BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22729_g1_i2 len=2388 path=[3150:0-796 3947:797-2221 5372:2222-2328
78:2329-2387]

Length=2388
                                                                      Score     E

ref|XP_010319234.1|  PREDICTED: LRR receptor-like serine/threonin...    482   3e-150   
ref|XP_010319235.1|  PREDICTED: LRR receptor-like serine/threonin...    479   6e-150   
ref|XP_006367556.1|  PREDICTED: probable leucine-rich repeat rece...    467   3e-145   
ref|XP_009786715.1|  PREDICTED: LRR receptor-like serine/threonin...    459   3e-142   
ref|XP_010324743.1|  PREDICTED: LRR receptor-like serine/threonin...    449   1e-140   
ref|XP_010324742.1|  PREDICTED: LRR receptor-like serine/threonin...    449   2e-140   
ref|XP_010324747.1|  PREDICTED: LRR receptor-like serine/threonin...    447   2e-139   
ref|XP_010324745.1|  PREDICTED: LRR receptor-like serine/threonin...    447   6e-138   
ref|XP_007010921.1|  Receptor like protein 15, putative                 444   1e-136   
ref|XP_009602464.1|  PREDICTED: LRR receptor-like serine/threonin...    432   2e-134   
ref|XP_007010925.1|  Receptor like protein 15, putative                 417   2e-125   
ref|XP_010244881.1|  PREDICTED: probable LRR receptor-like serine...    410   2e-124   
ref|XP_011038937.1|  PREDICTED: LRR receptor-like serine/threonin...    405   3e-122   
ref|XP_010244923.1|  PREDICTED: LRR receptor-like serine/threonin...    401   2e-120   
ref|XP_004250531.1|  PREDICTED: probable LRR receptor-like serine...    399   3e-120   
ref|XP_006382389.1|  hypothetical protein POPTR_0005s01680g             398   4e-120   
ref|XP_009615136.1|  PREDICTED: probable LRR receptor-like serine...    396   3e-119   
ref|XP_011038933.1|  PREDICTED: probable leucine-rich repeat rece...    388   2e-117   
ref|XP_009771122.1|  PREDICTED: probable leucine-rich repeat rece...    391   2e-117   
ref|XP_011038932.1|  PREDICTED: LRR receptor-like serine/threonin...    388   4e-116   
ref|XP_010324748.1|  PREDICTED: LRR receptor-like serine/threonin...    377   6e-115   
ref|XP_009631141.1|  PREDICTED: leucine-rich repeat receptor-like...    368   3e-114   
ref|XP_010648821.1|  PREDICTED: receptor-like protein 12                382   6e-114   
ref|XP_006489885.1|  PREDICTED: LRR receptor-like serine/threonin...    383   2e-113   
ref|XP_006389342.1|  hypothetical protein POPTR_0027s00200g             377   2e-113   
ref|XP_010648726.1|  PREDICTED: receptor-like protein 12                380   2e-113   
ref|XP_006382343.1|  hypothetical protein POPTR_0005s01230g             376   5e-113   
ref|XP_006489888.1|  PREDICTED: LRR receptor-like serine/threonin...    380   1e-112   
ref|XP_009615115.1|  PREDICTED: leucine-rich repeat receptor-like...    372   2e-112   
ref|XP_006489887.1|  PREDICTED: LRR receptor-like serine/threonin...    380   2e-112   
ref|XP_006382369.1|  hypothetical protein POPTR_0005s01500g             373   9e-112   
ref|XP_006489890.1|  PREDICTED: LRR receptor-like serine/threonin...    378   1e-111   
ref|XP_006389352.1|  hypothetical protein POPTR_0027s003001g            371   2e-111   
ref|XP_006389367.1|  hypothetical protein POPTR_0027s00410g             375   2e-111   
ref|XP_007011796.1|  Receptor like protein 1, putative                  375   3e-111   
ref|XP_006489882.1|  PREDICTED: LRR receptor-like serine/threonin...    377   4e-111   
ref|XP_011009774.1|  PREDICTED: LRR receptor-like serine/threonin...    369   4e-111   
gb|KDO40877.1|  hypothetical protein CISIN_1g001036mg                   372   8e-111   
ref|XP_006489891.1|  PREDICTED: LRR receptor-like serine/threonin...    372   1e-110   
ref|XP_011015511.1|  PREDICTED: probable leucine-rich repeat rece...    368   1e-110   
ref|XP_006489884.1|  PREDICTED: LRR receptor-like serine/threonin...    375   2e-110   
ref|XP_006489889.1|  PREDICTED: LRR receptor-like serine/threonin...    374   2e-110   
ref|XP_006489883.1|  PREDICTED: LRR receptor-like serine/threonin...    375   4e-110   
ref|XP_010244882.1|  PREDICTED: probable LRR receptor-like serine...    369   4e-110   
gb|KDO40876.1|  hypothetical protein CISIN_1g001036mg                   372   4e-110   
gb|KDO40875.1|  hypothetical protein CISIN_1g001036mg                   372   5e-110   
ref|XP_006489886.1|  PREDICTED: LRR receptor-like serine/threonin...    372   2e-109   
ref|XP_010250309.1|  PREDICTED: leucine-rich repeat receptor prot...    374   2e-109   
ref|XP_011015513.1|  PREDICTED: probable leucine-rich repeat rece...    364   3e-109   
gb|KDO40874.1|  hypothetical protein CISIN_1g001036mg                   372   3e-109   
ref|XP_006382336.1|  hypothetical protein POPTR_0005s01150g             370   2e-108   
ref|XP_010250260.1|  PREDICTED: LRR receptor-like serine/threonin...    366   7e-108   
gb|KDO40879.1|  hypothetical protein CISIN_1g001036mg                   362   7e-108   
ref|XP_010250259.1|  PREDICTED: LRR receptor-like serine/threonin...    366   8e-108   
ref|XP_006495105.1|  PREDICTED: LRR receptor-like serine/threonin...    365   1e-107   
ref|XP_006471615.1|  PREDICTED: leucine-rich repeat receptor-like...    369   3e-107   
gb|KDO38692.1|  hypothetical protein CISIN_1g039739mg                   352   9e-107   
ref|XP_006471618.1|  PREDICTED: leucine-rich repeat receptor-like...    363   9e-107   
ref|XP_010324746.1|  PREDICTED: LRR receptor-like serine/threonin...    362   1e-106   
ref|XP_006385240.1|  hypothetical protein POPTR_0003s02030g             362   1e-106   
ref|XP_006471617.1|  PREDICTED: leucine-rich repeat receptor-like...    362   4e-106   
ref|XP_006471613.1|  PREDICTED: leucine-rich repeat receptor-like...    365   5e-106   
ref|XP_006385264.1|  hypothetical protein POPTR_0003s02250g             359   5e-106   
ref|XP_010250305.1|  PREDICTED: receptor-like protein kinase            362   1e-105   
ref|XP_006471616.1|  PREDICTED: leucine-rich repeat receptor-like...    363   1e-105   
ref|XP_006471614.1|  PREDICTED: leucine-rich repeat receptor-like...    363   2e-105   
ref|XP_006471612.1|  PREDICTED: leucine-rich repeat receptor-like...    363   4e-105   
ref|XP_009615127.1|  PREDICTED: probable leucine-rich repeat rece...    359   8e-105   
ref|XP_010324744.1|  PREDICTED: probable LRR receptor-like serine...    352   9e-105   
ref|XP_010250307.1|  PREDICTED: LRR receptor-like serine/threonin...    358   1e-104   
ref|XP_006382320.1|  hypothetical protein POPTR_0005s01000g             353   2e-104   
ref|XP_006493420.1|  PREDICTED: LRR receptor-like serine/threonin...    357   2e-104   
ref|XP_010250257.1|  PREDICTED: LRR receptor-like serine/threonin...    356   4e-104   
ref|XP_009800701.1|  PREDICTED: LRR receptor-like serine/threonin...    353   6e-104   
ref|XP_010250306.1|  PREDICTED: receptor-like protein 12 isoform X1     357   2e-103   
ref|XP_006471620.1|  PREDICTED: LRR receptor-like serine/threonin...    353   2e-103   
ref|XP_006493419.1|  PREDICTED: LRR receptor-like serine/threonin...    354   2e-103   
gb|KDO41255.1|  hypothetical protein CISIN_1g0449241mg                  342   2e-102   
ref|XP_010324751.1|  PREDICTED: LRR receptor-like serine/threonin...    350   5e-102   
ref|XP_009586773.1|  PREDICTED: LRR receptor-like serine/threonin...    347   6e-102   
gb|KCW75502.1|  hypothetical protein EUGRSUZ_E04263                     349   1e-101   
gb|KHN28790.1|  LRR receptor-like serine/threonine-protein kinase...    348   3e-101   
ref|XP_006382351.1|  hypothetical protein POPTR_0005s01310g             343   6e-101   
gb|KDO40862.1|  hypothetical protein CISIN_1g001653mg                   346   1e-100   
ref|XP_010655050.1|  PREDICTED: leucine-rich repeat receptor prot...    346   1e-100   
ref|XP_010655049.1|  PREDICTED: leucine-rich repeat receptor prot...    347   2e-100   
ref|XP_006487933.1|  PREDICTED: LRR receptor-like serine/threonin...    346   2e-100   
ref|XP_007013630.1|  Receptor like protein 1, putative isoform 2        345   3e-100   
ref|XP_006489919.1|  PREDICTED: LRR receptor-like serine/threonin...    350   4e-100   
ref|XP_007013629.1|  Receptor like protein 1, putative isoform 1        340   8e-100   
ref|XP_006477903.1|  PREDICTED: LRR receptor-like serine/threonin...    341   1e-99    
gb|KDO38137.1|  hypothetical protein CISIN_1g0077622mg                  331   2e-99    
ref|XP_010059729.1|  PREDICTED: leucine-rich repeat receptor-like...    342   4e-99    
ref|XP_006494118.1|  PREDICTED: LRR receptor-like serine/threonin...    333   8e-99    
ref|XP_004514486.1|  PREDICTED: LRR receptor-like serine/threonin...    343   1e-98    
gb|KHN37937.1|  LRR receptor-like serine/threonine-protein kinase...    342   2e-98    
ref|XP_002531443.1|  serine-threonine protein kinase, plant-type,...    338   2e-98    Ricinus communis
ref|XP_011010638.1|  PREDICTED: LRR receptor-like serine/threonin...    345   2e-98    
ref|XP_006601721.1|  PREDICTED: disease resistance protein isofor...    342   3e-98    
gb|KDO44366.1|  hypothetical protein CISIN_1g042603mg                   336   3e-98    
ref|XP_006601724.1|  PREDICTED: disease resistance protein isofor...    342   4e-98    
ref|XP_006382382.1|  hypothetical protein POPTR_0005s01610g             338   4e-98    
ref|XP_006601723.1|  PREDICTED: disease resistance protein isofor...    341   5e-98    
gb|KHN08312.1|  LRR receptor-like serine/threonine-protein kinase...    341   1e-97    
ref|XP_002269212.3|  PREDICTED: probable leucine-rich repeat rece...    338   1e-97    Vitis vinifera
gb|KDO37806.1|  hypothetical protein CISIN_1g003888mg                   332   1e-97    
ref|XP_006601722.1|  PREDICTED: disease resistance protein isofor...    340   2e-97    
ref|XP_006389033.1|  hypothetical protein POPTR_0056s00220g             336   2e-97    
ref|XP_007140409.1|  hypothetical protein PHAVU_008G109300g             334   3e-97    
ref|XP_006602960.1|  PREDICTED: LRR receptor-like serine/threonin...    339   3e-97    
ref|XP_006602959.1|  PREDICTED: LRR receptor-like serine/threonin...    339   4e-97    
gb|KDO38653.1|  hypothetical protein CISIN_1g004005mg                   329   1e-96    
ref|XP_006366099.1|  PREDICTED: leucine-rich repeat receptor-like...    327   3e-96    
gb|KDO38654.1|  hypothetical protein CISIN_1g004005mg                   327   4e-96    
ref|XP_006489902.1|  PREDICTED: leucine-rich repeat receptor prot...    337   6e-96    
ref|XP_011009769.1|  PREDICTED: probable leucine-rich repeat rece...    328   4e-94    
ref|XP_006583617.1|  PREDICTED: brassinosteroid LRR receptor kina...    328   4e-94    
ref|XP_006389359.1|  hypothetical protein POPTR_0027s00350g             327   5e-94    
ref|XP_010655051.1|  PREDICTED: LRR receptor-like serine/threonin...    324   8e-94    
gb|KCW83038.1|  hypothetical protein EUGRSUZ_C04419                     323   8e-94    
gb|KHN28791.1|  LRR receptor-like serine/threonine-protein kinase...    326   3e-93    
ref|XP_006382330.1|  hypothetical protein POPTR_0005s01090g             319   7e-93    
gb|KDP36677.1|  hypothetical protein JCGZ_07895                         323   1e-92    
ref|XP_011009763.1|  PREDICTED: LRR receptor-like serine/threonin...    324   2e-92    
ref|XP_007140399.1|  hypothetical protein PHAVU_008G108400g             324   2e-92    
gb|KDO36983.1|  hypothetical protein CISIN_1g048657mg                   308   3e-92    
ref|XP_011084190.1|  PREDICTED: probable LRR receptor-like serine...    321   3e-92    
ref|XP_011009761.1|  PREDICTED: LRR receptor-like serine/threonin...    322   1e-91    
ref|XP_009793401.1|  PREDICTED: probable LRR receptor-like serine...    318   5e-91    
ref|XP_006583616.1|  PREDICTED: brassinosteroid LRR receptor kina...    321   5e-91    
gb|KDO48745.1|  hypothetical protein CISIN_1g046050mg                   314   5e-91    
gb|KCW83037.1|  hypothetical protein EUGRSUZ_C04416                     318   2e-90    
ref|XP_011009768.1|  PREDICTED: LRR receptor-like serine/threonin...    317   2e-90    
gb|KDO38165.1|  hypothetical protein CISIN_1g040297mg                   312   4e-90    
gb|KCW83029.1|  hypothetical protein EUGRSUZ_C04407                     315   7e-90    
ref|XP_010654830.1|  PREDICTED: LRR receptor-like serine/threonin...    319   1e-89    
ref|XP_010654831.1|  PREDICTED: LRR receptor-like serine/threonin...    318   1e-89    
gb|KCW75524.1|  hypothetical protein EUGRSUZ_E04289                     316   2e-89    
ref|XP_011009772.1|  PREDICTED: LRR receptor-like serine/threonin...    315   2e-89    
gb|KCW75504.1|  hypothetical protein EUGRSUZ_E04266                     311   4e-89    
ref|XP_011039078.1|  PREDICTED: probable LRR receptor-like serine...    313   9e-89    
ref|XP_006492060.1|  PREDICTED: LRR receptor-like serine/threonin...    313   1e-88    
gb|KEH23108.1|  LRR receptor-like kinase                                308   1e-88    
ref|XP_010654829.1|  PREDICTED: LRR receptor-like serine/threonin...    314   5e-88    
gb|KCW45079.1|  hypothetical protein EUGRSUZ_L01316                     311   7e-88    
ref|XP_011009773.1|  PREDICTED: LRR receptor-like serine/threonin...    309   8e-88    
gb|KDO40561.1|  hypothetical protein CISIN_1g037315mg                   303   1e-87    
ref|XP_011009766.1|  PREDICTED: LRR receptor-like serine/threonin...    310   2e-87    
ref|XP_011009765.1|  PREDICTED: LRR receptor-like serine/threonin...    309   2e-87    
ref|XP_006389344.1|  hypothetical protein POPTR_0027s00220g             303   2e-87    
ref|XP_011009767.1|  PREDICTED: LRR receptor-like serine/threonin...    309   2e-87    
ref|XP_010654827.1|  PREDICTED: LRR receptor-like serine/threonin...    312   3e-87    
ref|XP_011009771.1|  PREDICTED: LRR receptor-like serine/threonin...    308   3e-87    
gb|KDO42717.1|  hypothetical protein CISIN_1g043567mg                   306   6e-87    
ref|XP_010051687.1|  PREDICTED: probable LRR receptor-like serine...    308   6e-87    
ref|XP_010051783.1|  PREDICTED: probable LRR receptor-like serine...    307   1e-86    
ref|XP_011011153.1|  PREDICTED: probable leucine-rich repeat rece...    305   2e-86    
ref|XP_006492130.1|  PREDICTED: LRR receptor-like serine/threonin...    305   4e-86    
ref|XP_010654828.1|  PREDICTED: LRR receptor-like serine/threonin...    308   4e-86    
gb|KDP46608.1|  hypothetical protein JCGZ_04542                         302   4e-86    
ref|XP_006490132.1|  PREDICTED: probable LRR receptor-like serine...    305   7e-86    
gb|KDO47438.1|  hypothetical protein CISIN_1g0470351mg                  296   9e-86    
ref|XP_007140412.1|  hypothetical protein PHAVU_008G109600g             299   1e-85    
ref|XP_010059722.1|  PREDICTED: LRR receptor-like serine/threonin...    301   2e-85    
ref|XP_010051676.1|  PREDICTED: probable LRR receptor-like serine...    298   2e-85    
ref|XP_011038950.1|  PREDICTED: LRR receptor-like serine/threonin...    303   3e-85    
gb|KDO42722.1|  hypothetical protein CISIN_1g043182mg                   300   4e-85    
ref|XP_011038947.1|  PREDICTED: LRR receptor-like serine/threonin...    304   4e-85    
ref|XP_006492127.1|  PREDICTED: LRR receptor-like serine/threonin...    304   4e-85    
ref|XP_006490131.1|  PREDICTED: probable LRR receptor-like serine...    303   4e-85    
ref|XP_011038949.1|  PREDICTED: LRR receptor-like serine/threonin...    303   4e-85    
ref|XP_011038946.1|  PREDICTED: LRR receptor-like serine/threonin...    303   5e-85    
ref|NP_001235512.1|  disease resistance protein                         298   5e-85    
ref|XP_006492122.1|  PREDICTED: putative leucine-rich repeat rece...    301   6e-85    
ref|XP_010655170.1|  PREDICTED: LRR receptor-like serine/threonin...    298   9e-85    
gb|KDO39671.1|  hypothetical protein CISIN_1g0013131mg                  297   2e-84    
ref|XP_006427432.1|  hypothetical protein CICLE_v10024777mg             300   2e-84    
gb|KDO39672.1|  hypothetical protein CISIN_1g0013131mg                  296   2e-84    
ref|XP_010662256.1|  PREDICTED: LRR receptor-like serine/threonin...    298   4e-84    
ref|XP_010059725.1|  PREDICTED: LRR receptor-like serine/threonin...    293   6e-84    
ref|XP_006490130.1|  PREDICTED: probable LRR receptor-like serine...    300   7e-84    
gb|KGN45250.1|  hypothetical protein Csa_7G432320                       298   2e-83    
ref|XP_010656507.1|  PREDICTED: probable LRR receptor-like serine...    297   2e-83    
ref|XP_011038948.1|  PREDICTED: LRR receptor-like serine/threonin...    298   3e-83    
gb|KCW83028.1|  hypothetical protein EUGRSUZ_C04405                     295   4e-83    
ref|XP_010691123.1|  PREDICTED: probable LRR receptor-like serine...    295   4e-83    
ref|XP_010059719.1|  PREDICTED: LRR receptor-like serine/threonin...    294   4e-83    
gb|KDP30191.1|  hypothetical protein JCGZ_16973                         295   7e-83    
ref|XP_011009764.1|  PREDICTED: probable LRR receptor-like serine...    296   9e-83    
ref|XP_010059732.1|  PREDICTED: LRR receptor-like serine/threonin...    293   1e-82    
gb|EMT32126.1|  LRR receptor-like serine/threonine-protein kinase...    294   2e-82    
ref|XP_009104682.1|  PREDICTED: LRR receptor-like serine/threonin...    296   2e-82    
ref|XP_007152590.1|  hypothetical protein PHAVU_004G142700g             296   4e-82    
ref|XP_007152589.1|  hypothetical protein PHAVU_004G142600g             292   4e-82    
ref|XP_011017910.1|  PREDICTED: LRR receptor-like serine/threonin...    294   5e-82    
ref|XP_011017909.1|  PREDICTED: LRR receptor-like serine/threonin...    295   5e-82    
gb|KDO65529.1|  hypothetical protein CISIN_1g036932mg                   289   1e-81    
ref|XP_011038951.1|  PREDICTED: probable LRR receptor-like serine...    293   2e-81    
gb|KDO35905.1|  hypothetical protein CISIN_1g042271mg                   282   2e-81    
ref|XP_010691121.1|  PREDICTED: probable LRR receptor-like serine...    291   3e-81    
ref|XP_010064151.1|  PREDICTED: probable leucine-rich repeat rece...    285   8e-81    
ref|XP_006427433.1|  hypothetical protein CICLE_v10027313mg             288   9e-81    
ref|XP_006489913.1|  PREDICTED: probable LRR receptor-like serine...    280   1e-80    
ref|XP_010040586.1|  PREDICTED: probable LRR receptor-like serine...    290   1e-80    
gb|EYU18241.1|  hypothetical protein MIMGU_mgv1a022932mg                288   1e-80    
ref|XP_004136092.1|  PREDICTED: probable LRR receptor-like serine...    291   2e-80    
gb|KCW66225.1|  hypothetical protein EUGRSUZ_F000531                    279   2e-80    
ref|XP_011012869.1|  PREDICTED: LRR receptor-like serine/threonin...    288   4e-80    
gb|KDP46604.1|  hypothetical protein JCGZ_04538                         286   5e-80    
ref|XP_011017908.1|  PREDICTED: LRR receptor-like serine/threonin...    289   8e-80    
gb|KDO47433.1|  hypothetical protein CISIN_1g038149mg                   285   8e-80    
ref|NP_177557.2|  receptor like protein 13                              287   1e-79    Arabidopsis thaliana [mouse-ear cress]
gb|KDO37246.1|  hypothetical protein CISIN_1g038273mg                   280   1e-79    
ref|XP_006492070.1|  PREDICTED: probable LRR receptor-like serine...    289   1e-79    
ref|XP_006492075.1|  PREDICTED: probable LRR receptor-like serine...    288   2e-79    
ref|XP_010907022.1|  PREDICTED: LRR receptor-like serine/threonin...    286   2e-79    
ref|XP_006492129.1|  PREDICTED: LRR receptor-like serine/threonin...    286   2e-79    
ref|XP_009104681.1|  PREDICTED: LRR receptor-like serine/threonin...    288   2e-79    
emb|CDP05461.1|  unnamed protein product                                287   2e-79    
ref|XP_006492066.1|  PREDICTED: probable LRR receptor-like serine...    288   2e-79    
gb|KCW82691.1|  hypothetical protein EUGRSUZ_C04070                     284   3e-79    
ref|XP_010064149.1|  PREDICTED: probable leucine-rich repeat rece...    285   3e-79    
ref|XP_010911496.1|  PREDICTED: LRR receptor-like serine/threonin...    279   4e-79    
gb|KGN45251.1|  hypothetical protein Csa_7G432330                       286   4e-79    
gb|AAG51873.1|AC079678_3  disease resistance protein, putative; 1...    286   4e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006492065.1|  PREDICTED: probable LRR receptor-like serine...    288   5e-79    
ref|XP_006492062.1|  PREDICTED: probable LRR receptor-like serine...    287   5e-79    
ref|XP_006385257.1|  hypothetical protein POPTR_0003s02180g             280   5e-79    
gb|KDO37091.1|  hypothetical protein CISIN_1g0452911mg                  275   6e-79    
ref|XP_006492068.1|  PREDICTED: probable LRR receptor-like serine...    287   6e-79    
ref|XP_010654937.1|  PREDICTED: probable LRR receptor-like serine...    287   6e-79    
gb|KFK41862.1|  hypothetical protein AALP_AA2G180500                    284   8e-79    
ref|XP_006492069.1|  PREDICTED: probable LRR receptor-like serine...    286   8e-79    
ref|XP_011012868.1|  PREDICTED: probable LRR receptor-like serine...    285   9e-79    
ref|XP_006492063.1|  PREDICTED: probable LRR receptor-like serine...    286   1e-78    
ref|XP_006492073.1|  PREDICTED: probable LRR receptor-like serine...    286   1e-78    
ref|XP_006492061.1|  PREDICTED: probable LRR receptor-like serine...    286   1e-78    
gb|KCW82697.1|  hypothetical protein EUGRSUZ_C04080                     281   1e-78    
ref|XP_006492067.1|  PREDICTED: probable LRR receptor-like serine...    286   1e-78    
gb|KDO38435.1|  hypothetical protein CISIN_1g040184mg                   279   1e-78    
ref|XP_006442414.1|  hypothetical protein CICLE_v10024083mg             279   2e-78    
ref|XP_006492064.1|  PREDICTED: probable LRR receptor-like serine...    285   3e-78    
gb|KDO54099.1|  hypothetical protein CISIN_1g0374272mg                  280   3e-78    
ref|XP_010907023.1|  PREDICTED: LRR receptor-like serine/threonin...    283   4e-78    
emb|CBI25536.3|  unnamed protein product                                280   5e-78    
emb|CBI36499.3|  unnamed protein product                                271   5e-78    
ref|XP_006492071.1|  PREDICTED: probable LRR receptor-like serine...    284   5e-78    
ref|XP_010655176.1|  PREDICTED: probable LRR receptor-like serine...    281   6e-78    
gb|KCW82928.1|  hypothetical protein EUGRSUZ_C04300                     277   7e-78    
ref|XP_010064154.1|  PREDICTED: LRR receptor-like serine/threonin...    276   1e-77    
gb|KHN01758.1|  LRR receptor-like serine/threonine-protein kinase...    282   2e-77    
ref|XP_010051672.1|  PREDICTED: LRR receptor-like serine/threonin...    273   2e-77    
ref|XP_010059721.1|  PREDICTED: probable LRR receptor-like serine...    279   3e-77    
ref|XP_010654940.1|  PREDICTED: LRR receptor-like serine/threonin...    278   3e-77    
ref|XP_006382385.1|  hypothetical protein POPTR_0005s01640g             276   3e-77    
gb|KDO39549.1|  hypothetical protein CISIN_1g040468mg                   271   4e-77    
ref|XP_002324585.2|  hypothetical protein POPTR_0018s12440g             280   6e-77    Populus trichocarpa [western balsam poplar]
ref|XP_010064153.1|  PREDICTED: leucine-rich repeat receptor-like...    278   6e-77    
gb|KEH36601.1|  LRR receptor-like kinase family protein                 278   6e-77    
gb|KCW66236.1|  hypothetical protein EUGRSUZ_F00068                     274   8e-77    
ref|XP_010654943.1|  PREDICTED: LRR receptor-like serine/threonin...    281   8e-77    
ref|XP_011017907.1|  PREDICTED: LRR receptor-like serine/threonin...    280   8e-77    
gb|KCW82939.1|  hypothetical protein EUGRSUZ_C04317                     275   1e-76    
gb|KDO40867.1|  hypothetical protein CISIN_1g046382mg                   273   1e-76    
gb|KDO39146.1|  hypothetical protein CISIN_1g041908mg                   276   2e-76    
ref|XP_010907021.1|  PREDICTED: LRR receptor-like serine/threonin...    275   3e-76    
ref|XP_008778832.1|  PREDICTED: receptor-like protein 12                279   3e-76    
ref|XP_010312674.1|  PREDICTED: receptor-like protein kinase 5 is...    270   4e-76    
ref|XP_009104683.1|  PREDICTED: probable LRR receptor-like serine...    277   5e-76    
ref|XP_006427435.1|  hypothetical protein CICLE_v10027124mg             272   5e-76    
ref|XP_009104779.1|  PREDICTED: LRR receptor-like serine/threonin...    276   7e-76    
ref|XP_010656508.1|  PREDICTED: probable LRR receptor-like serine...    274   1e-75    
ref|XP_004158820.1|  PREDICTED: uncharacterized protein LOC101224990    281   1e-75    
emb|CBI21113.3|  unnamed protein product                                275   1e-75    
ref|XP_010064145.1|  PREDICTED: LRR receptor-like serine/threonin...    274   1e-75    
ref|XP_002517679.1|  serine/threonine-protein kinase bri1, putative     274   1e-75    Ricinus communis
gb|EEE61799.1|  hypothetical protein OsJ_16412                          274   2e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009779091.1|  PREDICTED: leucine-rich repeat receptor-like...    260   3e-75    
gb|KDP37049.1|  hypothetical protein JCGZ_06105                         270   4e-75    
ref|XP_007099690.1|  Receptor like protein 15, putative                 268   4e-75    
ref|NP_172219.5|  receptor like protein 1                               274   6e-75    
ref|XP_003636801.1|  Receptor kinase                                    273   7e-75    
ref|NP_001154317.1|  receptor like protein 1                            272   8e-75    
gb|KDO38199.1|  hypothetical protein CISIN_1g0453232mg                  267   1e-74    
ref|XP_006492072.1|  PREDICTED: probable LRR receptor-like serine...    274   1e-74    
ref|XP_011044904.1|  PREDICTED: LRR receptor-like serine/threonin...    273   2e-74    
ref|XP_010064146.1|  PREDICTED: LRR receptor-like serine/threonin...    267   3e-74    
ref|XP_009149339.1|  PREDICTED: probable LRR receptor-like serine...    271   3e-74    
ref|XP_009149342.1|  PREDICTED: probable leucine-rich repeat rece...    270   4e-74    
gb|KDO39536.1|  hypothetical protein CISIN_1g005619mg                   266   5e-74    
ref|XP_010064147.1|  PREDICTED: probable leucine-rich repeat rece...    265   6e-74    
gb|KDP35112.1|  hypothetical protein JCGZ_10954                         267   6e-74    
ref|XP_010911336.1|  PREDICTED: putative receptor-like protein ki...    259   6e-74    
ref|XP_006492076.1|  PREDICTED: probable LRR receptor-like serine...    271   1e-73    
gb|KEH20413.1|  LRR receptor-like kinase                                266   1e-73    
gb|AAG52409.1|AC020579_11  putative disease resistance protein; 4...    269   1e-73    
gb|KGN45249.1|  hypothetical protein Csa_7G432310                       269   2e-73    
ref|XP_009149343.1|  PREDICTED: leucine-rich repeat receptor prot...    269   2e-73    
ref|XP_009118443.1|  PREDICTED: probable LRR receptor-like serine...    270   3e-73    
gb|KCW82930.1|  hypothetical protein EUGRSUZ_C04303                     264   3e-73    
ref|XP_006306635.1|  hypothetical protein CARUB_v10008151mg             268   3e-73    
gb|KDO36044.1|  hypothetical protein CISIN_1g042089mg                   260   4e-73    
ref|XP_010419197.1|  PREDICTED: leucine-rich repeat receptor prot...    268   5e-73    
ref|XP_007023062.1|  Receptor like protein 15, putative                 268   5e-73    
ref|XP_010051740.1|  PREDICTED: receptor-like protein kinase 2          265   5e-73    
ref|XP_010051738.1|  PREDICTED: probable LRR receptor-like serine...    264   6e-73    
ref|XP_002517677.1|  receptor-kinase, putative                          273   7e-73    
ref|XP_002888967.1|  leucine-rich repeat family protein                 267   8e-73    
ref|XP_006492074.1|  PREDICTED: probable LRR receptor-like serine...    268   1e-72    
gb|KCW66234.1|  hypothetical protein EUGRSUZ_F00066                     263   1e-72    
ref|XP_008461139.1|  PREDICTED: probable LRR receptor-like serine...    267   1e-72    
ref|XP_006306634.1|  hypothetical protein CARUB_v10008151mg             266   1e-72    
gb|KDO41046.1|  hypothetical protein CISIN_1g040607mg                   261   1e-72    
ref|XP_008461423.1|  PREDICTED: LRR receptor-like serine/threonin...    267   1e-72    
ref|NP_177559.1|  receptor like protein 15                              266   2e-72    
ref|XP_006306633.1|  hypothetical protein CARUB_v10008151mg             267   2e-72    
ref|XP_009118444.1|  PREDICTED: probable LRR receptor-like serine...    267   2e-72    
ref|XP_010691120.1|  PREDICTED: probable LRR receptor-like serine...    266   2e-72    
ref|XP_006385236.1|  hypothetical protein POPTR_0003s01970g             265   3e-72    
ref|XP_006427453.1|  hypothetical protein CICLE_v10027492mg             264   3e-72    
ref|XP_010907024.1|  PREDICTED: LRR receptor-like serine/threonin...    265   4e-72    
gb|EMT28713.1|  LRR receptor-like serine/threonine-protein kinase...    264   4e-72    
ref|XP_006431956.1|  hypothetical protein CICLE_v100040452mg            259   4e-72    
gb|KDO50390.1|  hypothetical protein CISIN_1g044108mg                   259   5e-72    
ref|XP_006583611.1|  PREDICTED: brassinosteroid LRR receptor kina...    260   7e-72    
gb|KDP42637.1|  hypothetical protein JCGZ_01675                         264   7e-72    
ref|XP_010045587.1|  PREDICTED: phytosulfokine receptor 1-like          264   7e-72    
ref|XP_002442436.1|  hypothetical protein SORBIDRAFT_08g020030          263   9e-72    
gb|KCW82692.1|  hypothetical protein EUGRSUZ_C04071                     263   9e-72    
gb|KCW83651.1|  hypothetical protein EUGRSUZ_B00536                     260   1e-71    
ref|XP_006388377.1|  hypothetical protein POPTR_0204s00240g             260   2e-71    
emb|CBI36377.3|  unnamed protein product                                265   2e-71    
gb|KCW75511.1|  hypothetical protein EUGRSUZ_E04272                     259   2e-71    
ref|XP_010470279.1|  PREDICTED: probable leucine-rich repeat rece...    260   3e-71    
ref|XP_009128032.1|  PREDICTED: leucine-rich repeat receptor prot...    263   3e-71    
ref|XP_006583610.1|  PREDICTED: systemin receptor SR160-like            258   3e-71    
gb|EMT13466.1|  LRR receptor-like serine/threonine-protein kinase...    264   3e-71    
gb|KCW83033.1|  hypothetical protein EUGRSUZ_C04412                     263   3e-71    
gb|KDO47431.1|  hypothetical protein CISIN_1g045580mg                   259   3e-71    
ref|XP_010414772.1|  PREDICTED: probable leucine-rich repeat rece...    259   4e-71    
ref|XP_010414771.1|  PREDICTED: probable leucine-rich repeat rece...    259   4e-71    
ref|XP_006427407.1|  hypothetical protein CICLE_v10024794mg             262   4e-71    
ref|XP_006382384.1|  hypothetical protein POPTR_0005s01630g             261   4e-71    
ref|XP_010051727.1|  PREDICTED: LRR receptor-like serine/threonin...    265   5e-71    
gb|KDO38690.1|  hypothetical protein CISIN_1g0406992mg                  252   6e-71    
ref|XP_010064150.1|  PREDICTED: probably inactive leucine-rich re...    256   9e-71    
ref|NP_001154318.1|  receptor like protein 1                            262   1e-70    
gb|KDO41821.1|  hypothetical protein CISIN_1g0023501mg                  258   1e-70    
ref|XP_008461140.1|  PREDICTED: probable LRR receptor-like serine...    260   2e-70    
ref|XP_010273780.1|  PREDICTED: probable LRR receptor-like serine...    260   2e-70    
ref|XP_006427438.1|  hypothetical protein CICLE_v10025050mg             256   2e-70    
ref|XP_010470276.1|  PREDICTED: protein BRASSINOSTEROID INSENSITI...    260   2e-70    
gb|KCW82690.1|  hypothetical protein EUGRSUZ_C04068                     257   2e-70    
ref|XP_006390450.1|  hypothetical protein EUTSA_v10018087mg             259   4e-70    
gb|KCW66241.1|  hypothetical protein EUGRSUZ_F00076                     249   5e-70    
gb|KDO41822.1|  hypothetical protein CISIN_1g0023501mg                  256   6e-70    
ref|XP_010471506.1|  PREDICTED: probable LRR receptor-like serine...    259   6e-70    
gb|KCW66231.1|  hypothetical protein EUGRSUZ_F00060                     254   9e-70    
gb|EMS56608.1|  LRR receptor-like serine/threonine-protein kinase...    257   1e-69    
ref|XP_009149344.1|  PREDICTED: probable LRR receptor-like serine...    257   2e-69    
gb|KGN45248.1|  hypothetical protein Csa_7G432300                       255   2e-69    
ref|XP_006381073.1|  hypothetical protein POPTR_0006s06000g             257   2e-69    
ref|XP_009106079.1|  PREDICTED: brassinosteroid LRR receptor kina...    257   3e-69    
ref|XP_003604710.1|  Receptor-like protein kinase                       257   3e-69    
ref|XP_010428392.1|  PREDICTED: LRR receptor-like serine/threonin...    257   3e-69    
ref|XP_010511096.1|  PREDICTED: LRR receptor-like serine/threonin...    253   6e-69    
ref|XP_010250380.1|  PREDICTED: probably inactive leucine-rich re...    256   7e-69    
ref|XP_010051734.1|  PREDICTED: probable LRR receptor-like serine...    252   8e-69    
gb|KEH23111.1|  LRR receptor-like kinase                                256   1e-68    
ref|XP_006492124.1|  PREDICTED: LRR receptor-like serine/threonin...    251   1e-68    
gb|KCW82935.1|  hypothetical protein EUGRSUZ_C04311                     251   2e-68    
emb|CDP05454.1|  unnamed protein product                                251   2e-68    
ref|XP_010511092.1|  PREDICTED: probable leucine-rich repeat rece...    254   2e-68    
emb|CBI38971.3|  unnamed protein product                                255   3e-68    
ref|XP_006389374.1|  hypothetical protein POPTR_0027s004601g            248   3e-68    
ref|XP_009104780.1|  PREDICTED: LRR receptor-like serine/threonin...    251   4e-68    
gb|KDO41114.1|  hypothetical protein CISIN_1g0017191mg                  248   4e-68    
gb|KDO53076.1|  hypothetical protein CISIN_1g0441582mg                  246   6e-68    
emb|CDY42434.1|  BnaC02g22740D                                          254   7e-68    
emb|CDY49131.1|  BnaA02g16750D                                          251   8e-68    
gb|AES86907.2|  LRR receptor-like kinase family protein                 252   8e-68    
ref|XP_011017599.1|  PREDICTED: probable LRR receptor-like serine...    249   1e-67    
ref|XP_009104776.1|  PREDICTED: LOW QUALITY PROTEIN: brassinoster...    252   1e-67    
gb|KCW82740.1|  hypothetical protein EUGRSUZ_C04115                     248   1e-67    
gb|EMT33454.1|  LRR receptor-like serine/threonine-protein kinase...    252   1e-67    
gb|KCW82933.1|  hypothetical protein EUGRSUZ_C04306                     248   2e-67    
ref|NP_001185260.1|  receptor like protein 9                            252   2e-67    
gb|KCW75513.1|  hypothetical protein EUGRSUZ_E04274                     248   3e-67    
ref|XP_002324701.2|  hypothetical protein POPTR_0018s14100g             250   3e-67    
ref|XP_010051729.1|  PREDICTED: LRR receptor-like serine/threonin...    247   4e-67    
ref|XP_006432852.1|  hypothetical protein CICLE_v10003464mg             243   5e-67    
ref|XP_006495145.1|  PREDICTED: LRR receptor-like serine/threonin...    245   8e-67    
emb|CDY11072.1|  BnaC06g23240D                                          254   9e-67    
ref|XP_006390456.1|  hypothetical protein EUTSA_v10018093mg             249   1e-66    
ref|XP_006390459.1|  hypothetical protein EUTSA_v10018158mg             247   1e-66    
ref|XP_006389395.1|  hypothetical protein POPTR_0025s00320g             246   1e-66    
ref|XP_010511095.1|  PREDICTED: LRR receptor-like serine/threonin...    247   1e-66    
gb|EEE61800.1|  hypothetical protein OsJ_16413                          249   1e-66    
gb|KDO42718.1|  hypothetical protein CISIN_1g043317mg                   245   2e-66    
ref|XP_010511094.1|  PREDICTED: LRR receptor-like serine/threonin...    246   2e-66    
ref|XP_006427428.1|  hypothetical protein CICLE_v10027505mg             245   2e-66    
ref|XP_010428400.1|  PREDICTED: leucine-rich repeat receptor-like...    248   2e-66    
ref|XP_002264681.3|  PREDICTED: serine/threonine-protein kinase B...    248   3e-66    
ref|XP_006846858.1|  hypothetical protein AMTR_s00150p00038000          246   4e-66    
emb|CBI38976.3|  unnamed protein product                                245   4e-66    
ref|XP_010051742.1|  PREDICTED: probably inactive leucine-rich re...    237   5e-66    
ref|XP_002533665.1|  serine-threonine protein kinase, plant-type,...    244   6e-66    
ref|XP_010042138.1|  PREDICTED: probable LRR receptor-like serine...    239   6e-66    
ref|XP_010691118.1|  PREDICTED: LRR receptor-like serine/threonin...    246   8e-66    
ref|XP_010429540.1|  PREDICTED: leucine-rich repeat receptor-like...    246   8e-66    
ref|XP_006389393.1|  hypothetical protein POPTR_0025s00300g             243   1e-65    
ref|XP_010691117.1|  PREDICTED: LRR receptor-like serine/threonin...    246   1e-65    
emb|CAD41701.2|  OSJNBa0010D21.3                                        244   1e-65    
dbj|BAF63333.1|  LRR binding protein                                    244   2e-65    
gb|KDO40449.1|  hypothetical protein CISIN_1g0388582mg                  236   2e-65    
ref|XP_003604715.1|  Receptor-like protein kinase                       246   2e-65    
ref|XP_007140436.1|  hypothetical protein PHAVU_008G111800g             245   3e-65    
ref|XP_003636910.1|  Receptor-like protein kinase                       245   4e-65    
ref|XP_006427410.1|  hypothetical protein CICLE_v10027537mg             242   5e-65    
gb|EMT04731.1|  LRR receptor-like serine/threonine-protein kinase...    244   5e-65    
ref|XP_002324703.2|  hypothetical protein POPTR_0018s14150g             244   5e-65    
gb|ABW81103.1|  unknown                                                 243   1e-64    
gb|KEH28882.1|  leucine-rich receptor-like kinase family protein,...    244   1e-64    
ref|XP_010521912.1|  PREDICTED: leucine-rich repeat receptor-like...    243   1e-64    
gb|KEH28884.1|  leucine-rich receptor-like kinase family protein,...    243   2e-64    
ref|XP_006390454.1|  hypothetical protein EUTSA_v10018082mg             242   2e-64    
ref|XP_011017600.1|  PREDICTED: LRR receptor-like serine/threonin...    239   2e-64    
gb|KEH28881.1|  leucine-rich receptor-like kinase family protein,...    243   3e-64    
gb|KCW82689.1|  hypothetical protein EUGRSUZ_C04067                     241   3e-64    
gb|AES86912.2|  leucine-rich receptor-like kinase family protein,...    242   4e-64    
ref|XP_010521913.1|  PREDICTED: leucine-rich repeat receptor prot...    239   5e-64    
ref|XP_010416261.1|  PREDICTED: probable leucine-rich repeat rece...    241   5e-64    
ref|XP_011017601.1|  PREDICTED: LRR receptor-like serine/threonin...    237   7e-64    
gb|KCW75522.1|  hypothetical protein EUGRSUZ_E04285                     239   9e-64    
gb|KDO47439.1|  hypothetical protein CISIN_1g043452mg                   229   9e-64    
ref|XP_006432836.1|  hypothetical protein CICLE_v10000397mg             234   9e-64    
ref|XP_010472543.1|  PREDICTED: receptor-like protein 12 isoform X1     241   1e-63    
gb|KCW82941.1|  hypothetical protein EUGRSUZ_C043202                    230   1e-63    
ref|XP_010416262.1|  PREDICTED: LRR receptor-like serine/threonin...    239   1e-63    
ref|XP_002306256.2|  hypothetical protein POPTR_0005s00830g             237   2e-63    
gb|KCW44415.1|  hypothetical protein EUGRSUZ_L02094                     237   2e-63    
ref|XP_009118520.1|  PREDICTED: LRR receptor-like serine/threonin...    239   3e-63    
ref|XP_006389390.1|  hypothetical protein POPTR_0025s00270g             233   3e-63    
ref|XP_010472545.1|  PREDICTED: LRR receptor-like serine/threonin...    239   3e-63    
ref|XP_010470277.1|  PREDICTED: receptor-like protein kinase 5 is...    238   4e-63    
ref|XP_006388334.1|  hypothetical protein POPTR_0223s00200g             238   6e-63    
ref|XP_006427458.1|  hypothetical protein CICLE_v10025151mg             233   9e-63    
gb|KCW82694.1|  hypothetical protein EUGRSUZ_C04075                     234   1e-62    
gb|KDO39674.1|  hypothetical protein CISIN_1g0364112mg                  228   1e-62    
ref|XP_006300680.1|  hypothetical protein CARUB_v10019719mg             237   1e-62    
gb|KDO38018.1|  hypothetical protein CISIN_1g042884mg                   232   1e-62    
emb|CBI33424.3|  unnamed protein product                                229   1e-62    
gb|KCW66221.1|  hypothetical protein EUGRSUZ_F00048                     233   1e-62    
gb|EEE61798.1|  hypothetical protein OsJ_16411                          237   2e-62    
emb|CAJ86057.1|  H0821G03.8                                             237   2e-62    
gb|EEC78127.1|  hypothetical protein OsI_17675                          237   2e-62    
emb|CBI36375.3|  unnamed protein product                                235   3e-62    
dbj|BAF63330.1|  phytosulfokine receptor kinase                         236   3e-62    
ref|XP_010470278.1|  PREDICTED: probable leucine-rich repeat rece...    236   3e-62    
gb|KCW66220.1|  hypothetical protein EUGRSUZ_F00047                     233   3e-62    
ref|NP_001054072.1|  Os04g0647900                                       236   3e-62    
ref|XP_006293622.1|  hypothetical protein CARUB_v10022573mg             236   4e-62    
ref|XP_010554828.1|  PREDICTED: LRR receptor-like serine/threonin...    235   4e-62    
ref|XP_010417315.1|  PREDICTED: leucine-rich repeat receptor-like...    235   5e-62    
gb|KCW83040.1|  hypothetical protein EUGRSUZ_C04421                     234   5e-62    
gb|KDO36779.1|  hypothetical protein CISIN_1g046000mg                   227   6e-62    
ref|XP_011039082.1|  PREDICTED: receptor-like protein 12                227   8e-62    
ref|XP_009140600.1|  PREDICTED: LRR receptor-like serine/threonin...    235   9e-62    
gb|AAG50756.1|AC079131_1  hypothetical protein                          238   1e-61    
ref|XP_010416270.1|  PREDICTED: LRR receptor-like serine/threonin...    232   1e-61    
ref|XP_006379980.1|  hypothetical protein POPTR_0008s18640g             233   1e-61    
gb|AAG51872.1|AC079678_2  disease resistance protein, putative; 6...    234   1e-61    
dbj|BAC41889.1|  unknown protein                                        234   1e-61    
ref|NP_176115.2|  receptor like protein 9                               234   2e-61    
ref|XP_010930006.1|  PREDICTED: LRR receptor-like serine/threonin...    233   2e-61    
gb|KDO38786.1|  hypothetical protein CISIN_1g042919mg                   224   2e-61    
emb|CDY09920.1|  BnaC08g45310D                                          231   2e-61    
ref|XP_006653822.1|  PREDICTED: LRR receptor-like serine/threonin...    232   2e-61    
ref|XP_006427415.1|  hypothetical protein CICLE_v10027330mg             227   2e-61    
ref|XP_010472547.1|  PREDICTED: probable LRR receptor-like serine...    233   3e-61    
emb|CBI36380.3|  unnamed protein product                                235   3e-61    
emb|CBI36370.3|  unnamed protein product                                233   3e-61    
gb|EEC78128.1|  hypothetical protein OsI_17676                          232   3e-61    
gb|KDO37793.1|  hypothetical protein CISIN_1g0046171mg                  228   3e-61    
ref|XP_009149341.1|  PREDICTED: receptor-like protein kinase 2 is...    233   4e-61    
emb|CDY09922.1|  BnaC08g45290D                                          233   5e-61    
ref|XP_006379981.1|  hypothetical protein POPTR_0008s18640g             232   5e-61    
ref|XP_007149520.1|  hypothetical protein PHAVU_005G077100g             230   5e-61    
gb|KCW81898.1|  hypothetical protein EUGRSUZ_C03265                     231   8e-61    
ref|XP_006390452.1|  hypothetical protein EUTSA_v10018202mg             229   9e-61    
gb|KCW82940.1|  hypothetical protein EUGRSUZ_C04318                     228   9e-61    
ref|XP_010656506.1|  PREDICTED: LRR receptor-like serine/threonin...    230   9e-61    
ref|XP_009145147.1|  PREDICTED: LRR receptor-like serine/threonin...    228   1e-60    
ref|XP_006403713.1|  hypothetical protein EUTSA_v10010101mg             231   1e-60    
ref|XP_006405014.1|  hypothetical protein EUTSA_v10000563mg             230   2e-60    
ref|XP_010909236.1|  PREDICTED: probable LRR receptor-like serine...    223   2e-60    
emb|CAE51863.1|  RPP27 protein                                          231   3e-60    
gb|KCW82932.1|  hypothetical protein EUGRSUZ_C04305                     227   3e-60    
ref|XP_002304193.2|  hypothetical protein POPTR_0003s04290g             229   4e-60    
gb|KEH28880.1|  leucine-rich receptor-like kinase family protein,...    228   4e-60    



