Sbjct  67   YTLFVGDLKEFGKMRNEALSKPMNLFSHDIAPRVLSFIQHTVNKHGKNSFIWFGPIPRVT  126

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
            L DPE IK+VLNK   F KP  +P  R L  GLVS+E E+W+KHR++INPAF
Sbjct  127  LTDPEQIKDVLNKIYDFGKPDMNPHVRLLAPGLVSHEGEKWSKHRKIINPAF  178



>ref|XP_003543171.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=537

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMAL-SDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y +  GD KEF KM ++A+SKPM L S ++APRV  +  H   K+GKN + W GPIP V 
Sbjct  67   YTLFVGDLKEFGKMRNEALSKPMNLFSHDIAPRVLSFIQHTVNKHGKNSFIWFGPIPRVT  126

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
            L DPE IK+VLNK   F KP  +P  R L  GLVS+E E+W+KHR++INPAF
Sbjct  127  LTDPEQIKDVLNKIYDFGKPDMNPHVRLLAPGLVSHEGEKWSKHRKIINPAF  178



>ref|XP_010502032.1| PREDICTED: cytochrome P450 72A13-like isoform X2 [Camelina sativa]
Length=512

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y +L GD K    M ++A SKP+ L+D++ PR+ PY + +   +G+  + W+GPIP + +
Sbjct  49   YTLLVGDLKRHFSMLTEAKSKPIKLTDDITPRIVPYPLQMLKTHGRTFFTWLGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV NK   FQK    PLGR +  GLVSY+ ++WAKHRR+INPAF+
Sbjct  109  MDPEQIKEVFNKVYDFQKAHTFPLGRLIAAGLVSYDGDKWAKHRRIINPAFH  160



>ref|XP_002268319.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD +E ++M ++A S+P++ SD++  RV P+  H   KYGKN + W GP P+V++
Sbjct  47   YRLLHGDFREMSEMINEANSRPISFSDDIVQRVLPFHDHSIQKYGKNSFTWFGPKPVVYI  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PELI++VL K ++FQKP   PL + L  G+V+ E EQW K R++INPAF+
Sbjct  107  MEPELIRDVLLKHNVFQKPPPHPLSKLLATGVVALEGEQWTKRRKIINPAFH  158



>ref|XP_006349622.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=516

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+ L GD KE +KM  +A+SKP+  S D + PRVNP+   +   YGKN + W GP P V 
Sbjct  51   YKFLFGDMKEMSKMGEEALSKPVNFSHDMIWPRVNPFIHKIITNYGKNSFVWFGPKPAVV  110

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPE+IKEV+ K+ +FQKP  +PL + L  G+  YE ++WA HRRL+NPAF+
Sbjct  111  IMDPEVIKEVMMKNYVFQKPGGNPLTKLLATGIADYEADKWAVHRRLLNPAFH  163



>ref|XP_010465366.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K    M ++A SKP+ L+D++ PRV PY +H+   +G+  + W GP+P+V +
Sbjct  49   YTPLVGDLKRNFSMLAEARSKPIKLTDDITPRVVPYPLHILRTHGRTFFTWFGPVPVVTI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEV NK + F K    PLGR +  GLVSY+ ++WAKHRR+INPAF+
Sbjct  109  MDPELIKEVFNKVNDFPKAHAFPLGRIIAAGLVSYDGDKWAKHRRIINPAFH  160



>ref|XP_008798317.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP72A219-like 
[Phoenix dactylifera]
Length=527

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD KE A++  +A SKPM  S ++ PRV+P F     + GK    W+GP+P V +
Sbjct  58   YRFLHGDLKETARLNKEARSKPMPFSHDIIPRVSPIFHRAIKENGKISITWLGPVPRVTI  117

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PEL++EVL NK   F KPK +PLG+ L RGL  YE EQWAKHRR++NPAF+
Sbjct  118  MNPELVREVLSNKFGHFTKPKLNPLGQLLARGLADYEGEQWAKHRRILNPAFH  170



>gb|AJD25171.1| cytochrome P450 CYP72A330 [Salvia miltiorrhiza]
Length=517

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+++ GD KE  +++ +A SKP+ L D++  RV P+ V+   K+G   + W+GP P + L
Sbjct  48   YKLVYGDLKELTQLSMEARSKPINLDDDIKNRVAPFIVNAIHKHGNESFVWLGPRPSIIL  107

Query  160  RDPELIKEVLNKSDLFQKPKN-SPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPEL+KEVL+KS L+ +P+N +P+ + L++GL SYEK++WAKHR++INPAF+
Sbjct  108  TDPELVKEVLSKSYLYLRPENRNPMTKLLLQGLASYEKDEWAKHRKIINPAFH  160



>ref|XP_010502020.1| PREDICTED: cytochrome P450 72A13 isoform X2 [Camelina sativa]
Length=513

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K  + M + A SKP+ L+D++ PRV P+ +H+   +G+  + W GP+P++ +
Sbjct  49   YTPLVGDLKRNSSMLAVARSKPIKLTDDITPRVVPFPLHMLKTHGRTFFTWFGPVPVITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEV NK   FQK    PLGR +  GLVSY+ ++WAKHRR+INPAF+
Sbjct  109  MDPELIKEVFNKVYDFQKAHTFPLGRIIAAGLVSYDGDKWAKHRRIINPAFH  160



>ref|XP_006364094.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y++L GD KE  KM  +A SKP+  S D + PR+NP+       YGKNC+ W GP P V 
Sbjct  52   YKLLYGDMKEMKKMIEEATSKPIDFSHDLIWPRINPFIHKTITNYGKNCFVWFGPKPAVL  111

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + +P+LIKEVL K+ ++QK + SPL +  + GL ++EK++WA HRR++NPAF+
Sbjct  112  ITEPKLIKEVLTKNYVYQKARGSPLLKLAISGLAAHEKDKWATHRRILNPAFH  164



>emb|CDP19600.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE A+M   A SKP+  ++++ PR+ P+   L    G N   WMGP P + L
Sbjct  48   YRLLFGDMKETAQMVKQAYSKPINFTNDIVPRILPFVDKLIRSSGTNTLTWMGPSPALLL  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPEL+KEVL K+ ++QKP+N+PLG+ L  G  +Y+ ++WAK+RR+I+PAF+
Sbjct  108  IDPELVKEVLTKNYVYQKPRNNPLGKLLAEGFATYDTDKWAKNRRIISPAFH  159



>emb|CDP15986.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KE + M ++A SK + LSD++ PRV P ++    KYGKN Y W GP P V +
Sbjct  54   YKLLHGDFKEMSTMHTEAGSKNLNLSDDIVPRVIPQYLGAVKKYGKNTYLWFGPRPAVVI  113

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP LIK V  K D+F K   +PLGR L +GL +YE E+WAK R+L+NPAF+
Sbjct  114  MDPNLIKAVTQKVDVFHKLGVNPLGRLLAQGLRTYEGEKWAKQRKLLNPAFH  165



>ref|XP_002271303.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD +E  +M S+A S+ ++LSD++  RV P+  H   KYGKN + WMGP P+V +
Sbjct  47   YRLLHGDFREMLRMISEANSRSISLSDDIVQRVLPFHCHSIKKYGKNYFIWMGPKPVVNI  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI++V  K + F+KP   PLG+ L  GLV+ E EQW K R++INPAF+
Sbjct  107  MDPELIRDVFLKYNAFRKPPPHPLGKLLATGLVTLEGEQWTKRRKIINPAFH  158



>ref|XP_004243263.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMAL-SDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y IL GDTKE +    +  SK M++  D++APR  P+F+    KYGK  + W+GP P+VF
Sbjct  51   YSILYGDTKELSMRIKEVTSKSMSVYDDDIAPRSLPFFLDTIKKYGKKSFIWLGPKPLVF  110

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DP+LIKEV  K+ ++QK K +PL + L +GLV  E ++WAKHR++INPAF+
Sbjct  111  IMDPDLIKEVFTKTYIYQKTKTNPLTKLLAQGLVREEGDKWAKHRKIINPAFH  163



>ref|XP_010676732.1| PREDICTED: cytochrome P450 CYP72A219-like [Beta vulgaris subsp. 
vulgaris]
Length=523

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD KE + + S+A+ KP+  S++   R+ P    L  K G NC+ WMGP+P +F+
Sbjct  50   YRFLIGDMKENSMLRSEAMKKPIPFSNDYFHRIQPLLHQLVTKAGSNCFTWMGPVPTIFI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
              PELI++   + + F+KPK +PL   L  GLVSYE E+WA HRRL+NPAF+
Sbjct  110  TQPELIRDAFTRMNEFRKPKMNPLTELLAPGLVSYEGEKWANHRRLVNPAFH  161



>emb|CBI39884.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD K+ + M  +A S+P+ LSD++ PRV P+      +YGKN + W+GPIP V +
Sbjct  48   YRPLHGDAKKVSIMLKEANSRPINLSDDIVPRVIPFLYKTIQQYGKNSFTWVGPIPRVNI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
              PELI+EV  ++  FQK K +PL   L+ GLVSYE E+WAKHR+L+NPAF+
Sbjct  108  MKPELIREVFLEAGRFQKQKPNPLANFLLTGLVSYEGEKWAKHRKLLNPAFH  159



>ref|XP_002263652.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=516

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD K+ + M  +A S+P+ LSD++ PRV P+      +YGKN + W+GPIP V +
Sbjct  48   YRPLHGDAKKVSIMLKEANSRPINLSDDIVPRVIPFLYKTIQQYGKNSFTWVGPIPRVNI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
              PELI+EV  ++  FQK K +PL   L+ GLVSYE E+WAKHR+L+NPAF+
Sbjct  108  MKPELIREVFLEAGRFQKQKPNPLANFLLTGLVSYEGEKWAKHRKLLNPAFH  159



>ref|XP_006364093.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=536

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y++L GD KE  KM  +A SKP+  S D + PR+NP+       YGKNC+ W+GP P V 
Sbjct  71   YKLLYGDMKEMKKMIEEATSKPIDFSHDLIWPRINPFIHKTITNYGKNCFVWIGPKPAVL  130

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + +P+LI+EVL K+ ++ K + SPL + ++ GL  +EK++WA HRR++NPAF+
Sbjct  131  ITEPKLIREVLTKNYVYHKARGSPLSKLVISGLAGHEKDKWATHRRILNPAFH  183