>ref|XP_010319234.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X1 [Solanum lycopersicum]
Length=1155

 Score =   482 bits (1240),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 333/777 (43%), Positives = 460/777 (59%), Gaps = 32/777 (4%)
 Frame = +3

Query  102   GLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFN--KFQSFGPINDVGGAKKLE  275
             G I    L  R   ++E        + + + L V   G N   F S   +  + G K LE
Sbjct  184   GTIEFPSLKNRSAPIDEGITKKCPGMSNLVVLMVAGYGINDTSFLSTLGLGKLTGLKNLE  243

Query  276   ELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE  455
              LYL    FN +IF SLK  PSLK LDL +ND   G +   DI  L NLK L L  N FE
Sbjct  244   RLYLPSNDFNSTIFSSLKHLPSLKHLDLTNNDI-GGKIETSDIIALSNLKFLDLQMNNFE  302

Query  456   GFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNI  635
             GF T+    GS     R  S L  + L   + + T ++ SL +F S+K L  +  +++  
Sbjct  303   GFVTTK---GS-----RRMSSLRNIRLGGSNSNSTNIIQSLKSFSSLKRLSYEYGDLSAS  354

Query  636   DAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKN  815
                +A++NLS LE L L GS L+++FLS+IG +ESLKVL+++     GTLPN+G CELKN
Sbjct  355   SVTYAIRNLSKLEYLDLKGSYLNENFLSSIGQIESLKVLTMAFGGNNGTLPNQGWCELKN  414

Query  816   LQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIels-plstltsleylsIMNNS  992
             +QE+ L+ N  EG IPS  GNLTSLR+++L  N+ +GNI       TLTSLEYL I  N 
Sbjct  415   IQEVALTNNNFEGTIPSCLGNLTSLRWLSLHGNRFTGNIASYPLWRTLTSLEYLDISFNQ  474

Query  993   FEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLH  1172
             FE+  SF  F NNSKL  +   +N +  D + + ++P FQL    +  CI+L KLP FLH
Sbjct  475   FEIPLSFNQFDNNSKLTYLDVGQNTITRDVEFKNWIPNFQLQLFVVEGCINLQKLPSFLH  534

Query  1173  YQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVS  1352
             YQ DL+++ I +N L G+FP+WLL+NNT+L       NAF G  KL S  +  L+ ++VS
Sbjct  535   YQHDLRIISIDKNQLPGKFPTWLLENNTRLAGLYARGNAFIGPWKLPSTSHLCLEQLDVS  594

Query  1353  NNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGT-HLGFLDLSNNSFTGEIPKEM  1529
             NNKL G +  N SS+FP +  LN+S NL  G + S IG  +L  LD+S+N  +G +P ++
Sbjct  595   NNKLSGHVPANISSAFPKLNFLNMSQNLLEGPIPSDIGGLYLVMLDISHNLLSGGVPSDL  654

Query  1530  LISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIR  1709
              +S  +L  L+LSNN+L G I  +    S+L YL+L+GN FEG +P+++   PL +LD  
Sbjct  655   AVSSPALTYLRLSNNRLSGTIFSKDIRPSTLFYLYLNGNRFEGPLPSNIFLKPLIALDAS  714

Query  1710  DNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL  1889
              N  SGEIPRW+   T L+QL L+KNHLEG IP+E CNLK + +L LSEN L+G +PSC+
Sbjct  715   GNNFSGEIPRWIRDNTRLIQLDLAKNHLEGSIPVEICNLKLIQVLALSENRLSGPVPSCV  774

Query  1890  NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNG  2069
             +   +KH+ L K+QL G+L  + FN ++L+ LDL YN+F G IP  I  +S L+ LLLN 
Sbjct  775   SDLPLKHIHLDKNQLGGELEDSLFNISSLITLDLGYNNFTGNIPHTIALLSSLNFLLLNN  834

Query  2070  NRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSIN  2249
             N+ +G++P Q+C L +LS++DLS N L G +  CLG   L   + + R +     YY  +
Sbjct  835   NQLDGEIPIQICLLNKLSIMDLSFNKLYGPLLPCLGNFKLAENDAETRSV-----YYQAS  889

Query  2250  D--AILD---------RLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSILK  2387
                A LD           H  +G   ++  M   DV   VQF TK N Y Y+ SILK
Sbjct  890   SRLAWLDFKSWISSTRHYHISYGFLSDFNLM---DVETRVQFSTKRNSYTYKGSILK  943


 Score = 73.9 bits (180),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 179/768 (23%), Positives = 287/768 (37%), Gaps = 171/768 (22%)
 Frame = +3

Query  105   LINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELY  284
             L  LE L ++ + + E N LS  ++    SLKVL + F       P       K ++E+ 
Sbjct  363   LSKLEYLDLKGSYLNE-NFLS--SIGQIESLKVLTMAFGGNNGTLPNQGWCELKNIQEVA  419

Query  285   LFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---  455
             L    F  +I   L    SL+ L L  N F            L +L+ L +S N FE   
Sbjct  420   LTNNNFEGTIPSCLGNLTSLRWLSLHGNRFTGNIASYPLWRTLTSLEYLDISFNQFEIPL  479

Query  456   GFETSANHSGSSRHTIRNKSYLEVLHLNNI-------------SFDMTKLLSSLAAFPSI  596
              F    N+S  +   +   +    +   N                ++ KL S L     +
Sbjct  480   SFNQFDNNSKLTYLDVGQNTITRDVEFKNWIPNFQLQLFVVEGCINLQKLPSFLHYQHDL  539

Query  597   KTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPME-------SLKVLS  755
             + + + +  +        L+N + L  L+  G+         IGP +        L+ L 
Sbjct  540   RIISIDKNQLPGKFPTWLLENNTRLAGLYARGNAF-------IGPWKLPSTSHLCLEQLD  592

Query  756   LSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIe  935
             +S  ++ G +P         L  L +S+N LEG IPS  G L  L  +++S N LSG + 
Sbjct  593   VSNNKLSGHVPANISSAFPKLNFLNMSQNLLEGPIPSDIGGLY-LVMLDISHNLLSGGVP  651

Query  936   lsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQL  1115
                  +  +L YL + NN     + F      S L  +  + N+       +G +P    
Sbjct  652   SDLAVSSPALTYLRLSNNRLS-GTIFSKDIRPSTLFYLYLNGNR------FEGPLP----  700

Query  1116  DSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
                  SN            + + L  L  S NN  GE P W+ ++NT+L    +  N   
Sbjct  701   -----SNI-----------FLKPLIALDASGNNFSGEIPRWI-RDNTRLIQLDLAKNHLE  743

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLH-------  1454
             GS+ +       +Q++ +S N+L G +  +  S  P +  ++L  N   G+L        
Sbjct  744   GSIPVEICNLKLIQVLALSENRLSGPVP-SCVSDLP-LKHIHLDKNQLGGELEDSLFNIS  801

Query  1455  SLIGTHLGFLDLSNN-------------------SFTGEIPKEMLISCSSLVILKLSNNK  1577
             SLI   LG+ + + N                      GEIP ++ +  + L I+ LS NK
Sbjct  802   SLITLDLGYNNFTGNIPHTIALLSSLNFLLLNNNQLDGEIPIQICL-LNKLSIMDLSFNK  860

Query  1578  LEGQI--------VQEFD---------------------YLSSLEYLHL-----------  1637
             L G +        + E D                     ++SS  + H+           
Sbjct  861   LYGPLLPCLGNFKLAENDAETRSVYYQASSRLAWLDFKSWISSTRHYHISYGFLSDFNLM  920

Query  1638  ------------DGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLS  1781
                         +   ++G+I   +S +     D+  N+L+G IP  +G L+ +    LS
Sbjct  921   DVETRVQFSTKRNSYTYKGSILKYMSGI-----DLSSNRLTGIIPVELGNLSKIRAFNLS  975

Query  1782  KNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFF  1961
              NH+ G IP  F NL  +  LDLS N+L G+IP  L         L  H           
Sbjct  976   HNHIFGRIPYTFSNLHEIESLDLSHNSLNGTIPVDL---------LELH-----------  1015

Query  1962  NNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVC  2105
                 L I  ++YN+  G +P +    S        GN      P   C
Sbjct  1016  ---FLAIFSVAYNNLSGAVPPFKAQFSTFDKSSYQGNPLLCGYPLDEC  1060



>ref|XP_010319235.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X2 [Solanum lycopersicum]
Length=1091

 Score =   479 bits (1233),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 328/752 (44%), Positives = 453/752 (60%), Gaps = 32/752 (4%)
 Frame = +3

Query  177   LKDFISLKVLDIGFN--KFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKI  350
             + + + L V   G N   F S   +  + G K LE LYL    FN +IF SLK  PSLK 
Sbjct  145   MSNLVVLMVAGYGINDTSFLSTLGLGKLTGLKNLERLYLPSNDFNSTIFSSLKHLPSLKH  204

Query  351   LDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVL  530
             LDL +ND   G +   DI  L NLK L L  N FEGF T+    GS     R  S L  +
Sbjct  205   LDLTNNDI-GGKIETSDIIALSNLKFLDLQMNNFEGFVTT---KGS-----RRMSSLRNI  255

Query  531   HLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKD  710
              L   + + T ++ SL +F S+K L  +  +++     +A++NLS LE L L GS L+++
Sbjct  256   RLGGSNSNSTNIIQSLKSFSSLKRLSYEYGDLSASSVTYAIRNLSKLEYLDLKGSYLNEN  315

Query  711   FLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSL  890
             FLS+IG +ESLKVL+++     GTLPN+G CELKN+QE+ L+ N  EG IPS  GNLTSL
Sbjct  316   FLSSIGQIESLKVLTMAFGGNNGTLPNQGWCELKNIQEVALTNNNFEGTIPSCLGNLTSL  375

Query  891   RYVNLSLNKLSGNIels-plstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNK  1067
             R+++L  N+ +GNI       TLTSLEYL I  N FE+  SF  F NNSKL  +   +N 
Sbjct  376   RWLSLHGNRFTGNIASYPLWRTLTSLEYLDISFNQFEIPLSFNQFDNNSKLTYLDVGQNT  435

Query  1068  VIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQ  1247
             +  D + + ++P FQL    +  CI+L KLP FLHYQ DL+++ I +N L G+FP+WLL+
Sbjct  436   ITRDVEFKNWIPNFQLQLFVVEGCINLQKLPSFLHYQHDLRIISIDKNQLPGKFPTWLLE  495

Query  1248  NNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLS  1427
             NNT+L       NAF G  KL S  +  L+ ++VSNNKL G +  N SS+FP +  LN+S
Sbjct  496   NNTRLAGLYARGNAFIGPWKLPSTSHLCLEQLDVSNNKLSGHVPANISSAFPKLNFLNMS  555

Query  1428  SNLFSGQLHSLIGT-HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEF  1604
              NL  G + S IG  +L  LD+S+N  +G +P ++ +S  +L  L+LSNN+L G I  + 
Sbjct  556   QNLLEGPIPSDIGGLYLVMLDISHNLLSGGVPSDLAVSSPALTYLRLSNNRLSGTIFSKD  615

Query  1605  DYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSK  1784
                S+L YL+L+GN FEG +P+++   PL +LD   N  SGEIPRW+   T L+QL L+K
Sbjct  616   IRPSTLFYLYLNGNRFEGPLPSNIFLKPLIALDASGNNFSGEIPRWIRDNTRLIQLDLAK  675

Query  1785  NHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFN  1964
             NHLEG IP+E CNLK + +L LSEN L+G +PSC++   +KH+ L K+QL G+L  + FN
Sbjct  676   NHLEGSIPVEICNLKLIQVLALSENRLSGPVPSCVSDLPLKHIHLDKNQLGGELEDSLFN  735

Query  1965  NTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnn  2144
              ++L+ LDL YN+F G IP  I  +S L+ LLLN N+ +G++P Q+C L +LS++DLS N
Sbjct  736   ISSLITLDLGYNNFTGNIPHTIALLSSLNFLLLNNNQLDGEIPIQICLLNKLSIMDLSFN  795

Query  2145  llsGVIPRCLGKISLEGTNEQFRGINLPFEYYSIND--AILD---------RLHYEWGSD  2291
              L G +  CLG   L   + + R +     YY  +   A LD           H  +G  
Sbjct  796   KLYGPLLPCLGNFKLAENDAETRSV-----YYQASSRLAWLDFKSWISSTRHYHISYGFL  850

Query  2292  DEYIPMLAVDVLPEVQFRTKGNLYNYQNSILK  2387
              ++  M   DV   VQF TK N Y Y+ SILK
Sbjct  851   SDFNLM---DVETRVQFSTKRNSYTYKGSILK  879


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 168/621 (27%), Positives = 275/621 (44%), Gaps = 79/621 (13%)
 Frame = +3

Query  84    GNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGA  263
             G+ R++ L N+    +  +     NI+   +LK F SLK L   +    +      +   
Sbjct  245   GSRRMSSLRNIR---LGGSNSNSTNIIQ--SLKSFSSLKRLSYEYGDLSASSVTYAIRNL  299

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
              KLE L L     N++   S+    SLK+L  M     +G L  Q   +L+N++E+ L++
Sbjct  300   SKLEYLDLKGSYLNENFLSSIGQIESLKVLT-MAFGGNNGTLPNQGWCELKNIQEVALTN  358

Query  444   NYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVN  623
             N FEG   S          + N + L  L L+   F  T  ++S   + ++ +LE   ++
Sbjct  359   NNFEGTIPSC---------LGNLTSLRWLSLHGNRF--TGNIASYPLWRTLTSLEYLDIS  407

Query  624   VTNID---AIHALKNLSSLEELHLDGSNLHKDF-LSNIGPMESLKVLSLSGAQVGGTLPN  791
                 +   + +   N S L  L +  + + +D    N  P   L++  + G         
Sbjct  408   FNQFEIPLSFNQFDNNSKLTYLDVGQNTITRDVEFKNWIPNFQLQLFVVEGC--------  459

Query  792   KGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsley  971
                    NLQ           K+PS+      LR +++  N+L G      L   T L  
Sbjct  460   ------INLQ-----------KLPSFLHYQHDLRIISIDKNQLPGKFPTWLLENNTRLAG  502

Query  972   lsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPK------FQLDSLSLS  1133
             L    N+F       S ++       L      +++ +L G VP        +L+ L++S
Sbjct  503   LYARGNAFIGPWKLPSTSH-------LCLEQLDVSNNKLSGHVPANISSAFPKLNFLNMS  555

Query  1134  NCIDLLKLPRFLHYQRDLKVLRI-----SRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTG  1298
                +LL+ P       D+  L +     S N L G  PS L  ++  L Y  ++NN  +G
Sbjct  556   Q--NLLEGP----IPSDIGGLYLVMLDISHNLLSGGVPSDLAVSSPALTYLRLSNNRLSG  609

Query  1299  SLKLSSHVNPN-LQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI--GT  1469
             ++  S  + P+ L  + ++ N+  G +  N       ++AL+ S N FSG++   I   T
Sbjct  610   TI-FSKDIRPSTLFYLYLNGNRFEGPLPSNI--FLKPLIALDASGNNFSGEIPRWIRDNT  666

Query  1470  HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN  1649
              L  LDL+ N   G IP E + +   + +L LS N+L G +      L  L+++HLD N 
Sbjct  667   RLIQLDLAKNHLEGSIPVE-ICNLKLIQVLALSENRLSGPVPSCVSDL-PLKHIHLDKNQ  724

Query  1650  FEGTIpnsl-snlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNL  1826
               G + +SL +   L +LD+  N  +G IP  +  L+SL  L L+ N L+G IPI+ C L
Sbjct  725   LGGELEDSLFNISSLITLDLGYNNFTGNIPHTIALLSSLNFLLLNNNQLDGEIPIQICLL  784

Query  1827  KSLSILDLSENNLTGSIPSCL  1889
               LSI+DLS N L G +  CL
Sbjct  785   NKLSIMDLSFNKLYGPLLPCL  805


 Score = 73.9 bits (180),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 179/768 (23%), Positives = 287/768 (37%), Gaps = 171/768 (22%)
 Frame = +3

Query  105   LINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELY  284
             L  LE L ++ + + E N LS  ++    SLKVL + F       P       K ++E+ 
Sbjct  299   LSKLEYLDLKGSYLNE-NFLS--SIGQIESLKVLTMAFGGNNGTLPNQGWCELKNIQEVA  355

Query  285   LFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---  455
             L    F  +I   L    SL+ L L  N F            L +L+ L +S N FE   
Sbjct  356   LTNNNFEGTIPSCLGNLTSLRWLSLHGNRFTGNIASYPLWRTLTSLEYLDISFNQFEIPL  415

Query  456   GFETSANHSGSSRHTIRNKSYLEVLHLNNI-------------SFDMTKLLSSLAAFPSI  596
              F    N+S  +   +   +    +   N                ++ KL S L     +
Sbjct  416   SFNQFDNNSKLTYLDVGQNTITRDVEFKNWIPNFQLQLFVVEGCINLQKLPSFLHYQHDL  475

Query  597   KTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPME-------SLKVLS  755
             + + + +  +        L+N + L  L+  G+         IGP +        L+ L 
Sbjct  476   RIISIDKNQLPGKFPTWLLENNTRLAGLYARGNAF-------IGPWKLPSTSHLCLEQLD  528

Query  756   LSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIe  935
             +S  ++ G +P         L  L +S+N LEG IPS  G L  L  +++S N LSG + 
Sbjct  529   VSNNKLSGHVPANISSAFPKLNFLNMSQNLLEGPIPSDIGGLY-LVMLDISHNLLSGGVP  587

Query  936   lsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQL  1115
                  +  +L YL + NN     + F      S L  +  + N+       +G +P    
Sbjct  588   SDLAVSSPALTYLRLSNNRLS-GTIFSKDIRPSTLFYLYLNGNR------FEGPLP----  636

Query  1116  DSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
                  SN            + + L  L  S NN  GE P W+ ++NT+L    +  N   
Sbjct  637   -----SNI-----------FLKPLIALDASGNNFSGEIPRWI-RDNTRLIQLDLAKNHLE  679

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLH-------  1454
             GS+ +       +Q++ +S N+L G +  +  S  P +  ++L  N   G+L        
Sbjct  680   GSIPVEICNLKLIQVLALSENRLSGPVP-SCVSDLP-LKHIHLDKNQLGGELEDSLFNIS  737

Query  1455  SLIGTHLGFLDLSNN-------------------SFTGEIPKEMLISCSSLVILKLSNNK  1577
             SLI   LG+ + + N                      GEIP ++ +  + L I+ LS NK
Sbjct  738   SLITLDLGYNNFTGNIPHTIALLSSLNFLLLNNNQLDGEIPIQICL-LNKLSIMDLSFNK  796

Query  1578  LEGQI--------VQEFD---------------------YLSSLEYLHL-----------  1637
             L G +        + E D                     ++SS  + H+           
Sbjct  797   LYGPLLPCLGNFKLAENDAETRSVYYQASSRLAWLDFKSWISSTRHYHISYGFLSDFNLM  856

Query  1638  ------------DGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLS  1781
                         +   ++G+I   +S +     D+  N+L+G IP  +G L+ +    LS
Sbjct  857   DVETRVQFSTKRNSYTYKGSILKYMSGI-----DLSSNRLTGIIPVELGNLSKIRAFNLS  911

Query  1782  KNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFF  1961
              NH+ G IP  F NL  +  LDLS N+L G+IP  L         L  H           
Sbjct  912   HNHIFGRIPYTFSNLHEIESLDLSHNSLNGTIPVDL---------LELH-----------  951

Query  1962  NNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVC  2105
                 L I  ++YN+  G +P +    S        GN      P   C
Sbjct  952   ---FLAIFSVAYNNLSGAVPPFKAQFSTFDKSSYQGNPLLCGYPLDEC  996