>ref|XP_010465353.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K    M ++A SKP+ L+D++ PR+ PY + +   +G+  + W+GPIP + +
Sbjct  49   YTPLVGDLKRHFSMLTEAKSKPIKLTDDITPRIVPYPLQMLKTHGRTHFTWLGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEV NK   FQK    PLGR +  GL+SY+ ++WAKHRR+INPAF+
Sbjct  109  MDPELIKEVFNKVYDFQKAHTFPLGRLIAAGLLSYDGDKWAKHRRIINPAFH  160



>ref|XP_009628921.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+ L GD KE  KM  +A+SKP+  S D + PRV P+       YGKNC+ W GP P V 
Sbjct  52   YKFLFGDMKEIKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCFVWFGPRPAVL  111

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPEL+KEVL K+ ++QKP  +PL +    G+  YE ++WA HRRL+NPAF+
Sbjct  112  ITDPELVKEVLTKNFVYQKPPGTPLTKLAATGIAGYETDKWATHRRLLNPAFH  164



>gb|ABC69389.1| CYP72A52v1 [Nicotiana tabacum]
Length=518

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+ L GD KE  KM  +A+SKP+  S D + PRV P+       YGKNC+ W GP P V 
Sbjct  52   YKFLFGDMKEIKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCFVWFGPRPAVL  111

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPEL+KEVL K+ ++QKP  +PL +    G+  YE ++WA HRRL+NPAF+
Sbjct  112  ITDPELVKEVLTKNFVYQKPPGTPLTKLAATGIAGYETDKWATHRRLLNPAFH  164



>emb|CDP19607.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KE + + ++A SK + LSD++ PRV P ++    KYGKN Y W GP P V +
Sbjct  54   YKLLHGDFKEMSTLYTEAQSKNLNLSDDIVPRVIPQYLGAVKKYGKNTYLWFGPAPAVVI  113

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP LIK V  K D F+K   +PLGR + +GLVSYE E+WAK R+L+NPAF+
Sbjct  114  MDPNLIKAVTQKIDDFRKLPVNPLGRLVAQGLVSYEGEKWAKQRKLLNPAFH  165



>ref|XP_002270501.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD +E ++M ++A S+P++ SD++  RV P+  H   KYGKN + W+GP P+V +
Sbjct  47   YRLLHGDFREMSRMINEANSRPISFSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNI  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
              PELI++VL K + FQKP   PLG+ L  G+ S E EQW K R++INPAF+
Sbjct  107  MQPELIRDVLLKHNAFQKPPRHPLGKLLASGVASLEGEQWTKRRKIINPAFH  158



>ref|XP_008452438.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=521

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE A M  +A+SKPM  S+++APRV P   H    YGK    W+GP+P V +
Sbjct  52   YRILHGDLKESAAMREEAMSKPMNFSNHIAPRVIPSVYHTIQLYGKKSMMWLGPMPRVHI  111

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K V +  + FQKP  +PL R LV+GL S E ++W KHR++INPAF+
Sbjct  112  MDPEQLKIVFSSINDFQKPTMNPLTRLLVQGLASLEGQKWVKHRKIINPAFH  163



>ref|XP_010676734.1| PREDICTED: cytochrome P450 CYP72A219-like [Beta vulgaris subsp. 
vulgaris]
Length=523

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD KE + + S+A+ KP+  S++   R+ P    L  K G NC+ WMGP+P +F+
Sbjct  50   YRFLIGDMKENSMLRSEAMKKPIPFSNDYFYRIQPLLHQLVTKAGSNCFTWMGPVPTIFI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
              PELI++   + + F+KPK +PL   L  GLVSYE E+WA HRRL+NPAF+
Sbjct  110  TQPELIRDAFTRMNEFRKPKMNPLTELLAPGLVSYEGEKWANHRRLVNPAFH  161



>emb|CDP15985.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+++ GD K+ + +  +A SKP++LSD + PR+ P+F+    KYGKN Y W GP PM+ +
Sbjct  51   YKLIYGDLKQISSLFQEANSKPISLSDGIVPRIAPHFLEAVNKYGKNTYLWSGPRPMMLI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI++V  K D+FQK K  P    LV G++ YE E+W K R+L+N AF+
Sbjct  111  MDPELIRKVTQKMDIFQKVKFHPQASLLVAGILGYEGEKWVKQRKLLNQAFH  162



>gb|EYU43426.1| hypothetical protein MIMGU_mgv1a018638mg, partial [Erythranthe 
guttata]
Length=361

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+ L GD KE +KM + A S P+ L D++ PRV  +      KYG+  + W+GP P V +
Sbjct  48   YKFLYGDLKEMSKMFNHAKSTPINLHDDIKPRVLAFLHKTFEKYGQESFIWLGPRPTVMI  107

Query  160  RDPELIKEVLNKSDLFQKPKNS-PLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PEL+KEV+ K +L+QKPKNS PL + L +GL SYE ++W+KHR++INPAF+
Sbjct  108  TEPELVKEVMTKFNLYQKPKNSNPLTKLLAQGLFSYEGDKWSKHRKIINPAFH  160



>ref|XP_009594691.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
tomentosiformis]
Length=419

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KE   M  +A SKP+  S ++ PR+ P+       YGKN + W+ P P + +
Sbjct  49   YKLLYGDMKEVVMMDEEAKSKPIKFSHDIVPRIMPFIHKTIIDYGKNSFIWLWPTPAMLI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI+E+L+KS++FQKP  +   + LV G++SYE ++WAKHRR+INPAF+
Sbjct  109  TDPELIREILSKSNIFQKPPPTAHTKLLVEGILSYEADKWAKHRRIINPAFH  160



>ref|XP_010926817.1| PREDICTED: cytochrome P450 72A15-like isoform X3 [Elaeis guineensis]
Length=519

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD K+  ++   A SKPM LS  + PRV P+F      +GK  + W GP P V L
Sbjct  50   YRFLYGDLKDNVRLQKAARSKPMPLSHCIGPRVLPFFHQAIEDHGKISFTWFGPYPTVIL  109

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            +DPEL++EVL NK   F+KP  +PLG+ L RG+  YE E+WAKHRR+INPAF+
Sbjct  110  KDPELVREVLSNKFGHFEKPNINPLGKLLARGVADYEGEKWAKHRRIINPAFH  162



>ref|XP_009594690.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KE   M  +A SKP+  S ++ PR+ P+       YGKN + W+ P P + +
Sbjct  49   YKLLYGDMKEVVMMDEEAKSKPIKFSHDIVPRIMPFIHKTIIDYGKNSFIWLWPTPAMLI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI+E+L+KS++FQKP  +   + LV G++SYE ++WAKHRR+INPAF+
Sbjct  109  TDPELIREILSKSNIFQKPPPTAHTKLLVEGILSYEADKWAKHRRIINPAFH  160



>ref|XP_010926808.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Elaeis guineensis]
Length=519

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD K+  ++   A SKPM LS  + PRV P+F      +GK  + W GP P V L
Sbjct  50   YRFLYGDLKDNVRLQKAARSKPMPLSHCIGPRVLPFFHQAIEDHGKISFTWFGPYPTVIL  109

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            +DPEL++EVL NK   F+KP  +PLG+ L RG+  YE E+WAKHRR+INPAF+
Sbjct  110  KDPELVREVLSNKFGHFEKPNINPLGKLLARGVADYEGEKWAKHRRIINPAFH  162



>emb|CBI22133.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD +E  +M S+A S+ ++LSD++  RV P+  H   KYGKN + WMGP P+V +
Sbjct  117  YRLLHGDFREMLRMISEANSRSISLSDDIVQRVLPFHCHSIKKYGKNYFIWMGPKPVVNI  176

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI++V  K + F+KP   PLG+ L  GLV+ E EQW K R++INPAF+
Sbjct  177  MDPELIRDVFLKYNAFRKPPPHPLGKLLATGLVTLEGEQWTKRRKIINPAFH  228



>gb|KGN55010.1| hypothetical protein Csa_4G621220 [Cucumis sativus]
Length=181

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE A M   AISKPM  S+ +APRV P   H    YGKN + W+GP+P V +
Sbjct  56   YRILHGDLKERAAMRDQAISKPMNFSNYIAPRVIPSVHHTIQHYGKNSFMWIGPMPRVHI  115

Query  160  RDPELIKEVLNKSDLFQKPKNS--PLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K V +  + +QKP  S  PL + L  GL+++E ++W KHR++INPAF+
Sbjct  116  MDPEQLKTVFSLINDYQKPTASLNPLAKLLADGLLNHEGQKWVKHRKIINPAFH  169



>ref|XP_008367417.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=238

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  +SGD KE +  T  A SKPM+LS ++APRV P+   L   YGKN + WMG IP V +
Sbjct  48   YXFMSGDMKEISMTTEQAYSKPMSLSHDIAPRVIPFHHRLVNTYGKNSFVWMGTIPRVII  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE +K +L K   F +P+ +PL + L  G+  YE E+WAKHRR+INP F+
Sbjct  108  TNPEDLKYILTKMGEFPQPEPNPLVKLLATGIALYEGEKWAKHRRIINPVFH  159



>ref|XP_010327096.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=250

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y++L GD KE   M  +A SKP+  S D + PR+NP+       YGKNC+ W+GP P V 
Sbjct  52   YKLLYGDMKEMKMMIEEATSKPINFSHDLIWPRINPFIHKTITNYGKNCFVWIGPKPAVL  111

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + +P+LI+EVL K+ ++ K + SPL +  + GL ++EK++WA HRR++NPAF+
Sbjct  112  ITEPKLIREVLTKNYVYHKARGSPLLKLAISGLAAHEKDKWATHRRILNPAFH  164



>ref|XP_010926800.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Elaeis guineensis]
Length=519

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD K+  ++   A SKPM LS  + PRV P+F      +GK  + W GP P V L
Sbjct  50   YRFLYGDLKDNVRLQKAARSKPMPLSHCIGPRVLPFFHQAIEDHGKISFTWFGPYPRVIL  109

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            +DPEL++EVL NK   F+KP  +PLG+ L RG+  YE E+WAKHRR+INPAF+
Sbjct  110  KDPELVREVLSNKFGHFEKPNINPLGKLLARGVADYEGEKWAKHRRIINPAFH  162



>ref|XP_007022099.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
 gb|EOY13624.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
Length=518

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR LSGD KE + M+  A SKPM LSD++A  V+P+       YGKN + W+GP P V +
Sbjct  50   YRFLSGDIKESSDMSKQARSKPMPLSDDIAQYVSPFLHQTVKNYGKNSFVWIGPRPRVTI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             +PE I+E+  K + FQKP++ P+G  LV GL + + E+WAKHR +INPAF+ 
Sbjct  110  MEPEQIREIFTKFNDFQKPRSYPVGNLLVCGLANLQGEEWAKHRNIINPAFHQ  162



>ref|XP_006407055.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
 dbj|BAJ33634.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48508.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
Length=512

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L+GD+K    M+ +A SKP+ L+D++ PRV P+ +H+   YG+  + W G IP++ +
Sbjct  49   YTPLAGDSKRTFNMSMEARSKPINLTDDIIPRVLPFSLHMLKTYGRTFFTWRGHIPVITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV NK   FQKP   PLGR +  GL SY+ ++WA HRR+INPAF+
Sbjct  109  MDPEQIKEVFNKIYDFQKPHTFPLGRLIATGLFSYDGDKWANHRRIINPAFH  160



>ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=521

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+ SGD K+   M+ +A SKPM  S ++APRV P   H   KYGKN + W+GPIP VF+
Sbjct  52   YRLYSGDLKDLVAMSEEAKSKPMNFSHDIAPRVIPSIHHTIEKYGKNSFVWLGPIPRVFI  111

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K  L+  + FQKP  +PL + L  GL+++E E+W KHR+++N AF+
Sbjct  112  MDPEQLKAALSLYNDFQKPTINPLVKLLFDGLINHEGEKWVKHRKIVNHAFH  163



>gb|EPS69403.1| hypothetical protein M569_05363, partial [Genlisea aurea]
Length=504

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+ L GD KE  ++  +A SKP+A+ D++ PRV  +FV     YGKNC+ W G  P+V L
Sbjct  25   YKFLHGDNKESLEILRNAKSKPIAVDDDIKPRVVGFFVKTIDTYGKNCFFWRGTRPVVIL  84

Query  160  RDPELIKEVLNKSDLFQKPKN-SPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +KEV  K++ FQKP + +PL + L  GLV+ E E+WAKHR+++NPAF+
Sbjct  85   TDPETVKEVFKKTEAFQKPVDPNPLAKFLSTGLVAIEGEKWAKHRKIMNPAFH  137



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L G+ KE   MT  A S+PM+L+D++AP V PY+      YGKN   W GP P V +
Sbjct  52   YRLLFGEIKEMFTMTRQARSRPMSLTDDIAPYVIPYYHQTVTNYGKNSIRWFGPSPRVTI  111

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI+E+ NK + FQKP+ +PL   L  G+++ E E+WAKHR++I P+F+
Sbjct  112  MDPELIREIFNKFNEFQKPRINPLITLLFSGILTLEGERWAKHRKIITPSFH  163



>ref|XP_006348901.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMAL-SDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y IL GDTKE +    +  SK M+L  D++A R  P+F+    KYGK  + W+GP P+VF
Sbjct  51   YSILYGDTKELSLRIKEVTSKSMSLYDDDIAQRSMPFFLDTIKKYGKKSFIWLGPKPLVF  110

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DP+LIKEV  K+ ++QK K +PL + L +GLV  E ++WAKHR++INPAF+
Sbjct  111  IMDPDLIKEVFTKTYIYQKTKTNPLTKLLAQGLVREEGDKWAKHRKIINPAFH  163



>ref|XP_006477947.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=263

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE +    +A ++P++L DN+A RVNP+   L   YGKN + W GP P V +
Sbjct  49   YRLLFGDLKENSIELKEAKARPLSLDDNIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             +P+ IKE+  + + FQK  + PL R L+ GL + E E+WAKHR+LINPAF+ 
Sbjct  109  MNPDQIKEIFTRINDFQKVNSIPLARLLIVGLATLEGEKWAKHRKLINPAFHQ  161



>gb|AJD25169.1| cytochrome P450 CYP72A328 [Salvia miltiorrhiza]
Length=517

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD K+   M+ +A SKP+  S +   R+ P F     KYG+NC+ W GP P + +
Sbjct  47   YRVLYGDLKDMRLMSKEASSKPLDFSHDFVHRIMPIFHFALKKYGENCFVWFGPSPAILV  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE ++EV++KS++FQKP   P  R + +GLV+ E ++WAKHRRLINPAF+
Sbjct  107  MNPESVREVVSKSNVFQKPPGRPFIRLMSKGLVTLETDKWAKHRRLINPAFH  158



>ref|XP_008226302.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=518

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD  + +KMT +A+SKPM  S ++ P V P       KYGK  + W+GP+P V +
Sbjct  49   YRLLIGDLTDNSKMTKEALSKPMEFSHDIVPYVLPLLQETFNKYGKKSFIWLGPVPSVVI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             D EL++E L K  +F+KP ++PL   LV GL+SYE ++W KH+R+INPAF+
Sbjct  109  FDAELMRETLTKHRVFEKPHSNPLLSFLVTGLLSYEGDKWVKHKRIINPAFH  160



>ref|XP_002882888.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59147.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K    M ++A SKP+ L+D++ PR+ PY + +   YG+  Y W+GPIP + +
Sbjct  49   YTPLVGDLKRNFSMLAEARSKPINLTDDITPRIVPYPLQMFKTYGRTFYTWLGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV NK   FQK    PL R +  GLVSY+ ++WAKHRR+INPAF+
Sbjct  109  MDPEQIKEVFNKVYDFQKSHTFPLARLIAAGLVSYDGDKWAKHRRIINPAFH  160



>ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=587

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+ SGD K+   M+ +A SKPM  S ++APRV P   H   KYGKN + W+GPIP VF+
Sbjct  118  YRLYSGDLKDLVAMSEEAKSKPMNFSHDIAPRVIPSIHHTIEKYGKNSFVWLGPIPRVFI  177

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K  L+  + FQKP  +PL + L  GL+++E E+W KHR+++N AF+
Sbjct  178  MDPEQLKAALSLYNDFQKPTINPLVKLLFDGLINHEGEKWVKHRKIVNHAFH  229



>ref|XP_010645072.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=390

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD +E ++M ++A S+P++ SD++  RV P+  H   KYGKN + W+GP P+V +
Sbjct  58   YRLLHGDFREMSRMINEANSRPISFSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNI  117

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
              PELI++VL K + FQKP   PLG+ L  G+ S + EQW K R++INPAF+
Sbjct  118  MQPELIRDVLLKHNAFQKPPPHPLGKLLASGISSLDGEQWTKRRKIINPAFH  169



>gb|EPS61578.1| hypothetical protein M569_13218, partial [Genlisea aurea]
Length=498

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR +SGD+KE  ++       P+ L D++ P V  +F      YG  C+ W GP P V L
Sbjct  43   YRFVSGDSKEIQQIDWSCRRNPINLGDDIKPNVAGFFAKSIKTYGNCCFYWAGPTPTVIL  102

Query  160  RDPELIKEVLNKSDLFQKPKNS-PLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE++KEVLNK D + +P++S PLGR L RGLV  E ++W KHRRL+NPAF+
Sbjct  103  NDPEMVKEVLNKPDFYGRPRSSNPLGRLLARGLVHLEGQKWLKHRRLMNPAFH  155



>ref|XP_007149362.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
 gb|ESW21356.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
Length=523

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMAL-SDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y +L GDTK+FAKM  +A SKPM L S ++ PRV  +F H    +GK  + W GP P V 
Sbjct  52   YTLLVGDTKDFAKMRKEAFSKPMNLFSHDIVPRVFSFFHHSINTHGKKSFMWFGPAPRVT  111

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
            + DPELIK+VLNK+  F+K   +P  R L  GLVS+E E+W+KHR++INPAF
Sbjct  112  ITDPELIKDVLNKTYDFEKINMNPQVRLLAPGLVSHEGEKWSKHRKIINPAF  163



>ref|XP_009394211.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=196

 Score =   114 bits (285),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -3

Query  325  GDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFLRDPEL  146
            GD KE  ++  +A +KPM L+ N+ PR+ P+F     +YGK  + W GP+P V ++DPEL
Sbjct  59   GDVKETVRLREEARAKPMPLAHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVNIKDPEL  118

Query  145  IKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
            ++EVL NK   F KP  +PL R   RGL  YE E+W KHRR++NPAF++
Sbjct  119  VREVLSNKFGHFGKPNQNPLARFFARGLALYEGEKWVKHRRILNPAFHA  167



>ref|XP_009790251.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
 gb|ABC69391.1| CYP72A53v2 [Nicotiana tabacum]
Length=518

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+ L GD KE  KM  +A+SKP+  S D + PRV P+       YGKNC  W GP P V 
Sbjct  52   YKFLFGDMKEMKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCIVWFGPRPAVL  111

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPEL+KEVL K+ ++QKP  +PL +    G+  YE ++WA HRRL+NPAF+
Sbjct  112  ITDPELVKEVLTKNFVYQKPLGNPLTKLAATGIAGYETDKWATHRRLLNPAFH  164



>ref|XP_008226213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSD--NVAPRVNPYFVHLAGKYGKNCYAWMGPIPMV  167
            YR+L GDTK+ +KM     SKP+ LS   ++AP V P+F      YGKN + WMGPIP V
Sbjct  51   YRLLFGDTKDLSKMLEQTQSKPIKLSTSHDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRV  110

Query  166  FLRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             + +PE +K+  N+ D F K   +P+ + L +G+V  E EQWAKHR++INPAF+
Sbjct  111  HIMNPEDLKDTFNRHDDFHKVVKNPIMKSLPQGIVGIEGEQWAKHRKIINPAFH  164



>ref|XP_008226215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Prunus 
mume]
Length=518

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSD--NVAPRVNPYFVHLAGKYGKNCYAWMGPIPMV  167
            YR+L GDTK+ +KM     SKP+ LS   ++AP V P+F      YGKN + WMGPIP V
Sbjct  48   YRLLFGDTKDLSKMLEQTQSKPIKLSTSHDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRV  107

Query  166  FLRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             + +PE +K+  N+ D F K   +P+ + L +G+V  E EQWAKHR++INPAF+
Sbjct  108  HIMNPEDLKDTFNRHDDFHKVVKNPIMKSLPQGIVGIEGEQWAKHRKIINPAFH  161



>ref|XP_007149361.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
 gb|ESW21355.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
Length=516