>ref|XP_006367556.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Solanum tuberosum]
Length=1092

 Score =   467 bits (1201),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 323/779 (41%), Positives = 471/779 (60%), Gaps = 42/779 (5%)
 Frame = +3

Query  75    NNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDV  254
             N S +++  GL NL EL     ++ +INILS L             G N           
Sbjct  142   NTSMSKKCPGLSNLRELWFEGYEINDINILSAL-------------GANS----------  178

Query  255   GGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELY  434
              G + LE+L L +  FN +IF SLK FPSLK L+L  N+   G + + DI  L NLK L 
Sbjct  179   -GLRNLEKLILNDNNFNSTIFSSLKIFPSLKHLNLASNEI-TGNIKMNDIIALSNLKYLN  236

Query  435   LSDNYFEGFETSANHSGSSR-HTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLEL  611
             L +N  + F T+    G  R  ++RN     +L   N + + + +L SL  F S+K+L  
Sbjct  237   LWNNNIKSFRTTK---GKKRISSLRNL----LLGSRNSNSNSSSVLQSLKLFSSLKSLSY  289

Query  612   QRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPN  791
             +  ++T    I+AL+NLS++E L+L  S+L+++FL+NIG M SLKVLS+      G LPN
Sbjct  290   KDSDLTAPTIIYALRNLSTVEYLYLGKSSLNENFLANIGQMTSLKVLSMPSGYNNGNLPN  349

Query  792   KGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstl-tsle  968
             +G CELK ++EL   +N   G +PS  GNLTSLR++ L+ N  SGN     +    TSLE
Sbjct  350   QGWCELKYIEELDFLDNNFVGTLPSCLGNLTSLRWLCLAGNYFSGNTTSHSIWRRFTSLE  409

Query  969   ylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDL  1148
             YL I  N F+V  SFR F+N++KL  +    N +I DT+ Q ++P FQL+  ++  C++L
Sbjct  410   YLDIAYNQFDVPLSFRHFSNHTKLIYLDVGYNTIITDTEFQNWIPNFQLEFFAIEGCMNL  469

Query  1149  LKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNP  1328
              KLP FLHYQ DL++L I  N L+G FP+WLL+NNT+L      +NAF G  KL S  + 
Sbjct  470   QKLPSFLHYQYDLRILVIDGNQLQGNFPTWLLENNTRLAGIYSRDNAFDGPFKLPSSCHL  529

Query  1329  NLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI-GTHLGFLDLSNNSF  1505
             +L++I+VSNNKL G I  N S +FP + +LNLS N   G + S I G H+ +LDLS+N  
Sbjct  530   HLEMIDVSNNKLNGRIPENMSLAFPKLTSLNLSQNYLEGPIPSKICGVHVFYLDLSHNFL  589

Query  1506  TGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnl  1685
             +G +P ++ I   +L  L+LS+NKL+GQI  ++     L +L+L+GNNFEG +P+++   
Sbjct  590   SGGVPSDVAIGSPALGYLRLSHNKLKGQIFPKYVKQRMLSFLYLNGNNFEGPLPSNMFIT  649

Query  1686  plhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNL  1865
              L  LD  +N  SG+IPR +   T L+QL LSKNHLEG IP+E CNLK + +L LSEN+L
Sbjct  650   SLFVLDANNNSFSGKIPRCIRDNTRLLQLDLSKNHLEGSIPVEICNLKRIQVLSLSENSL  709

Query  1866  TGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsr  2045
             +G IPSC++  S++H+ L ++QL G L    FN ++L+ LDL  N+F G IP  IG+++ 
Sbjct  710   SGLIPSCMSSLSLQHIHLERNQLGGTLEHVLFNFSSLITLDLRNNNFRGNIPHTIGSLNT  769

Query  2046  lsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKIS-----LEGTNEQF  2210
             L+ LLL+ N+ EG++P Q+C L +LS++DLS N L G +  CLG ++     +E ++ ++
Sbjct  770   LNYLLLSTNQLEGQIPNQICMLNKLSIVDLSFNKLYGPLLPCLGYLTQAENDVEISSTKY  829

Query  2211  RGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSILK  2387
                +  + + +    I  + HY   S      +  +DV  +VQF TK N Y Y+ SILK
Sbjct  830   ATTS-TYSWLNFLHWIRSKRHYH-DSHGILSDISLMDVETQVQFSTKRNSYTYKGSILK  886


 Score = 84.0 bits (206),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 195/815 (24%), Positives = 317/815 (39%), Gaps = 186/815 (23%)
 Frame = +3

Query  48    FDNPLNSHLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKF  227
             ++N + S     G +R++ L NL  L  R +     ++L  L L  F SLK L    +  
Sbjct  238   WNNNIKSFRTTKGKKRISSLRNLL-LGSRNSNSNSSSVLQSLKL--FSSLKSLSYKDSDL  294

Query  228   QSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKIL------------------  353
              +   I  +     +E LYL +   N++   ++    SLK+L                  
Sbjct  295   TAPTIIYALRNLSTVEYLYLGKSSLNENFLANIGQMTSLKVLSMPSGYNNGNLPNQGWCE  354

Query  354   -------DLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTI-RN  509
                    D +DN+F  G L    + +L +L+ L L+ NYF G  TS        H+I R 
Sbjct  355   LKYIEELDFLDNNFV-GTLP-SCLGNLTSLRWLCLAGNYFSGNTTS--------HSIWRR  404

Query  510   KSYLEVLHLNNISFDM----------TKLLSSLAAFPSIKT-LELQ------RVNVTNID  638
              + LE L +    FD+          TKL+     + +I T  E Q      ++    I+
Sbjct  405   FTSLEYLDIAYNQFDVPLSFRHFSNHTKLIYLDVGYNTIITDTEFQNWIPNFQLEFFAIE  464

Query  639   AIHALKNLSS-------LEELHLDGSNLHKDF----------LSNI--------GPME--  737
                 L+ L S       L  L +DG+ L  +F          L+ I        GP +  
Sbjct  465   GCMNLQKLPSFLHYQYDLRILVIDGNQLQGNFPTWLLENNTRLAGIYSRDNAFDGPFKLP  524

Query  738   -----SLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVN  902
                   L+++ +S  ++ G +P         L  L LS+N LEG IPS    +  + Y++
Sbjct  525   SSCHLHLEMIDVSNNKLNGRIPENMSLAFPKLTSLNLSQNYLEGPIPSKICGV-HVFYLD  583

Query  903   LSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADT  1082
             LS N LSG +         +L YL + +N  +    F  +     L  +  + N      
Sbjct  584   LSHNFLSGGVPSDVAIGSPALGYLRLSHNKLK-GQIFPKYVKQRMLSFLYLNGNNFEGPL  642

Query  1083  QLQGFVPK-FQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTK  1259
                 F+   F LD+   +N     K+PR +     L  L +S+N+LEG  P  +  N  +
Sbjct  643   PSNMFITSLFVLDA---NNNSFSGKIPRCIRDNTRLLQLDLSKNHLEGSIPVEIC-NLKR  698

Query  1260  LQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEI----------------SGNFS  1391
             +Q   ++ N+ +G L  S   + +LQ I++  N+L G +                + NF 
Sbjct  699   IQVLSLSENSLSG-LIPSCMSSLSLQHIHLERNQLGGTLEHVLFNFSSLITLDLRNNNFR  757

Query  1392  SSFPNILA-------LNLSSNLFSGQLHSLIGT--HLGFLDLSNNSFTGEIPKEMLISCS  1544
              + P+ +        L LS+N   GQ+ + I     L  +DLS N   G      L+ C 
Sbjct  758   GNIPHTIGSLNTLNYLLLSTNQLEGQIPNQICMLNKLSIVDLSFNKLYGP-----LLPCL  812

Query  1545  SLVILKLSNNKLEGQIVQEFDYLSSLEYLHL-----------------------------  1637
               +    ++ ++           S L +LH                              
Sbjct  813   GYLTQAENDVEISSTKYATTSTYSWLNFLHWIRSKRHYHDSHGILSDISLMDVETQVQFS  872

Query  1638  ---DGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIP  1808
                +   ++G+I   +S +     D+  N+L+GEIP  +G +++L  L LS NHL G IP
Sbjct  873   TKRNSYTYKGSILKYMSGI-----DLSSNRLTGEIPVELGNMSNLPALNLSHNHLIGRIP  927

Query  1809  IEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILD  1988
               F NL+ +  LDLS N L GSIP  L                           +L +  
Sbjct  928   YTFSNLQEIESLDLSYNRLNGSIPVGL-----------------------LELNSLAVFS  964

Query  1989  LSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
             ++YN+  G +P++    +        GN F    P
Sbjct  965   VAYNNLSGAVPDFKAQFATFDKSSYEGNPFLCGYP  999



>ref|XP_009786715.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana sylvestris]
Length=1115

 Score =   459 bits (1182),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 331/776 (43%), Positives = 459/776 (59%), Gaps = 43/776 (6%)
 Frame = +3

Query  84    GNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGA  263
             G+ +  GL NL  L +   ++ +I+ILS L L   I                      G 
Sbjct  178   GSAKCPGLSNLRVLLLEGYRINDISILSALGLGTHI----------------------GL  215

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
             KKLE+LYL +  FN SIF SLK  PSL  LDL  N+  DG + + DI  L NLK + L  
Sbjct  216   KKLEKLYLSDNSFNSSIFSSLKDLPSLTHLDLSYNEI-DGKIEMSDIVALSNLKFMNLQG  274

Query  444   NYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVN  623
             N FE F T+    GS R +   K     L L   + + T +L SL +F S+ +L  +  N
Sbjct  275   NKFESFVTTK---GSKRMSSMRK-----LELGGFNSNSTNILQSLKSFSSLHSLSYRDSN  326

Query  624   VTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLC  803
             +T     +AL NLS+LE L+L+GS+L+++FLS+IG M SLKVLSL+     GTLPN G C
Sbjct  327   LTAPTITYALTNLSTLEHLYLEGSSLNENFLSSIGQMTSLKVLSLAFGGNYGTLPNHGWC  386

Query  804   ELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstlts-leylsI  980
             ELKN+QEL  + N  EG +PS  GNLTS++++ L  N  +GNI+L P     + LE+L I
Sbjct  387   ELKNIQELAFTNNNFEGTLPSCLGNLTSVKWLGLQGNNFTGNIDLHPFWRRLTPLEFLDI  446

Query  981   MNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLP  1160
               N FEV  SF+ FAN+SKL  +    N +  DT+ Q ++P FQL   ++  CI+L KLP
Sbjct  447   SYNQFEVPLSFKQFANHSKLTYLDVGHNTITTDTEFQNWIPNFQLQLFAIHGCINLQKLP  506

Query  1161  RFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQI  1340
              FLHYQ DL++L I  N L G FP+WLL+NNT+L      +NAF G L+L S   P L  
Sbjct  507   SFLHYQYDLRILAIDGNQLPGNFPTWLLENNTRLGALYARDNAFIGPLELPSTSLPRLHT  566

Query  1341  INVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI-GTHLGFLDLSNNSFTGEI  1517
             I+VSNN L G I  NFSS+FP I  LN+S NL  G + S + G  L  +DLS+N  +G +
Sbjct  567   IDVSNNTLNGHIPTNFSSAFPKINRLNMSQNLIEGPIPSGVSGISLRIVDLSHNFLSGGV  626

Query  1518  PKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs  1697
             P + L S   L+ L+LSNN+L+GQI  +    S+L +L+++GNNFEG +P+++       
Sbjct  627   PSD-LTSSPYLLYLQLSNNRLKGQIFSKNFRSSTLSFLYVNGNNFEGPLPSNIFLRDFIV  685

Query  1698  lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSI  1877
             LD  +N  SGEIPRW+   ++L+QL LSKNH EG IP+E C LKS+ +L +SEN L+G I
Sbjct  686   LDASNNNFSGEIPRWIRDNSNLLQLDLSKNHFEGSIPVEICKLKSIKVLAMSENRLSGII  745

Query  1878  PSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlssl  2057
             PSC++   + H+ L  ++L G L     N ++L+ LDL  NSF G IP  IG++S L+ L
Sbjct  746   PSCVSGLPLDHIHLDNNKLGGGL-EYLSNISSLITLDLGNNSFTGSIPHTIGSLSNLNFL  804

Query  2058  llNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGI---NLP  2228
             LLN N+ EG +P Q+C L  LS++DLS N + G +  CLG +     + + R +   + P
Sbjct  805   LLNHNQLEGNIPAQICLLNELSIMDLSFNKIYGSLLPCLGNLIQAKRDGKIRTLIYASFP  864

Query  2229  FEYY-SINDAILDRLHY--EWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSILK  2387
              E + +     +  +HY   +   +    M+  DV  +VQF TK N Y Y+ SILK
Sbjct  865   KEAWLNFLTWKISTMHYHNRYSMGESNFGMM--DVETQVQFSTKRNTYTYKGSILK  918


 Score = 87.0 bits (214),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 196/762 (26%), Positives = 305/762 (40%), Gaps = 162/762 (21%)
 Frame = +3

Query  96    LTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLE  275
             LT L  LE L++  + + E N LS  ++    SLKVL + F       P +     K ++
Sbjct  336   LTNLSTLEHLYLEGSSLNE-NFLS--SIGQMTSLKVLSLAFGGNYGTLPNHGWCELKNIQ  392

Query  276   ELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDI-NDLRNLKELYLSDNYF  452
             EL      F  ++   L    S+K L L  N+F  G + +      L  L+ L +S N F
Sbjct  393   ELAFTNNNFEGTLPSCLGNLTSVKWLGLQGNNF-TGNIDLHPFWRRLTPLEFLDISYNQF  451

Query  453   E---GFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVN  623
             E    F+  ANHS          +YL+V H N I+ D T+  + +  F      +LQ   
Sbjct  452   EVPLSFKQFANHS--------KLTYLDVGH-NTITTD-TEFQNWIPNF------QLQ---  492

Query  624   VTNIDAIHALKNLSSLEE----------LHLDGSNLHKDF----LSN-------------  722
                + AIH   NL  L            L +DG+ L  +F    L N             
Sbjct  493   ---LFAIHGCINLQKLPSFLHYQYDLRILAIDGNQLPGNFPTWLLENNTRLGALYARDNA  549

Query  723   -IGPME-------SLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGN  878
              IGP+E        L  + +S   + G +P         +  L +S+N +EG IPS    
Sbjct  550   FIGPLELPSTSLPRLHTIDVSNNTLNGHIPTNFSSAFPKINRLNMSQNLIEGPIPSGVSG  609

Query  879   LTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFE---VASSFRS------FANN  1031
             + SLR V+LS N LSG +     S+   L    + NN  +    + +FRS      + N 
Sbjct  610   I-SLRIVDLSHNFLSGGVPSDLTSSPYLLYLQ-LSNNRLKGQIFSKNFRSSTLSFLYVNG  667

Query  1032  SKLRVILAD----RNKVIADTQ---LQGFVPKFQLDSLSLSNCIDLLK------LPRFLH  1172
             +     L      R+ ++ D       G +P++  D+ +L   +DL K      +P  + 
Sbjct  668   NNFEGPLPSNIFLRDFIVLDASNNNFSGEIPRWIRDNSNLLQ-LDLSKNHFEGSIPVEIC  726

Query  1173  YQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVS  1352
               + +KVL +S N L G  PS +  +   L +  ++NN   G L+  S+++ +L  +++ 
Sbjct  727   KLKSIKVLAMSENRLSGIIPSCV--SGLPLDHIHLDNNKLGGGLEYLSNIS-SLITLDLG  783

Query  1353  NNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKE  1526
             NN   G I     S   N+  L L+ N   G + + I     L  +DLS N   G     
Sbjct  784   NNSFTGSIPHTIGSLS-NLNFLLLNHNQLEGNIPAQICLLNELSIMDLSFNKIYGS----  838

Query  1527  MLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHL-----------------------  1637
              L+ C   +I    + K+   I   F   + L +L                         
Sbjct  839   -LLPCLGNLIQAKRDGKIRTLIYASFPKEAWLNFLTWKISTMHYHNRYSMGESNFGMMDV  897

Query  1638  ----------DGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKN  1787
                       +   ++G+I   +S +     D+  N+L+GEIP  +G L+ +  L LS N
Sbjct  898   ETQVQFSTKRNTYTYKGSILKYMSGI-----DLSSNRLTGEIPIELGNLSKIHALNLSHN  952

Query  1788  HLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNN  1967
             HL G IP  F  L  +  LDLS N+L  SIP  L         L  H L+          
Sbjct  953   HLIGRIPESFSYLHEVESLDLSYNSLNESIPEGL---------LELHPLA----------  993

Query  1968  TALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
                 +  ++YN+  G +P++ G           GN F    P
Sbjct  994   ----VFSVTYNNLSGRVPDFKGQFGTFDKSSYEGNPFLCGYP  1031



>ref|XP_010324743.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X2 [Solanum lycopersicum]
Length=861

 Score =   449 bits (1154),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 282/673 (42%), Positives = 408/673 (61%), Gaps = 20/673 (3%)
 Frame = +3

Query  393   IQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLS  572
             + DI  L NLK L L  N  E F T+          I+  SYL  L   +++ + ++++ 
Sbjct  1     MNDIIALSNLKHLDLRANNIESFVTTKG--------IKRMSYLRNLQFESLNSNSSRVIQ  52

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
             SL +F  +K+L  +  ++T    I+AL+NLS++E L+L GS+++ +FL NIG M SLKVL
Sbjct  53    SLKSFSFLKSLSYEDSDLTAPTIIYALRNLSTVEYLYLKGSSVNDNFLPNIGQMTSLKVL  112

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
             S+   +  GTLPN+G CELK+++E+   +N  EG +PS  GNLTSLR++ L++N   GNI
Sbjct  113   SMPSGENNGTLPNQGWCELKHIEEVDFLDNNFEGTLPSCLGNLTSLRWLCLAMNYFRGNI  172

Query  933   elsplstltsleyls-IMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKF  1109
                 +    +      I +N FEV  SF  F+N +KL  +    + +I DT+ Q ++P F
Sbjct  173   VSHSIWRRLTSLEYLDISHNQFEVPLSFSQFSNYTKLIYLDVGYSTIIPDTEFQNWIPNF  232

Query  1110  QLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNA  1289
             QL+   +   I L KLP FLHYQ DL++L I  N L+G+F +WLL+NNT+L  F   +NA
Sbjct  233   QLEFFGIYGYIKLQKLPSFLHYQYDLRILVIDENQLQGKFQTWLLENNTRLAGFYSRDNA  292

Query  1290  FTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI-G  1466
             F G  KL S V+  L+ I+VSNNKL G I  N S +FP +  LN+S N   G + S+  G
Sbjct  293   FDGPFKLPSIVHLYLETIDVSNNKLNGHIPANMSLAFPKLSFLNMSQNYLEGPIPSMFCG  352

Query  1467  THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGN  1646
             THL FLDLS N  +GE+P ++ I    L+ L+LSNNKL+G +  E      L +L+L+GN
Sbjct  353   THLEFLDLSVNKLSGEVPVDLTIGSPQLLYLRLSNNKLKGHMFLEVKS-HVLSFLYLNGN  411

Query  1647  NFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNL  1826
             NFEG +P ++    L  LD   N  +GEIPRW+     L+QL LS NHL+G IP+E CNL
Sbjct  412   NFEGPLPENIFLRSLIVLDASRNSFTGEIPRWITDNKRLLQLDLSNNHLQGLIPVEICNL  471

Query  1827  KSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSF  2006
             K L++L +SEN L+G IPSC++   +KH+ L K+QL G+L    FN ++L+ LDL  N+F
Sbjct  472   KFLNVLAISENRLSGFIPSCVSSLPLKHIHLEKNQLGGELGHVLFNFSSLITLDLRRNNF  531

Query  2007  VGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKIS  2186
              G I   IG+++ L+ LLL+ N+ EG++PTQ+C L  LS++DLS N+L G +P CLG ++
Sbjct  532   AGNISHAIGSLTNLNYLLLSHNQLEGQIPTQICMLNDLSIIDLSFNMLYGPLPPCLGYLT  591

Query  2187  LEGTNEQFRGINLPF----EYYSINDAILDRLHYEWGSDDEYIP--MLAVDVLPEVQFRT  2348
                 + +      P      + S    +  + HY    D   +P  +  +DV  +VQF T
Sbjct  592   RTKKDAEISWTYYPATSTRSWLSFEIWMRSKRHYH---DSHGLPSDLFLMDVETQVQFST  648

Query  2349  KGNLYNYQNSILK  2387
             K N Y Y+ SILK
Sbjct  649   KRNSYTYKGSILK  661


 Score = 77.8 bits (190),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 129/504 (26%), Positives = 204/504 (40%), Gaps = 89/504 (18%)
 Frame = +3

Query  741   LKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKL  920
             L+ + +S  ++ G +P         L  L +S+N LEG IPS F   T L +++LS+NKL
Sbjct  307   LETIDVSNNKLNGHIPANMSLAFPKLSFLNMSQNYLEGPIPSMFCG-THLEFLDLSVNKL  365

Query  921   SGNIelsplstltsleylsIMNNSF------EVASSFRSFA--NNSKLRVILAD----RN  1064
             SG + +        L YL + NN        EV S   SF   N +     L +    R+
Sbjct  366   SGEVPVDLTIGSPQLLYLRLSNNKLKGHMFLEVKSHVLSFLYLNGNNFEGPLPENIFLRS  425

Query  1065  KVIADTQLQGF---VPKFQLDS-----LSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLE  1220
              ++ D     F   +P++  D+     L LSN      +P  +   + L VL IS N L 
Sbjct  426   LIVLDASRNSFTGEIPRWITDNKRLLQLDLSNNHLQGLIPVEICNLKFLNVLAISENRLS  485

Query  1221  GEFPSWL---------LQNNT---KLQYFLMN----------NNAFTGSLKLSSHVNPNL  1334
             G  PS +         L+ N    +L + L N           N F G++  +     NL
Sbjct  486   GFIPSCVSSLPLKHIHLEKNQLGGELGHVLFNFSSLITLDLRRNNFAGNISHAIGSLTNL  545

Query  1335  QIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGE  1514
               + +S+N+L G+I         ++  ++LS N+  G L   +G       L+      E
Sbjct  546   NYLLLSHNQLEGQIPTQICM-LNDLSIIDLSFNMLYGPLPPCLGY------LTRTKKDAE  598

Query  1515  IPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYL-----------HLDGNNFEGT  1661
             I      + S+   L         +   +   L S  +L             +   ++G+
Sbjct  599   ISWTYYPATSTRSWLSFEIWMRSKRHYHDSHGLPSDLFLMDVETQVQFSTKRNSYTYKGS  658

Query  1662  IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSI  1841
             I   +S +     D+  N+L+GEIP  +G ++++  L LS NHL G IP  F NL+ +  
Sbjct  659   ILKYMSGI-----DLSSNRLTGEIPVELGNMSNIHALNLSHNHLNGRIPNTFSNLQEIES  713

Query  1842  LDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIP  2021
             LDLS N L GSIP  L                           +L +  ++YN+  G +P
Sbjct  714   LDLSCNRLNGSIPVGL-----------------------LELNSLAVFSVAYNNLSGAVP  750

Query  2022  EWIGTIsrlsslllNGNRFEGKVP  2093
             ++ G           GN F    P
Sbjct  751   DFKGQFGTFDKSSYEGNPFLCGYP  774



>ref|XP_010324742.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X1 [Solanum lycopersicum]
Length=880

 Score =   449 bits (1154),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 282/671 (42%), Positives = 407/671 (61%), Gaps = 20/671 (3%)
 Frame = +3

Query  399   DINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSL  578
             DI  L NLK L L  N  E F T+          I+  SYL  L   +++ + ++++ SL
Sbjct  22    DIIALSNLKHLDLRANNIESFVTTKG--------IKRMSYLRNLQFESLNSNSSRVIQSL  73

Query  579   AAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSL  758
              +F  +K+L  +  ++T    I+AL+NLS++E L+L GS+++ +FL NIG M SLKVLS+
Sbjct  74    KSFSFLKSLSYEDSDLTAPTIIYALRNLSTVEYLYLKGSSVNDNFLPNIGQMTSLKVLSM  133

Query  759   SGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
                +  GTLPN+G CELK+++E+   +N  EG +PS  GNLTSLR++ L++N   GNI  
Sbjct  134   PSGENNGTLPNQGWCELKHIEEVDFLDNNFEGTLPSCLGNLTSLRWLCLAMNYFRGNIVS  193

Query  939   splstltsleyls-IMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQL  1115
               +    +      I +N FEV  SF  F+N +KL  +    + +I DT+ Q ++P FQL
Sbjct  194   HSIWRRLTSLEYLDISHNQFEVPLSFSQFSNYTKLIYLDVGYSTIIPDTEFQNWIPNFQL  253

Query  1116  DSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
             +   +   I L KLP FLHYQ DL++L I  N L+G+F +WLL+NNT+L  F   +NAF 
Sbjct  254   EFFGIYGYIKLQKLPSFLHYQYDLRILVIDENQLQGKFQTWLLENNTRLAGFYSRDNAFD  313

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI-GTH  1472
             G  KL S V+  L+ I+VSNNKL G I  N S +FP +  LN+S N   G + S+  GTH
Sbjct  314   GPFKLPSIVHLYLETIDVSNNKLNGHIPANMSLAFPKLSFLNMSQNYLEGPIPSMFCGTH  373

Query  1473  LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNF  1652
             L FLDLS N  +GE+P ++ I    L+ L+LSNNKL+G +  E      L +L+L+GNNF
Sbjct  374   LEFLDLSVNKLSGEVPVDLTIGSPQLLYLRLSNNKLKGHMFLEVKS-HVLSFLYLNGNNF  432

Query  1653  EGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKS  1832
             EG +P ++    L  LD   N  +GEIPRW+     L+QL LS NHL+G IP+E CNLK 
Sbjct  433   EGPLPENIFLRSLIVLDASRNSFTGEIPRWITDNKRLLQLDLSNNHLQGLIPVEICNLKF  492

Query  1833  LSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVG  2012
             L++L +SEN L+G IPSC++   +KH+ L K+QL G+L    FN ++L+ LDL  N+F G
Sbjct  493   LNVLAISENRLSGFIPSCVSSLPLKHIHLEKNQLGGELGHVLFNFSSLITLDLRRNNFAG  552

Query  2013  IIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLE  2192
              I   IG+++ L+ LLL+ N+ EG++PTQ+C L  LS++DLS N+L G +P CLG ++  
Sbjct  553   NISHAIGSLTNLNYLLLSHNQLEGQIPTQICMLNDLSIIDLSFNMLYGPLPPCLGYLTRT  612

Query  2193  GTNEQFRGINLPF----EYYSINDAILDRLHYEWGSDDEYIP--MLAVDVLPEVQFRTKG  2354
               + +      P      + S    +  + HY    D   +P  +  +DV  +VQF TK 
Sbjct  613   KKDAEISWTYYPATSTRSWLSFEIWMRSKRHYH---DSHGLPSDLFLMDVETQVQFSTKR  669

Query  2355  NLYNYQNSILK  2387
             N Y Y+ SILK
Sbjct  670   NSYTYKGSILK  680


 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 129/504 (26%), Positives = 204/504 (40%), Gaps = 89/504 (18%)
 Frame = +3

Query  741   LKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKL  920
             L+ + +S  ++ G +P         L  L +S+N LEG IPS F   T L +++LS+NKL
Sbjct  326   LETIDVSNNKLNGHIPANMSLAFPKLSFLNMSQNYLEGPIPSMFCG-THLEFLDLSVNKL  384

Query  921   SGNIelsplstltsleylsIMNNSF------EVASSFRSFA--NNSKLRVILAD----RN  1064
             SG + +        L YL + NN        EV S   SF   N +     L +    R+
Sbjct  385   SGEVPVDLTIGSPQLLYLRLSNNKLKGHMFLEVKSHVLSFLYLNGNNFEGPLPENIFLRS  444

Query  1065  KVIADTQLQGF---VPKFQLDS-----LSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLE  1220
              ++ D     F   +P++  D+     L LSN      +P  +   + L VL IS N L 
Sbjct  445   LIVLDASRNSFTGEIPRWITDNKRLLQLDLSNNHLQGLIPVEICNLKFLNVLAISENRLS  504

Query  1221  GEFPSWL---------LQNNT---KLQYFLMN----------NNAFTGSLKLSSHVNPNL  1334
             G  PS +         L+ N    +L + L N           N F G++  +     NL
Sbjct  505   GFIPSCVSSLPLKHIHLEKNQLGGELGHVLFNFSSLITLDLRRNNFAGNISHAIGSLTNL  564

Query  1335  QIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGE  1514
               + +S+N+L G+I         ++  ++LS N+  G L   +G       L+      E
Sbjct  565   NYLLLSHNQLEGQIPTQICM-LNDLSIIDLSFNMLYGPLPPCLGY------LTRTKKDAE  617

Query  1515  IPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYL-----------HLDGNNFEGT  1661
             I      + S+   L         +   +   L S  +L             +   ++G+
Sbjct  618   ISWTYYPATSTRSWLSFEIWMRSKRHYHDSHGLPSDLFLMDVETQVQFSTKRNSYTYKGS  677

Query  1662  IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSI  1841
             I   +S +     D+  N+L+GEIP  +G ++++  L LS NHL G IP  F NL+ +  
Sbjct  678   ILKYMSGI-----DLSSNRLTGEIPVELGNMSNIHALNLSHNHLNGRIPNTFSNLQEIES  732

Query  1842  LDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIP  2021
             LDLS N L GSIP  L                           +L +  ++YN+  G +P
Sbjct  733   LDLSCNRLNGSIPVGL-----------------------LELNSLAVFSVAYNNLSGAVP  769

Query  2022  EWIGTIsrlsslllNGNRFEGKVP  2093
             ++ G           GN F    P
Sbjct  770   DFKGQFGTFDKSSYEGNPFLCGYP  793



>ref|XP_010324747.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 isoform X3 [Solanum lycopersicum]
Length=946

 Score =   447 bits (1151),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 319/770 (41%), Positives = 451/770 (59%), Gaps = 46/770 (6%)
 Frame = +3

Query  102   GLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEEL  281
             GL NL EL      +++INILS L                           G  + LE+L
Sbjct  9     GLSNLRELWFEGYGIDDINILSAL---------------------------GRLRNLEKL  41

Query  282   YLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGF  461
              L +  FN +IF SLK FPSLK L+L  N+  +G + + DI  L NLK L LSDN  E F
Sbjct  42    NLNDNNFNSTIFSSLKIFPSLKHLNLAANEI-NGYIEMNDIIALSNLKHLDLSDNNIESF  100

Query  462   ETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDA  641
              T     GS +   R+ S+   L L + + + ++++ SL +F S+K+L  +  ++T    
Sbjct  101   VTDK---GSKK---RSTSF-RSLLLGSSNSNSSRVIQSLKSFSSLKSLSYENSDLTAPTI  153

Query  642   IHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQ  821
             I+AL+NLS+LE L+LDGS+++ +FL NIG M SLKVLS++      T+PN+G CELK+L+
Sbjct  154   IYALRNLSTLEYLYLDGSSINDNFLPNIGHMTSLKVLSIAFGSNNDTIPNQGWCELKHLE  213

Query  822   ELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleyl-sIMNNSFE  998
             EL    N  EG +PS  GNLTSLR ++L+ N L GNI    +    +     SI +N F+
Sbjct  214   ELDFVNNNFEGTLPSCLGNLTSLRRLSLAGNNLRGNIASHSILRRLTSLEYLSIEDNQFD  273

Query  999   VASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQ  1178
             V  SF  F N +KL  +    + +I DT+ Q ++P FQL+   +  CI L KLP FLHYQ
Sbjct  274   VPLSFSQFYNYTKLIYLDVGDSTIIPDTEFQNWIPNFQLEFFGIYGCIKLQKLPSFLHYQ  333

Query  1179  RDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNN  1358
              DL++L I  N L+G+FP+WLL+NNT++      +NAF G  KL S V+  L+ I+VSNN
Sbjct  334   YDLRILVIDENQLQGKFPTWLLENNTRIAGVYSRDNAFDGPFKLPSIVHLYLKTIDVSNN  393

Query  1359  KLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI-GTHLGFLDLSNNSFTGEIPKEMLI  1535
             KL G I    S +FP + +LN+S N   G + S I G HL  LDLSNN  +GEIP +++I
Sbjct  394   KLNGHIPDKMSLAFPKLTSLNMSQNFLEGPIPSKISGIHLETLDLSNNLLSGEIPSDVVI  453

Query  1536  SCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDN  1715
                 L+ L+LSNNKL+G+I  E      L +L+L+GNN EG +P++     L  LD   N
Sbjct  454   GSPQLLFLRLSNNKLKGKIFLEVKS-HILSFLYLNGNNLEGPLPSNTFITSLFILDASRN  512

Query  1716  KLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNP  1895
               +GEIPRW+   T L+ L LSKNHL G IP+E C  K + +L +SEN L+G IPSC++ 
Sbjct  513   NFTGEIPRWITDNTRLLLLDLSKNHLTGSIPVEICKFKLIQVLAISENRLSGFIPSCVSS  572

Query  1896  SSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNR  2075
               ++H+ L K+QL G L    FN ++L+ LDL YN+F G IP  IG+++ L+ LLL+ N+
Sbjct  573   LPLEHIHLEKNQLGGGLEHVLFNFSSLITLDLRYNNFTGHIPHTIGSLNSLNYLLLSHNQ  632

Query  2076  FEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSINDA  2255
              EG++P Q+C L  LS++DLS N L G +  CLG ++ +   +  + I   F Y +  + 
Sbjct  633   LEGQIPIQICMLNMLSIMDLSFNKLYGPLFPCLGNLT-QAKKDAKKRITYYF-YKTYWNP  690

Query  2256  ILDRLHYEWGSDDEY------IPMLAVDVLPEVQFRTKGNLYNYQNSILK  2387
              L  L + W     +      +  L +D    VQF TK N Y Y+ SILK
Sbjct  691   WLTFLRWIWLERHYHNRHGILVDTLLMDAETVVQFSTKRNSYTYKGSILK  740


 Score = 89.4 bits (220),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 168/716 (23%), Positives = 286/716 (40%), Gaps = 110/716 (15%)
 Frame = +3

Query  96    LTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLE  275
             +  L NL  L   Y     IN   + N+    SLKVL I F       P       K LE
Sbjct  154   IYALRNLSTLEYLYLDGSSINDNFLPNIGHMTSLKVLSIAFGSNNDTIPNQGWCELKHLE  213

Query  276   ELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE  455
             EL      F  ++   L    SL+ L L  N+          +  L +L+ L + DN F+
Sbjct  214   ELDFVNNNFEGTLPSCLGNLTSLRRLSLAGNNLRGNIASHSILRRLTSLEYLSIEDNQFD  273