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMAL-SDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+   GDTKE  KM  + +SKPM L S ++ PRV  +F H    +GK C+ W GPIP V 
Sbjct  45   YKFFVGDTKEIEKMKKEGLSKPMDLFSHDIVPRVFSFFHHSINTHGKICFTWFGPIPRVI  104

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
            L DP+LIK+VLNK + F +    P  + LV GLVS+E E+W+KHR++INPAF
Sbjct  105  LTDPDLIKDVLNKMNEFGRINMHPQLKFLVPGLVSHEGERWSKHRKIINPAF  156



>ref|XP_010911572.1| PREDICTED: cytochrome P450 CYP72A219-like [Elaeis guineensis]
Length=522

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD KE A++  +A SKPM  S ++ PRV P+F     + GK  + W GP+P V +
Sbjct  53   YRFLHGDLKETARLNKEARSKPMPFSHDIVPRVAPFFHRAIKENGKISFTWFGPVPRVTI  112

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE ++EVL NK   F KP+ +PLGR L  GL +YE E+WAKHRR++NPAF+
Sbjct  113  MNPEWVREVLSNKFGHFAKPQINPLGRLLATGLANYEGEKWAKHRRILNPAFH  165



>ref|XP_007213922.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
 gb|EMJ15121.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
Length=519

 Score =   118 bits (295),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GDTKE + M  +A SKPM L  ++APRV P+       YGKN + W+GP P V +
Sbjct  51   YRLLIGDTKESSMMLKEAKSKPMDLFHDLAPRVLPFVHQSMNTYGKNSFIWIGPTPRVNI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             +PE +K++  K + FQKP  +PL + L  GL +YE E+WAKHR++INPAF+S
Sbjct  111  SNPEDMKDIFAKYEDFQKPVKNPLVKLLATGLANYEGEKWAKHRKIINPAFHS  163



>ref|XP_006407058.1| hypothetical protein EUTSA_v10021993mg [Eutrema salsugineum]
 gb|ESQ48511.1| hypothetical protein EUTSA_v10021993mg [Eutrema salsugineum]
Length=501

 Score =   117 bits (294),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K   +M  DA SKP+ L+D++A RV P+ + +   +G+  + W+GPIP + +
Sbjct  47   YTPLVGDLKRNLRMVMDARSKPIRLTDDIAKRVVPFPLQMLNMHGRTFFTWIGPIPTITI  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV NK + F K    PLGR +  GLVSY+ ++WAKHRR+INPAF+
Sbjct  107  MDPEQIKEVFNKVNDFTKTHTFPLGRLIATGLVSYDGDKWAKHRRIINPAFH  158



>ref|XP_009146333.1| PREDICTED: cytochrome P450 72A13-like [Brassica rapa]
Length=512

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD +    M+ +A SKP+  +D++ PRV P+  H+   YG+  + W GPIP + +
Sbjct  49   YTPLVGDVRRDYTMSMEARSKPIKTTDDIIPRVVPFPSHMLKTYGRTFFTWRGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV NK   FQKP + PLGR +  GL SY+ ++WAKHRR+INPAF+
Sbjct  109  TDPEQIKEVFNKIYDFQKPHSFPLGRLIATGLFSYDGDKWAKHRRIINPAFH  160



>ref|XP_008386157.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR  +GD KE + M   A SKP++LS ++APRV P+   L   YGKN + WMGP P V +
Sbjct  51   YRFYTGDMKEISTMIKQAYSKPVSLSHDIAPRVIPFDYQLVNTYGKNYFVWMGPTPRVNI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K +L K D F KP  +PL + L  G+   E E+WAKHRR+INP F+
Sbjct  111  TDPEDMKTILTKMDDFPKPXANPLXKLLXTGIALCEGEKWAKHRRIINPVFH  162



>emb|CDX97593.1| BnaA05g24860D [Brassica napus]
Length=512

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD +    M+ +A SKP+ ++D++ PRV P+  H+   YG   + W GPIP + +
Sbjct  49   YTPLVGDVRRDYTMSMEARSKPIRITDDIVPRVVPFPSHMLKTYGMTFFTWRGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV NK   FQKP + PLGR +  GL SY+ ++WAKHRR+INPAF+
Sbjct  109  TDPEQIKEVFNKIYDFQKPHSFPLGRLIATGLFSYDGDKWAKHRRIINPAFH  160



>gb|ABC69390.1| CYP72A53v1 [Nicotiana tabacum]
Length=518

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALS-DNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y+ L GD KE  KM  +A+SKP+  S D + PRV P+       YGKNC  W GP P V 
Sbjct  52   YKFLFGDMKETKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCIVWFGPRPAVL  111

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPEL+KEVL K+ ++QKP  +PL +    G+  YE ++WA HRRL+NPAF+
Sbjct  112  ITDPELVKEVLTKNFVYQKPLGNPLTKLAATGIAGYETDKWATHRRLLNPAFH  164



>ref|XP_007022096.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
 gb|EOY13621.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
Length=482

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 74/113 (65%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR LSGD KE   M+  A S+PM L D++   V P+       YGKN ++W+GPIP V +
Sbjct  50   YRFLSGDIKESFAMSRQARSQPMPLGDDITQYVGPFLHQTVKNYGKNSFSWVGPIPRVTI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             +PE I+E+  K + FQKP  +PL   LV GLV+ + E+WAKHR++INPAF+ 
Sbjct  110  MEPEDIREIFTKFNDFQKPHTNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQ  162



>ref|NP_188087.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
 sp|Q9LUC5.1|C7A15_ARATH RecName: Full=Cytochrome P450 72A15 [Arabidopsis thaliana]
 dbj|BAB02401.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAK92762.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM20382.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE75556.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
Length=512

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K+   M S+A SKP+ L+D+++PRV PY + +   YG+  + W GPIP + +
Sbjct  49   YTPLVGDLKKNFTMLSEARSKPLKLTDDISPRVVPYPLQMFKTYGRTYFTWFGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV NK   FQKP   PL   + +GL +Y+ ++WAKHRR+INPAF+
Sbjct  109  MDPEQIKEVFNKVYDFQKPHTFPLATIIAKGLANYDGDKWAKHRRIINPAFH  160



>ref|XP_009116708.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Brassica rapa]
Length=508

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K+ + M ++A SKP+ L+D+V PRV PY  H+   +G+  Y W GPIP + +
Sbjct  49   YTPLVGDLKKMSSMLTEARSKPIKLTDDVTPRVVPYPFHMLKTHGRTYYTWFGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV N    F KP   PL R +  GL SY+ ++WAKHRR+INPAF+
Sbjct  109  MDPEQIKEVFNNVYDFPKPHTFPLVRFIATGLASYDGDKWAKHRRIINPAFH  160



>ref|XP_007149376.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
 gb|ESW21370.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
Length=523

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 74/112 (66%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMAL-SDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y +L GDT EFAKM  +A SKPM L S+++  RV P+F H    +GKN + W GP P V 
Sbjct  52   YTLLVGDTNEFAKMRKEAFSKPMDLFSNDIVQRVYPFFRHSINTHGKNSFIWFGPAPRVI  111

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
            L DPELIK+V NK+  FQK   +P  R L  GLVS+E E+W KHR++I P F
Sbjct  112  LTDPELIKDVFNKTFDFQKIYLNPQVRLLTPGLVSHEGEKWRKHRKIITPVF  163



>gb|EPS70870.1| hypothetical protein M569_03891 [Genlisea aurea]
Length=535

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  + GD KE   +T  A +KP+ L D++ PRV    V     YG   Y W+GP P V L
Sbjct  49   YSSIHGDLKELKLITESAKAKPIRLDDDIKPRVLGLIVKTIAAYGNESYFWIGPKPSVIL  108

Query  160  RDPELIKEVLNKSDLFQKPKN-SPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE++KEVL K+D+F KP N +PL R L +GL+ YE E+WAKHR+L+NPAF+
Sbjct  109  TDPEMVKEVLRKNDVFTKPVNPNPLTRILSKGLIGYEGEKWAKHRKLLNPAFH  161



>gb|EYU31635.1| hypothetical protein MIMGU_mgv1a025572mg [Erythranthe guttata]
Length=515

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 74/112 (66%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD  E   M  +A+SKP+  SD+  PR   +       +G+N + W+GP   V +
Sbjct  48   YRFLIGDLNEMKNMGEEALSKPIDFSDDFVPRTISFIHKTVTNHGENSFVWLGPYAAVII  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE ++EVL+KS +FQKP N PLG+ + +GL SYE ++WAKHRRLINPAF+
Sbjct  108  SDPENVREVLSKSYVFQKPYN-PLGKLVAQGLASYETDKWAKHRRLINPAFH  158



>gb|EYU31636.1| hypothetical protein MIMGU_mgv1a004595mg [Erythranthe guttata]
Length=519

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD KE   M + A S P+ L D++ PRV  +      KYGK  + W+GP P V +
Sbjct  51   YNFLYGDLKEMLNMINHAKSHPINLDDDIKPRVLAFIHKTFLKYGKGSFIWLGPRPAVMI  110

Query  160  RDPELIKEVLNKSDLFQKPKNS-PLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PELIKEV+ K +L+QKPKNS PL + L +G+V+YE ++WAKHR++INPAF+
Sbjct  111  TEPELIKEVMTKINLYQKPKNSNPLTKLLAQGVVAYEGDKWAKHRKIINPAFH  163



>ref|XP_010910666.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Elaeis 
guineensis]
Length=256

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD KE A +  +A SKPM  S ++ PRV P+F     + GK    W GP+P V +
Sbjct  53   YRFLHGDLKETAWLNKEARSKPMPFSHDIVPRVAPFFHRAIKENGKISITWFGPVPRVTI  112

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE ++EVL NK   F KP+ +PLGR L  GL +YE E+WAKHRR++NPAF+
Sbjct  113  MNPEWVREVLSNKFGHFAKPQINPLGRLLATGLANYEGEKWAKHRRILNPAFH  165



>gb|AHK60841.1| CYP72A225 [Catharanthus roseus]
Length=538

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD  E ++M  +A SKP+  ++++ PR+ P+   +   +GKN + W GP P V +
Sbjct  65   YRLLIGDLGETSQMDKEAKSKPINFTNHIIPRIMPFLHKIIQSHGKNPFIWQGPNPAVII  124