Query  456   ---GFETSANHSGSSRHTIRNKSYLEVLHLNNI-------------SFDMTKLLSSLAAF  587
                 F    N++      + + + +      N                 + KL S L   
Sbjct  274   VPLSFSQFYNYTKLIYLDVGDSTIIPDTEFQNWIPNFQLEFFGIYGCIKLQKLPSFLHYQ  333

Query  588   PSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDF-LSNIGPMESLKVLSLSG  764
               ++ L +    +        L+N + +  ++   +     F L +I  +  LK + +S 
Sbjct  334   YDLRILVIDENQLQGKFPTWLLENNTRIAGVYSRDNAFDGPFKLPSIVHLY-LKTIDVSN  392

Query  765   AQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsp  944
              ++ G +P+K       L  L +S+N LEG IPS    +  L  ++LS N LSG I    
Sbjct  393   NKLNGHIPDKMSLAFPKLTSLNMSQNFLEGPIPSKISGI-HLETLDLSNNLLSGEIPSDV  451

Query  945   lstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSL  1124
             +     L +L + NN               K ++ L  ++ +++   L G   +  L S 
Sbjct  452   VIGSPQLLFLRLSNNKL-------------KGKIFLEVKSHILSFLYLNGNNLEGPLPSN  498

Query  1125  SLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSL  1304
             +               +   L +L  SRNN  GE P W+  +NT+L    ++ N  TGS+
Sbjct  499   T---------------FITSLFILDASRNNFTGEIPRWI-TDNTRLLLLDLSKNHLTGSI  542

Query  1305  KLSSHVNPNLQIINVSNNKLCGEISGNFSS----------------------SFPNILAL  1418
              +       +Q++ +S N+L G I    SS                      +F +++ L
Sbjct  543   PVEICKFKLIQVLAISENRLSGFIPSCVSSLPLEHIHLEKNQLGGGLEHVLFNFSSLITL  602

Query  1419  NLSSNLFSGQLHSLIGTHLGFLDLS--NNSFTGEIPKEMLISCSSLVILKLSNNKLEG--  1586
             +L  N F+G +   IG+      L   +N   G+IP ++ +  + L I+ LS NKL G  
Sbjct  603   DLRYNNFTGHIPHTIGSLNSLNYLLLSHNQLEGQIPIQICM-LNMLSIMDLSFNKLYGPL  661

Query  1587  ----------------QIVQEF------DYLSSLEYLHLDGN--NFEGTIpnslsnlplh  1694
                             +I   F       +L+ L ++ L+ +  N  G + ++L      
Sbjct  662   FPCLGNLTQAKKDAKKRITYYFYKTYWNPWLTFLRWIWLERHYHNRHGILVDTLLMDAET  721

Query  1695  slDIRDNKLS----GEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENN  1862
              +     + S    G I ++M        + LS N L G IPIE  N+ ++  L+LS N+
Sbjct  722   VVQFSTKRNSYTYKGSILKYMS------GIDLSSNRLTGEIPIEIGNMSNIHTLNLSHNH  775

Query  1863  LTGSIPSCL-NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEW  2027
             L G IP+   N   I+ + LS ++L+G +        +L +  ++YN+  G +P++
Sbjct  776   LIGRIPNTFSNLQEIESLDLSCNRLNGSIPVGLIELNSLAVFSVAYNNLSGAVPDF  831



>ref|XP_010324745.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 isoform X1 [Solanum lycopersicum]
Length=1084

 Score =   447 bits (1150),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 319/770 (41%), Positives = 451/770 (59%), Gaps = 46/770 (6%)
 Frame = +3

Query  102   GLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEEL  281
             GL NL EL      +++INILS L                           G  + LE+L
Sbjct  147   GLSNLRELWFEGYGIDDINILSAL---------------------------GRLRNLEKL  179

Query  282   YLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGF  461
              L +  FN +IF SLK FPSLK L+L  N+  +G + + DI  L NLK L LSDN  E F
Sbjct  180   NLNDNNFNSTIFSSLKIFPSLKHLNLAANEI-NGYIEMNDIIALSNLKHLDLSDNNIESF  238

Query  462   ETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDA  641
              T     GS +   R+ S+   L L + + + ++++ SL +F S+K+L  +  ++T    
Sbjct  239   VTDK---GSKK---RSTSF-RSLLLGSSNSNSSRVIQSLKSFSSLKSLSYENSDLTAPTI  291

Query  642   IHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQ  821
             I+AL+NLS+LE L+LDGS+++ +FL NIG M SLKVLS++      T+PN+G CELK+L+
Sbjct  292   IYALRNLSTLEYLYLDGSSINDNFLPNIGHMTSLKVLSIAFGSNNDTIPNQGWCELKHLE  351

Query  822   ELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleyl-sIMNNSFE  998
             EL    N  EG +PS  GNLTSLR ++L+ N L GNI    +    +     SI +N F+
Sbjct  352   ELDFVNNNFEGTLPSCLGNLTSLRRLSLAGNNLRGNIASHSILRRLTSLEYLSIEDNQFD  411

Query  999   VASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQ  1178
             V  SF  F N +KL  +    + +I DT+ Q ++P FQL+   +  CI L KLP FLHYQ
Sbjct  412   VPLSFSQFYNYTKLIYLDVGDSTIIPDTEFQNWIPNFQLEFFGIYGCIKLQKLPSFLHYQ  471

Query  1179  RDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNN  1358
              DL++L I  N L+G+FP+WLL+NNT++      +NAF G  KL S V+  L+ I+VSNN
Sbjct  472   YDLRILVIDENQLQGKFPTWLLENNTRIAGVYSRDNAFDGPFKLPSIVHLYLKTIDVSNN  531

Query  1359  KLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI-GTHLGFLDLSNNSFTGEIPKEMLI  1535
             KL G I    S +FP + +LN+S N   G + S I G HL  LDLSNN  +GEIP +++I
Sbjct  532   KLNGHIPDKMSLAFPKLTSLNMSQNFLEGPIPSKISGIHLETLDLSNNLLSGEIPSDVVI  591

Query  1536  SCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDN  1715
                 L+ L+LSNNKL+G+I  E      L +L+L+GNN EG +P++     L  LD   N
Sbjct  592   GSPQLLFLRLSNNKLKGKIFLEVKS-HILSFLYLNGNNLEGPLPSNTFITSLFILDASRN  650

Query  1716  KLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNP  1895
               +GEIPRW+   T L+ L LSKNHL G IP+E C  K + +L +SEN L+G IPSC++ 
Sbjct  651   NFTGEIPRWITDNTRLLLLDLSKNHLTGSIPVEICKFKLIQVLAISENRLSGFIPSCVSS  710

Query  1896  SSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNR  2075
               ++H+ L K+QL G L    FN ++L+ LDL YN+F G IP  IG+++ L+ LLL+ N+
Sbjct  711   LPLEHIHLEKNQLGGGLEHVLFNFSSLITLDLRYNNFTGHIPHTIGSLNSLNYLLLSHNQ  770

Query  2076  FEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSINDA  2255
              EG++P Q+C L  LS++DLS N L G +  CLG ++ +   +  + I   F Y +  + 
Sbjct  771   LEGQIPIQICMLNMLSIMDLSFNKLYGPLFPCLGNLT-QAKKDAKKRITYYF-YKTYWNP  828

Query  2256  ILDRLHYEWGSDDEY------IPMLAVDVLPEVQFRTKGNLYNYQNSILK  2387
              L  L + W     +      +  L +D    VQF TK N Y Y+ SILK
Sbjct  829   WLTFLRWIWLERHYHNRHGILVDTLLMDAETVVQFSTKRNSYTYKGSILK  878


 Score = 89.4 bits (220),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 168/715 (23%), Positives = 285/715 (40%), Gaps = 110/715 (15%)
 Frame = +3

Query  96    LTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLE  275
             +  L NL  L   Y     IN   + N+    SLKVL I F       P       K LE
Sbjct  292   IYALRNLSTLEYLYLDGSSINDNFLPNIGHMTSLKVLSIAFGSNNDTIPNQGWCELKHLE  351

Query  276   ELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE  455
             EL      F  ++   L    SL+ L L  N+          +  L +L+ L + DN F+
Sbjct  352   ELDFVNNNFEGTLPSCLGNLTSLRRLSLAGNNLRGNIASHSILRRLTSLEYLSIEDNQFD  411

Query  456   ---GFETSANHSGSSRHTIRNKSYLEVLHLNNI-------------SFDMTKLLSSLAAF  587
                 F    N++      + + + +      N                 + KL S L   
Sbjct  412   VPLSFSQFYNYTKLIYLDVGDSTIIPDTEFQNWIPNFQLEFFGIYGCIKLQKLPSFLHYQ  471

Query  588   PSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDF-LSNIGPMESLKVLSLSG  764
               ++ L +    +        L+N + +  ++   +     F L +I  +  LK + +S 
Sbjct  472   YDLRILVIDENQLQGKFPTWLLENNTRIAGVYSRDNAFDGPFKLPSIVHLY-LKTIDVSN  530

Query  765   AQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsp  944
              ++ G +P+K       L  L +S+N LEG IPS    +  L  ++LS N LSG I    
Sbjct  531   NKLNGHIPDKMSLAFPKLTSLNMSQNFLEGPIPSKISGI-HLETLDLSNNLLSGEIPSDV  589

Query  945   lstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSL  1124
             +     L +L + NN               K ++ L  ++ +++   L G   +  L S 
Sbjct  590   VIGSPQLLFLRLSNNKL-------------KGKIFLEVKSHILSFLYLNGNNLEGPLPSN  636

Query  1125  SLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSL  1304
             +               +   L +L  SRNN  GE P W+  +NT+L    ++ N  TGS+
Sbjct  637   T---------------FITSLFILDASRNNFTGEIPRWI-TDNTRLLLLDLSKNHLTGSI  680

Query  1305  KLSSHVNPNLQIINVSNNKLCGEISGNFSS----------------------SFPNILAL  1418
              +       +Q++ +S N+L G I    SS                      +F +++ L
Sbjct  681   PVEICKFKLIQVLAISENRLSGFIPSCVSSLPLEHIHLEKNQLGGGLEHVLFNFSSLITL  740

Query  1419  NLSSNLFSGQLHSLIGTHLGFLDLS--NNSFTGEIPKEMLISCSSLVILKLSNNKLEG--  1586
             +L  N F+G +   IG+      L   +N   G+IP ++ +  + L I+ LS NKL G  
Sbjct  741   DLRYNNFTGHIPHTIGSLNSLNYLLLSHNQLEGQIPIQICM-LNMLSIMDLSFNKLYGPL  799

Query  1587  ----------------QIVQEF------DYLSSLEYLHLDGN--NFEGTIpnslsnlplh  1694
                             +I   F       +L+ L ++ L+ +  N  G + ++L      
Sbjct  800   FPCLGNLTQAKKDAKKRITYYFYKTYWNPWLTFLRWIWLERHYHNRHGILVDTLLMDAET  859

Query  1695  slDIRDNKLS----GEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENN  1862
              +     + S    G I ++M        + LS N L G IPIE  N+ ++  L+LS N+
Sbjct  860   VVQFSTKRNSYTYKGSILKYMS------GIDLSSNRLTGEIPIEIGNMSNIHTLNLSHNH  913

Query  1863  LTGSIPSCL-NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPE  2024
             L G IP+   N   I+ + LS ++L+G +        +L +  ++YN+  G +P+
Sbjct  914   LIGRIPNTFSNLQEIESLDLSCNRLNGSIPVGLIELNSLAVFSVAYNNLSGAVPD  968


 Score = 70.9 bits (172),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 163/687 (24%), Positives = 284/687 (41%), Gaps = 114/687 (17%)
 Frame = +3

Query  315   FQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSR  494
             F  L+  P+LK+LDL  N  +   L +  +  + +L+ L L  +    F     ++ +S 
Sbjct  81    FSKLRQLPNLKVLDLQYNPIHPKVL-LSSLCWISSLEVLKLGVDVDTSFSIPTTYNSTSM  139

Query  495   HTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLE  674
              + +                            +++ L  +   + +I+ + AL  L +LE
Sbjct  140   KSKKCG----------------------GGLSNLRELWFEGYGIDDINILSALGRLRNLE  177

Query  675   ELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEG  854
             +L+L+ +N +    S++    SLK L+L+  ++ G +    +  L NL+ L LS+N +E 
Sbjct  178   KLNLNDNNFNSTIFSSLKIFPSLKHLNLAANEINGYIEMNDIIALSNLKHLDLSDNNIES  237

Query  855   KIPSYFGNL--TSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFAN  1028
              +         TS R + L  +  + +  +  L + +SL+ LS  N+     +   +  N
Sbjct  238   FVTDKGSKKRSTSFRSLLLGSSNSNSSRVIQSLKSFSSLKSLSYENSDLTAPTIIYALRN  297

Query  1029  NSKLRVILADRNKVIADTQLQ--GFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRI  1202
              S L  +  D +  I D  L   G +   ++ S++  +  D +    +   +  L+ L  
Sbjct  298   LSTLEYLYLDGSS-INDNFLPNIGHMTSLKVLSIAFGSNNDTIPNQGWCELKH-LEELDF  355

Query  1203  SRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVN--PNLQIINVSNNKLCGEI  1376
               NN EG  PS  L N T L+   +  N   G++   S +    +L+ +++ +N+    +
Sbjct  356   VNNNFEGTLPS-CLGNLTSLRRLSLAGNNLRGNIASHSILRRLTSLEYLSIEDNQFDVPL  414

Query  1377  SGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVI  1556
             S +   ++  ++ L++  +                  + +  F   IP   L        
Sbjct  415   SFSQFYNYTKLIYLDVGDSTI----------------IPDTEFQNWIPNFQLEFFGIYGC  458

Query  1557  LKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDI--RDNKLSGE  1730
             +KL   KL   +  ++D    L  L +D N  +G  P  L         +  RDN   G 
Sbjct  459   IKLQ--KLPSFLHYQYD----LRILVIDENQLQGKFPTWLLENNTRIAGVYSRDNAFDGP  512

Query  1731  IPRWMGRLTSLVQLTL-----SKNHLEGHIP----IEFCNLKSLSI--------------  1841
                   +L S+V L L     S N L GHIP    + F  L SL++              
Sbjct  513   F-----KLPSIVHLYLKTIDVSNNKLNGHIPDKMSLAFPKLTSLNMSQNFLEGPIPSKIS  567

Query  1842  ------LDLSENNLTGSIPS--CLNPSSIKHVSLSKHQLSGQ---------LTRAFFNN-  1967
                   LDLS N L+G IPS   +    +  + LS ++L G+         L+  + N  
Sbjct  568   GIHLETLDLSNNLLSGEIPSDVVIGSPQLLFLRLSNNKLKGKIFLEVKSHILSFLYLNGN  627

Query  1968  ------------TALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQL  2111
                         T+L ILD S N+F G IP WI   +RL  L L+ N   G +P ++C+ 
Sbjct  628   NLEGPLPSNTFITSLFILDASRNNFTGEIPRWITDNTRLLLLDLSKNHLTGSIPVEICKF  687

Query  2112  MRlslldlsnnllsGVIPRCLGKISLE  2192
               + +L +S N LSG IP C+  + LE
Sbjct  688   KLIQVLAISENRLSGFIPSCVSSLPLE  714



>ref|XP_007010921.1| Receptor like protein 15, putative [Theobroma cacao]
 gb|EOY19731.1| Receptor like protein 15, putative [Theobroma cacao]
Length=1090

 Score =   444 bits (1142),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 312/792 (39%), Positives = 452/792 (57%), Gaps = 63/792 (8%)
 Frame = +3

Query  105   LINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGA---KKLE  275
             L +L+ L M   Q++    +    L + I+LK LD+ +NK +S       G       LE
Sbjct  98    LSSLKSLDMSGNQLQ--GSIDTEELNNLINLKKLDLHWNKIESLRSFQGSGRQLELTHLE  155

Query  276   ELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE  455
             EL L +  FN SIF SL+G  +LK L +  N    G + ++D++   NL EL +S N   
Sbjct  156   ELDLSDNLFNNSIFASLRGLSNLKSLYIRFNQL-KGSIDMEDLSAFTNLGELDMSYNELN  214

Query  456   GFETSANHSGSSRHTIRNKSYLEVLHLNNISF---DMTKLLSSLAAFPSIKTLELQRVNV  626
              F     H G+     R+   L++LHL+N+     +MT L   L AF S+KT  L+    
Sbjct  215   KF---VAHKGN-----RSLRKLKILHLDNVFMTNGNMTSLPGLLEAFSSVKTFYLEENYF  266

Query  627   TNIDAIHALKNLSS-LEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLC  803
                 A  +  ++SS +EE+ LD S ++ + L +IG + SLK LSLS   + GTLP++G C
Sbjct  267   NKSMAFSSELHMSSNVEEIFLDYSYINSNILKSIGVLTSLKTLSLSDCGLIGTLPDQGWC  326

Query  804   ELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIM  983
             +LKN +EL +S N L+G +PS  GNLTSLR +++S N  +GN+      T        + 
Sbjct  327   DLKNFEELCISRNALQGNLPSCLGNLTSLRVLDISDNHFTGNLSPLTNFTSLRFLS--LS  384

Query  984   NNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCID----LL  1151
              N F+V +SF S AN + L+++L+D NK++ +   Q  VPKFQL  +SLS C      + 
Sbjct  385   TNHFQVPASFISLANLTDLKILLSDGNKLVMEPVFQTSVPKFQLKMMSLSKCSTDQGLIK  444

Query  1152  KLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPN  1331
             +LP FL+YQ DL+ + +S N   G  P WLL+NNTKL+  ++ +N FTG L      +  
Sbjct  445   ELPMFLYYQYDLRYVDLSYNKFSGMLPFWLLENNTKLEELILTDNFFTGPLLFPPFPHLE  504

Query  1332  LQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSF  1505
                I++SNNK+  +IS +  S+FP++  L+LS+N F G +   +G  +HL  LDLSNN  
Sbjct  505   ASSIDISNNKIQAQISADICSAFPHLGQLSLSTNAFRGNIPPCLGGMSHLYSLDLSNNQL  564

Query  1506  TGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGT-----Ipn  1670
             +G +P+E+ +S  SL +L+LSNN L G++V        L  L+LDGNNF G      +  
Sbjct  565   SGGVPEELSMS-RSLEVLRLSNNNLSGKVVPTILKSKFLGELYLDGNNFAGQRLDIDVLA  623

Query  1671  slsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDL  1850
                   L  +D+ +N LSGE+PRW+   + L +L LS NH EG IP+E CNL +L  LDL
Sbjct  624   VDFPYFLQGIDLSNNSLSGELPRWIWNFSYLERLDLSNNHFEGSIPMELCNLDNLEFLDL  683

Query  1851  SENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWI  2030
             S+NNL+G IPSC NP SIKHV LSK++LSG LTRA +++++LV LDL  N   G IPEWI
Sbjct  684   SQNNLSGCIPSCFNPPSIKHVHLSKNRLSGPLTRALYSSSSLVTLDLRANKLTGNIPEWI  743

Query  2031  GTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLE--GTN-  2201
             GT+S L+ LLL  N+ +GK+P Q+C+   LS++DLS N+LSG IP CLG ++LE  G+  
Sbjct  744   GTLSALNVLLLKANQLDGKIPVQLCKSYFLSIIDLSQNMLSGPIPSCLGNLTLELMGSKS  803

Query  2202  -----------EQFRGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRT  2348
                         ++ G+ + F ++S+     D    EW                 V+F T
Sbjct  804   SLGIVYSGFEVSKYIGMEVEFSFFSVLHRYPDSYMEEW-----------------VEFTT  846

Query  2349  KGNLYNYQNSIL  2384
             K   + Y   IL
Sbjct  847   KSGSHKYTGVIL  858


 Score = 98.6 bits (244),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 176/700 (25%), Positives = 294/700 (42%), Gaps = 125/700 (18%)
 Frame = +3

Query  111   NLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGA--KKLEELY  284
             N+EE+ + Y+ +    + S+  L    +L + D G       G + D G    K  EEL 
Sbjct  281   NVEEIFLDYSYINSNILKSIGVLTSLKTLSLSDCGL-----IGTLPDQGWCDLKNFEELC  335

Query  285   LFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---  455
             +       ++   L    SL++LD+ DN F     ++  + +  +L+ L LS N+F+   
Sbjct  336   ISRNALQGNLPSCLGNLTSLRVLDISDNHFTG---NLSPLTNFTSLRFLSLSTNHFQVPA  392

Query  456   GFETSANHSG--------------SSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAF--  587
              F + AN +                   T   K  L+++ L+  S D   L+  L  F  
Sbjct  393   SFISLANLTDLKILLSDGNKLVMEPVFQTSVPKFQLKMMSLSKCSTDQ-GLIKELPMFLY  451

Query  588   --PSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLS  761
                 ++ ++L     + +     L+N + LEEL L  +      L    P      + +S
Sbjct  452   YQYDLRYVDLSYNKFSGMLPFWLLENNTKLEELILTDNFFTGPLLFPPFPHLEASSIDIS  511

Query  762   GAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIels  941
               ++   +         +L +L LS N   G IP   G ++ L  ++LS N+LSG +   
Sbjct  512   NNKIQAQISADICSAFPHLGQLSLSTNAFRGNIPPCLGGMSHLYSLDLSNNQLSGGVPEE  571

Query  942   plstltsleylsIMNNSFEVASSFRSFANNSKLRVILAD-RNKVIADTQLQG--FV----  1100
                          M+ S EV    R   NN   +V+    ++K + +  L G  F     
Sbjct  572   LS-----------MSRSLEV---LRLSNNNLSGKVVPTILKSKFLGELYLDGNNFAGQRL  617

Query  1101  ---------PKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNN  1253
                      P F L  + LSN     +LPR++     L+ L +S N+ EG  P  L  N 
Sbjct  618   DIDVLAVDFPYF-LQGIDLSNNSLSGELPRWIWNFSYLERLDLSNNHFEGSIPMELC-NL  675

Query  1254  TKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSN  1433
               L++  ++ N  +G +  S    P+++ +++S N+L G ++    SS  +++ L+L +N
Sbjct  676   DNLEFLDLSQNNLSGCIP-SCFNPPSIKHVHLSKNRLSGPLTRALYSS-SSLVTLDLRAN  733

Query  1434  LFSGQLHSLIGT--HLGFLDLSNNSFTGEIPKEMLISCSS--LVILKLSNNKLEGQIVQ-  1598
               +G +   IGT   L  L L  N   G+IP ++   C S  L I+ LS N L G I   
Sbjct  734   KLTGNIPEWIGTLSALNVLLLKANQLDGKIPVQL---CKSYFLSIIDLSQNMLSGPIPSC  790

Query  1599  --------------------------------EFDYLSSL------------EYLHLDGN  1646
                                             EF + S L            E+    G+
Sbjct  791   LGNLTLELMGSKSSLGIVYSGFEVSKYIGMEVEFSFFSVLHRYPDSYMEEWVEFTTKSGS  850

Query  1647  N-FEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCN  1823
             + + G I + +  +     D+  N L+G+IP  +G L+ +  L LS N+L G IP  F N
Sbjct  851   HKYTGVILDYMFGI-----DLSCNNLTGQIPFELGNLSEIRSLNLSHNNLIGVIPQSFSN  905

Query  1824  LKSLSILDLSENNLTGSIP-SCLNPSSIKHVSLSKHQLSG  1940
             LK +  LDLS N+L+G IP   +  +S++  S++ + LSG
Sbjct  906   LKQIESLDLSYNSLSGRIPMQLIELNSLEVFSVAHNNLSG  945


 Score = 95.9 bits (237),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 196/704 (28%), Positives = 319/704 (45%), Gaps = 71/704 (10%)
 Frame = +3

Query  246   NDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLK  425
             N++GG  ++ +L      F  + F  L+G  SLK LD+  N    G +  +++N+L NLK
Sbjct  15    NNLGGTVRIHDLS--SNLFRNNTFAFLRGLSSLKSLDMSRNQL-QGSIDTEELNNLTNLK  71

Query  426   ELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTL  605
              L LS+N  E       + G++       S L+ L ++      +     L    ++K L
Sbjct  72    NLDLSENRIESLLPL--YQGTTHLHSFVLSSLKSLDMSGNQLQGSIDTEELNNLINLKKL  129

Query  606   ELQRVNVTNIDAIHALKN---LSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVG  776
             +L    + ++ +         L+ LEEL L  +  +    +++  + +LK L +   Q+ 
Sbjct  130   DLHWNKIESLRSFQGSGRQLELTHLEELDLSDNLFNNSIFASLRGLSNLKSLYIRFNQLK  189

Query  777   GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKL---SGNIels--  941
             G++  + L    NL EL +S N+L  K  ++ GN +  +   L L+ +   +GN+     
Sbjct  190   GSIDMEDLSAFTNLGELDMSYNELN-KFVAHKGNRSLRKLKILHLDNVFMTNGNMTSLPG  248

Query  942   plstltsleylsIMNNSFEVASSFRS-FANNSKLRVILADRNKVIADTQLQGFVPKFQLD  1118
              L   +S++   +  N F  + +F S    +S +  I  D + + ++  L+       L 
Sbjct  249   LLEAFSSVKTFYLEENYFNKSMAFSSELHMSSNVEEIFLDYSYINSNI-LKSIGVLTSLK  307

Query  1119  SLSLSNCIDLLKLP-RFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
             +LSLS+C  +  LP +     ++ + L ISRN L+G  PS  L N T L+   +++N FT
Sbjct  308   TLSLSDCGLIGTLPDQGWCDLKNFEELCISRNALQGNLPS-CLGNLTSLRVLDISDNHFT  366

Query  1296  GSLK----------LSSHVN--------------PNLQIINVSNNKLCGEISGNFSSSFP  1403
             G+L           LS   N               +L+I+    NKL  E    F +S P
Sbjct  367   GNLSPLTNFTSLRFLSLSTNHFQVPASFISLANLTDLKILLSDGNKLVMEPV--FQTSVP  424

Query  1404  NILALNLSSNLFS---GQLHSL-----IGTHLGFLDLSNNSFTGEIPKEMLISCSSLVIL  1559
                   +S +  S   G +  L         L ++DLS N F+G +P  +L + + L  L
Sbjct  425   KFQLKMMSLSKCSTDQGLIKELPMFLYYQYDLRYVDLSYNKFSGMLPFWLLENNTKLEEL  484

Query  1560  KLSNNKLEGQIVQEFDYLSSLEYLHLD--GNNFEGTIpnslsnl--plhslDIRDNKLSG  1727
              L++N   G ++  F     LE   +D   N  +  I   + +    L  L +  N   G
Sbjct  485   ILTDNFFTGPLL--FPPFPHLEASSIDISNNKIQAQISADICSAFPHLGQLSLSTNAFRG  542

Query  1728  EIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGS-IPSCLNPSSI  1904
              IP  +G ++ L  L LS N L G +P E    +SL +L LS NNL+G  +P+ L    +
Sbjct  543   NIPPCLGGMSHLYSLDLSNNQLSGGVPEELSMSRSLEVLRLSNNNLSGKVVPTILKSKFL  602

Query  1905  KHVSLSKHQLSGQ--------LTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlssll  2060
               + L  +  +GQ        +   +F    L  +DLS NS  G +P WI   S L  L 
Sbjct  603   GELYLDGNNFAGQRLDIDVLAVDFPYF----LQGIDLSNNSLSGELPRWIWNFSYLERLD  658

Query  2061  lNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLE  2192
             L+ N FEG +P ++C L  L  LDLS N LSG IP C    S++
Sbjct  659   LSNNHFEGSIPMELCNLDNLEFLDLSQNNLSGCIPSCFNPPSIK  702


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 115/437 (26%), Positives = 196/437 (45%), Gaps = 58/437 (13%)
 Frame = +3

Query  723   IGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVN  902
             +G + SLK L L G  +GGT+               LS N       ++   L+SL+ ++
Sbjct  1     MGNISSLKALYLRGNNLGGTVRIHD-----------LSSNLFRNNTFAFLRGLSSLKSLD  49

Query  903   LSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADT  1082
             +S N+L G+I+   L+ LT+L+ L +  N  E          +    V+ + ++  ++  
Sbjct  50    MSRNQLQGSIDTEELNNLTNLKNLDLSENRIESLLPLYQGTTHLHSFVLSSLKSLDMSGN  109

Query  1083  QLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKL  1262
             QLQG      +D+  L+N I+L KL    +    L+  + S   LE           T L
Sbjct  110   QLQG-----SIDTEELNNLINLKKLDLHWNKIESLRSFQGSGRQLEL----------THL  154

Query  1263  QYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFS  1442
             +   +++N F  S+  S     NL+ + +  N+L G I     S+F              
Sbjct  155   EELDLSDNLFNNSIFASLRGLSNLKSLYIRFNQLKGSIDMEDLSAF--------------  200

Query  1443  GQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSN----NKLEGQIVQEFDY  1610
                     T+LG LD+S N     +  +   S   L IL L N    N     +    + 
Sbjct  201   --------TNLGELDMSYNELNKFVAHKGNRSLRKLKILHLDNVFMTNGNMTSLPGLLEA  252

Query  1611  LSSLEYLHLDGNNFEGTIpnslsnlplhslD---IRDNKLSGEIPRWMGRLTSLVQLTLS  1781
              SS++  +L+ N F  ++  S       +++   +  + ++  I + +G LTSL  L+LS
Sbjct  253   FSSVKTFYLEENYFNKSMAFSSELHMSSNVEEIFLDYSYINSNILKSIGVLTSLKTLSLS  312

Query  1782  KNHLEGHIPIE-FCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQLTRA  1955
                L G +P + +C+LK+   L +S N L G++PSCL N +S++ + +S +  +G L+  
Sbjct  313   DCGLIGTLPDQGWCDLKNFEELCISRNALQGNLPSCLGNLTSLRVLDISDNHFTGNLS-P  371

Query  1956  FFNNTALVILDLSYNSF  2006
               N T+L  L LS N F
Sbjct  372   LTNFTSLRFLSLSTNHF  388



>ref|XP_009602464.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana tomentosiformis]
Length=843

 Score =   432 bits (1110),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 284/641 (44%), Positives = 394/641 (61%), Gaps = 21/641 (3%)
 Frame = +3

Query  504   RNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELH  683
             +  S +  L L   +F+ T +L SL +F S+++L     N+T     +AL NLS+LE L+
Sbjct  13    KGMSCVRALVLGGSNFNSTNVLQSLKSFSSLESLAYVYSNLTAPAITYALTNLSTLEYLY  72

Query  684   LDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIP  863
             L GS+L+++FLS+IG M SLKVLSL+     GTLPN+G CELKN+QEL  + N  EG +P
Sbjct  73    LGGSSLNENFLSSIGQMTSLKVLSLAFGDNYGTLPNQGWCELKNIQELAFTNNNFEGTLP  132

Query  864   SYFGNLTSLRYVNLSLNKLSGNIelsplstltsley-lsIMNNSFEVASSFRSFANNSKL  1040
             S  GNLTSLR+++L+ N  +GNI+L P     +    L I +N FEV  SF+ FAN+SKL
Sbjct  133   SCLGNLTSLRWLSLTGNSFTGNIDLHPFWRRLTSLEFLDISHNHFEVPLSFKQFANHSKL  192

Query  1041  RVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLE  1220
               +    N +  DT+ Q ++P FQL   ++  CI+L KLP FL YQ DL++L I  N L 
Sbjct  193   TYLDVGSNTITTDTEFQNWIPNFQLQLFAIQGCINLQKLPSFLRYQYDLRILAIGGNQLP  252

Query  1221  GEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSF  1400
             G FP+WLL+NNT+L      +NA  G L+L S   P L  I+VSNNKL G I  N SS+F
Sbjct  253   GNFPTWLLENNTRLGGLYARDNALIGPLELPSTSLPRLHTIDVSNNKLNGHIPANISSAF  312

Query  1401  PNILALNLSSNLFSGQLHSLI-GTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNK  1577
             P +  LN+S NL  G +HS + G HL  LDLS N  +G +P + L S  +L+ L+LS N+
Sbjct  313   PKLTILNMSQNLLEGPIHSKVSGIHLQILDLSQNFLSGGVPSD-LTSSPALLYLRLSYNR  371

Query  1578  LEGQIVQEFDYLSS-LEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRL  1754
             L GQI    D+ S  L +L+L+ NNFEG +P+++  +    LD  +N  SGEIPR +   
Sbjct  372   LIGQIFSN-DFRSGILSFLYLNDNNFEGPLPSNIFLIAFIVLDASNNNFSGEIPRGIREN  430

Query  1755  TSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQL  1934
             + L+QL LSKNH EG IP+E CNLKS+ +L +SEN L+G+IPSC++   ++H+ L K+QL
Sbjct  431   SRLLQLDLSKNHFEGSIPVEICNLKSIQVLAMSENRLSGTIPSCVSSLPLEHIHLDKNQL  490

Query  1935  SGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLM  2114
              G L  A  N ++L+ LDL YNSF G IP  IG++S L+ LLLN N+ EG +P Q+C L 
Sbjct  491   GGGLEYALPNISSLITLDLGYNSFTGSIPHTIGSLSNLNFLLLNHNQLEGNIPAQICLLN  550

Query  2115  RlslldlsnnllsGVIPRCLGKI-SLEGTNEQFRGINLPFEYYSINDAILDRLHY-EWGS  2288
             +LS++DLS N L   +  CLG +  +E   +  R       +Y    +  + LH+  W S
Sbjct  551   KLSIMDLSFNKLYSPLLHCLGNLKQVENDEQTIR------SFYFRMTSRAEWLHFLSWIS  604

Query  2289  DDEYI--------PMLAVDVLPEVQFRTKGNLYNYQNSILK  2387
                +          +  +DV   VQF TK N Y Y+ SILK
Sbjct  605   STRHYHITYGFISDVTLMDVETRVQFSTKRNTYTYKGSILK  645


 Score = 95.1 bits (235),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 159/594 (27%), Positives = 250/594 (42%), Gaps = 81/594 (14%)
 Frame = +3

Query  174   NLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKIL  353
             +LK F SL+ L   ++   +      +     LE LYL     N++   S+    SLK+L
Sbjct  36    SLKSFSSLESLAYVYSNLTAPAITYALTNLSTLEYLYLGGSSLNENFLSSIGQMTSLKVL  95

Query  354   DLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTI----------  503
              L   D Y G L  Q   +L+N++EL  ++N FEG   S   + +S   +          
Sbjct  96    SLAFGDNY-GTLPNQGWCELKNIQELAFTNNNFEGTLPSCLGNLTSLRWLSLTGNSFTGN  154

Query  504   -------RNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNL  662
                    R  + LE L +++  F++       A    +  L++    +T           
Sbjct  155   IDLHPFWRRLTSLEFLDISHNHFEVPLSFKQFANHSKLTYLDVGSNTITTDTEFQNWIPN  214

Query  663   SSLEELHLDGS-NLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSE  839
               L+   + G  NL K   S +     L++L++ G Q+ G  P   L     L  L+  +
Sbjct  215   FQLQLFAIQGCINLQK-LPSFLRYQYDLRILAIGGNQLPGNFPTWLLENNTRLGGLYARD  273

Query  840   NQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRS  1019
             N L G +     +L  L  +++S NKL+G+I                      ++S+F  
Sbjct  274   NALIGPLELPSTSLPRLHTIDVSNNKLNGHIPA-------------------NISSAF--  312

Query  1020  FANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLR  1199
                  KL ++   +N  + +  +   V    L  L LS       +P  L     L  LR
Sbjct  313   ----PKLTILNMSQN--LLEGPIHSKVSGIHLQILDLSQNFLSGGVPSDLTSSPALLYLR  366

Query  1200  ISRNNLEGEFPSWLLQNNTK---LQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCG  1370
             +S N L G+    +  N+ +   L +  +N+N F G L  S+       +++ SNN   G
Sbjct  367   LSYNRLIGQ----IFSNDFRSGILSFLYLNDNNFEGPLP-SNIFLIAFIVLDASNNNFSG  421

Query  1371  EISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSL  1550
             EI        P  +  N               + L  LDLS N F G IP E + +  S+
Sbjct  422   EI--------PRGIREN---------------SRLLQLDLSKNHFEGSIPVE-ICNLKSI  457

Query  1551  VILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnsls-nlplhslDIRDNKLSG  1727
              +L +S N+L G I      L  LE++HLD N   G +  +L     L +LD+  N  +G
Sbjct  458   QVLAMSENRLSGTIPSCVSSL-PLEHIHLDKNQLGGGLEYALPNISSLITLDLGYNSFTG  516

Query  1728  EIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL  1889
              IP  +G L++L  L L+ N LEG+IP + C L  LSI+DLS N L   +  CL
Sbjct  517   SIPHTIGSLSNLNFLLLNHNQLEGNIPAQICLLNKLSIMDLSFNKLYSPLLHCL  570


 Score = 80.1 bits (196),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 189/760 (25%), Positives = 306/760 (40%), Gaps = 157/760 (21%)
 Frame = +3

Query  96    LTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGA--KK  269
             LT L  LE L++  + + E N LS  ++    SLKVL + F    ++G + + G    K 
Sbjct  62    LTNLSTLEYLYLGGSSLNE-NFLS--SIGQMTSLKVLSLAFG--DNYGTLPNQGWCELKN  116

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDI-NDLRNLKELYLSDN  446
             ++EL      F  ++   L    SL+ L L  N F  G + +      L +L+ L +S N
Sbjct  117   IQELAFTNNNFEGTLPSCLGNLTSLRWLSLTGNSF-TGNIDLHPFWRRLTSLEFLDISHN  175

Query  447   YFE---GFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQR  617
             +FE    F+  ANHS          +YL+V   N I+ D T+  + +  F  ++   +Q 
Sbjct  176   HFEVPLSFKQFANHS--------KLTYLDV-GSNTITTD-TEFQNWIPNF-QLQLFAIQG  224

Query  618   -VNVTNIDAIHALKNLSSLEELHLDGSNLHKDF----LSN--------------IGPME-  737
              +N+  + +   L+    L  L + G+ L  +F    L N              IGP+E 
Sbjct  225   CINLQKLPSF--LRYQYDLRILAIGGNQLPGNFPTWLLENNTRLGGLYARDNALIGPLEL  282

Query  738   ------SLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYV  899
                    L  + +S  ++ G +P         L  L +S+N LEG I S    +  L+ +
Sbjct  283   PSTSLPRLHTIDVSNNKLNGHIPANISSAFPKLTILNMSQNLLEGPIHSKVSGI-HLQIL  341

Query  900   NLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD  1079
             +LS N LSG +     S+   L      N         + F+N+ +  ++       + D
Sbjct  342   DLSQNFLSGGVPSDLTSSPALLYLRLSYNRLIG-----QIFSNDFRSGIL---SFLYLND  393

Query  1080  TQLQGFVPK----FQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQ  1247
                +G +P          L  SN     ++PR +     L  L +S+N+ EG  P  +  
Sbjct  394   NNFEGPLPSNIFLIAFIVLDASNNNFSGEIPRGIRENSRLLQLDLSKNHFEGSIPVEIC-  452

Query  1248  NNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNI---LAL  1418
             N   +Q   M+ N  +G++       P L+ I++  N+L     G    + PNI   + L
Sbjct  453   NLKSIQVLAMSENRLSGTIPSCVSSLP-LEHIHLDKNQL----GGGLEYALPNISSLITL  507

Query  1419  NLSSNLFSGQLHSLIGTHLGFLDLSNNSFT--GEIPKEMLISCSSLVILKLSNNKL----  1580
             +L  N F+G +   IG+      L  N     G IP ++ +  + L I+ LS NKL    
Sbjct  508   DLGYNSFTGSIPHTIGSLSNLNFLLLNHNQLEGNIPAQICL-LNKLSIMDLSFNKLYSPL  566

Query  1581  ------------EGQIVQEFDY--LSSLEYLHL---------------------------  1637
                         + Q ++ F +   S  E+LH                            
Sbjct  567   LHCLGNLKQVENDEQTIRSFYFRMTSRAEWLHFLSWISSTRHYHITYGFISDVTLMDVET  626

Query  1638  --------DGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHL  1793
                     +   ++G+I   +S +     D+  N+L+GEIP  +G L+ +  L LS NHL
Sbjct  627   RVQFSTKRNTYTYKGSILKYMSGI-----DLSSNRLTGEIPIELGNLSKIHALNLSHNHL  681

Query  1794  EGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTA  1973
              G IP  F  L  +  LDLS N+L GSIP  L         L  H L+            
Sbjct  682   IGRIPESFSYLHEVESLDLSYNSLNGSIPEGL---------LELHPLA------------  720

Query  1974  LVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
               +  +++N+  G +PE+ G           GN F    P
Sbjct  721   --VFSVAHNNLSGRVPEFKGQFGTFDKSSYEGNPFLCGYP  758



>ref|XP_007010925.1| Receptor like protein 15, putative [Theobroma cacao]
 gb|EOY19735.1| Receptor like protein 15, putative [Theobroma cacao]
Length=1252

 Score =   417 bits (1073),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 289/690 (42%), Positives = 407/690 (59%), Gaps = 67/690 (10%)
 Frame = +3

Query  162   LSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGA---KKLEELYLFECRFNQSIFQSLKG  332
             L  L L + I+LK LD+ +NK +S       G       LEEL L E  FN SIF SL+G
Sbjct  348   LKTLELNNLINLKKLDLRWNKIESLRSFQGSGRQLELTHLEELDLSENLFNNSIFASLRG  407

Query  333   FPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNK  512
               +LK L +  N    G + ++D++   NL+EL +S+N    F           H + NK
Sbjct  408   LSNLKSLYISSNQL-KGSIDMEDLSAFTNLEELDMSNNELNKFVG---------HKV-NK  456

Query  513   SYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDG  692
             S                      AF S                   L   S++EE+ LD 
Sbjct  457   S---------------------MAFSS------------------ELHMSSNVEEIFLDY  477

Query  693   SNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYF  872
             S+L+ + + +IG + SLK LSLS   + GTLP++G C+LKNL+EL++S N L+G +PS  
Sbjct  478   SDLNSNIVQSIGVLNSLKTLSLSDCGLIGTLPDRGWCDLKNLEELYISRNALQGNLPSCL  537

Query  873   GNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVIL  1052
             GNLTSLR +++S N+ +GN+      T   + +  +  N F+V +SF S AN + L+++L
Sbjct  538   GNLTSLRVLDISDNQFTGNLSPLTNFTSLRVLF--LSTNHFQVPASFISLANLTDLKILL  595

Query  1053  ADRNKVIADTQLQGFVPKFQLDSLSLSNCI---DLLK-LPRFLHYQRDLKVLRISRNNLE  1220
             +D NK++ D   Q  VPKFQL+ ++LS C    +L+K LP+FL+YQ DL+ + +S N   
Sbjct  596   SDGNKLVMDPVFQTSVPKFQLNMMTLSKCSTDQELIKELPKFLYYQYDLRYVDLSYNKFS  655

Query  1221  GEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSF  1400
             G  P WLL+NNTKL+  ++ +N FTG L      +     I++SNNK+  +IS +  S+F
Sbjct  656   GMLPFWLLENNTKLEGLILADNFFTGPLLFPPFPHLEASSIDISNNKIQAQISVDICSAF  715

Query  1401  PNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNN  1574
             P++  L LS+N F   +   +G  + L  LDLSNN  +G +PKE+ +S SSL +L+LSNN
Sbjct  716   PHLEKLILSANTFEDNIPPCLGGMSQLTILDLSNNQLSGGVPKELSMS-SSLRVLRLSNN  774

Query  1575  KLEGQIVQEFDYLSSLEYLHLDGNNFEGT-----IpnslsnlplhslDIRDNKLSGEIPR  1739
              L G +V        L  L+LDGNNF G      I        L  +D+ +N LSGE+PR
Sbjct  775   NLSGNVVPIILKSKFLLELYLDGNNFAGQRLDIDILTVGFPYFLRGIDLSNNSLSGELPR  834

Query  1740  WMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSL  1919
             W+  L++L +L LS NH EG IP+E CNL +L  LDLS+NNL+GSIPSC NP SIKHV L
Sbjct  835   WIWNLSNLERLDLSNNHFEGSIPMELCNLHNLEFLDLSQNNLSGSIPSCFNPPSIKHVHL  894

Query  1920  SKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQ  2099
             SK++LSG LT A +N+++LV LDL  N   G IPEWIGT+S L+ LLL  N+ +GK+P Q
Sbjct  895   SKNRLSGPLTLALYNSSSLVTLDLRANKLTGNIPEWIGTLSALNVLLLKANQLDGKIPVQ  954

Query  2100  VCQLMRlslldlsnnllsGVIPRCLGKISL  2189
             +C+   LS++DLS N+LSG IP CLG  +L
Sbjct  955   LCKSYFLSIIDLSQNMLSGPIPSCLGNFTL  984


 Score =   159 bits (403),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 194/656 (30%), Positives = 299/656 (46%), Gaps = 123/656 (19%)
 Frame = +3

Query  72    LNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIG---FNKF-----  227
              NNS    L GL NL+ L++   Q++    + + +L  F +L+ LD+     NKF     
Sbjct  397   FNNSIFASLRGLSNLKSLYISSNQLK--GSIDMEDLSAFTNLEELDMSNNELNKFVGHKV  454

Query  228   -QSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDI  404
              +S    +++  +  +EE++L     N +I QS+    SLK L L D     G L  +  
Sbjct  455   NKSMAFSSELHMSSNVEEIFLDYSDLNSNIVQSIGVLNSLKTLSLSDCGLI-GTLPDRGW  513

Query  405   NDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAA  584
              DL+NL+ELY+S N  +G   S          + N + L VL +++  F  T  LS L  
Sbjct  514   CDLKNLEELYISRNALQGNLPSC---------LGNLTSLRVLDISDNQF--TGNLSPLTN  562

Query  585   FPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKD--FLSNIGPMESLKVLSL  758
             F S++ L L   +     +  +L NL+ L+ L  DG+ L  D  F +++ P   L +++L
Sbjct  563   FTSLRVLFLSTNHFQVPASFISLANLTDLKILLSDGNKLVMDPVFQTSV-PKFQLNMMTL  621

Query  759   SGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
             S                        ++ +L  ++P +      LRYV+LS NK SG +  
Sbjct  622   SKCS---------------------TDQELIKELPKFLYYQYDLRYVDLSYNKFSGML--  658

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLR-VILADRNKVIADTQLQGFVPKFQL  1115
                                     F    NN+KL  +ILAD N          F P  + 
Sbjct  659   -----------------------PFWLLENNTKLEGLILAD-NFFTGPLLFPPF-PHLEA  693

Query  1116  DSLSLSN-------CIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFL  1274
              S+ +SN        +D+     F H ++    L +S N  E   P   L   ++L    
Sbjct  694   SSIDISNNKIQAQISVDICS--AFPHLEK----LILSANTFEDNIPP-CLGGMSQLTILD  746

Query  1275  MNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISG-NFSSSFPNILALNLSSNLFSGQL  1451
             ++NN  +G +     ++ +L+++ +SNN L G +      S F  +L L L  N F+GQ 
Sbjct  747   LSNNQLSGGVPKELSMSSSLRVLRLSNNNLSGNVVPIILKSKF--LLELYLDGNNFAGQR  804

Query  1452  HSLIGTHLGF------LDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYL  1613
               +    +GF      +DLSNNS +GE+P+  + + S+L  L LSNN  EG I  E   L
Sbjct  805   LDIDILTVGFPYFLRGIDLSNNSLSGELPR-WIWNLSNLERLDLSNNHFEGSIPMELCNL  863

Query  1614  SSLEYLHLDGNNFEGTI------------------------pnslsnlplhslDIRDNKL  1721
              +LE+L L  NN  G+I                            ++  L +LD+R NKL
Sbjct  864   HNLEFLDLSQNNLSGSIPSCFNPPSIKHVHLSKNRLSGPLTLALYNSSSLVTLDLRANKL  923

Query  1722  SGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL  1889
             +G IP W+G L++L  L L  N L+G IP++ C    LSI+DLS+N L+G IPSCL
Sbjct  924   TGNIPEWIGTLSALNVLLLKANQLDGKIPVQLCKSYFLSIIDLSQNMLSGPIPSCL  979


 Score =   102 bits (253),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 174/688 (25%), Positives = 294/688 (43%), Gaps = 98/688 (14%)
 Frame = +3

Query  111   NLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGA--KKLEELY  284
             N+EE+ + Y+ +    + S+  L    +L + D G       G + D G    K LEELY
Sbjct  469   NVEEIFLDYSDLNSNIVQSIGVLNSLKTLSLSDCGL-----IGTLPDRGWCDLKNLEELY  523

Query  285   LFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---  455
             +       ++   L    SL++LD+ DN F     ++  + +  +L+ L+LS N+F+   
Sbjct  524   ISRNALQGNLPSCLGNLTSLRVLDISDNQFTG---NLSPLTNFTSLRVLFLSTNHFQVPA  580

Query  456   GFETSANHSG--------------SSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAF--  587
              F + AN +                   T   K  L ++ L+  S D  +L+  L  F  
Sbjct  581   SFISLANLTDLKILLSDGNKLVMDPVFQTSVPKFQLNMMTLSKCSTDQ-ELIKELPKFLY  639

Query  588   --PSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLS  761
                 ++ ++L     + +     L+N + LE L L  +      L    P      + +S
Sbjct  640   YQYDLRYVDLSYNKFSGMLPFWLLENNTKLEGLILADNFFTGPLLFPPFPHLEASSIDIS  699

Query  762   GAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIels  941
               ++   +         +L++L LS N  E  IP   G ++ L  ++LS N+LSG +   
Sbjct  700   NNKIQAQISVDICSAFPHLEKLILSANTFEDNIPPCLGGMSQLTILDLSNNQLSGGVPKE  759

Query  942   plstltsleylsIMNNSFEVASSFRSFANNSK--LRVILADRN----KVIADTQLQGFVP  1103
                + +        NN   ++ +       SK  L + L   N    ++  D    GF P
Sbjct  760   LSMSSSLRVLRLSNNN---LSGNVVPIILKSKFLLELYLDGNNFAGQRLDIDILTVGF-P  815

Query  1104  KFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNN  1283
              F L  + LSN     +LPR++    +L+ L +S N+ EG  P  L  N   L++  ++ 
Sbjct  816   YF-LRGIDLSNNSLSGELPRWIWNLSNLERLDLSNNHFEGSIPMELC-NLHNLEFLDLSQ  873

Query  1284  NAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI  1463
             N  +GS+  S    P+++ +++S N+L G ++    +S  +++ L+L +N  +G +   I
Sbjct  874   NNLSGSIP-SCFNPPSIKHVHLSKNRLSGPLTLALYNS-SSLVTLDLRANKLTGNIPEWI  931

Query  1464  GT--HLGFLDLSNNSFTGEIPKEMLISCSS--LVILKLSNNKLEGQIVQ-----------  1598
             GT   L  L L  N   G+IP ++   C S  L I+ LS N L G I             
Sbjct  932   GTLSALNVLLLKANQLDGKIPVQL---CKSYFLSIIDLSQNMLSGPIPSCLGNFTLGLMY  988

Query  1599  ----------EFDYLSSLEYLHL--------------DGNNFEGTIpnslsnlplhslDI  1706
                        F  L  L+Y+ +              D    E     + S    ++ DI
Sbjct  989   RKSSLDIGYFPFSELEVLKYIRMEVEISFFSVLHRYPDSYMEEWVEFTTKSGSHKYAGDI  1048

Query  1707  RD---------NKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSEN  1859
              D         N L+G+IP  +G  + +  L  S N+L G IP  F NLK +  LDLS N
Sbjct  1049  LDYMFGIDLSCNNLTGQIPIELGNFSEIRSLNFSHNNLIGVIPQSFSNLKQIESLDLSYN  1108

Query  1860  NLTGSIP-SCLNPSSIKHVSLSKHQLSG  1940
             +L+G IP   +  +S++  S++ + LSG
Sbjct  1109  SLSGRIPMQLIELNSLEVFSVAHNNLSG  1136


 Score = 70.5 bits (171),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 151/540 (28%), Positives = 238/540 (44%), Gaps = 92/540 (17%)
 Frame = +3

Query  627   TNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTL-------  785
              N     +   LS+LE L L  ++L    L ++G + SLKVL L G+ +GGT+       
Sbjct  143   VNGSGFESFSRLSNLETLDLSWNSLKNSILLHMGNISSLKVLYLRGSNLGGTVRIHDLSS  202

Query  786   ---PNKGLCELK---NLQELWLSENQLEGKIP----SYFGNLTSLRYVNLSLNKLSGN-I  932
                 N     L+   +L+ L +S NQL+G I       F  L++L  ++LS N L  + +
Sbjct  203   NLFRNNTFAFLRGPSSLKSLDMSHNQLQGSIDIEGFESFSRLSNLETLDLSWNSLKNSPL  262

Query  933   elsplstltsleylsIMNNSFEVASSFRSF--ANNSKLRVILAD---------RNKVIAD  1079
                 L+ LT+L+ L + +N  E   S R     N ++LR+   D         RN   A 
Sbjct  263   LHMELNNLTNLKNLDLSDNRIE---SLRPLYQGNETELRLTSLDVLDLSWNLLRNNTFAF  319

Query  1080  -----------TQLQG------FVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISR  1208
                         Q  G      F     L +L L+N I+L KL    +    L+  + S 
Sbjct  320   LRGLSRRYWPLKQAWGSHSGPVFFGLISLKTLELNNLINLKKLDLRWNKIESLRSFQGSG  379

Query  1209  NNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNF  1388
               LE           T L+   ++ N F  S+  S     NL+ + +S+N+L G I    
Sbjct  380   RQLEL----------THLEELDLSENLFNNSIFASLRGLSNLKSLYISSNQLKGSIDMED  429

Query  1389  SSSFPNILALNLSSN--------------LFSGQLHSLIGTHLGFLDLSNNSFTGEIPKE  1526
              S+F N+  L++S+N               FS +LH        FLD S+      I + 
Sbjct  430   LSAFTNLEELDMSNNELNKFVGHKVNKSMAFSSELHMSSNVEEIFLDYSD--LNSNIVQS  487

Query  1527  MLISCSSLVILKLSNNKLEGQIVQE-FDYLSSLEYLHLDGNNFEGTIpnsl-snlplhsl  1700
             + +  +SL  L LS+  L G +    +  L +LE L++  N  +G +P+ L +   L  L
Sbjct  488   IGV-LNSLKTLSLSDCGLIGTLPDRGWCDLKNLEELYISRNALQGNLPSCLGNLTSLRVL  546

Query  1701  DIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILD--LSENN----  1862
             DI DN+ +G +   +   TSL  L LS NH +  +P  F +L +L+ L   LS+ N    
Sbjct  547   DISDNQFTGNLSP-LTNFTSLRVLFLSTNHFQ--VPASFISLANLTDLKILLSDGNKLVM  603

Query  1863  ---LTGSIPSC-LNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWI  2030
                   S+P   LN  ++   S +  +L  +L +  +    L  +DLSYN F G++P W+
Sbjct  604   DPVFQTSVPKFQLNMMTLSKCS-TDQELIKELPKFLYYQYDLRYVDLSYNKFSGMLPFWL  662



>ref|XP_010244881.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 isoform X1 [Nelumbo nucifera]
Length=1005

 Score =   410 bits (1053),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 299/717 (42%), Positives = 420/717 (59%), Gaps = 29/717 (4%)
 Frame = +3

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
             + LE L L     N ++F SLK   SLK L+L +N  ++   HIQ++  L NL+ L L +
Sbjct  125   RNLEVLDLSWNSLNDTVFSSLKMLSSLKSLNLSNNAIFEST-HIQELAGLINLEVLNLGN  183

Query  444   NYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVN  623
             N    F T A      +  + +            SFD T +L  L A  S++ L L + N
Sbjct  184   NEIGSFPTVAGLKSLKKLKVLDL--------RGNSFD-TSILQFLGALSSLEILYLSKNN  234

Query  624   VTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLC  803
             +     I  L  LS+L+ L L  +++++  L NIG M SLKVLSLS   +  TL  +GLC
Sbjct  235   LNGSIDIQVLDALSNLQVLGLASTSVNRSILQNIGVMTSLKVLSLSNNGLNETLSAEGLC  294

Query  804   ELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIM  983
              LKNL+EL LS N  EG +PS   NLTSLR ++LS N+  GNI  S +++L SLEYLS+ 
Sbjct  295   TLKNLEELDLSMNGFEGNLPSCLENLTSLRVLDLSSNQFGGNISSSLITSLRSLEYLSLS  354

Query  984   NNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSN-CIDLLK--  1154
             +N F+   SF S AN+SKL       N+++ +T    +VP FQL  L  SN  I  L   
Sbjct  355   DNRFQGPFSFSSLANHSKLEAFANSNNELVLETDYSPWVPTFQLKILLFSNSTIKRLSGS  414

Query  1155  LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNL  1334
             +P+FL YQ DL+V+ +S NN EGEFP+WLL+NNT+L+   + NN+ TG   L SH N + 
Sbjct  415   IPKFLQYQYDLRVVDLSHNNFEGEFPNWLLENNTRLEILNLKNNSLTGQFLLPSHPNRDT  474

Query  1335  QIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFT  1508
              I+++S N + GEI  N  +  PN+L LN+SSN   G++ S +G    L  LDLSNN F 
Sbjct  475   SILDISRNHISGEIPTNIGTILPNLLVLNMSSNSLRGRIPSSLGDMKRLQALDLSNNRFL  534

Query  1509  GEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-pnslsnl  1685
             G IP+ +    +SL ++KLSN  L+GQI+  F  L+ L YL+LDGN F G I     ++ 
Sbjct  535   GGIPENLATGYTSLELIKLSNCNLKGQILPSFSNLTRLHYLYLDGNQFTGEIPDILSNSS  594

Query  1686  plhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNL  1865
              L  LDI  N +SG++P WMG ++SL  L ++ NHLEG IP+EFC+L  L I+DLSENNL
Sbjct  595   ELKRLDISHNNISGKLPWWMGNMSSLEALKITNNHLEGPIPVEFCSLNDLRIIDLSENNL  654

Query  1866  TGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsr  2045
             +GSIP C +P  + H    K+  +G +T AF  ++ LV L+++ N   G IP+WIG +  
Sbjct  655   SGSIPDCFSPPFLFHARFQKNGFTGPMTTAFSKSSYLVTLNIAKNYLTGRIPDWIGKLQS  714

Query  2046  lsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLG----KISLEGTNEQFR  2213
             LS LLL+ N F+GK+PTQ+CQL ++++LDLS+N LSG IP CL     K+       + +
Sbjct  715   LSILLLDENNFQGKIPTQLCQLSKITILDLSHNNLSGTIPSCLSNLTFKVGFRSGKYRLQ  774

Query  2214  GINLPFEYYSINDAILDRLHYEWGSDDEY----IPMLAVDVLPEVQFRTKGNLYNYQ  2372
               +  +  YS    +      E G  D Y       +AV  + E++F TK   YNY+
Sbjct  775   QGSPIYSSYSFQSLV-----KESGDLDLYQVNFYSYIAVYEVTEMEFTTKTRSYNYK  826


 Score =   137 bits (346),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 189/714 (26%), Positives = 300/714 (42%), Gaps = 135/714 (19%)
 Frame = +3

Query  96    LTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLE  275
             L  L NL+ L +  T    +N   + N+    SLKVL +  N          +   K LE
Sbjct  244   LDALSNLQVLGLASTS---VNRSILQNIGVMTSLKVLSLSNNGLNETLSAEGLCTLKNLE  300

Query  276   ELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE  455
             EL L    F  ++   L+   SL++LDL  N F  G +    I  LR+L+ L LSDN F+
Sbjct  301   ELDLSMNGFEGNLPSCLENLTSLRVLDLSSNQF-GGNISSSLITSLRSLEYLSLSDNRFQ  359

Query  456   G---FETSANHS------GSSRHTIRNKSY--------LEVLHLNNISFDMTKLLSSLAA  584
             G   F + ANHS       S+   +    Y        L++L  +N +  + +L  S+  
Sbjct  360   GPFSFSSLANHSKLEAFANSNNELVLETDYSPWVPTFQLKILLFSNST--IKRLSGSIPK  417

Query  585   F----PSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
             F      ++ ++L   N         L+N + LE L+L  ++L   FL    P     +L
Sbjct  418   FLQYQYDLRVVDLSHNNFEGEFPNWLLENNTRLEILNLKNNSLTGQFLLPSHPNRDTSIL  477

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S   + G +P      L NL  L +S N L G+IPS  G++  L+ ++LS N+  G I
Sbjct  478   DISRNHISGEIPTNIGTILPNLLVLNMSSNSLRGRIPSSLGDMKRLQALDLSNNRFLGGI  537

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
               +  +  TSLE + + N + +      SF+N ++L  +  D N+   +           
Sbjct  538   PENLATGYTSLELIKLSNCNLK-GQILPSFSNLTRLHYLYLDGNQFTGE-----------  585

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                           +P  L    +LK L IS NN+ G+ P W + N + L+   + NN  
Sbjct  586   --------------IPDILSNSSELKRLDISHNNISGKLP-WWMGNMSSLEALKITNNHL  630

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSF----------------------PN  1406
              G + +      +L+II++S N L G I   FS  F                        
Sbjct  631   EGPIPVEFCSLNDLRIIDLSENNLSGSIPDCFSPPFLFHARFQKNGFTGPMTTAFSKSSY  690

Query  1407  ILALNLSSNLFSGQLHSLIG--------------------------THLGFLDLSNNSFT  1508
             ++ LN++ N  +G++   IG                          + +  LDLS+N+ +
Sbjct  691   LVTLNIAKNYLTGRIPDWIGKLQSLSILLLDENNFQGKIPTQLCQLSKITILDLSHNNLS  750

Query  1509  GEIPKEM---------------------LISCSSLVILKLSNNKLEGQIVQEFDYLSSLE  1625
             G IP  +                     + S  S   L   +  L+   V  + Y++  E
Sbjct  751   GTIPSCLSNLTFKVGFRSGKYRLQQGSPIYSSYSFQSLVKESGDLDLYQVNFYSYIAVYE  810

Query  1626  YLHLD------GNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKN  1787
                ++        N++G      S   +  +D   N+L+G+IP  +G L  L    LS N
Sbjct  811   VTEMEFTTKTRSYNYKGN-----SLYYMTGIDFSSNRLTGDIPPEIGNLGRLRAFNLSHN  865

Query  1788  HLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQL  1946
              L G IP  F NL+ +  LDLS NNL G+IPS L N +S+   S++ + LSGQ+
Sbjct  866   LLAGPIPTSFSNLEKIESLDLSYNNLAGTIPSELSNLNSLAVFSVAHNNLSGQI  919



>ref|XP_011038937.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Populus euphratica]
Length=1068

 Score =   405 bits (1041),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 283/702 (40%), Positives = 406/702 (58%), Gaps = 29/702 (4%)
 Frame = +3

Query  321   SLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHT  500
             ++K    L++L  +DN F    + +  +  L +LK LY  DN F G  T           
Sbjct  163   AIKDLRKLEVL-FLDNIFISESILLDSLRALPSLKTLYARDNNFLGTHTVEG--------  213

Query  501   IRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEEL  680
             I N + LE + L+  S      L ++    +++ L L   ++          NL++LEEL
Sbjct  214   IYNLTNLEEIFLDGSSLP-ENFLQNIGVLSALRVLSLTSCHLNATLPTRGFLNLTNLEEL  272

Query  681   HLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKI  860
              LD S L   FL +IG   ++KVLS+S  Q+ GTL   G CELK L++L LS N L+G +
Sbjct  273   FLDDSPLPFKFLQSIGVFSAIKVLSMSNCQLNGTLLTSGWCELKRLEQLDLSRNNLDGLL  332

Query  861   PSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKL  1040
             P+ FGNL+SL+ +++S N+L+G+I   PL++L  L+YLS+ +N F+V  SF+SF N+S L
Sbjct  333   PACFGNLSSLQLLDVSYNQLTGSIASGPLTSLKFLKYLSLSSNQFQVPVSFKSFMNHSDL  392

Query  1041  RVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLL---KLPRFLHYQRDLKVLRISRN  1211
             + I  D NK+I +   Q F+PKFQL   SLSNC        +P FL+ Q DL+VL +S N
Sbjct  393   QFISCDNNKLIKEPTFQNFIPKFQLKFFSLSNCKSKALNASIPDFLYNQYDLRVLDLSLN  452

Query  1212  NLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFS  1391
             +  G FPSWL  NNTKL+   +  N+F G  +L  H NPNL I++VS+N +  +I  N  
Sbjct  453   SFPGMFPSWLFVNNTKLEQLFLKGNSFVGPFQLPYHPNPNLWILDVSSNSIQDQIPRNMC  512

Query  1392  SSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKL  1565
               FP +  L ++ N  +G + S  G  + L  LDLSNN  +  I +++    SSL+ LKL
Sbjct  513   LIFPYLRNLRMTENGLTGYIPSCFGNISSLEVLDLSNNQLSRGILEDL---TSSLLFLKL  569

Query  1566  SNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnsl--snlplhslDIRDNKLSGEIPR  1739
             SNN L GQI       S LE+L+LDGNNFEG I +    +   + +LDI +N  +G +P+
Sbjct  570   SNNNLGGQISPSILNSSLLEFLYLDGNNFEGKIWDISLNTWPSMSALDISNNHFTGMLPK  629

Query  1740  WMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSL  1919
             W+G +  +  +  S+NH EG IP ++C L  L  LDLSEN L+G +PSC N  S+ HV L
Sbjct  630   WIGNIAYIRAIDFSRNHFEGQIPGDYCKLDQLEFLDLSENRLSGFLPSCFNLPSLSHVHL  689

Query  1920  SKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQ  2099
             S++QLSG LT +F+N++ LV LDL YNSF G IP WIG +S LS LLL  N F G+ P  
Sbjct  690   SQNQLSGPLTDSFYNSSYLVTLDLRYNSFTGPIPNWIGNLSTLSVLLLKANHFSGEFPVH  749

Query  2100  VCQLMRlslldlsnnllsGVIPRCLGKIS-LEGTNEQFRGINLPFEY------YSINDAI  2258
             +C L  LS+LD+S+N+L G +P CLG ++ L    +     ++ F Y      YS     
Sbjct  750   LCLLSELSILDMSHNMLFGPLPSCLGNLTFLTSFKKALVASHMYFVYKSSVGIYSKKSYG  809

Query  2259  LDRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
               RL +   + +   P L V+ +  ++F TKG  Y Y+  IL
Sbjct  810   RSRLEHGGDNTENESPALIVEEV--IEFTTKGKSYAYKGDIL  849


 Score =   154 bits (389),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 211/765 (28%), Positives = 334/765 (44%), Gaps = 134/765 (18%)
 Frame = +3

Query  264   KKLEELYLFECRFNQSIF-QSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLS  440
             +KLE L+L     ++SI   SL+  PSLK L   DN+F  G   ++ I +L NL+E++L 
Sbjct  168   RKLEVLFLDNIFISESILLDSLRALPSLKTLYARDNNFL-GTHTVEGIYNLTNLEEIFLD  226

Query  441   -----DNYFEGFETSANH---SGSSRH---TIRNKSYLEVLHLNNISFDMT----KLLSS  575
                  +N+ +     +     S +S H   T+  + +L + +L  +  D +    K L S
Sbjct  227   GSSLPENFLQNIGVLSALRVLSLTSCHLNATLPTRGFLNLTNLEELFLDDSPLPFKFLQS  286

Query  576   LAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLS  755
             +  F +IK L +    +           L  LE+L L  +NL     +  G + SL++L 
Sbjct  287   IGVFSAIKVLSMSNCQLNGTLLTSGWCELKRLEQLDLSRNNLDGLLPACFGNLSSLQLLD  346

Query  756   LSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIP-SYFGNLTSLRYVNLSLNKLSGNI  932
             +S  Q+ G++ +  L  LK L+ L LS NQ +  +    F N + L++++   NKL    
Sbjct  347   VSYNQLTGSIASGPLTSLKFLKYLSLSSNQFQVPVSFKSFMNHSDLQFISCDNNKLIKEP  406

Query  933   elsplstltsleylsIMN---------------------------NSFEVASSFRSFANN  1031
                       L++ S+ N                           NSF        F NN
Sbjct  407   TFQNFIPKFQLKFFSLSNCKSKALNASIPDFLYNQYDLRVLDLSLNSFPGMFPSWLFVNN  466

Query  1032  SKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPR----FLHYQRDLKVLR  1199
             +KL  +    N  +   QL  + P   L  L +S+     ++PR       Y R+L   R
Sbjct  467   TKLEQLFLKGNSFVGPFQLP-YHPNPNLWILDVSSNSIQDQIPRNMCLIFPYLRNL---R  522

Query  1200  ISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEIS  1379
             ++ N L G  PS    N + L+   ++NN    S  +   +  +L  + +SNN L G+IS
Sbjct  523   MTENGLTGYIPS-CFGNISSLEVLDLSNNQL--SRGILEDLTSSLLFLKLSNNNLGGQIS  579