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEVL K+  +QKP +  LG+ + +G+ +Y+K++WAKHRRL+NPAF+
Sbjct  125  TDPELIKEVLTKNYTYQKPPSDDLGKLISQGVAAYDKDKWAKHRRLLNPAFH  176



>ref|XP_007149364.1| hypothetical protein PHAVU_005G064100g [Phaseolus vulgaris]
 gb|ESW21358.1| hypothetical protein PHAVU_005G064100g [Phaseolus vulgaris]
Length=520

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMAL-SDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            Y +L GDTK+FAKM  +A SKPM L S ++ PRV  +F H    +GKN + W GP+P V 
Sbjct  48   YTLLVGDTKDFAKMRKEAFSKPMNLFSHDIVPRVFSFFHHSINTHGKNSFIWFGPVPRVT  107

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
            L DPELIK+V NK+  FQK   +P    L  GL+S+  E+W+KHR++INPAF
Sbjct  108  LTDPELIKDVFNKTHDFQKINMNPQIWLLGPGLLSHHGEKWSKHRKIINPAF  159



>ref|XP_009116688.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y +L GD K    MT++A SKP+ L+D++ P V P+  H+   YG+  + W GPIP + +
Sbjct  49   YTLLVGDVKREYSMTTEARSKPIKLTDDIVPLVLPFPSHMLKTYGRTFFTWRGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE IKEVLNK   FQKP    L R +  GL SY+ ++WAKHRR+INPAF+
Sbjct  109  TNPEQIKEVLNKIYDFQKPNTFALSRLVASGLFSYDGDKWAKHRRIINPAFH  160



>ref|XP_009394812.1| PREDICTED: cytochrome P450 72A15-like [Musa acuminata subsp. 
malaccensis]
Length=518

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR + GD KE  ++ ++A+SKP+ LS ++ PRV P+      ++GK  + W GP+P V +
Sbjct  50   YRFIRGDVKEDRRLLAEALSKPIPLSHHIIPRVAPFLRAAMNEFGKTFFTWFGPVPRVMI  109

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPEL++E+L NK   F++   SPLGR +  GL+SY   +WAKHRR++NPAF+
Sbjct  110  MDPELVREILSNKFGHFERASLSPLGRAVASGLISYHGGKWAKHRRILNPAFH  162



>ref|XP_006830578.1| hypothetical protein AMTR_s00117p00135230, partial [Amborella 
trichopoda]
 gb|ERM97994.1| hypothetical protein AMTR_s00117p00135230, partial [Amborella 
trichopoda]
Length=251

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+ L GD KE  ++  +AISKPM LS  + PR+ PYF+ +   YGK C +W G +P+V +
Sbjct  53   YKPLFGDLKENNRLFEEAISKPMDLSHRIVPRIFPYFIKMVENYGKICLSWFGLVPLVIV  112

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PEL+KE+L NK   F+KP    L + L  GL + + E+WA+HRR+INPAF+
Sbjct  113  TEPELVKEILSNKYGHFEKPTPDQLIKLLALGLAAEQGEKWARHRRIINPAFH  165



>ref|XP_008452437.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=522

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE A M  +A+SKPM  S+++APRV P   H    YGKN + W+G +P V +
Sbjct  54   YRILHGDLKESAAMREEAMSKPMKFSNHIAPRVIPSVYHTIQLYGKNSFMWIGTMPRVHI  113

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K V +  + FQ+P  SPL +    GL SYE ++W KHR++I+PAF+
Sbjct  114  MDPEQLKTVFSLINDFQRPTMSPLLKLFANGLFSYEGQKWVKHRKIISPAFH  165



>emb|CDP19608.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GDT++  +M  +A SKP++L+D++ PR+ P+        GKN + W+GP P + +
Sbjct  48   YRFLFGDTRDMGRMLEEAKSKPISLTDDIFPRIVPFINETMQHKGKNSFFWLGPRPAMVI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +KEV  K+  +QKP+ +P+ + L  GL S + E+WAKHRRL+NPAF+
Sbjct  108  LDPEQVKEVFTKNFTYQKPRANPISKLLALGLASLDTEKWAKHRRLLNPAFH  159



>emb|CAN72443.1| hypothetical protein VITISV_032856 [Vitis vinifera]
Length=245

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD KE ++M ++A S+P++ SD++  RV P+  H   KYGKN + W+GP P+V +
Sbjct  47   YSCLYGDFKEMSRMINEANSRPISFSDDIVQRVLPFHDHSIQKYGKNSFTWLGPKPVVNI  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PELI++V  K + FQK    PLG+ L  G+V+ E EQW K R++INPAF+
Sbjct  107  MEPELIRDVFLKHNAFQKVPPHPLGKLLATGVVALEGEQWTKRRKIINPAFH  158



>ref|XP_008226210.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GDTKE + M  +  SKPM L  ++APRV P+       YGKN + W+GP P V +
Sbjct  51   YRLLIGDTKESSMMVKETKSKPMDLCHDLAPRVLPFVHQSMNTYGKNFFIWIGPTPRVNI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             +P+ +K++  K + FQKP  +PL   L  GL SYE E+WAKHR++INPAF+S
Sbjct  111  SNPDDMKDIFAKYEDFQKPATNPLVNLLATGLSSYEGEKWAKHRKIINPAFHS  163



>ref|XP_008452436.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=529

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE A M   AISKPM  S+++APRV P   H    YGKN + W+GPIP V +
Sbjct  55   YRILYGDLKERAAMRDQAISKPMNFSNHIAPRVIPSVHHTIQHYGKNSFMWIGPIPRVHI  114

Query  160  RDPELIKEVLNKSDLFQKPKNS--PLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K V +  + +QKP  S  PL + L  GL+++E  +W KHR++INPAF+
Sbjct  115  MDPEQLKTVFSLINDYQKPTASLNPLAKLLADGLLNHEGHKWVKHRKIINPAFH  168



>ref|XP_008226216.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSD--NVAPRVNPYFVHLAGKYGKNCYAWMGPIPMV  167
            YR+L GDTKE + M   A SKP+ LS   ++APRV P+   +   YG+N + WMGP P V
Sbjct  51   YRLLFGDTKEISMMVEQAQSKPIKLSTTHDIAPRVIPFSHQIVYTYGRNSFVWMGPTPRV  110

Query  166  FLRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             + +PE +K+  NKSD FQ+  ++P+ + + +GL S E E+WAKHR++INPAF+
Sbjct  111  TIMNPEDLKDAFNKSDEFQRAISNPIVKSISQGLSSLEGEKWAKHRKIINPAFH  164



>ref|XP_008226217.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=522

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSD--NVAPRVNPYFVHLAGKYGKNCYAWMGPIPMV  167
            YR+L GDTKE + M   A SKP+ LS   ++APRV P+   +   YG+N + WMGP P V
Sbjct  52   YRLLFGDTKEISMMVEQAQSKPIKLSTTHDIAPRVIPFSHQIVYTYGRNSFVWMGPTPRV  111

Query  166  FLRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             + +PE +K+  NKSD FQ+  ++P+ + + +GL S E E+WAKHR++INPAF+
Sbjct  112  TIMNPEDLKDAFNKSDEFQRAISNPIVKSISQGLSSLEGEKWAKHRKIINPAFH  165



>ref|XP_004294187.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 73/114 (64%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSD--NVAPRVNPYFVHLAGKYGKNCYAWMGPIPMV  167
            YRIL GDTKE   M   A SKPM LS   ++APRV P        YGKN   WMGPIP V
Sbjct  51   YRILYGDTKENVIMLKKAKSKPMNLSTSHDIAPRVTPLLHQTVKTYGKNSLVWMGPIPQV  110

Query  166  FLRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             + +PE +K+V  +   FQKP ++PL + L  GLV +E E+WAKHRR+INP F+
Sbjct  111  NIMNPEDLKDVFTELSDFQKPHSNPLVKFLATGLVIHEGEKWAKHRRIINPTFH  164



>emb|CDY20078.1| BnaA01g29240D [Brassica napus]
Length=512

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y +L GD K    MT++A SKP+ L+D++ P V P+  H+   YG+  + W GPIP + +
Sbjct  49   YTLLVGDVKREYSMTTEARSKPIKLTDDIVPLVLPFPSHMLKTYGRTFFTWRGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
              PE IKEVLNK   FQKP    L R +  GL SY+ ++WAKHRR+INPAF+
Sbjct  109  TSPEQIKEVLNKIYDFQKPNTFALSRPVASGLFSYDGDKWAKHRRIINPAFH  160



>gb|AIA82924.1| SLS1 [Gentiana rigescens]
Length=519

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 74/114 (65%), Gaps = 1/114 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPM-ALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR+L GD KE  K    A S+P+   S    PRV P +  +  KYGKN YAW GP   V 
Sbjct  51   YRLLYGDLKEMQKTLKKACSQPVKGFSHAFEPRVIPLYQDVVHKYGKNGYAWFGPEASVI  110

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
            + DPE IKEV  K D+F KP ++PL + L+RG+VSYE ++W KHR++INPAF+ 
Sbjct  111  VMDPESIKEVTLKYDVFNKPHSNPLSKLLLRGVVSYEGDKWVKHRKIINPAFHQ  164



>ref|XP_004488695.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=513

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GDT +  KM ++A  K + LSD++   V PY      KYG N + W GP P V L
Sbjct  48   YRLLYGDTNDVIKMQTEAAFKSINLSDDLVSHVFPYDHQTVTKYGNNPFIWFGPKPRVIL  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             D EL+KEV  KS+ FQK   +PL R L+ GLVSY+ E+W+KHR++INPAF+
Sbjct  108  TDSELVKEVFMKSNSFQKLPQNPLLRMLINGLVSYDSEKWSKHRKIINPAFH  159



>ref|XP_009790240.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=512

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KE   M  +A SKP+  S ++ PR+ P+       YGK  + W+GP P + +
Sbjct  48   YKLLYGDMKEVVMMDEEAKSKPIKFSHDIVPRIMPFIQKTIIDYGKKSFIWLGPTPALLI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELI+E+L+KS++FQKP  +   + L  G++SYE ++WAKHRR+IN AF+
Sbjct  108  MDPELIREILSKSNIFQKPPPTAQTKLLAEGILSYEADKWAKHRRIINHAFH  159



>emb|CDY51038.1| BnaA06g03010D [Brassica napus]
Length=512

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y +L GD K       +A SKP+ ++D++ PRV P+  H+   YG   + W+GPIP + +
Sbjct  49   YTLLIGDIKRDHSTLMEARSKPIKVTDDIIPRVLPFPSHMLKTYGMTFFTWLGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV NK   FQKP   PL   ++ GL SYE ++WAKHRR+INPAF+
Sbjct  109  TDPEQIKEVFNKVYDFQKPHTFPLSNLIISGLFSYEGDKWAKHRRIINPAFH  160



>ref|XP_008386388.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 74/113 (65%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+ SGD KE + M  +A+SKPM LS + APRV PY       YGKN + W+GP P V +
Sbjct  51   YRLWSGDLKEISMMLKEAVSKPMNLSHDTAPRVVPYAHQSVSTYGKNSFIWIGPTPRVNI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             +PE +K +  K + F KP  SPL + L+ GL +Y  E+WAKHR++I PAF+S
Sbjct  111  TNPEDLKNIFTKHEDFPKPALSPLVKLLLTGLANYGGEKWAKHRKIIKPAFHS  163



>ref|XP_009394212.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR   GD KE  ++  +A +KPM L+ N+ PR+ P+F     +YGK  + W GP+P V +
Sbjct  54   YRFPYGDVKEILRLRKEARAKPMPLAHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVTI  113

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             DPEL++EVL NK  +F KP  +PL R   +GL  YE E+W KHRR++NPAF++
Sbjct  114  TDPELVREVLSNKFGIFGKPTQNPLSRFFSKGLFVYEGEKWVKHRRIMNPAFHA  167



>ref|XP_009394213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR   GD KE  ++  +A +KPM L+ N+ PR+ P+F     +YGK  + W GP+P V +
Sbjct  54   YRFPYGDVKEILRLRKEARAKPMPLAHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVTI  113

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             DPEL++EVL NK  +F KP  +PL R   +GL  YE E+W KHRR++NPAF++
Sbjct  114  TDPELVREVLSNKFGIFGKPTQNPLSRFFSKGLFVYEGEKWVKHRRIMNPAFHA  167



>ref|XP_009339350.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=519

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+ SGD +E + M  +A+SKPM LS + APRV P+       YGKN + W+GP P V +
Sbjct  51   YRLWSGDLRESSIMLKEAMSKPMNLSHDTAPRVLPFVHQSVSTYGKNSFMWIGPTPRVNI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             +PE +K++  K + F KP  +PL + L  GL +YE ++WAKHRR++NPAF+S
Sbjct  111  TNPEDLKDIFTKHEDFPKPALNPLVKLLATGLANYEGDKWAKHRRIVNPAFHS  163



>ref|XP_009394809.1| PREDICTED: cytochrome P450 72A13-like [Musa acuminata subsp. 
malaccensis]
Length=530

 Score =   116 bits (290),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD KE  ++  +A+SKPM LS ++ PRV P+        G+  ++W GP+P V +
Sbjct  58   YRFLRGDLKEGKRLLEEALSKPMPLSHHIIPRVEPFLHAAMNDLGRRFFSWFGPVPRVMI  117

Query  160  RDPELIKEV-LNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPEL++E+ LNK   F++   SPLGR +  GL+SY   +WAKHRR++NPAF+
Sbjct  118  MDPELVREILLNKFGHFERTTLSPLGRAVATGLLSYNGGKWAKHRRILNPAFH  170



>gb|AJD25167.1| cytochrome P450 CYP72A326 [Salvia miltiorrhiza]
Length=518

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = -3

Query  331  LSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFLRDP  152
            +SGD KE  K   +A SKP+ L D++ PR+ P+ ++   K+G  C+ W GP P+V + + 
Sbjct  52   VSGDMKEMVKAMQEANSKPINLDDDIKPRLQPFLLNTIRKHGNECFMWKGPTPVVVITET  111

Query  151  ELIKEVLNKSDLFQKPKN-SPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            ELIK+VLNK  +F+KP+  +PL R   +G+ S+EK++W+KHR++INPAF+
Sbjct  112  ELIKQVLNKHSVFEKPRVLNPLVRMFSQGIFSHEKDKWSKHRKIINPAFH  161



>ref|XP_002458199.1| hypothetical protein SORBIDRAFT_03g028600 [Sorghum bicolor]
 gb|EES03319.1| hypothetical protein SORBIDRAFT_03g028600 [Sorghum bicolor]
Length=538

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 81/114 (71%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMAL-SDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR+L+GD +E A++  +A +KP+AL S ++ PRV P   ++  +YG N + W GP+P V 
Sbjct  71   YRLLTGDVRENARLNREARTKPLALGSHDIIPRVLPMLHNVVKEYGTNSFTWFGPVPRVI  130

Query  163  LRDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + DPEL++EVL NK   F KP+ S LG+ L  GL ++E E+WAKHRR++NPAF+
Sbjct  131  IPDPELVREVLSNKFGHFGKPRFSRLGKLLANGLANHEGEKWAKHRRILNPAFH  184



>emb|CDY32349.1| BnaC01g36680D [Brassica napus]
Length=508

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K+ + M ++A SKP+ L+D+V PRV PY  H+   +G   Y W GPIP + +
Sbjct  49   YTPLVGDLKKMSSMLTEARSKPIKLTDDVTPRVVPYPFHMLKTHGITYYTWFGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV N    F KP   PL R +  GL SY+ ++WAKHRR+INPAF+
Sbjct  109  MDPEQIKEVFNNVYDFPKPHTFPLVRFIATGLASYDGDKWAKHRRIINPAFH  160



>ref|NP_188084.1| cytochrome P450, family 72, subfamily A, polypeptide 13 [Arabidopsis 
thaliana]
 sp|Q9LUC8.1|C7A13_ARATH RecName: Full=Cytochrome P450 72A13 [Arabidopsis thaliana]
 dbj|BAB02398.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAL57694.1| AT3g14660/MIE1_16 [Arabidopsis thaliana]
 gb|AAO22574.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE75552.1| cytochrome P450, family 72, subfamily A, polypeptide 13 [Arabidopsis 
thaliana]
Length=512

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K    M ++A SKP+ L+D++ PR+ PY + +   +G+  + W GPIP + +
Sbjct  49   YTPLVGDLKRNFSMLAEARSKPINLTDDITPRIVPYPLQMLKTHGRTFFTWFGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV NK   FQK    PLGR +  GLVSY+ ++W KHRR+INPAF+
Sbjct  109  MDPEQIKEVFNKVYDFQKAHTFPLGRLIAAGLVSYDGDKWTKHRRIINPAFH  160



>emb|CDP15983.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KE + +  +A SK + LSD++ PRV P ++    KYGK  Y W+GP P + +
Sbjct  52   YKLLHGDIKEMSTLHKEAQSKNLNLSDDIVPRVIPQYLGAVKKYGKKTYLWLGPKPAMVI  111

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +KE+  K  +FQKP  +PL R L  G+V YE ++W +HR+L+NPAF+
Sbjct  112  MDPEQVKEITQKVYVFQKPHGNPLRRMLTPGIVMYEGDKWTQHRKLLNPAFH  163



>ref|XP_007224159.1| hypothetical protein PRUPE_ppa016446mg [Prunus persica]
 gb|EMJ25358.1| hypothetical protein PRUPE_ppa016446mg [Prunus persica]
Length=519

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSD--NVAPRVNPYFVHLAGKYGKNCYAWMGPIPMV  167
            YR+L GDTK+ + M   A SKPM LS   ++APRV P+   +   YG+N + WMGP+P +
Sbjct  48   YRLLFGDTKDSSMMLRQAQSKPMKLSTSHDIAPRVMPFVHQIVKTYGRNSFVWMGPMPKL  107

Query  166  FLRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             + +PE +KE+ NK   FQ+P  +PL + LV+GL+  E E+WAKHR++I PAF+
Sbjct  108  NIMNPEDLKEIFNKRQNFQRPSANPLIKLLVQGLLHIEDEKWAKHRKIIKPAFH  161



>ref|XP_010927481.1| PREDICTED: cytochrome P450 CYP72A219-like [Elaeis guineensis]
Length=535

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD K+ A+ + +A SKPM LS  + PRV P+   +   +GK  + W GP P V L
Sbjct  54   YRVLKGDLKDMARFSKEAQSKPMPLSHCIVPRVLPFIRQVINDHGKISFMWFGPYPRVIL  113

Query  160  RDPELIKEVLN-KSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             D EL+K +L+ K   F+KPK +PLGR LV G++ +E E+WA+HRR+INPAF+
Sbjct  114  NDAELVKGLLSGKFGHFEKPKVTPLGRLLVTGVLIHEGEKWARHRRIINPAFH  166



>emb|CDP15978.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KE + +  +A+SKP+ L+D+  PRV P+F     KYGK+ Y W G    V +
Sbjct  51   YKLLYGDFKEISTLFKEALSKPINLTDDFVPRVIPHFYAATKKYGKHTYLWQGTELTVVI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE I+EV  K  +FQ+P ++PL + LV+GL SY  ++W KHR+LINPAF+
Sbjct  111  MDPEHIREVTQKVYIFQRPHSNPLLKLLVQGLASYNGDKWTKHRKLINPAFH  162



>ref|XP_006442293.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
 gb|ESR55533.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
Length=167

 Score =   110 bits (276),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE      +A ++P++L D++A RVNP+   L   YGKN + W GP P V +
Sbjct  49   YRLLFGDLKENFIELKEAKARPLSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             +P+ IK +  + + FQK  + PL R L+ GL + E E+WAKHR+LINPAF+ 
Sbjct  109  MNPDQIKAIFTRINDFQKVNSIPLARLLIVGLATLEGEKWAKHRKLINPAFHQ  161



>ref|XP_004146005.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=530

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE A M   AISKPM  S+ +APRV P   H    YGKN + W+GP+P V +
Sbjct  56   YRILHGDLKESAAMRDQAISKPMNFSNYIAPRVIPSVHHTIQHYGKNSFMWIGPMPRVHI  115

Query  160  RDPELIKEVLNKSDLFQKPKNS--PLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K V +  + +QKP  S  PL + L  GL+++E ++W KHR++INPAF+
Sbjct  116  MDPEQLKTVFSLINDYQKPTASLNPLAKLLADGLLNHEGQKWVKHRKIINPAFH  169



>ref|XP_010926866.1| PREDICTED: cytochrome P450 72A15-like [Elaeis guineensis]
Length=522