Query  1380  ----------------GNFSS--------SFPNILALNLSSNLFSGQLHSLIG--THLGF  1481
                              NF          ++P++ AL++S+N F+G L   IG   ++  
Sbjct  580   PSILNSSLLEFLYLDGNNFEGKIWDISLNTWPSMSALDISNNHFTGMLPKWIGNIAYIRA  639

Query  1482  LDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGT  1661
             +D S N F G+IP +       L  L LS N+L G +   F+ L SL ++HL  N   G 
Sbjct  640   IDFSRNHFEGQIPGDY-CKLDQLEFLDLSENRLSGFLPSCFN-LPSLSHVHLSQNQLSGP  697

Query  1662  Ipnsls-nlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLS  1838
             + +S   +  L +LD+R N  +G IP W+G L++L  L L  NH  G  P+  C L  LS
Sbjct  698   LTDSFYNSSYLVTLDLRYNSFTGPIPNWIGNLSTLSVLLLKANHFSGEFPVHLCLLSELS  757

Query  1839  ILDLSENNLTGSIPSCLNP----SSIKHVSLSKHQL------SGQLTRAFFNNT------  1970
             ILD+S N L G +PSCL      +S K   ++ H         G  ++  +  +      
Sbjct  758   ILDMSHNMLFGPLPSCLGNLTFLTSFKKALVASHMYFVYKSSVGIYSKKSYGRSRLEHGG  817

Query  1971  --------ALVI-------------------------LDLSYNSFVGIIPEWIGTIsrls  2051
                     AL++                         +DLS N F G IP  +G +  + 
Sbjct  818   DNTENESPALIVEEVIEFTTKGKSYAYKGDILNFMSGIDLSDNRFTGEIPSEMGYLREIH  877

Query  2052  slllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKIS  2186
             +L L+ N   G +PT    L  +  LDLS+N L+G IPR L +++
Sbjct  878   ALNLSHNNLIGSIPTTFLNLKNVESLDLSHNNLTGAIPRQLTELT  922


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 173/702 (25%), Positives = 311/702 (44%), Gaps = 64/702 (9%)
 Frame = +3

Query  69    HLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPIN  248
             HLN +   R  G +NL  L   +     +    + ++  F ++KVL +   +       +
Sbjct  253   HLNATLPTR--GFLNLTNLEELFLDDSPLPFKFLQSIGVFSAIKVLSMSNCQLNGTLLTS  310

Query  249   DVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKE  428
                  K+LE+L L     +  +        SL++LD+  N    G +    +  L+ LK 
Sbjct  311   GWCELKRLEQLDLSRNNLDGLLPACFGNLSSLQLLDVSYNQL-TGSIASGPLTSLKFLKY  369

Query  429   LYLSDNYFE---GFETSANHSGSSRHTIRN---------KSYLEVLHLNNISFDMTKLLS  572
             L LS N F+    F++  NHS     +  N         ++++    L   S    K  +
Sbjct  370   LSLSSNQFQVPVSFKSFMNHSDLQFISCDNNKLIKEPTFQNFIPKFQLKFFSLSNCKSKA  429

Query  573   SLAAFPS-------IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGP  731
               A+ P        ++ L+L   +   +       N + LE+L L G++    F     P
Sbjct  430   LNASIPDFLYNQYDLRVLDLSLNSFPGMFPSWLFVNNTKLEQLFLKGNSFVGPFQLPYHP  489

Query  732   MESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSL  911
               +L +L +S   +   +P         L+ L ++EN L G IPS FGN++SL  ++LS 
Sbjct  490   NPNLWILDVSSNSIQDQIPRNMCLIFPYLRNLRMTENGLTGYIPSCFGNISSLEVLDLSN  549

Query  912   NKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKV---IADT  1082
             N+LS  I     S+L  L+   + NN+     S  S  N+S L  +  D N     I D 
Sbjct  550   NQLSRGILEDLTSSLLFLK---LSNNNLGGQIS-PSILNSSLLEFLYLDGNNFEGKIWDI  605

Query  1083  QLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKL  1262
              L  +     + +L +SN      LP+++     ++ +  SRN+ EG+ P    + + +L
Sbjct  606   SLNTWP---SMSALDISNNHFTGMLPKWIGNIAYIRAIDFSRNHFEGQIPGDYCKLD-QL  661

Query  1263  QYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFS  1442
             ++  ++ N  +G L    ++ P+L  +++S N+L G ++ +F +S   ++ L+L  N F+
Sbjct  662   EFLDLSENRLSGFLPSCFNL-PSLSHVHLSQNQLSGPLTDSFYNS-SYLVTLDLRYNSFT  719

Query  1443  GQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI---VQEFD  1607
             G + + IG  + L  L L  N F+GE P  + +  S L IL +S+N L G +   +    
Sbjct  720   GPIPNWIGNLSTLSVLLLKANHFSGEFPVHLCL-LSELSILDMSHNMLFGPLPSCLGNLT  778

Query  1608  YLSSLEYLHLDGNNF---------------------EGTIpnslsnlplhslDIRDNKLS  1724
             +L+S +   +  + +                      G       +  L   ++ +    
Sbjct  779   FLTSFKKALVASHMYFVYKSSVGIYSKKSYGRSRLEHGGDNTENESPALIVEEVIEFTTK  838

Query  1725  GEIPRWMGRLTSLVQ-LTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSC-LNPS  1898
             G+   + G + + +  + LS N   G IP E   L+ +  L+LS NNL GSIP+  LN  
Sbjct  839   GKSYAYKGDILNFMSGIDLSDNRFTGEIPSEMGYLREIHALNLSHNNLIGSIPTTFLNLK  898

Query  1899  SIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPE  2024
             +++ + LS + L+G + R     T+L +  +++N+  G  PE
Sbjct  899   NVESLDLSHNNLTGAIPRQLTELTSLAVFSVAFNNLSGKTPE  940



>ref|XP_010244923.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nelumbo nucifera]
Length=1101

 Score =   401 bits (1030),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 308/747 (41%), Positives = 425/747 (57%), Gaps = 58/747 (8%)
 Frame = +3

Query  192   SLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDND  371
             SLK L +G+NK +   P  ++ G +KL+ L L    FN S+ Q ++GF SL+IL+L +N 
Sbjct  203   SLKSLSLGYNKLEGNFPAEELAGLEKLQMLDLSGNGFNGSV-QVIQGFKSLEILNLSNNH  261

Query  372   FYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISF  551
             F +       +  L++LK L LS N  EG     N        + N   L++L   +  F
Sbjct  262   FTNTIF--TSLVALKSLKNLSLSVNKLEG-----NFPAEELAGLEN---LQMLDFCSNRF  311

Query  552   DMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGP  731
             + +                          AI  L  L +LE L L  S L   FL N+G 
Sbjct  312   NGSA------------------------QAIQELDTLRNLELLDLSYSTLKNKFLENMGG  347

Query  732   MESLKVLSLSGAQV--GGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNL  905
             M SLK LS++ A    G  LP+KGLC+L+NLQEL L  N   G +     NLTSLR ++L
Sbjct  348   MISLKFLSIAFAYGLNGTQLPHKGLCKLRNLQELDLKGNDFVGSVNHCLRNLTSLRALDL  407

Query  906   SLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQ  1085
             S N+  G  + S ++ LTSLEYLS+ +N F+ + SF SFAN SKL     + N +I +  
Sbjct  408   SHNQFEGIFDTSIIAGLTSLEYLSLSHNRFQGSFSFHSFANLSKLESFECEDNGLIVEAD  467

Query  1086  -LQGFVPKFQLDSLSLSN-CIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTK  1259
                 +VP F+L SL+LS         P FL+YQ +L+V+++S NNL GEFP WLL+NNTK
Sbjct  468   DYPTWVPSFRLKSLALSGFTFKNDAFPSFLYYQHELRVVQLSNNNLRGEFPIWLLENNTK  527

Query  1260  LQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLF  1439
             L Y  + NN+FTG L L SH   NL  + +SNN   G I  N    FPN+  L LS N F
Sbjct  528   LGYLNLTNNSFTGPLVLPSHPCLNLFSLILSNNNFFGSIPTNIGVIFPNLRILKLSQNCF  587

Query  1440  SGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYL  1613
              G++   IG    L  LDLSNN+ +G+IP+ ++  CS L++ KLS NKL G+I+     +
Sbjct  588   EGKIPPSIGNMAWLQVLDLSNNNLSGQIPEHLVTGCSMLMLFKLSYNKLYGKILPTITNI  647

Query  1614  SSLEYLHLDGNNFEGTIpnsls--nlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKN  1787
             +SL  L+LD N F G + +S    +  L  LDI  N +SG +PRW+G L+ L  L +  N
Sbjct  648   TSLTSLYLDHNLFGGNLSDSWLHGSQELSDLDISYNNISGPLPRWLGNLSYLQSLVMRNN  707

Query  1788  HLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNN  1967
             HLEG IP EFC L  L  LDLSEN++ GS+PSC +P  ++HV L K++L G +  AF N 
Sbjct  708   HLEGSIPSEFCQLHLLRYLDLSENDIQGSVPSCFSPQGLEHVYLQKNRLEGPMPNAFSNI  767

Query  1968  TALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnl  2147
             T+LV LD+S N   G IPEWIG +S L++LLL GN+FEG++P Q+CQL  L+++  S+N 
Sbjct  768   TSLVTLDISDNHISGGIPEWIGGLSSLNALLLKGNQFEGQIPLQLCQLKNLNIMQFSDNF  827

Query  2148  lsGVIPRCLGKISLEGTNEQFR---GINL-PFEY---YSINDAILDRLHYEWGSDDEYIP  2306
             LSG IP CL  I   G +  ++    + L P  Y   Y+ N  +     +E+G DDE I 
Sbjct  828   LSGTIPSCLNNIPFNGESSSYKRNSKVELNPLSYGGIYTYNSML---FQFEFGFDDEDI-  883

Query  2307  MLAVDVLPEVQFRTKGNLYNYQNSILK  2387
                V+V  EV+FRTK     Y+  +L+
Sbjct  884   --IVEV--EVEFRTKFRSETYKGVVLE  906


 Score =   119 bits (298),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 189/691 (27%), Positives = 293/691 (42%), Gaps = 89/691 (13%)
 Frame = +3

Query  90    ERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFG------PIND  251
             + L  L NLE L + Y+ ++      + N+   ISLK L I F    ++G      P   
Sbjct  319   QELDTLRNLELLDLSYSTLKNK---FLENMGGMISLKFLSIAF----AYGLNGTQLPHKG  371

Query  252   VGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKEL  431
             +   + L+EL L    F  S+   L+   SL+ LDL  N F +G      I  L +L+ L
Sbjct  372   LCKLRNLQELDLKGNDFVGSVNHCLRNLTSLRALDLSHNQF-EGIFDTSIIAGLTSLEYL  430

Query  432   YLSDNYFEG---FETSANHS---------------GSSRHTIRNKSYLEVLHLNNISFDM  557
              LS N F+G   F + AN S                    T      L+ L L+  +F  
Sbjct  431   SLSHNRFQGSFSFHSFANLSKLESFECEDNGLIVEADDYPTWVPSFRLKSLALSGFTFKN  490

Query  558   TKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPME  737
                 S L     ++ ++L   N+     I  L+N + L  L+L  ++     +    P  
Sbjct  491   DAFPSFLYYQHELRVVQLSNNNLRGEFPIWLLENNTKLGYLNLTNNSFTGPLVLPSHPCL  550

Query  738   SLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNK  917
             +L  L LS     G++P        NL+ L LS+N  EGKIP   GN+  L+ ++LS N 
Sbjct  551   NLFSLILSNNNFFGSIPTNIGVIFPNLRILKLSQNCFEGKIPPSIGNMAWLQVLDLSNNN  610

Query  918   LSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKV---IADTQL  1088
             LSG I    ++  + L    +  N         +  N + L  +  D N     ++D+ L
Sbjct  611   LSGQIPEHLVTGCSMLMLFKLSYNKL-YGKILPTITNITSLTSLYLDHNLFGGNLSDSWL  669

Query  1089  QGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQY  1268
              G      LD +S +N      LPR+L     L+ L +  N+LEG  PS   Q +  L+Y
Sbjct  670   HGSQELSDLD-ISYNNISG--PLPRWLGNLSYLQSLVMRNNHLEGSIPSEFCQLHL-LRY  725

Query  1269  FLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQ  1448
               ++ N   GS+  S      L+ + +  N+L G +   FS+   +++ L++S N  SG 
Sbjct  726   LDLSENDIQGSVP-SCFSPQGLEHVYLQKNRLEGPMPNAFSN-ITSLVTLDISDNHISGG  783

Query  1449  LHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLS------------------  1568
             +   IG  + L  L L  N F G+IP + L    +L I++ S                  
Sbjct  784   IPEWIGGLSSLNALLLKGNQFEGQIPLQ-LCQLKNLNIMQFSDNFLSGTIPSCLNNIPFN  842

Query  1569  --------NNKLE------GQIVQEFDYLSSLEYLHLDGN-----------NFEGTIpns  1673
                     N+K+E      G I      L   E+   D +            F       
Sbjct  843   GESSSYKRNSKVELNPLSYGGIYTYNSMLFQFEFGFDDEDIIVEVEVEFRTKFRSETYKG  902

Query  1674  lsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLS  1853
             +    +  +D+  NKL G IP  +G L+ +  L LS N+L G IP  F NL+ +  LDLS
Sbjct  903   VVLELMSGIDLSCNKLVGNIPPEIGDLSDIRALNLSHNYLNGQIPPSFSNLRKIESLDLS  962

Query  1854  ENNLTGSIP-SCLNPSSIKHVSLSKHQLSGQ  1943
              NNLTG IP   +  +S+   +++ + LSG+
Sbjct  963   YNNLTGMIPLQMIELNSLSIFNVAHNNLSGR  993


 Score = 85.5 bits (210),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 159/592 (27%), Positives = 235/592 (40%), Gaps = 129/592 (22%)
 Frame = +3

Query  195   LKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLM--DN  368
             L+V+ +  N  +   PI  +    KL  L L    F   +   L   P L +  L+  +N
Sbjct  503   LRVVQLSNNNLRGEFPIWLLENNTKLGYLNLTNNSFTGPLV--LPSHPCLNLFSLILSNN  560

Query  369   DFYDG-PLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHL--N  539
             +F+   P +I  I    NL+ L LS N FEG             +I N ++L+VL L  N
Sbjct  561   NFFGSIPTNIGVI--FPNLRILKLSQNCFEG---------KIPPSIGNMAWLQVLDLSNN  609

Query  540   NISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLD----GSNLHK  707
             N+S  + + L +  +   +  L   ++    +  I    N++SL  L+LD    G NL  
Sbjct  610   NLSGQIPEHLVTGCSMLMLFKLSYNKLYGKILPTI---TNITSLTSLYLDHNLFGGNLSD  666

Query  708   DFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTS  887
              +L      + L  L +S   + G LP + L  L  LQ L +  N LEG IPS F  L  
Sbjct  667   SWLHG---SQELSDLDISYNNISGPLP-RWLGNLSYLQSLVMRNNHLEGSIPSEFCQLHL  722

Query  888   LRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNK  1067
             LRY++LS N + G+                       V S F        L  +   +N+
Sbjct  723   LRYLDLSENDIQGS-----------------------VPSCFSP----QGLEHVYLQKNR  755

Query  1068  VIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQ  1247
                   L+G +P       + SN   L+              L IS N++ G  P W+  
Sbjct  756   ------LEGPMPN------AFSNITSLV-------------TLDISDNHISGGIPEWI-G  789

Query  1248  NNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNF--------SSSFP  1403
               + L   L+  N F G + L      NL I+  S+N L G I            SSS+ 
Sbjct  790   GLSSLNALLLKGNQFEGQIPLQLCQLKNLNIMQFSDNFLSGTIPSCLNNIPFNGESSSYK  849

Query  1404  NILALNLSSNLFSGQLHS----LIGTHLGFLDLS---------NNSFTGEIPKEMLISCS  1544
                 + L+  L  G +++    L     GF D              F  E  K +++   
Sbjct  850   RNSKVELNP-LSYGGIYTYNSMLFQFEFGFDDEDIIVEVEVEFRTKFRSETYKGVVLELM  908

Query  1545  SLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLS  1724
             S +   LS NKL G I  E   LS +  L+L                         N L+
Sbjct  909   SGI--DLSCNKLVGNIPPEIGDLSDIRALNLS-----------------------HNYLN  943

Query  1725  GEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP  1880
             G+IP     L  +  L LS N+L G IP++   L SLSI +++ NNL+G  P
Sbjct  944   GQIPPSFSNLRKIESLDLSYNNLTGMIPLQMIELNSLSIFNVAHNNLSGRTP  995



>ref|XP_004250531.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 isoform X1 [Solanum lycopersicum]
Length=1022

 Score =   399 bits (1024),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 316/756 (42%), Positives = 444/756 (59%), Gaps = 66/756 (9%)
 Frame = +3

Query  186   FISLKVLDI------GFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLK  347
             F +LK L+I      G+ K + F  +  +   +KLE L L   +FN+SIFQSL    SLK
Sbjct  115   FKNLKALNIPGHSLAGWVKNEGFEKLRPL---RKLERLDLSGNQFNRSIFQSLSQLSSLK  171

Query  348   ILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEV  527
              L+L  N+F                 E++ +DN           SGS R +  +K  LE+
Sbjct  172   SLNLSSNNFAPR-------------SEMWFTDNKI--------GSGSERLSGLDK--LEI  208

Query  528   LHLNNISFDMTKLLSSL---AAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSN  698
             L L+    +  K LS+L    + P++K L ++     +      L  L ++E L LDG  
Sbjct  209   LDLSYNDLEDKKFLSALELNTSRPTLKKLNIRYSRFQSFIPNEELGALRNIEYLLLDGIT  268

Query  699   LHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGN  878
             L K+FL + G M SLKVLS++   + GTLP +GLC+LK L+EL LS N   GK+P+   N
Sbjct  269   LDKNFLRSSGVMSSLKVLSVAQCSLNGTLPRQGLCDLKYLEELSLSRNSFTGKLPACLRN  328

Query  879   LTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILAD  1058
             LT LR ++L+ N+ +GNI LSPLS+L SLEYL I NN+FEV  SF SFAN+SKL+ + AD
Sbjct  329   LTFLRVIDLTQNQFTGNIALSPLSSLLSLEYLLITNNNFEVPISFESFANHSKLKFVFAD  388

Query  1059  RNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSW  1238
              N VI  T  + ++PKFQL++LSL N     ++P FLH Q  L+++R+S+ N+ G+FP+W
Sbjct  389   YNSVIVQTTSKIWIPKFQLEALSLFNSS---QMPNFLHSQHHLRLIRLSKCNIGGDFPNW  445

Query  1239  LLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILAL  1418
             LL+NN KL    ++ NAFTGSL+L     PNL+  ++SNNK+ G++  N  S FPN++  
Sbjct  446   LLENNPKLGEVYLDGNAFTGSLQLP--FLPNLKAFDISNNKIRGQLPPNIGSIFPNLVIS  503

Query  1419  NLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI  1592
              +SSN+  G L S       L  LDLS N   GE+P  +    S L +L+LSNN L+G+I
Sbjct  504   TMSSNMLEGLLPSSFADMQSLECLDLSYNKLKGELPTRLARKGSKLYLLRLSNNMLKGEI  563

Query  1593  VQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQL  1772
                   +++  YL+LDGNNF G IP +LS  PL +LD+  N LSG IP W+G ++SL  L
Sbjct  564   FPASANINNFNYLYLDGNNFSGPIPQTLSTAPLRTLDLSYNNLSGNIPSWLGNISSLTFL  623

Query  1773  TLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNP-SSIKHVSLSKHQLSGQLT  1949
              LSKNHL GHIP +FC L+ L +LD+SENNL G IPSC +    +KHV LSK++L G+  
Sbjct  624   ALSKNHLNGHIPPDFCRLEGLEVLDISENNLVGVIPSCFSSFRDLKHVYLSKNKLQGEFN  683

Query  1950  RAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlsll  2129
                F+N+ L +LDL  N+F G IP+W+G+ S + +LLL GN  +G +PT++C    L ++
Sbjct  684   --MFSNSGLRVLDLGDNNFSGSIPKWLGS-SGIITLLLKGNNLQGTIPTELCHASYLRIM  740

Query  2130  dlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSINDAILDRLHYEWGSDDEY---  2300
             DLS+N LSG IPRC G I       Q   I    E Y  + +    +   +G D      
Sbjct  741   DLSHNNLSGPIPRCFGNIM------QQEDI---IELYPYSSSFGSSVFETFGGDTAIEVE  791

Query  2301  ------IPMLAVD--VLPEVQFRTKGNLYNYQNSIL  2384
                     +L +D  V    +F TK N Y+Y+ SI+
Sbjct  792   SSIMSSSTLLLLDNYVWVGAEFMTKHNTYSYEGSIV  827


 Score =   152 bits (383),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 206/775 (27%), Positives = 327/775 (42%), Gaps = 144/775 (19%)
 Frame = +3

Query  81    SGNERLTGLINLEELHMRYTQMEEINILSVLNL-KDFISLKVLDIGFNKFQSFGPINDVG  257
             SG+ERL+GL  LE L + Y  +E+   LS L L     +LK L+I +++FQSF P  ++G
Sbjct  195   SGSERLSGLDKLEILDLSYNDLEDKKFLSALELNTSRPTLKKLNIRYSRFQSFIPNEELG  254

Query  258   GAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYL  437
               + +E L L     +++  +S     SLK+L +      +G L  Q + DL+ L+EL L
Sbjct  255   ALRNIEYLLLDGITLDKNFLRSSGVMSSLKVLSVAQCSL-NGTLPRQGLCDLKYLEELSL  313

Query  438   SDNYFEG----------------------------------------------------F  461
             S N F G                                                    F
Sbjct  314   SRNSFTGKLPACLRNLTFLRVIDLTQNQFTGNIALSPLSSLLSLEYLLITNNNFEVPISF  373

Query  462   ETSANHS---------GSSRHTIRNKSYLEVLHLNNIS-FDMTKLLSSLAAFPSIKTLEL  611
             E+ ANHS          S      +K ++    L  +S F+ +++ + L +   ++ + L
Sbjct  374   ESFANHSKLKFVFADYNSVIVQTTSKIWIPKFQLEALSLFNSSQMPNFLHSQHHLRLIRL  433

Query  612   QRVNVTNIDAIHALKNLSSLEELHLDGS----NLHKDFLSNIGPMESLKVLSLSGAQVGG  779
              + N+        L+N   L E++LDG+    +L   FL N      LK   +S  ++ G
Sbjct  434   SKCNIGGDFPNWLLENNPKLGEVYLDGNAFTGSLQLPFLPN------LKAFDISNNKIRG  487

Query  780   TLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstlt  959
              LP        NL    +S N LEG +PS F ++ SL  ++LS NKL G +        +
Sbjct  488   QLPPNIGSIFPNLVISTMSSNMLEGLLPSSFADMQSLECLDLSYNKLKGELPTRLARKGS  547

Query  960   sleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNC  1139
              L  L + NN  +    F + AN +    +  D N         G +P+    +LS +  
Sbjct  548   KLYLLRLSNNMLK-GEIFPASANINNFNYLYLDGN------NFSGPIPQ----TLSTA--  594

Query  1140  IDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSH  1319
                            L+ L +S NNL G  PSWL  N + L +  ++ N   G      H
Sbjct  595   --------------PLRTLDLSYNNLSGNIPSWL-GNISSLTFLALSKNHLNG------H  633

Query  1320  VNPN------LQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGF  1481
             + P+      L+++++S N L G I   FSS F ++  + LS N   G+ +    + L  
Sbjct  634   IPPDFCRLEGLEVLDISENNLVGVIPSCFSS-FRDLKHVYLSKNKLQGEFNMFSNSGLRV  692

Query  1482  LDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGT  1661
             LDL +N+F+G IPK   +  S ++ L L  N L+G I  E  + S L  + L  NN  G 
Sbjct  693   LDLGDNNFSGSIPK--WLGSSGIITLLLKGNNLQGTIPTELCHASYLRIMDLSHNNLSGP  750

Query  1662  IpnslsnlplhslDIR----DNKLSGEIPRWMGRLTSL---------VQLTLSKNHLEGH  1802
             IP    N+      I      +     +    G  T++           L L  N++   
Sbjct  751   IPRCFGNIMQQEDIIELYPYSSSFGSSVFETFGGDTAIEVESSIMSSSTLLLLDNYV--W  808

Query  1803  IPIEFCN-----------LKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQL  1946
             +  EF             +  +S +DLS N L+G IP  L N + I+ ++LS + ++G +
Sbjct  809   VGAEFMTKHNTYSYEGSIVDYMSGIDLSCNQLSGHIPKELSNLTQIRALNLSHNHITGTI  868

Query  1947  TRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQL  2111
               AF     +  LDLSYN+  G IP  +  ++ L+   +  N   G  P  + Q 
Sbjct  869   LSAFSKLLNIESLDLSYNNLTGNIPTQLLDLTTLAVFSVAHNNLTGTTPQPIAQF  923



>ref|XP_006382389.1| hypothetical protein POPTR_0005s01680g [Populus trichocarpa]
 gb|ERP60186.1| hypothetical protein POPTR_0005s01680g [Populus trichocarpa]
Length=1016

 Score =   398 bits (1023),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 279/653 (43%), Positives = 395/653 (60%), Gaps = 27/653 (4%)
 Frame = +3

Query  468   SANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIH  647
             SAN  G +  + R K  LE LHL    ++   + SSL  F S+K+L+L    +T   +I+
Sbjct  176   SANFYGLNVLSSRLKK-LENLHLRGNQYN-DSIFSSLTGFSSLKSLDLSYNMLTGSTSIN  233

Query  648   A-LKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQE  824
                 N ++LEEL+LDGS+L  +FL NIG + +LKVLS     + GTLP +GLC LKNL++
Sbjct  234   GTFFNSTTLEELYLDGSSLPLNFLHNIGVLPALKVLSAGECDLNGTLPAQGLCGLKNLEQ  293

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
             L+LSEN LEG +P  F NL+SL+ +++S N+ +GNI  SPL+ L SLE++S+ NN F+V 
Sbjct  294   LFLSENNLEGSLPDCFKNLSSLQLLDVSRNQFTGNIASSPLTNLLSLEFISLSNNHFQVP  353

Query  1005  SSFRSFANNSKLRVILADRNKVIADT-QLQGFVPKFQLDSLSLSNCIDL---LKLPRFLH  1172
              S + F N+S LR   +D N+++ +       +PKFQL   SLS        ++ P FL+
Sbjct  354   ISMKPFMNHSSLRFFSSDNNRLVTEPMSFHDLIPKFQLVFFSLSKSSSEALNVETPSFLY  413

Query  1173  YQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVS  1352
              Q DL+VL +S+N+  G FPSWLL+NNT+L+   +N N+F G+L+L  H NP++  I++S
Sbjct  414   NQHDLRVLDLSQNSFIGMFPSWLLKNNTRLEQLFLNENSFFGTLQLQDHPNPDMTAIDIS  473

Query  1353  NNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKE  1526
             NN + GEI  N    F N+  L ++ N  +G + S +G  + LG LDLSNN  +  +  E
Sbjct  474   NNNMHGEIPKNICLIFSNLWTLRMAKNGLTGCIPSCLGNSSSLGVLDLSNNQLS-VVELE  532

Query  1527  MLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpn--slsnlplhsl  1700
               I+   L  LKLSNN L GQ+       S L YL+L  NNF G I +  S        L
Sbjct  533   QFIT---LTFLKLSNNSLGGQLPASVVNSSRLNYLYLSDNNFWGRISDFPSPIKTIWPVL  589

Query  1701  DIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP  1880
             D+ +N+ SG +PRW   LT +  + LSKNH  G IP+EFC L  L  LDLS+NNL  SIP
Sbjct  590   DLSNNQFSGMLPRWFVNLTQIFAIDLSKNHFNGPIPVEFCKLDELKYLDLSDNNLFDSIP  649

Query  1881  SCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlssll  2060
             SC NP  I HV LSK++LSG LT  F+N+++LV LDL  N+F G I  WIG +S LS LL
Sbjct  650   SCFNPPHITHVHLSKNKLSGPLTYGFYNSSSLVTLDLRDNNFTGSISNWIGNLSSLSVLL  709

Query  2061  lNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYY  2240
             L  N F+G+ P Q+C L +LS+LD+S N LSG +P CLG +S + + E+   ++  F + 
Sbjct  710   LRANDFDGEFPVQLCLLEQLSILDVSQNQLSGPLPSCLGNLSFKESYEK-ASVDFGFHFG  768

Query  2241  SINDAILDRLHYEWGSD-----DEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
             S     +++ +YE+          YIP+   +V   ++F  K   Y Y+  IL
Sbjct  769   S---TPIEKAYYEFNQTRALLGSSYIPITTEEV---IEFTAKSMYYGYKGKIL  815


 Score =   112 bits (281),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 182/712 (26%), Positives = 306/712 (43%), Gaps = 72/712 (10%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             LEEL++  + +  +N L   N+    +LKVL  G        P   + G K LE+L+L E
Sbjct  242   LEELYLDGSSLP-LNFLH--NIGVLPALKVLSAGECDLNGTLPAQGLCGLKNLEQLFLSE  298

Query  294   CRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---GFE  464
                  S+    K   SL++LD+  N F  G +    + +L +L+ + LS+N+F+     +
Sbjct  299   NNLEGSLPDCFKNLSSLQLLDVSRNQF-TGNIASSPLTNLLSLEFISLSNNHFQVPISMK  357

Query  465   TSANHSG-------SSRHTIRNKSYLEVL-HLNNISFDMTKLLSSL--AAFPS-------  593
                NHS        ++R      S+ +++     + F ++K  S       PS       
Sbjct  358   PFMNHSSLRFFSSDNNRLVTEPMSFHDLIPKFQLVFFSLSKSSSEALNVETPSFLYNQHD  417

Query  594   IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQV  773
             ++ L+L + +   +     LKN + LE+L L+ ++          P   +  + +S   +
Sbjct  418   LRVLDLSQNSFIGMFPSWLLKNNTRLEQLFLNENSFFGTLQLQDHPNPDMTAIDISNNNM  477

Query  774   GGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplst  953
              G +P        NL  L +++N L G IPS  GN +SL  ++LS N+LS    +  L  
Sbjct  478   HGEIPKNICLIFSNLWTLRMAKNGLTGCIPSCLGNSSSLGVLDLSNNQLS----VVELEQ  533

Query  954   ltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLS  1133
               +L +L + NNS        S  N+S+L  +       ++D    G +  F     ++ 
Sbjct  534   FITLTFLKLSNNSLG-GQLPASVVNSSRLNYL------YLSDNNFWGRISDFPSPIKTIW  586

Query  1134  NCIDLLK------LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
               +DL        LPR+      +  + +S+N+  G  P    + + +L+Y  +++N   
Sbjct  587   PVLDLSNNQFSGMLPRWFVNLTQIFAIDLSKNHFNGPIPVEFCKLD-ELKYLDLSDNNLF  645

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHL  1475
              S+  S    P++  +++S NKL G ++  F +S  +++ L+L  N F+G + + IG   
Sbjct  646   DSIP-SCFNPPHITHVHLSKNKLSGPLTYGFYNS-SSLVTLDLRDNNFTGSISNWIGNLS  703

Query  1476  GFLDLSN--NSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLS---SLEYLHLD  1640
                 L    N F GE P ++ +    L IL +S N+L G +      LS   S E   +D
Sbjct  704   SLSVLLLRANDFDGEFPVQLCL-LEQLSILDVSQNQLSGPLPSCLGNLSFKESYEKASVD  762

Query  1641  -GNNFEGTIpnslsnlplhslDIRDNKLSGEIP----------------RWMGRLTSLVQ  1769
              G +F  T           +  +     S  IP                 + G++ S + 
Sbjct  763   FGFHFGSTPIEKAYYEFNQTRALLG---SSYIPITTEEVIEFTAKSMYYGYKGKILSFMS  819

Query  1770  -LTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQ  1943
              + LS N   G IP E  NL  L  L+LS NNLTGSIP+   N   I+   LS + L G 
Sbjct  820   GIDLSSNKFSGAIPPELGNLSELLALNLSHNNLTGSIPATFSNLKQIESFDLSYNNLDGV  879

Query  1944  LTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQ  2099
             +    +  T L +  +++N+  G  PE              GN F    P Q
Sbjct  880   IPHKLYEITTLEVFSVAHNNLSGETPERKYQFGTFDESSYEGNPFLCGPPLQ  931



>ref|XP_009615136.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 isoform X2 [Nicotiana tomentosiformis]
Length=1022

 Score =   396 bits (1017),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 308/733 (42%), Positives = 440/733 (60%), Gaps = 43/733 (6%)
 Frame = +3

Query  213   GFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLH  392
             G+ K + F  +  +G   KLE L L   +FN+SIFQSL    SLK L+L  N+   G   
Sbjct  129   GWAKNEGFEKLRQLG---KLEILDLSGNQFNRSIFQSLSQLSSLKSLNLSHNNIGSG---  182

Query  393   IQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLS  572
                            SD +F     + N  GS    +     LE+L L++ + D   LLS
Sbjct  183   ---------------SDIWF-----THNKIGSGSERLSGLDKLEILDLSDNNLDDENLLS  222

Query  573   SL---AAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESL  743
             +L    +  ++K L+++     +      L  L ++E L LDG+ L ++FL + G M SL
Sbjct  223   ALELNTSRTALKKLDIRYNTFRSFIPNEELGALRNIEYLLLDGNTLDENFLRSSGVMSSL  282

Query  744   KVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLS  923
             KVLS++   + G LP +GLC+LK L+EL LS N   GK+P+  GNLT LR  +L++N+ +
Sbjct  283   KVLSVANCMLNGILPLQGLCDLKYLEELSLSGNSFTGKLPTCLGNLTFLRVFDLTINQFT  342

Query  924   GNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVP  1103
             GNI  SPLS+L SLEYL + NN+FE+  SF SFAN+SKL+ + AD N VI  T  + ++P
Sbjct  343   GNIASSPLSSLLSLEYLLLANNNFEIPISFESFANHSKLKFVTADYNSVIVQTSSKSWIP  402

Query  1104  KFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNN  1283
             KFQL+ LSL+NC    ++P FLHYQR L++LR+S+ N+ G FP+WLL+NN +L   L++ 
Sbjct  403   KFQLEVLSLNNCS---QMPSFLHYQRRLRLLRLSKCNIGGNFPNWLLENNPRLADVLLDG  459