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD ++  +++ +A SKPM L+  + PRV P+   L   +GK  + W G  P V L
Sbjct  53   YRFLYGDVEDVDRVSKEARSKPMPLTHCIVPRVLPFHHQLINDHGKISFMWFGSYPRVIL  112

Query  160  RDPELIKEVLN-KSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPEL++EVL+ K   F+KPK +PL R LV G++SYE E+WAKHRR+INPAF+
Sbjct  113  NDPELVREVLSGKFGHFEKPKVNPLARLLVTGVLSYEGEKWAKHRRIINPAFH  165



>ref|XP_008804072.1| PREDICTED: cytochrome P450 72A15-like [Phoenix dactylifera]
Length=523

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD +++ ++  +A S PMA S  + PRV P+      K GK  + W GP P V +
Sbjct  53   YRFLYGDLRDYDRLNKEARSMPMAFSHQIIPRVLPHLHQAIKKNGKTSFTWFGPDPRVAI  112

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP L +E+L NK   F+KP ++PLGR L  GL SYE+E+WAKHRR+INPAF+
Sbjct  113  MDPGLTREILSNKFGHFEKPNSNPLGRLLAGGLASYEREKWAKHRRIINPAFH  165



>ref|XP_010502013.1| PREDICTED: cytochrome P450 72A13 isoform X1 [Camelina sativa]
Length=519

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 77/118 (65%), Gaps = 6/118 (5%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHL------AGKYGKNCYAWMGP  179
            Y  L GD K  + M + A SKP+ L+D++ PRV P+ +H+        + G+  + W GP
Sbjct  49   YTPLVGDLKRNSSMLAVARSKPIKLTDDITPRVVPFPLHMLKTHVAVAETGRTFFTWFGP  108

Query  178  IPMVFLRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            +P++ + DPELIKEV NK   FQK    PLGR +  GLVSY+ ++WAKHRR+INPAF+
Sbjct  109  VPVITIMDPELIKEVFNKVYDFQKAHTFPLGRIIAAGLVSYDGDKWAKHRRIINPAFH  166



>emb|CDP15972.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  + GD KE   M  +A SKP+ LSD+  PRV P       KYG N + W+GP P V +
Sbjct  47   YTPVYGDFKEMVSMIEEAYSKPINLSDDHVPRVIPMVTKTIKKYGGNSFIWLGPYPAVII  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             D E I+E++ K +LFQKP   PLG+ L++GLV+ E + WAKHR++INPAF+
Sbjct  107  LDSESIREIMVKYNLFQKPHFHPLGKYLIQGLVASEGKIWAKHRKIINPAFH  158



>ref|XP_010644780.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Vitis vinifera]
Length=518

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE + M  +A S+P+++SD++  RV P+  H   KYGK+ + WMGP P V +
Sbjct  50   YRLLYGDFKEMSMMIKEATSRPISISDDIVQRVAPFHYHSIKKYGKSSFIWMGPKPRVNI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             +PELI++VL+   +F+KP+   L + LV GL+  + E+WAKHR++INPAF
Sbjct  110  MEPELIRDVLSMHTVFRKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAF  160



>emb|CDP15977.1| unnamed protein product [Coffea canephora]
Length=181

 Score =   111 bits (277),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = -3

Query  337  RILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFLR  158
            ++L  D KE + +  +A SKP+ LS++  PRV P+F     KYGKN   W+GP PMV + 
Sbjct  52   KLLYEDFKETSTLFEEAHSKPVNLSEDFVPRVIPHFCKAVKKYGKNTCVWLGPHPMVVIM  111

Query  157  DPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            +PE  +E+  K  +FQKP  +PL + L +GLVSY+ ++WAKHR+LI PAF+
Sbjct  112  NPEHTREITTKLYIFQKPHANPLIKLLAQGLVSYDGDKWAKHRKLIAPAFH  162



>ref|XP_010926829.1| PREDICTED: cytochrome P450 72A11-like [Elaeis guineensis]
Length=516

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD K+  +++ +A SKPM L+  + PRV P+   L   +GK  + W+G  P V L
Sbjct  47   YRFLHGDFKDLDRLSKEARSKPMPLTHRIVPRVLPFHHQLINDHGKISFMWVGSDPRVIL  106

Query  160  RDPELIKEVLN-KSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPEL++EVL+ K   F+K + +PLGR L+ G+V+YE E+WAKHRR+INPAF+
Sbjct  107  YDPELVREVLSRKFGHFEKQETNPLGRLLLTGVVTYEGEKWAKHRRIINPAFH  159



>ref|XP_007022097.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
 gb|EOY13622.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
Length=518

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR LSGD KE   M+  A SKPM LSD++   V P+        GK+ ++W+GPIP V +
Sbjct  50   YRFLSGDIKESFAMSRQARSKPMPLSDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE I+E+  K + FQKP ++PL   LV GLV+ + E+WAKHR++INPAF+
Sbjct  110  MEPEEIREIFTKFNDFQKPHSNPLVSLLVSGLVNLDGEEWAKHRKIINPAFH  161



>ref|XP_003605472.1| Cytochrome P450 monooxygenase CYP72A61 [Medicago truncatula]
 gb|AES87669.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=393

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMA-LSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR++ GD ++  KM  +A SKPM   S+++APRV P+ VH   KYGK+ + W+GP P VF
Sbjct  60   YRLMVGDIRDMVKMIKEAKSKPMDPYSNDIAPRVLPFVVHTIAKYGKSSFMWLGPRPRVF  119

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
            + +P+ IKE+  K   FQKP  SPL + L  G  +Y+ ++WAKHR++++PAF
Sbjct  120  IMEPDKIKEMTTKVYDFQKPDTSPLFKLLASGFANYDGDKWAKHRKIVSPAF  171



>emb|CDY65330.1| BnaC03g73760D [Brassica napus]
Length=344

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y    GD K  + MT DA SKP+ L+D+++PRV P+   +   +G   + W+G  P + +
Sbjct  49   YTPFVGDLKRNSSMTMDARSKPIKLTDDISPRVVPFPFEMLKTHGMTFFTWLGTTPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE IKEV NK   FQKP  +PL   + +GL SY+ E+WAKHRR+INPAF+
Sbjct  109  MDPEQIKEVFNKVYDFQKPHTAPLDNVIAKGLTSYDGEKWAKHRRIINPAFH  160



>ref|XP_010927457.1| PREDICTED: cytochrome P450 72A15-like [Elaeis guineensis]
Length=522

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR   GD K++ ++  +A SKPM+ S  + PRV PY      K GK  + W GP P V +
Sbjct  53   YRFPHGDVKDYDRLDQEARSKPMSFSHQIIPRVLPYLHQTIKKNGKTSFTWFGPEPRVIM  112

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP L +E+L NK   F+KP  +PLGR LV GL  YE E+WAKHRR+INPAF+
Sbjct  113  MDPGLTREILSNKFGHFEKPNLNPLGRLLVTGLAIYEGEKWAKHRRIINPAFH  165



>ref|XP_006364091.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=510

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD  E  KM  +A SKP+  S ++ PR+ P+       YGKN + W+GP P + +
Sbjct  47   YRLLVGDMNEVVKMDEEAKSKPIKFSHDIVPRLMPFIHKTIIDYGKNSFIWLGPNPAMLI  106

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE I+E+L+KS++FQKP  + L + L  G++SYE ++WAKHRR+INPAF+
Sbjct  107  MEPEHIREILSKSNIFQKPPPA-LTKLLAEGILSYEADKWAKHRRIINPAFH  157



>ref|XP_004169020.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=530

 Score =   115 bits (288),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YRIL GD KE A M   AISKPM  S+ +APRV P   H    YGKN + W+GP+P V +
Sbjct  56   YRILHGDLKERAAMRDQAISKPMNFSNYIAPRVIPSVHHTIQHYGKNSFMWIGPMPRVHI  115

Query  160  RDPELIKEVLNKSDLFQKPKNS--PLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +K V +  + +QKP  S  PL + L  GL+++E ++W KHR++INPAF+
Sbjct  116  MDPEQLKTVFSLINDYQKPTASLNPLAKLLADGLLNHEGQKWVKHRKIINPAFH  169



>ref|XP_007022098.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
 gb|EOY13623.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
Length=518

 Score =   115 bits (288),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR LSGD KE   M+  A SKPM LSD++   V P+        GK+ ++W+GPIP V +
Sbjct  50   YRFLSGDIKESFAMSRQARSKPMPLSDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE I+E+  K + FQKP ++PL   LV GLV+ + E+WAKHR++INPAF+
Sbjct  110  MEPEEIREIFTKFNDFQKPHSNPLVSLLVSGLVNLDGEEWAKHRKIINPAFH  161



>ref|XP_009394217.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=538

 Score =   115 bits (289),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR   GD KE A+ + +A +KPM LS N+ PR+ P+      +YGK  + W+GP+P V +
Sbjct  70   YRFPYGDLKENARFSKEARAKPMPLSHNIIPRLLPFLNRAMDEYGKISFTWLGPVPQVTI  129

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFYS  2
             DPEL++EVL NK   F KP  +PL R   RGL  YE E+W KHRR++NPAF++
Sbjct  130  TDPELVREVLSNKFGHFGKPNQNPLVRFFARGLFVYEGEKWVKHRRILNPAFHA  183



>gb|KFK38821.1| hypothetical protein AALP_AA3G164800 [Arabis alpina]
Length=512

 Score =   115 bits (288),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y  L GD K+   M ++A SKP+ L+D++  RV PY +H+   +G+  ++W GPIP + +
Sbjct  49   YTPLVGDLKKNFAMLAEARSKPLKLTDDITTRVVPYPLHMLKTHGRTFFSWFGPIPTITI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKEV NK   F K    PLGR +  GL +Y+ ++WAKHRR+INPAF+
Sbjct  109  MDPELIKEVFNKVYDFPKTHTFPLGRLIATGLANYDGDKWAKHRRIINPAFH  160



>ref|XP_009394814.1| PREDICTED: cytochrome P450 72A13-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=526

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD KE  ++  +A+SKPM LS ++ PRV P+        G   ++W+GP+P V +
Sbjct  54   YRFLRGDLKEDKRLLEEALSKPMPLSHHIVPRVEPFLHAAMNDLGSRFFSWIGPVPRVMI  113

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPEL++E+L NK   F +   SPLGR L  GL+SY + +WAKHRR++NPAF+
Sbjct  114  MDPELVREILSNKFGHFDRASLSPLGRALGTGLLSYNRGKWAKHRRILNPAFH  166



>ref|XP_010694548.1| PREDICTED: cytochrome P450 CYP72A219-like [Beta vulgaris subsp. 
vulgaris]
Length=518

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPM-ALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR+L GDTK+ A+M  +A +KPM  LS++   RV P+F     KYG  C  W GPIP+V+
Sbjct  49   YRLLHGDTKDRARMMLEARTKPMPCLSNDYLARVLPFFSETIAKYGTRCLVWNGPIPLVY  108

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
            + +P +I+EVL K + FQKPK +P+ +K+  GL+  E + WA  R+L+NPAF+
Sbjct  109  ISEPAMIREVLMKINQFQKPKTNPILKKVASGLILLEGQVWANRRKLLNPAFH  161



>emb|CDP15976.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++L GD KE A    +A SKP+ +S++  PRV P+F     KYG+N Y W GP PMV +
Sbjct  51   YKLLYGDFKEIATHFKEAHSKPINVSEDFIPRVIPHFCAAVKKYGENTYIWHGPKPMVLI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +PE I+E+  K  +FQK   +PL + L  GLVSY+ ++WAKHR+LI PAF+
Sbjct  111  LNPEHIREITTKLYIFQKAPANPLTKLLATGLVSYDGDKWAKHRKLITPAFH  162



>ref|XP_010275244.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=518

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L G+ +E  ++  +A++KP++LS N+ PRV P+       YG+   +W G  P V++
Sbjct  49   YRLLFGNLREEMRLEKEAMAKPISLSHNIVPRVIPFVHQTIQNYGRMSISWFGRTPRVYI  108

Query  160  RDPELIKEVL-NKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPELIKE+L  K   F++PK +PL +  +RGL+SYE E+WAKHRRLIN AF+
Sbjct  109  TDPELIKEILFTKFGHFERPKPNPLTKSFLRGLLSYEGEKWAKHRRLINGAFH  161



>ref|XP_006442299.1| hypothetical protein CICLE_v100199322mg, partial [Citrus clementina]
 gb|ESR55539.1| hypothetical protein CICLE_v100199322mg, partial [Citrus clementina]
Length=210

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++  GD KE A+ T +A S+P++LSD++A R+ P+  H+   +GKN + WMGP P + +
Sbjct  27   YKVFYGDMKELAQTTKEAKSRPISLSDDIARRILPFHYHIITNFGKNSFIWMGPRPNLNI  86

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP++I+E+  K D+F+K + SPL + L+ G+V Y+ EQW K R++  PAF+
Sbjct  87   TDPKMIREIFLKHDIFKKLR-SPLAKLLITGMVGYDGEQWFKVRKIATPAFH  137



>gb|KHN14193.1| Secologanin synthase [Glycine soja]
Length=518

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 71/111 (64%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE   M  +  SKPM LS ++ PRV  +  H    +GKN + W G  P V +
Sbjct  48   YRLLVGDLKEIMNMQKEVTSKPMNLSHDIVPRVFSFLQHTLNTHGKNSFIWFGRKPRVII  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             +PELIK+VLNK   F KP  SPL + L  GL+++E E+W KHRR+I+PAF
Sbjct  108  TEPELIKDVLNKMHDFPKPDTSPLVKLLATGLLNHEGEKWNKHRRIISPAF  158



>emb|CDP19601.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GDT++  +M  +A SKP++L+D++ PR+ P         GKN + W+GP P + +
Sbjct  48   YRFLFGDTRDMGRMLEEAKSKPISLTDDIFPRIMPLINETMQHKGKNSFFWLGPRPAMVI  107

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DPE +KEV  K+  +QKP+ +P+ + L  GL S + E+WAKHRRL+NPAF+
Sbjct  108  LDPEQVKEVFTKNFTYQKPRANPISKLLALGLASLDTEKWAKHRRLLNPAFH  159



>emb|CAN72865.1| hypothetical protein VITISV_029731 [Vitis vinifera]
Length=502

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE   M  +A S+P+++SD++  R+ P+  H   KYGK+ + WMGP P V +
Sbjct  50   YRLLHGDFKEMFMMIKEATSRPISISDDIVQRIAPFHYHSIKKYGKSSFIWMGPKPRVNI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             +PELI++VL+   +F+KP+   L + LV GL+  + E+WAKHR++INPAF
Sbjct  110  MEPELIRDVLSMHTVFRKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAF  160



>ref|XP_006495010.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=519

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y++  GD KE A+ T +A S+P++LSD++A R+ P+  H+   +GKN + WMGP P + +
Sbjct  55   YKVFHGDMKELAQTTKEAKSRPISLSDDIARRILPFHHHIITNFGKNSFIWMGPRPNIHI  114

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             DP++I+E+  K D+FQKP+ SPL + LV G+  Y  EQW K R++  PAF+
Sbjct  115  TDPKMIREIFLKYDIFQKPR-SPLVKLLVTGMADYAGEQWFKVRKIATPAFH  165



>ref|XP_003605471.1| Cytochrome P450 monooxygenase CYP72A61 [Medicago truncatula]
 gb|AES87668.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=506

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMA-LSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR++ GD ++  KM  +A SKPM   S+++APRV P+ VH   KYGK+ + W+GP P VF
Sbjct  60   YRLMVGDIRDMVKMIKEAKSKPMDPYSNDIAPRVLPFVVHTIAKYGKSSFMWLGPRPRVF  119

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
            + +P+ IKE+  K   FQKP  SPL + L  G  +Y+ ++WAKHR++++PAF
Sbjct  120  IMEPDKIKEMTTKVYDFQKPDTSPLFKLLASGFANYDGDKWAKHRKIVSPAF  171



>ref|XP_009339373.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=511

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD  + +KMT  A+SKPM  S ++ P V P    +  KYG+  + W+GPIP V L
Sbjct  42   YRLLIGDLNDNSKMTKAALSKPMEFSHDIVPYVLPLLHDIFNKYGRKSFIWLGPIPSVIL  101

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             D EL++E   K  +++KP ++PL   LV GLV +E ++W KHRR+INPAF+
Sbjct  102  FDAELMREAFTKYRVYEKPHSNPLISLLVTGLVGHEGDKWVKHRRIINPAFH  153



>ref|XP_006477949.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=517

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE + M   A ++P++L D+ A RVNP+   L   YGKN + W GP P V +
Sbjct  49   YRLLFGDLKESSIMLKKAKARPLSLDDDAAVRVNPFLPKLFKDYGKNSFMWFGPTPRVNI  108

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             +P+ IKE+  K + F K  ++PL R L  GLV+YE EQWAKHR++INPAF
Sbjct  109  TNPDQIKEIFTKINDFPKINSNPLARILGVGLVNYEGEQWAKHRKIINPAF  159



>ref|XP_008226211.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GDTKE + M  +A SKPM LS ++ PRV P+       YGKN + W+GP P V +
Sbjct  51   YRLLVGDTKESSMMVKEAKSKPMNLSHDITPRVLPFLHQSVTTYGKNFFIWIGPTPRVNI  110

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +P  +K+V    + FQKP  +PL + L  GL +YE E+WAKHR++INPAF+
Sbjct  111  SNPADVKDVFTNYEDFQKPVINPLVKLLATGLPNYEGEKWAKHRKIINPAFH  162



>gb|AGX93046.1| secologanin synthase-like protein [Amsonia hubrichtii]
Length=524

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR L GD KE  KM  +A+SKPMA ++++ PR+ P+  H    YG+N + WMG IP + +
Sbjct  52   YRFLVGDVKENGKMLQEAMSKPMAFNNDIVPRIMPHIHHTIQTYGRNSFTWMGRIPRIHV  111

Query  160  RDPELIKEVLNKSDLFQK--PKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             +PELIKEVL  S  +QK    ++PL + L+ G+ S+E  +W+KHRR+I+PAF
Sbjct  112  MEPELIKEVLTHSSKYQKNFDVHNPLVKFLLTGVGSFEGAKWSKHRRIISPAF  164



>ref|XP_003605470.1| Cytochrome P450 monooxygenase CYP72A61 [Medicago truncatula]
 gb|ABC59088.1| cytochrome P450 monooxygenase CYP72A61 [Medicago truncatula]
 gb|AES87667.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=528

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMA-LSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVF  164
            YR++ GD ++  KM  +A SKPM   S+++APRV P+ VH   KYGK+ + W+GP P VF
Sbjct  60   YRLMVGDIRDMVKMIKEAKSKPMDPYSNDIAPRVLPFVVHTIAKYGKSSFMWLGPRPRVF  119

Query  163  LRDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
            + +P+ IKE+  K   FQKP  SPL + L  G  +Y+ ++WAKHR++++PAF
Sbjct  120  IMEPDKIKEMTTKVYDFQKPDTSPLFKLLASGFANYDGDKWAKHRKIVSPAF  171



>gb|AFO64616.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=515

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            Y+ + GD KE  +M+++A SKPM+L+ ++A RV P++ +    +GK C+ W+G  P+V L
Sbjct  48   YKFMFGDLKELVQMSNEAKSKPMSLNHDIANRVLPFYYNALSTHGKTCFTWLGIKPVVHL  107

Query  160  RDPELIKEVLNKSDLFQKPK-NSPLGRKLVRGLVSYEKEQWAKHRRLINPAFY  5
             +P +I+EVLN  + +QKP+  +PL + L RG+   E +QW KHR++INPAF+
Sbjct  108  SEPTMIREVLNNYNQYQKPRAGNPLTKLLARGVADAEADQWVKHRKIINPAFH  160



>ref|XP_003634773.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
 emb|CBI22132.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = -3

Query  340  YRILSGDTKEFAKMTSDAISKPMALSDNVAPRVNPYFVHLAGKYGKNCYAWMGPIPMVFL  161
            YR+L GD KE   M  +A S+P+++SD++  R+ P+  H   KYGK+ + WMGP P V +
Sbjct  50   YRLLHGDFKEMFMMIKEATSRPISISDDIVQRIAPFHYHSIKKYGKSSFIWMGPKPRVNI  109

Query  160  RDPELIKEVLNKSDLFQKPKNSPLGRKLVRGLVSYEKEQWAKHRRLINPAF  8
             +PELI++VL+   +F+KP+   L + LV GL+  + E+WAKHR++INPAF
Sbjct  110  MEPELIRDVLSMHTVFRKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAF  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511879084288