Query  1284  NAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI  1463
             NAFTGSL+L   + P+L+  ++SNNK+ G++  N  S FPN++   +S+N+  G L S  
Sbjct  460   NAFTGSLELP--LLPDLKAFDISNNKIQGQLPPNIGSIFPNLVISTMSNNMLEGMLPSSF  517

Query  1464  G--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHL  1637
             G    L  LDLS N   G++P  +    S L  L+LS N L+G+I      +++LEYL+L
Sbjct  518   GDMKDLAVLDLSYNKLIGDLPIGLARKGSKLNFLRLSYNMLKGEIFLISANINNLEYLYL  577

Query  1638  DGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEF  1817
             D NNF G  P  LS  PL +LD+  N LSG +P W+G + SL  L LS+NHL+GHIP ++
Sbjct  578   DRNNFSGPTPQKLSTAPLITLDLSYNNLSGNVPAWLGNIPSLTSLALSRNHLKGHIPPDY  637

Query  1818  CNLKSLSILDLSENNLTGSIPSCLNPS-SIKHVSLSKHQLSGQLTRAFFNNTALVILDLS  1994
             C L+ L +LDLS+NNL G IPSC N S  +K V LSK++L G+     F+NT L +LDL 
Sbjct  638   CRLEGLEVLDLSDNNLVGVIPSCFNSSLGLKRVYLSKNKLQGEFN--MFSNTDLKVLDLR  695

Query  1995  YNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCL  2174
              N+F G IP+W+G+   +++LLL GNR +G +PTQ+C    L +LDLS+N LSG IP CL
Sbjct  696   DNNFSGSIPKWLGSTLEITTLLLKGNRLQGTIPTQLCHASNLRILDLSHNNLSGPIPHCL  755

Query  2175  GKI-SLEGTNEQFRGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEV--QFR  2345
             G +  +EG +E +   +  F Y        D L     S +    +  +D    V  +F 
Sbjct  756   GSLMQIEGISEAYP-YSSSFGYSGFQTFGGDTLINIESSIESSSTIFFLDNYAWVGAEFT  814

Query  2346  TKGNLYNYQNSIL  2384
             TK N Y+Y+ SI+
Sbjct  815   TKYNTYSYEASIV  827


 Score =   144 bits (363),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 215/808 (27%), Positives = 314/808 (39%), Gaps = 197/808 (24%)
 Frame = +3

Query  81    SGNERLTGLINLEELHMRYTQMEEINILSVLNL-KDFISLKVLDIGFNKFQSFGPINDVG  257
             SG+ERL+GL  LE L +    +++ N+LS L L     +LK LDI +N F+SF P  ++G
Sbjct  194   SGSERLSGLDKLEILDLSDNNLDDENLLSALELNTSRTALKKLDIRYNTFRSFIPNEELG  253

Query  258   GAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYL  437
               + +E L L     +++  +S     SLK+L +  N   +G L +Q + DL+ L+EL L
Sbjct  254   ALRNIEYLLLDGNTLDENFLRSSGVMSSLKVLSVA-NCMLNGILPLQGLCDLKYLEELSL  312

Query  438   SDNYFEG----------------------------------------------------F  461
             S N F G                                                    F
Sbjct  313   SGNSFTGKLPTCLGNLTFLRVFDLTINQFTGNIASSPLSSLLSLEYLLLANNNFEIPISF  372

Query  462   ETSANHSG--------------SSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIK  599
             E+ ANHS               +S  +   K  LEVL LNN S    ++ S L     ++
Sbjct  373   ESFANHSKLKFVTADYNSVIVQTSSKSWIPKFQLEVLSLNNCS----QMPSFLHYQRRLR  428

Query  600   TLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGG  779
              L L + N+        L+N   L ++ LDG+         + P   LK   +S  ++ G
Sbjct  429   LLRLSKCNIGGNFPNWLLENNPRLADVLLDGNAFTGSLELPLLP--DLKAFDISNNKIQG  486

Query  780   TLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstlt  959
              LP        NL    +S N LEG +PS FG++  L  ++LS NKL G++ +      +
Sbjct  487   QLPPNIGSIFPNLVISTMSNNMLEGMLPSSFGDMKDLAVLDLSYNKLIGDLPIGLARKGS  546

Query  960   sleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADT-QLQGFVPKFQLDSLSLSN  1136
              L +L +  N  +    F   AN + L  +  DRN     T Q     P   LD      
Sbjct  547   KLNFLRLSYNMLK-GEIFLISANINNLEYLYLDRNNFSGPTPQKLSTAPLITLD------  599

Query  1137  CIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSS  1316
                                  +S NNL G  P+WL  N   L    ++ N   G +    
Sbjct  600   ---------------------LSYNNLSGNVPAWL-GNIPSLTSLALSRNHLKGHIPPDY  637

Query  1317  HVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDLSN  1496
                  L+++++S+N L G I   F+SS   +  + LS N   G+ +    T L  LDL +
Sbjct  638   CRLEGLEVLDLSDNNLVGVIPSCFNSSL-GLKRVYLSKNKLQGEFNMFSNTDLKVLDLRD  696

Query  1497  NSFTGEIPKEM-----------------------LISCSSLVILKLSNNKLEGQI-----  1592
             N+F+G IPK +                       L   S+L IL LS+N L G I     
Sbjct  697   NNFSGSIPKWLGSTLEITTLLLKGNRLQGTIPTQLCHASNLRILDLSHNNLSGPIPHCLG  756

Query  1593  --------VQEFDYLSSLEY------------------------LHLDGNNFEGTIpnsl  1676
                      + + Y SS  Y                          LD   + G    + 
Sbjct  757   SLMQIEGISEAYPYSSSFGYSGFQTFGGDTLINIESSIESSSTIFFLDNYAWVGAEFTTK  816

Query  1677  snlplhslDIRD---------NKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLK  1829
              N   +   I D         N+LSGEIP+ +  LT +  L LS NH+ G I  EF  L+
Sbjct  817   YNTYSYEASIVDYMSGIDLSCNQLSGEIPKELSNLTEIRALNLSHNHITGTILSEFSKLQ  876

Query  1830  SLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFV  2009
             ++  LDLS NNLTG IPS                   QL       T L I  +++N+  
Sbjct  877   NIESLDLSYNNLTGRIPS-------------------QLVEL----TTLAIFSVAHNNLT  913

Query  2010  GIIPEWIGTIsrlsslllNGNRFEGKVP  2093
             G  P+     +  +     GN F    P
Sbjct  914   GRTPQRTSQFATFTESSYEGNPFLCGPP  941



>ref|XP_011038933.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 isoform X2 [Populus euphratica]
Length=902

 Score =   388 bits (997),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 274/654 (42%), Positives = 396/654 (61%), Gaps = 27/654 (4%)
 Frame = +3

Query  468   SANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIH  647
             SAN  G +  + R K  LE LHL    ++   + SSL  F S+K+L+L    +T   +I+
Sbjct  56    SANFYGLNVLSSRLKK-LENLHLRGNQYN-DSIFSSLIGFSSLKSLDLSYNMLTGSTSIN  113

Query  648   A-LKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQE  824
                 N ++LEEL+LDGS+L  +FL +IG + +LK LS     + GTLP +GLC LKNL++
Sbjct  114   GTFFNSTTLEELYLDGSSLPLNFLHDIGVLPALKDLSAGECDLNGTLPAQGLCGLKNLEQ  173

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
             L+L EN LEG +P  F NL+SL+ +++S N+ +GNI  SPL+ L SLE++S+ NN F+V 
Sbjct  174   LFLYENNLEGSLPDCFKNLSSLQLLDVSRNQFTGNIASSPLTNLISLEFISLSNNHFKVP  233

Query  1005  SSFRSFANNSKLRVILADRNKVIADT-QLQGFVPKFQLDSLSLSNCIDL---LKLPRFLH  1172
              S + F N+S L+   +D N+++ +       +PKFQL   SLSN       ++ P FL+
Sbjct  234   ISMKPFMNHSSLKFFSSDNNRLVTEPMSFHNLIPKFQLVFFSLSNSSSEALNVETPSFLY  293

Query  1173  YQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVS  1352
              Q DL+VL +S+N+  G FPSWLL+NNT+L+   +N N+F G+L+L  H N ++  I++S
Sbjct  294   NQHDLRVLDLSQNSFIGMFPSWLLKNNTRLEQLFLNENSFVGALQLQGHPNSDMTAIDIS  353

Query  1353  NNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKE  1526
             NN + GEI  N    F N+  L ++ N  +G + S +G  + LG LDLSNN  +G +  E
Sbjct  354   NNNMHGEIPKNICLIFSNLWTLRMAKNGLTGSIPSCLGNSSSLGVLDLSNNQLSG-VELE  412

Query  1527  MLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplh--sl  1700
               I+   L  LKLSNN L GQ+       S L YL+L  NNF G I +  S +      L
Sbjct  413   QFIT---LTFLKLSNNILGGQLPASVVNSSRLNYLYLSDNNFWGQISDFPSPIRTIWPVL  469

Query  1701  DIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP  1880
             D+ +N+ SG +PRW   LT +  + LS+NH  G IP+EFC L  L  LDLSENNL  SIP
Sbjct  470   DLSNNQFSGMLPRWFVNLTQIFAIDLSENHFHGPIPVEFCKLDELKYLDLSENNLFDSIP  529

Query  1881  SCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlssll  2060
             SC NP  I HV LSK++LSG LT  F+N+++LV LDL  N+F G I   IG +S LS LL
Sbjct  530   SCFNPPHITHVHLSKNRLSGPLTYGFYNSSSLVTLDLRDNNFTGSISNRIGNLSSLSVLL  589

Query  2061  lNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYY  2240
             L  N F+G++P Q+C L +LS+LD+S+N L G +P CLG ++ + ++E+    +  F + 
Sbjct  590   LRANDFDGELPVQLCLLEQLSILDVSHNQLYGPLPSCLGNLTFKESSEK-ASTDFGFHFG  648

Query  2241  SINDAILDRLHYEWGS-----DDEYIPMLAVDVLPEVQFRTKGNLYNYQNSILK  2387
             S     +++ +YE+          YIP+   +V   ++F  KG  Y Y+  IL 
Sbjct  649   S---TPIEKAYYEFSQIRALLGSSYIPITTEEV---IEFTAKGMYYGYKGKILS  696


 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 166/684 (24%), Positives = 296/684 (43%), Gaps = 66/684 (10%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             LEEL++  + +  +N L  + +    +LK L  G        P   + G K LE+L+L+E
Sbjct  122   LEELYLDGSSLP-LNFLHDIGV--LPALKDLSAGECDLNGTLPAQGLCGLKNLEQLFLYE  178

Query  294   CRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---GFE  464
                  S+    K   SL++LD+  N F  G +    + +L +L+ + LS+N+F+     +
Sbjct  179   NNLEGSLPDCFKNLSSLQLLDVSRNQF-TGNIASSPLTNLISLEFISLSNNHFKVPISMK  237

Query  465   TSANHSG---------------SSRHTIRNKSYLEVLHLNNISFDM--TKLLSSLAAFPS  593
                NHS                 S H +  K  L    L+N S +    +  S L     
Sbjct  238   PFMNHSSLKFFSSDNNRLVTEPMSFHNLIPKFQLVFFSLSNSSSEALNVETPSFLYNQHD  297

Query  594   IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQV  773
             ++ L+L + +   +     LKN + LE+L L+ ++          P   +  + +S   +
Sbjct  298   LRVLDLSQNSFIGMFPSWLLKNNTRLEQLFLNENSFVGALQLQGHPNSDMTAIDISNNNM  357

Query  774   GGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplst  953
              G +P        NL  L +++N L G IPS  GN +SL  ++LS N+LSG      ++ 
Sbjct  358   HGEIPKNICLIFSNLWTLRMAKNGLTGSIPSCLGNSSSLGVLDLSNNQLSGVELEQFITL  417

Query  954   ltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLS  1133
                    +I+           S  N+S+L  +       ++D    G +  F     ++ 
Sbjct  418   TFLKLSNNILGGQLPA-----SVVNSSRLNYL------YLSDNNFWGQISDFPSPIRTIW  466

Query  1134  NCIDLLK------LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
               +DL        LPR+      +  + +S N+  G  P    + + +L+Y  ++ N   
Sbjct  467   PVLDLSNNQFSGMLPRWFVNLTQIFAIDLSENHFHGPIPVEFCKLD-ELKYLDLSENNLF  525

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHL  1475
              S+  S    P++  +++S N+L G ++  F +S  +++ L+L  N F+G + + IG   
Sbjct  526   DSIP-SCFNPPHITHVHLSKNRLSGPLTYGFYNS-SSLVTLDLRDNNFTGSISNRIGNLS  583

Query  1476  GFLDLSN--NSFTGEIPKEMLISCSSLVILKLSNNKLEGQI--------VQEFDYLSSLE  1625
                 L    N F GE+P ++ +    L IL +S+N+L G +         +E    +S +
Sbjct  584   SLSVLLLRANDFDGELPVQLCL-LEQLSILDVSHNQLYGPLPSCLGNLTFKESSEKASTD  642

Query  1626  Y-LHLDGNNFEGTIpnslsnlp--------lhslDIRDNKLSGEIPRWMGRLTSLVQ-LT  1775
             +  H      E                   + + ++ +    G    + G++ S +  + 
Sbjct  643   FGFHFGSTPIEKAYYEFSQIRALLGSSYIPITTEEVIEFTAKGMYYGYKGKILSFISGID  702

Query  1776  LSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQLTR  1952
             LS N   G IP E  NL  L  L+LS NNLTGSIP+   N   I+ + LS + L+G + +
Sbjct  703   LSSNKFSGAIPPELGNLSELLALNLSHNNLTGSIPATFSNLKQIESLDLSYNNLNGVIPQ  762

Query  1953  AFFNNTALVILDLSYNSFVGIIPE  2024
               +  T L +  +++N+  G  PE
Sbjct  763   KLYEMTTLEVFSVAHNNLSGKTPE  786



>ref|XP_009771122.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Nicotiana sylvestris]
Length=1022

 Score =   391 bits (1005),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 285/646 (44%), Positives = 404/646 (63%), Gaps = 36/646 (6%)
 Frame = +3

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
             +KLE L L   +FN+SIFQSL    SLK L+L  N+   G                  SD
Sbjct  143   RKLERLDLSGNQFNRSIFQSLSQLSSLKSLNLSYNNIGSG------------------SD  184

Query  444   NYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSL---AAFPSIKTLELQ  614
              +F   +     SGS R +  +K  LE+L L+N + D   +LS+L    +  ++K L+++
Sbjct  185   IWFTHNKIV---SGSERLSGLDK--LEILDLSNNNLDDENVLSALELNTSRMALKKLDIR  239

Query  615   RVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNK  794
                  +      L  L +LE L LDG+ L ++FL + G M SLKVLS++   + GTLP +
Sbjct  240   YNKFRSFIPNEELGALRNLEYLLLDGNTLDENFLRSSGVMSSLKVLSVANCNLNGTLPRQ  299

Query  795   GLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleyl  974
             G C+LK L+EL LS N   GK+P+  GNLT LR  +L++N+ +GNI  SPLS+L SLEYL
Sbjct  300   GWCDLKYLEELSLSGNSFTGKLPTCLGNLTFLRVFDLTINQFTGNIASSPLSSLLSLEYL  359

Query  975   sIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLK  1154
              + NN+FE+  SF SFAN+SKL+ + AD N VI  T  + ++PKFQL+ LSL+NC    +
Sbjct  360   LLANNNFEIPISFESFANHSKLKFVTADYNSVIVQTSSKSWIPKFQLEVLSLNNCS---Q  416

Query  1155  LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNL  1334
             +P FLHYQR L++LR+S+ N+ G FP+WLL+NN +L   L++ NAFTG L+L   + PNL
Sbjct  417   MPSFLHYQRHLRLLRLSKCNIGGNFPNWLLENNPRLAEVLLDGNAFTGILELP--LLPNL  474

Query  1335  QIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFT  1508
             +  ++SNNK+ G++  N     PN++   +S+N+  G L S  G    L  LDLS N   
Sbjct  475   KSFDISNNKIQGQLPPNIGYILPNLVISTMSNNMLEGLLPSSFGDMKDLAVLDLSYNKLI  534

Query  1509  GEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlp  1688
             G++P  +    S L  L+LSNN L+G+I      +++L YL+LD NNF G IP  LS  P
Sbjct  535   GDLPIGLAHKGSKLNFLRLSNNMLKGEIFPISANINNLYYLYLDRNNFSGPIPQKLSTAP  594

Query  1689  lhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLT  1868
             L +LD+  N LSG +  W+G + SL  L LS+N L+GHIP ++C L+ L +LDLS+NN+ 
Sbjct  595   LITLDLSYNNLSGNVLAWLGNIPSLTSLALSRNQLKGHIPPDYCRLEGLEVLDLSDNNIV  654

Query  1869  GSIPSCLNPS-SIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsr  2045
             G IPSC N S S+K V LSK++L G+     F+N+ L +LDLS N+F G IP+W+G+   
Sbjct  655   GVIPSCFNASLSLKRVYLSKNKLHGEFN--MFSNSDLKVLDLSDNNFSGSIPKWLGSTLE  712

Query  2046  lsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKI  2183
             +++LLL GNR +  +PTQ+C    L +LDLS+N LSG IP CLG +
Sbjct  713   ITTLLLKGNRLQDTIPTQLCHASNLRILDLSHNNLSGTIPHCLGSL  758


 Score =   144 bits (362),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 207/773 (27%), Positives = 327/773 (42%), Gaps = 139/773 (18%)
 Frame = +3

Query  81    SGNERLTGLINLEELHMRYTQMEEINILSVLNL-KDFISLKVLDIGFNKFQSFGPINDVG  257
             SG+ERL+GL  LE L +    +++ N+LS L L    ++LK LDI +NKF+SF P  ++G
Sbjct  194   SGSERLSGLDKLEILDLSNNNLDDENVLSALELNTSRMALKKLDIRYNKFRSFIPNEELG  253

Query  258   GAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYL  437
               + LE L L     +++  +S     SLK+L + + +  +G L  Q   DL+ L+EL L
Sbjct  254   ALRNLEYLLLDGNTLDENFLRSSGVMSSLKVLSVANCNL-NGTLPRQGWCDLKYLEELSL  312

Query  438   SDNYFEG----------------------------------------------------F  461
             S N F G                                                    F
Sbjct  313   SGNSFTGKLPTCLGNLTFLRVFDLTINQFTGNIASSPLSSLLSLEYLLLANNNFEIPISF  372

Query  462   ETSANHSG--------------SSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIK  599
             E+ ANHS               +S  +   K  LEVL LNN S    ++ S L     ++
Sbjct  373   ESFANHSKLKFVTADYNSVIVQTSSKSWIPKFQLEVLSLNNCS----QMPSFLHYQRHLR  428

Query  600   TLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGG  779
              L L + N+        L+N   L E+ LDG+      +  +  + +LK   +S  ++ G
Sbjct  429   LLRLSKCNIGGNFPNWLLENNPRLAEVLLDGNAFTG--ILELPLLPNLKSFDISNNKIQG  486

Query  780   TLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstlt  959
              LP      L NL    +S N LEG +PS FG++  L  ++LS NKL G++ +      +
Sbjct  487   QLPPNIGYILPNLVISTMSNNMLEGLLPSSFGDMKDLAVLDLSYNKLIGDLPIGLAHKGS  546

Query  960   sleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNC  1139
              L +L + NN  +    F   AN + L  +  DRN         G +P+           
Sbjct  547   KLNFLRLSNNMLK-GEIFPISANINNLYYLYLDRN------NFSGPIPQ-----------  588

Query  1140  IDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSH  1319
               L   P        L  L +S NNL G   +W L N   L    ++ N   G +     
Sbjct  589   -KLSTAP--------LITLDLSYNNLSGNVLAW-LGNIPSLTSLALSRNQLKGHIPPDYC  638

Query  1320  VNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDLSNN  1499
                 L+++++S+N + G I   F++S  ++  + LS N   G+ +    + L  LDLS+N
Sbjct  639   RLEGLEVLDLSDNNIVGVIPSCFNASL-SLKRVYLSKNKLHGEFNMFSNSDLKVLDLSDN  697

Query  1500  SFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpns--  1673
             +F+G IPK  L S   +  L L  N+L+  I  +  + S+L  L L  NN  GTIP+   
Sbjct  698   NFSGSIPK-WLGSTLEITTLLLKGNRLQDTIPTQLCHASNLRILDLSHNNLSGTIPHCLG  756

Query  1674  lsnlplhslDIRDNKLSGEIPRWMG-------------RLTSLV-----------QLTLS  1781
                     +++     S   P +               +L+S++           + T  
Sbjct  757   SLMQQEMLIELYPYSTSSGYPGFQTFGEDALIDVESSIKLSSIIFFLDNYAWVGAEFTTK  816

Query  1782  KN--HLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQLTR  1952
              N    EG I      +  +S +DLS N  +G IP  L N + I+ ++LS + ++G +  
Sbjct  817   YNTYSYEGSI------VDYMSGIDLSCNQFSGEIPKELSNLTEIRALNLSHNHITGTILS  870

Query  1953  AFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQL  2111
              F     +  LDLSYN   G IP  +  ++ L+   +  N   G+ P +  Q 
Sbjct  871   EFSKLQNIESLDLSYNHLTGRIPAQLSELTTLAVFSVAHNNLTGRTPQRSAQF  923



>ref|XP_011038932.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X1 [Populus euphratica]
Length=1022

 Score =   388 bits (996),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 289/719 (40%), Positives = 416/719 (58%), Gaps = 31/719 (4%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L E  L  C  N+           L +LDL  N FY   +    ++    L  L   D  
Sbjct  114   LGETGLVGCSENEGFGTLSSKLRKLHVLDLSYNKFYSDSI----LSCFTGLSSLKSLDLS  169

Query  450   FEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVT  629
             +     SAN  G +  + R K  LE LHL    ++   + SSL  F S+K+L+L    +T
Sbjct  170   WNTLTGSANFYGLNVLSSRLKK-LENLHLRGNQYN-DSIFSSLIGFSSLKSLDLSYNMLT  227

Query  630   NIDAIHA-LKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCE  806
                +I+    N ++LEEL+LDGS+L  +FL +IG + +LK LS     + GTLP +GLC 
Sbjct  228   GSTSINGTFFNSTTLEELYLDGSSLPLNFLHDIGVLPALKDLSAGECDLNGTLPAQGLCG  287

Query  807   LKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMN  986
             LKNL++L+L EN LEG +P  F NL+SL+ +++S N+ +GNI  SPL+ L SLE++S+ N
Sbjct  288   LKNLEQLFLYENNLEGSLPDCFKNLSSLQLLDVSRNQFTGNIASSPLTNLISLEFISLSN  347

Query  987   NSFEVASSFRSFANNSKLRVILADRNKVIADT-QLQGFVPKFQLDSLSLSNCIDL---LK  1154
             N F+V  S + F N+S L+   +D N+++ +       +PKFQL   SLSN       ++
Sbjct  348   NHFKVPISMKPFMNHSSLKFFSSDNNRLVTEPMSFHNLIPKFQLVFFSLSNSSSEALNVE  407

Query  1155  LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNL  1334
              P FL+ Q DL+VL +S+N+  G FPSWLL+NNT+L+   +N N+F G+L+L  H N ++
Sbjct  408   TPSFLYNQHDLRVLDLSQNSFIGMFPSWLLKNNTRLEQLFLNENSFVGALQLQGHPNSDM  467

Query  1335  QIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFT  1508
               I++SNN + GEI  N    F N+  L ++ N  +G + S +G  + LG LDLSNN  +
Sbjct  468   TAIDISNNNMHGEIPKNICLIFSNLWTLRMAKNGLTGSIPSCLGNSSSLGVLDLSNNQLS  527

Query  1509  GEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpn--slsn  1682
             G +  E  I+   L  LKLSNN L GQ+       S L YL+L  NNF G I +  S   
Sbjct  528   G-VELEQFIT---LTFLKLSNNILGGQLPASVVNSSRLNYLYLSDNNFWGQISDFPSPIR  583

Query  1683  lplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENN  1862
                  LD+ +N+ SG +PRW   LT +  + LS+NH  G IP+EFC L  L  LDLSENN
Sbjct  584   TIWPVLDLSNNQFSGMLPRWFVNLTQIFAIDLSENHFHGPIPVEFCKLDELKYLDLSENN  643

Query  1863  LTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIs  2042
             L  SIPSC NP  I HV LSK++LSG LT  F+N+++LV LDL  N+F G I   IG +S
Sbjct  644   LFDSIPSCFNPPHITHVHLSKNRLSGPLTYGFYNSSSLVTLDLRDNNFTGSISNRIGNLS  703

Query  2043  rlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGIN  2222
              LS LLL  N F+G++P Q+C L +LS+LD+S+N L G +P CLG ++ + ++E+    +
Sbjct  704   SLSVLLLRANDFDGELPVQLCLLEQLSILDVSHNQLYGPLPSCLGNLTFKESSEK-ASTD  762

Query  2223  LPFEYYSINDAILDRLHYEWGS-----DDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
               F + S     +++ +YE+          YIP+   +V   ++F  KG  Y Y+  IL
Sbjct  763   FGFHFGS---TPIEKAYYEFSQIRALLGSSYIPITTEEV---IEFTAKGMYYGYKGKIL  815


 Score =   136 bits (342),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 214/769 (28%), Positives = 329/769 (43%), Gaps = 144/769 (19%)
 Frame = +3

Query  105   LINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDV-GGAKKLEEL  281
             L  LE LH+R  Q  + +I S  +L  F SLK LD+ +N       IN     +  LEEL
Sbjct  189   LKKLENLHLRGNQYND-SIFS--SLIGFSSLKSLDLSYNMLTGSTSINGTFFNSTTLEEL  245

Query  282   YLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGF  461
             YL       +    +   P+LK L   + D  +G L  Q +  L+NL++L+L +N  E  
Sbjct  246   YLDGSSLPLNFLHDIGVLPALKDLSAGECDL-NGTLPAQGLCGLKNLEQLFLYENNLE--  302

Query  462   ETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDA  641
                    GS     +N S L++L ++   F      S L    S++ + L   +     +
Sbjct  303   -------GSLPDCFKNLSSLQLLDVSRNQFTGNIASSPLTNLISLEFISLSNNHFKVPIS  355

Query  642   IHALKNLSSLEELHLDGSNLHKDFLS--NIGPMESLKVLSLSGAQVGGTLPNKGLCELKN  815
             +    N SSL+    D + L  + +S  N+ P   L   SLS +                
Sbjct  356   MKPFMNHSSLKFFSSDNNRLVTEPMSFHNLIPKFQLVFFSLSNS----------------  399

Query  816   LQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSF  995
                   S   L  + PS+  N   LR ++LS N   G                       
Sbjct  400   ------SSEALNVETPSFLYNQHDLRVLDLSQNSFIG-----------------------  430

Query  996   EVASSFRSF--ANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPR-F  1166
                  F S+   NN++L  +  + N  +   QLQG  P   + ++ +SN     ++P+  
Sbjct  431   ----MFPSWLLKNNTRLEQLFLNENSFVGALQLQGH-PNSDMTAIDISNNNMHGEIPKNI  485

Query  1167  LHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIIN  1346
                  +L  LR+++N L G  PS  L N++ L    ++NN  +G ++L   +   L  + 
Sbjct  486   CLIFSNLWTLRMAKNGLTGSIPS-CLGNSSSLGVLDLSNNQLSG-VELEQFI--TLTFLK  541

Query  1347  VSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLH---SLIGTHLGFLDLSNNSFTGEI  1517
             +SNN L G++  +  +S   +  L LS N F GQ+    S I T    LDLSNN F+G +
Sbjct  542   LSNNILGGQLPASVVNS-SRLNYLYLSDNNFWGQISDFPSPIRTIWPVLDLSNNQFSGML  600

Query  1518  PKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpns--------  1673
             P+   ++ + +  + LS N   G I  EF  L  L+YL L  NN   +IP+         
Sbjct  601   PR-WFVNLTQIFAIDLSENHFHGPIPVEFCKLDELKYLDLSENNLFDSIPSCFNPPHITH  659

Query  1674  ----------------lsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHI  1805
                              ++  L +LD+RDN  +G I   +G L+SL  L L  N  +G +
Sbjct  660   VHLSKNRLSGPLTYGFYNSSSLVTLDLRDNNFTGSISNRIGNLSSLSVLLLRANDFDGEL  719

Query  1806  PIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVS------LSKHQLSGQLTRAFFN-  1964
             P++ C L+ LSILD+S N L G +PSCL   + K  S         H  S  + +A++  
Sbjct  720   PVQLCLLEQLSILDVSHNQLYGPLPSCLGNLTFKESSEKASTDFGFHFGSTPIEKAYYEF  779

Query  1965  --------------NTALVI---------------------LDLSYNSFVGIIPEWIGTI  2039
                            T  VI                     +DLS N F G IP  +G +
Sbjct  780   SQIRALLGSSYIPITTEEVIEFTAKGMYYGYKGKILSFISGIDLSSNKFSGAIPPELGNL  839

Query  2040  srlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKIS  2186
             S L +L L+ N   G +P     L ++  LDLS N L+GVIP+ L +++
Sbjct  840   SELLALNLSHNNLTGSIPATFSNLKQIESLDLSYNNLNGVIPQKLYEMT  888


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 166/684 (24%), Positives = 296/684 (43%), Gaps = 66/684 (10%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             LEEL++  + +  +N L  + +    +LK L  G        P   + G K LE+L+L+E
Sbjct  242   LEELYLDGSSLP-LNFLHDIGV--LPALKDLSAGECDLNGTLPAQGLCGLKNLEQLFLYE  298

Query  294   CRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---GFE  464
                  S+    K   SL++LD+  N F  G +    + +L +L+ + LS+N+F+     +
Sbjct  299   NNLEGSLPDCFKNLSSLQLLDVSRNQF-TGNIASSPLTNLISLEFISLSNNHFKVPISMK  357

Query  465   TSANHSG---------------SSRHTIRNKSYLEVLHLNNISFDM--TKLLSSLAAFPS  593
                NHS                 S H +  K  L    L+N S +    +  S L     
Sbjct  358   PFMNHSSLKFFSSDNNRLVTEPMSFHNLIPKFQLVFFSLSNSSSEALNVETPSFLYNQHD  417

Query  594   IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQV  773
             ++ L+L + +   +     LKN + LE+L L+ ++          P   +  + +S   +
Sbjct  418   LRVLDLSQNSFIGMFPSWLLKNNTRLEQLFLNENSFVGALQLQGHPNSDMTAIDISNNNM  477

Query  774   GGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplst  953
              G +P        NL  L +++N L G IPS  GN +SL  ++LS N+LSG      ++ 
Sbjct  478   HGEIPKNICLIFSNLWTLRMAKNGLTGSIPSCLGNSSSLGVLDLSNNQLSGVELEQFITL  537

Query  954   ltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLS  1133
                    +I+           S  N+S+L  +       ++D    G +  F     ++ 
Sbjct  538   TFLKLSNNILGGQLPA-----SVVNSSRLNYL------YLSDNNFWGQISDFPSPIRTIW  586

Query  1134  NCIDLLK------LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
               +DL        LPR+      +  + +S N+  G  P    + + +L+Y  ++ N   
Sbjct  587   PVLDLSNNQFSGMLPRWFVNLTQIFAIDLSENHFHGPIPVEFCKLD-ELKYLDLSENNLF  645

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHL  1475
              S+  S    P++  +++S N+L G ++  F +S  +++ L+L  N F+G + + IG   
Sbjct  646   DSIP-SCFNPPHITHVHLSKNRLSGPLTYGFYNS-SSLVTLDLRDNNFTGSISNRIGNLS  703

Query  1476  GFLDLSN--NSFTGEIPKEMLISCSSLVILKLSNNKLEGQI--------VQEFDYLSSLE  1625
                 L    N F GE+P ++ +    L IL +S+N+L G +         +E    +S +
Sbjct  704   SLSVLLLRANDFDGELPVQLCL-LEQLSILDVSHNQLYGPLPSCLGNLTFKESSEKASTD  762

Query  1626  Y-LHLDGNNFEGTIpnslsnlp--------lhslDIRDNKLSGEIPRWMGRLTSLVQ-LT  1775
             +  H      E                   + + ++ +    G    + G++ S +  + 
Sbjct  763   FGFHFGSTPIEKAYYEFSQIRALLGSSYIPITTEEVIEFTAKGMYYGYKGKILSFISGID  822

Query  1776  LSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQLTR  1952
             LS N   G IP E  NL  L  L+LS NNLTGSIP+   N   I+ + LS + L+G + +
Sbjct  823   LSSNKFSGAIPPELGNLSELLALNLSHNNLTGSIPATFSNLKQIESLDLSYNNLNGVIPQ  882

Query  1953  AFFNNTALVILDLSYNSFVGIIPE  2024
               +  T L +  +++N+  G  PE
Sbjct  883   KLYEMTTLEVFSVAHNNLSGKTPE  906



>ref|XP_010324748.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X4 [Solanum lycopersicum]
Length=713

 Score =   377 bits (967),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 265/597 (44%), Positives = 361/597 (60%), Gaps = 38/597 (6%)
 Frame = +3

Query  102   GLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEEL  281
             GL NL EL      +++INILS L                           G  + LE+L
Sbjct  147   GLSNLRELWFEGYGIDDINILSAL---------------------------GRLRNLEKL  179

Query  282   YLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGF  461
              L +  FN +IF SLK FPSLK L+L  N+  +G + + DI  L NLK L LSDN  E F
Sbjct  180   NLNDNNFNSTIFSSLKIFPSLKHLNLAANEI-NGYIEMNDIIALSNLKHLDLSDNNIESF  238

Query  462   ETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDA  641
              T     GS +   R+ S+   L L + + + ++++ SL +F S+K+L  +  ++T    
Sbjct  239   VTDK---GSKK---RSTSF-RSLLLGSSNSNSSRVIQSLKSFSSLKSLSYENSDLTAPTI  291

Query  642   IHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQ  821
             I+AL+NLS+LE L+LDGS+++ +FL NIG M SLKVLS++      T+PN+G CELK+L+
Sbjct  292   IYALRNLSTLEYLYLDGSSINDNFLPNIGHMTSLKVLSIAFGSNNDTIPNQGWCELKHLE  351

Query  822   ELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel-splstltsleylsIMNNSFE  998
             EL    N  EG +PS  GNLTSLR ++L+ N L GNI   S L  LTSLEYLSI +N F+
Sbjct  352   ELDFVNNNFEGTLPSCLGNLTSLRRLSLAGNNLRGNIASHSILRRLTSLEYLSIEDNQFD  411

Query  999   VASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQ  1178
             V  SF  F N +KL  +    + +I DT+ Q ++P FQL+   +  CI L KLP FLHYQ
Sbjct  412   VPLSFSQFYNYTKLIYLDVGDSTIIPDTEFQNWIPNFQLEFFGIYGCIKLQKLPSFLHYQ  471

Query  1179  RDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNN  1358
              DL++L I  N L+G+FP+WLL+NNT++      +NAF G  KL S V+  L+ I+VSNN
Sbjct  472   YDLRILVIDENQLQGKFPTWLLENNTRIAGVYSRDNAFDGPFKLPSIVHLYLKTIDVSNN  531

Query  1359  KLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI-GTHLGFLDLSNNSFTGEIPKEMLI  1535
             KL G I    S +FP + +LN+S N   G + S I G HL  LDLSNN  +GEIP +++I
Sbjct  532   KLNGHIPDKMSLAFPKLTSLNMSQNFLEGPIPSKISGIHLETLDLSNNLLSGEIPSDVVI  591

Query  1536  SCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDN  1715
                 L+ L+LSNNKL+G+I  E      L +L+L+GNN EG +P++     L  LD   N
Sbjct  592   GSPQLLFLRLSNNKLKGKIFLEVKS-HILSFLYLNGNNLEGPLPSNTFITSLFILDASRN  650

Query  1716  KLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSC  1886
               +GEIPRW+   T L+ L LSKNHL G IP+E C  K + +L +SEN L+G IPSC
Sbjct  651   NFTGEIPRWITDNTRLLLLDLSKNHLTGSIPVEICKFKLIQVLAISENRLSGFIPSC  707



>ref|XP_009631141.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL1 
[Nicotiana tomentosiformis]
Length=490

 Score =   368 bits (944),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 236/493 (48%), Positives = 334/493 (68%), Gaps = 11/493 (2%)
 Frame = +3

Query  732   MESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSL  911
             M SLKVLS++   + GTLP +GLC+LK L+E+ LS N   G++P   GNLT LR ++LS 
Sbjct  1     MSSLKVLSVAQCNLNGTLPRQGLCDLKYLEEVSLSRNNFIGRLPPCLGNLTFLRVLDLSQ  60

Query  912   NKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQ  1091
             N+  GNI LSPLS+L SLEYL + NN+FE+  SF SFAN+S L+ ++AD N VI  T  +
Sbjct  61    NQFIGNIALSPLSSLLSLEYLLLANNNFEIPISFESFANHSNLKFVIADYNSVIVQTSSK  120

Query  1092  -GFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQY  1268
               ++PKFQL++ S+SNC    K+P FLHYQ DL++LR+S++N+ G FP+WLL+NN++L  
Sbjct  121   LSWIPKFQLEAFSISNCS---KMPSFLHYQHDLRLLRLSQSNIGGNFPNWLLENNSRLGE  177

Query  1269  FLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQ  1448
               +  NAFTGSL+      PNL+  ++SNNK+ G++  N  S FPN++   +S+N+  G 
Sbjct  178   VYLGGNAFTGSLQFP--FIPNLEAFDISNNKIQGQVPPNIGSIFPNLVISTMSNNMLEGM  235

Query  1449  LHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSL  1622
             L S      +L  LD+S N   GE+P  +    S L  L+LSNN  +G+I     Y++S 
Sbjct  236   LPSSFADMKNLECLDMSYNKLNGELPIGLARRGSKLYFLRLSNNMFKGEIFPASTYINSF  295

Query  1623  EYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGH  1802
             +YL+L GN+F G+IP  LS  PLHSLD+  N LSG +P W+G + SL  L+L  N L+GH
Sbjct  296   KYLYLRGNSFSGSIPKELSTAPLHSLDLSYNNLSGNLPAWLGHIPSLTHLSLFSNDLKGH  355

Query  1803  IPIEFCNLKSLSILDLSENNLTGSIPSCLNPS-SIKHVSLSKHQLSGQLTRAFFNNTALV  1979
             IP ++C L+ L +LDLS+NN+ GSIPSC + S ++K V LS++ L G+   +  N++ L 
Sbjct  356   IPPDYCRLEGLEVLDLSQNNIVGSIPSCFSASLNLKRVYLSQNYLQGEFHMS-SNSSNLK  414

Query  1980  ILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGV  2159
             +LDL YN+F G IP+W+G++  +++LLL GNR +G +PTQ+C    L +LDLS+N LSG 
Sbjct  415   VLDLRYNNFTGSIPKWLGSL-EITTLLLKGNRLQGIIPTQLCHASELRMLDLSHNNLSGP  473

Query  2160  IPRCLGKISLEGT  2198
             IP CLG I   GT
Sbjct  474   IPHCLGNIMRRGT  486


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 140/540 (26%), Positives = 218/540 (40%), Gaps = 117/540 (22%)
 Frame = +3

Query  192   SLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDND  371
             SLKVL +         P   +   K LEE+ L    F   +   L     L++LDL  N 
Sbjct  3     SLKVLSVAQCNLNGTLPRQGLCDLKYLEEVSLSRNNFIGRLPPCLGNLTFLRVLDLSQNQ  62

Query  372   FYDGPLHIQDINDLRNLKELYLSDNYFE---GFETSANHSG---------------SSRH  497
             F  G + +  ++ L +L+ L L++N FE    FE+ ANHS                SS+ 
Sbjct  63    FI-GNIALSPLSSLLSLEYLLLANNNFEIPISFESFANHSNLKFVIADYNSVIVQTSSKL  121

Query  498   TIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEE  677
             +   K  LE   ++N S    K+ S L     ++ L L + N+        L+N S L E
Sbjct  122   SWIPKFQLEAFSISNCS----KMPSFLHYQHDLRLLRLSQSNIGGNFPNWLLENNSRLGE  177

Query  678   LHLDG----SNLHKDFLSNIGPME-------------------SLKVLSLSGAQVGGTLP  788
             ++L G     +L   F+ N+   +                   +L + ++S   + G LP
Sbjct  178   VYLGGNAFTGSLQFPFIPNLEAFDISNNKIQGQVPPNIGSIFPNLVISTMSNNMLEGMLP  237

Query  789   NKGLCELKNLQELWLSENQLEGKIPSYFGNLTS-LRYVNLSLNKLSGNIelsplstltsl  965
             +    ++KNL+ L +S N+L G++P       S L ++ LS N   G I           
Sbjct  238   SS-FADMKNLECLDMSYNKLNGELPIGLARRGSKLYFLRLSNNMFKGEI-----------  285

Query  966   eylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCID  1145
                      F  ++   SF            +   +      G +PK            +
Sbjct  286   ---------FPASTYINSF------------KYLYLRGNSFSGSIPK------------E  312

Query  1146  LLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVN  1325
             L   P        L  L +S NNL G  P+WL    +     L +N+       L  H+ 
Sbjct  313   LSTAP--------LHSLDLSYNNLSGNLPAWLGHIPSLTHLSLFSND-------LKGHIP  357

Query  1326  PN------LQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLH-SLIGTHLGFL  1484
             P+      L+++++S N + G I   FS+S  N+  + LS N   G+ H S   ++L  L
Sbjct  358   PDYCRLEGLEVLDLSQNNIVGSIPSCFSASL-NLKRVYLSQNYLQGEFHMSSNSSNLKVL  416

Query  1485  DLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI  1664
             DL  N+FTG IPK   +    +  L L  N+L+G I  +  + S L  L L  NN  G I
Sbjct  417   DLRYNNFTGSIPK--WLGSLEITTLLLKGNRLQGIIPTQLCHASELRMLDLSHNNLSGPI  474



>ref|XP_010648821.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=1014

 Score =   382 bits (980),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 256/602 (43%), Positives = 368/602 (61%), Gaps = 14/602 (2%)
 Frame = +3

Query  393   IQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLS  572
             IQ++  L NL+EL LS+N  E F T+          +++   L VLHL    F+++ L  
Sbjct  167   IQELAALHNLEELDLSNNLLESFITTKG--------LKSLRKLRVLHLETNGFNISTL-K  217

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
             SL     +K L L    +     +  L NL +LE L L  +N+    L  +  M SLK L
Sbjct  218   SLGRLSLLKELYLGGNKLEGSVTLRELNNLRNLEVLDLSSTNISSSILQIVEVMTSLKAL  277

Query  753   SLSGAQVGGTLPN-KGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGN  929
             SL    + G+    +GLC+L+NLQEL LS+N  EG +    GNLTSLR ++LS N+ SGN
Sbjct  278   SLRSNGINGSQTALQGLCKLRNLQELDLSDNGFEGSVSPCLGNLTSLRALDLSKNRFSGN  337

Query  930   IelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVI--LADRNKVIADTQLQGFVP  1103
             ++ S  + L  LE+LS+ +N F+      SFA +SKL V+  +   N ++ +++ Q +VP
Sbjct  338   LDSSLFAGLMKLEFLSLSHNVFQTFPPISSFAKHSKLEVLDLICGNNTLLLESEDQTWVP  397

Query  1104  KFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMN  1280
              FQL    LS+CI     +P FLH+Q DL+V+ +S ++LE +FP+WL++NNT+L+   + 
Sbjct  398   SFQLKVFRLSSCILKTGSIPSFLHHQHDLRVVDLSNSSLEEDFPTWLMKNNTRLEELNLK  457

Query  1281  NNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSL  1460
             NN+ TG   L    +     I++SNN L G++  N S S PN++ LN+S N F G + S 
Sbjct  458   NNSLTGYFHLPYRPHIFTSAIDISNNLLQGQMPSNISVSLPNLMFLNVSRNSFEGSIPSF  517

Query  1461  IGTH-LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHL  1637
              G   L FLDLSNN FTG IP+++ + C SL  L LS N L GQ+      L SL +L L
Sbjct  518   GGMRKLLFLDLSNNLFTGGIPEDLAMGCPSLEYLILSKNDLHGQMFPRVSNLPSLRHLEL  577

Query  1638  DGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEF  1817
             D N+F G IP+  ++  L  LD+  N +SG++P W+G +++L  L +  N LEG IP+EF
Sbjct  578   DDNHFSGKIPDLSNSSGLERLDVSHNSISGKLPGWIGNMSNLAALVMPNNSLEGPIPVEF  637

Query  1818  CNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSY  1997
             C+L +L +LDLS N+L+GS+PSC +PSS+ HV L ++ L+G LT+AF  +  L  LD+  
Sbjct  638   CSLDALELLDLSNNSLSGSLPSCFSPSSLIHVHLQENHLTGPLTKAFTRSMHLATLDIRN  697

Query  1998  NSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLG  2177
             N+  G IP+WI   S LS LLL GN F+GK+P Q+CQL ++++LDLS N LSG IP CL 
Sbjct  698   NNLSGGIPDWISMFSGLSILLLKGNHFQGKIPYQLCQLSKITILDLSYNSLSGHIPSCLN  757

Query  2178  KI  2183
             KI
Sbjct  758   KI  759


 Score =   153 bits (387),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 212/769 (28%), Positives = 321/769 (42%), Gaps = 137/769 (18%)
 Frame = +3

Query  102   GLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEEL  281
             GL +L +L + + +    NI ++ +L     LK L +G NK +    + ++   + LE L
Sbjct  194   GLKSLRKLRVLHLETNGFNISTLKSLGRLSLLKELYLGGNKLEGSVTLRELNNLRNLEVL  253

Query  282   YLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGF  461
              L     + SI Q ++   SLK L L  N        +Q +  LRNL+EL LSDN FE  
Sbjct  254   DLSSTNISSSILQIVEVMTSLKALSLRSNGINGSQTALQGLCKLRNLQELDLSDNGFE--  311

Query  462   ETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDA  641
                    GS    + N + L  L L+   F      S  A    ++ L L          
Sbjct  312   -------GSVSPCLGNLTSLRALDLSKNRFSGNLDSSLFAGLMKLEFLSLSHNVFQTFPP  364

Query  642   IHALKNLSSLEELHLDGSN---LHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELK  812
             I +    S LE L L   N   L +       P   LKV  LS             C LK
Sbjct  365   ISSFAKHSKLEVLDLICGNNTLLLESEDQTWVPSFQLKVFRLSS------------CILK  412

Query  813   NLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNS  992
                          G IPS+  +   LR V+LS                         N+S
Sbjct  413   T------------GSIPSFLHHQHDLRVVDLS-------------------------NSS  435

Query  993   FEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLH  1172
              E         NN++L  +    N +     L  + P     ++ +SN +   ++P  + 
Sbjct  436   LEEDFPTWLMKNNTRLEELNLKNNSLTGYFHLP-YRPHIFTSAIDISNNLLQGQMPSNIS  494

Query  1173  YQ-RDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVN-PNLQIIN  1346
                 +L  L +SRN+ EG  PS+      KL +  ++NN FTG +     +  P+L+ + 
Sbjct  495   VSLPNLMFLNVSRNSFEGSIPSF--GGMRKLLFLDLSNNLFTGGIPEDLAMGCPSLEYLI  552

Query  1347  VSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTH-LGFLDLSNNSFTGEIPK  1523
             +S N L G++     S+ P++  L L  N FSG++  L  +  L  LD+S+NS +G++P 
Sbjct  553   LSKNDLHGQMFPRV-SNLPSLRHLELDDNHFSGKIPDLSNSSGLERLDVSHNSISGKLPG  611

Query  1524  EMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-------------  1664
               + + S+L  L + NN LEG I  EF  L +LE L L  N+  G++             
Sbjct  612   -WIGNMSNLAALVMPNNSLEGPIPVEFCSLDALELLDLSNNSLSGSLPSCFSPSSLIHVH  670

Query  1665  -----------pnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPI  1811
                             ++ L +LDIR+N LSG IP W+   + L  L L  NH +G IP 
Sbjct  671   LQENHLTGPLTKAFTRSMHLATLDIRNNNLSGGIPDWISMFSGLSILLLKGNHFQGKIPY  730

Query  1812  EFCNLKSLSILDLSENNLTGSIPSCLNPSSIK---------------------------H  1910
             + C L  ++ILDLS N+L+G IPSCLN    +                           H
Sbjct  731   QLCQLSKITILDLSYNSLSGHIPSCLNKIRFRTGFRSGKFSIISYFQSSGFSSYLYHSQH  790

Query  1911  VSLSK-----HQLSGQLTRAFFNNT------------ALVILDLSYNSFVGIIPEWIGTI  2039
             + LS+     + ++     A F               ++  +DLS N   G IP  IG +
Sbjct  791   IELSQVNVNSYPIAYDKAMAEFTTKNRTDFYKGNFLYSMTGIDLSSNKLTGAIPPEIGNL  850

Query  2040  srlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKIS  2186
             S++ +L L+ N   G +P     L  +  LDLS N L+G IP  L +++
Sbjct  851   SQVHALNLSHNILTGPIPAAFSGLKSIESLDLSYNNLTGTIPGELTELT  899


 Score =   113 bits (282),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 189/709 (27%), Positives = 294/709 (41%), Gaps = 84/709 (12%)
 Frame = +3

Query  84    GNERLTGLINLEELH----MRYTQMEEINILS-VLNLKDFI-SLKVLDI---GFNKFQSF  236
             G  +L G + L EL+    +    +   NI S +L + + + SLK L +   G N  Q+ 
Sbjct  231   GGNKLEGSVTLRELNNLRNLEVLDLSSTNISSSILQIVEVMTSLKALSLRSNGINGSQT-  289

Query  237   GPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLR  416
               +  +   + L+EL L +  F  S+   L    SL+ LDL  N F  G L       L 
Sbjct  290   -ALQGLCKLRNLQELDLSDNGFEGSVSPCLGNLTSLRALDLSKNRF-SGNLDSSLFAGLM  347

Query  417   NLKELYLSDNYFEGF---ETSANHSG----------------SSRHTIRNKSYLEVLHLN  539
              L+ L LS N F+ F    + A HS                 S   T      L+V  L+
Sbjct  348   KLEFLSLSHNVFQTFPPISSFAKHSKLEVLDLICGNNTLLLESEDQTWVPSFQLKVFRLS  407

Query  540   NISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLS  719
             +       + S L     ++ ++L   ++        +KN + LEEL+L  ++L   F  
Sbjct  408   SCILKTGSIPSFLHHQHDLRVVDLSNSSLEEDFPTWLMKNNTRLEELNLKNNSLTGYFHL  467

Query  720   NIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYV  899
                P      + +S   + G +P+     L NL  L +S N  EG IPS FG +  L ++
Sbjct  468   PYRPHIFTSAIDISNNLLQGQMPSNISVSLPNLMFLNVSRNSFEGSIPS-FGGMRKLLFL  526

Query  900   NLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD  1079
             +LS N  +G I         SLEYL +  N       F   +N   LR +  D      D
Sbjct  527   DLSNNLFTGGIPEDLAMGCPSLEYLILSKNDLH-GQMFPRVSNLPSLRHLELD------D  579

Query  1080  TQLQGFVPKFQ----LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQ  1247
                 G +P       L+ L +S+     KLP ++    +L  L +  N+LEG  P     
Sbjct  580   NHFSGKIPDLSNSSGLERLDVSHNSISGKLPGWIGNMSNLAALVMPNNSLEGPIPVEFCS  639

Query  1248  NNTKLQYFLMNNNAFTGSLKLSSHVNPNLQI-INVSNNKLCGEISGNFSSSFPNILALNL  1424
              +  L+   ++NN+ +GSL   S  +P+  I +++  N L G ++  F+ S  ++  L++
Sbjct  640   LDA-LELLDLSNNSLSGSLP--SCFSPSSLIHVHLQENHLTGPLTKAFTRSM-HLATLDI  695

Query  1425  SSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ  1598
              +N  SG +   I   + L  L L  N F G+IP + L   S + IL LS N L G I  
Sbjct  696   RNNNLSGGIPDWISMFSGLSILLLKGNHFQGKIPYQ-LCQLSKITILDLSYNSLSGHIPS  754

Query  1599  EFD--------------------------YLSSLEYLHLDGNNFEGTIpnslsnlplhsl  1700
               +                          YL   +++ L   N           +   + 
Sbjct  755   CLNKIRFRTGFRSGKFSIISYFQSSGFSSYLYHSQHIELSQVNVNSYPIAYDKAMAEFTT  814

Query  1701  DIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP  1880
               R +   G        L S+  + LS N L G IP E  NL  +  L+LS N LTG IP
Sbjct  815   KNRTDFYKGNF------LYSMTGIDLSSNKLTGAIPPEIGNLSQVHALNLSHNILTGPIP  868

Query  1881  SCLNP-SSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPE  2024
             +  +   SI+ + LS + L+G +       T L +  ++YN+  G IPE
Sbjct  869   AAFSGLKSIESLDLSYNNLTGTIPGELTELTNLAVFSVAYNNLSGKIPE  917



>ref|XP_006489885.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X4 [Citrus sinensis]
Length=1147

 Score =   383 bits (984),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 298/808 (37%), Positives = 436/808 (54%), Gaps = 99/808 (12%)
 Frame = +3

Query  78    NSGNERLTGLINLEELHMRY-------------------TQMEEINILSVLNLKDFISLK  200
             N G ERL+ L NL+ L++ Y                    ++   N+   +++K+F SL+
Sbjct  120   NEGLERLSRLNNLKMLNLSYNWFNNSILSSLTRLSSLRSLKLYANNLEGSIDVKEFDSLR  179

Query  201   ---VLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDND  371
                 LDIG+N    F       G  KL+ L L   + N+SI  SL  F SL+ L L D  
Sbjct  180   DLEELDIGWNMIDKFVV---SKGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTG  236

Query  372   FYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISF  551
             F  G   +++ +   NL+ L +S+N  +       + G  +        L+ LHL+ +  
Sbjct  237   F-KGTFDVREFDSFNNLEVLDMSNNEIDNLVVPQGYRGLRK--------LKSLHLSGVGI  287

Query  552   -DMTKLLSSLAAFPSIKTLELQRVN-VTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNI  725
              D +KLL S+ +FPS+ TL +   N +    A   L N ++LE L LD S+LH   L +I
Sbjct  288   RDGSKLLQSIGSFPSLNTLYISWNNFIDTATATQELHNFTNLEYLTLDFSSLHISLLQSI  347

Query  726   GPM-ESLKVLSLSGAQV-----------------------------------GGTLP---  788
               +  SLK LS+S  +V                                   G ++P   
Sbjct  348   ASLFPSLKNLSISHCEVNGVLRGQGFPHFKSLEHFDMRFARIALNTSFLQIIGESMPSLK  407

Query  789   -----------------NKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNK  917
                              ++GLC L +LQEL++  N L G +P    N+TSLR +++S N+
Sbjct  408   YLLLSYSTLGTNSSRILHQGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQ  467

Query  918   LSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQG  1094
             L+G+I  SPL  LTS+E L + NN F +  S     N+S+L++  AD N++ A+ T+   
Sbjct  468   LTGSISSSPLVHLTSIEKLDLSNNHFWIPISLEPLFNHSRLKLFYADNNEIKAEITESHS  527

Query  1095  F-VPKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQY  1268
                P FQL  LSLS+   D +  P+FL++Q DL+ + +S  N+ GEFP+WLL+NNT L+Y
Sbjct  528   LTAPNFQLKYLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHINMSGEFPNWLLENNTNLEY  587

Query  1269  FLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQ  1448
               + N++  G  +L  H +  L+++++SNN + G I        P + +LN++ N   G 
Sbjct  588   IFLVNDSLAGPFRLPIHSHKRLRLLDISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGC  647

Query  1449  LHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSL  1622
             + S  G    L FLDLSNN  TGEIPK + + C +L  L LSNN LEG +      L++L
Sbjct  648   IPSSFGNMKFLQFLDLSNNQLTGEIPKHLAVGCVNLESLALSNNNLEGHMFSRNFNLTNL  707

Query  1623  EYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEG  1799
             ++L L+ N+F G I  +      L  L + +N LSG+IPRW+G LT L  + +  NHLEG
Sbjct  708   KWLQLESNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEG  767

Query  1800  HIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNTAL  1976
              IP+EFC L+SL ILD+S+NN++GS+PSC +P SIK V LSK+ L GQL R  FFN ++L
Sbjct  768   PIPVEFCQLESLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSL  827

Query  1977  VILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsG  2156
             V LDLSYN   G IP+W+  +S+LS L+L  N  EG+VP Q+C+L +L LLDLSNN L G
Sbjct  828   VTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHG  887

Query  2157  VIPRCLGKISLEGTNEQFRGINLPFEYY  2240
             +IP C    +L  +       +  FE Y
Sbjct  888   LIPPCFDNTTLHESYNNSSSPDEQFEIY  915


 Score =   131 bits (330),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 190/691 (27%), Positives = 297/691 (43%), Gaps = 134/691 (19%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L ++++L LS+N+
Sbjct  434   LQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEKLDLSNNH  492

Query  450   FE---GFETSANHSG---------------SSRHTIRNKSY-LEVLHLNNISFDMTKLLS  572
             F      E   NHS                +  H++   ++ L+ L L++   D      
Sbjct  493   FWIPISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPK  552

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
              L     ++ ++L  +N++       L+N ++LE + L   +L   F   I   + L++L
Sbjct  553   FLYHQHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLL  612

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S   + G +P +    L  L  L ++ N L+G IPS FGN+  L++++LS N+L+G I
Sbjct  613   DISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEI  672

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                      +LE L++ NN+ E     R+F N + L+ +  + N  +      G +P+  
Sbjct  673   PKHLAVGCVNLESLALSNNNLEGHMFSRNF-NLTNLKWLQLESNHFV------GEIPQ--  723

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C               L+ L ++ N+L G+ P WL  N T LQY +M NN  
Sbjct  724   ----SLSKC-------------SSLEGLYLNNNSLSGKIPRWL-GNLTWLQYIIMPNNHL  765

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP--NILALNLSSNLFSGQLH----  1454
              G + +      +LQI+++S+N     ISG+  S F   +I  ++LS N+  GQL     
Sbjct  766   EGPIPVEFCQLESLQILDISDNN----ISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTF  821

Query  1455  ----SLIGTHLGF-------------------LDLSNNSFTGEIPKEMLISCSSLVILKL  1565
                 SL+   L +                   L L +N+  GE+P + L   + L +L L
Sbjct  822   FNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQ-LCELNQLQLLDL  880

Query  1566  SNNKLEGQIVQEFDYLSSLE--------------YLHLDGNN----------FEGT----  1661
             SNN L G I   FD  +  E              Y+ ++G            FE T    
Sbjct  881   SNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIYVFIEGPQGGVEKKIHEIFEFTTKNI  940

Query  1662  --IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSL  1835
               I        L  LD+  NKL G IP  +G LT +  L LS ++L G IP  F NLK +
Sbjct  941   AYIYQGKVFSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHHNLTGSIPSTFSNLKHV  1000

Query  1836  SILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGI  2015
               LDLS N L G IP               HQL    T        L +  ++YN+  G 
Sbjct  1001  ESLDLSNNKLNGKIP---------------HQLVELKT--------LEVFSVAYNNLSGE  1037

Query  2016  IPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
             I EW    +  +     GN F   +P  +C+
Sbjct  1038  ILEWKAQFATFNGSSYEGNTFLCGLPLPICR  1068



>ref|XP_006389342.1| hypothetical protein POPTR_0027s00200g [Populus trichocarpa]
 gb|ERP48256.1| hypothetical protein POPTR_0027s00200g [Populus trichocarpa]
Length=895

 Score =   377 bits (969),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 303/778 (39%), Positives = 438/778 (56%), Gaps = 82/778 (11%)
 Frame = +3

Query  72    LNNSGNERLTGLINLEELHMRYTQME-EINILSVLNLKDFISLKVLDIGFNKFQSFGPIN  248
             + N G E L+    L  L +R  +   + +ILS  N  +  +LK LD+ FN     G   
Sbjct  119   MENEGFEVLSS--KLSNLDLRVNKFTNDKSILSCFN-GNLSTLKSLDLSFN-----GLTA  170

Query  249   DVGGAK-------KLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPL------  389
               GG K       KLE L L E ++N SIF SL GF SLK L L  N      L      
Sbjct  171   GSGGLKVLSSRLKKLENLLLRENQYNDSIFPSLTGFSSLKSLYLSGNQLTGSGLKDLSSR  230

Query  390   -------HIQDI--ND--------LRNLKELYLSDNYF--EGFETSANHSGS------SR  494
                    H+ +I  ND          +LK LYLS N     GFE  ++H G       S 
Sbjct  231   LKKLENLHLSEIQCNDSIFPSLTGFSSLKSLYLSGNQLTGSGFEIISSHLGKLENLDLSH  290

Query  495   HTIRNKSYLEVL----HLN--NISFDMT------------KLLSSLAAFPSIKTLELQRV  620
             + I N S L  L    HL   N+S +M              +L SL ++PS+KTL L+  
Sbjct  291   NNIFNDSILSHLRGLSHLKSLNLSGNMLLGSTTINGLRNLDILQSLRSWPSLKTLSLKDT  350

Query  621   NVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGL  800
             N++         N S+LEELHLD ++L  +FL N G + +LKVLS++   + GTLP +G 
Sbjct  351   NLSQ----GTFFNSSTLEELHLDNTSLPINFLQNTGALPALKVLSVAECDLHGTLPAQGW  406

Query  801   CELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsI  980
             CELKNL++L L+ N   G +P   GNL+SL+ +++S N+ +GNI   PL+ L SLE+LS+
Sbjct  407   CELKNLKQLDLARNNFGGALPDCLGNLSSLQLLDVSDNQFTGNIAFGPLTKLISLEFLSL  466

Query  981   MNNSFEVASSFRSFANNSKLRVILADRNKVIADTQ-LQGFVPKFQLDSLSLSNCIDL---  1148
              NN FEV  S + F N+S L+   ++ N+++ ++      +PKFQL    LS+       
Sbjct  467   SNNLFEVPISMKPFMNHSSLKFFSSENNRLVTESAAFDNLIPKFQLVFFRLSSSPTSEAL  526

Query  1149  -LKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVN  1325
              +++  FL+YQ DL+ L +S NN+ G FPSWLL+NNT+++   ++ N+F G+L+L  H  
Sbjct  527   NVEILDFLYYQYDLRTLDLSHNNIFGMFPSWLLKNNTRMEQLYLSENSFVGTLQLLDHPY  586

Query  1326  PNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNN  1499
             PN+  +++SNN + G+I  +    FPN+  L ++ N F+G + S +G  + L FLDLSNN
Sbjct  587   PNMTELDISNNNINGQIPKDICLIFPNLWILRMADNGFTGYIPSCLGNFSSLSFLDLSNN  646

Query  1500  SFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpn--s  1673
                 ++    L   +++ +LKLSNN L GQI       S  +YL+L GN F G I +   
Sbjct  647   ----QLSTVKLEQLTTIQVLKLSNNSLGGQIPTSVFNSSISQYLYLGGNYFWGQISDFPL  702

Query  1674  lsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLS  1853
                     LD+ +N+ SG +PR     T    L LSKN  +G IP +FC L  L  LDLS
Sbjct  703   YGWKVWSVLDLSNNQFSGMLPRSFFNFTYDEVLDLSKNLFKGPIPRDFCKLDRLEFLDLS  762

Query  1854  ENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIG  2033
             +N L+G +PSC NP  I H+ LSK++LSG LT  F+N+++LV +DL  NSF+G IP WIG
Sbjct  763   DNYLSGYMPSCFNPPQITHIHLSKNRLSGPLTYGFYNSSSLVTMDLRDNSFIGSIPNWIG  822

Query  2034  TIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQ  2207
              +S LS LLL  N F+G++  Q+C L +LS+LD+S N LSG +P CLG ++L+ ++++
Sbjct  823   NLSSLSVLLLRANNFDGELAVQLCLLEQLSILDVSQNQLSGPLPSCLGNLTLKESSQK  880



>ref|XP_010648726.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=1020

 Score =   380 bits (977),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 261/612 (43%), Positives = 368/612 (60%), Gaps = 21/612 (3%)
 Frame = +3

Query  393   IQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLS  572
             IQ++  L NL+EL LS N  E F T+          +++   L VLHL    F+++ L  
Sbjct  167   IQELAALHNLEELDLSKNDLESFITTTG--------LKSLRKLRVLHLETNDFNISTL-K  217

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
             SL     +K L L    +     +  L NL +LE L L  +N+    L  +  M SLK L
Sbjct  218   SLGRLSLLKELYLGGNKLEGSVTLRELNNLRNLEVLDLSSTNISSSILQIVEVMTSLKAL  277

Query  753   SLSGAQVGGTLPN-KGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGN  929
             SL    + G+    +GLC+LKNLQEL LS+N  EG +    GNLTSLR ++LS N+ SGN
Sbjct  278   SLRSNGINGSQTALQGLCKLKNLQELDLSDNGFEGSVSPCLGNLTSLRALDLSKNRFSGN  337

Query  930   IelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVI--LADRNKVIADTQLQGFVP  1103
             ++ S  + L  LE+LS+ +N F+      SFA +SKL V+  +   N ++ +++ Q +VP
Sbjct  338   LDSSLFAGLMKLEFLSLSHNVFQTFPPISSFAKHSKLEVLDLICGNNTLLLESEDQTWVP  397

Query  1104  KFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMN  1280
              FQL    LS+CI     +P FLHYQ DL+V+ +S ++LE +FP+WL++NNT+L+   + 
Sbjct  398   SFQLKVFRLSSCILKTGSIPSFLHYQHDLRVVDLSNSSLEEDFPTWLMKNNTRLEELNLK  457

Query  1281  NNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSL  1460
             NN+ TG   L    N     I++SNN L G++  N S S PN++ LN+S N F G + S 
Sbjct  458   NNSLTGYFHLPYRPNIFTSAIDISNNLLQGQMPSNISVSLPNLMFLNVSRNSFEGSIPSF  517

Query  1461  IGTH-LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHL  1637
              G   L FLDLSNN FTG IP+++ + C SL  L LS N L GQ+      L SL +L L
Sbjct  518   GGMRKLLFLDLSNNLFTGGIPEDLAMGCPSLEYLILSKNDLHGQMFPRVSNLPSLRHLEL  577

Query  1638  DGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEF  1817
             D N+F G IP+  ++  L  L +  N +SG++P W+G +++L  L +  N LEG IP+EF
Sbjct  578   DDNHFSGKIPDLSNSSGLERLYVSHNSISGKLPGWIGNMSNLAALVMPNNSLEGPIPVEF  637

Query  1818  CNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSY  1997
             C+L +L +LDLS NNL+GS+PSC +PS + HV L ++ L+G LT+AF  +  L  LD+  
Sbjct  638   CSLDALELLDLSNNNLSGSLPSCFSPSLLIHVHLQENHLTGPLTKAFTRSMDLATLDIRN  697

Query  1998  NSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLG  2177
             N+  G IP+WI   S LS LLL GN F+GK+P Q+CQL ++++LDLS N LSG IP CL 
Sbjct  698   NNLSGGIPDWISMFSGLSILLLKGNHFQGKIPYQLCQLSKITILDLSYNSLSGHIPSCLN  757

Query  2178  KISLEGTNEQFR  2213
             KI       QFR
Sbjct  758   KI-------QFR  762


 Score =   152 bits (384),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 214/770 (28%), Positives = 323/770 (42%), Gaps = 137/770 (18%)
 Frame = +3

Query  99    TGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEE  278
             TGL +L +L + + +  + NI ++ +L     LK L +G NK +    + ++   + LE 
Sbjct  193   TGLKSLRKLRVLHLETNDFNISTLKSLGRLSLLKELYLGGNKLEGSVTLRELNNLRNLEV  252

Query  279   LYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEG  458
             L L     + SI Q ++   SLK L L  N        +Q +  L+NL+EL LSDN FE 
Sbjct  253   LDLSSTNISSSILQIVEVMTSLKALSLRSNGINGSQTALQGLCKLKNLQELDLSDNGFE-  311

Query  459   FETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNID  638
                     GS    + N + L  L L+   F      S  A    ++ L L         
Sbjct  312   --------GSVSPCLGNLTSLRALDLSKNRFSGNLDSSLFAGLMKLEFLSLSHNVFQTFP  363

Query  639   AIHALKNLSSLEELHLDGSN---LHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCEL  809
              I +    S LE L L   N   L +       P   LKV  LS             C L
Sbjct  364   PISSFAKHSKLEVLDLICGNNTLLLESEDQTWVPSFQLKVFRLSS------------CIL  411

Query  810   KNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNN  989
             K             G IPS+      LR V+LS                         N+
Sbjct  412   KT------------GSIPSFLHYQHDLRVVDLS-------------------------NS  434

Query  990   SFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFL  1169
             S E         NN++L  +    N +     L  + P     ++ +SN +   ++P  +
Sbjct  435   SLEEDFPTWLMKNNTRLEELNLKNNSLTGYFHLP-YRPNIFTSAIDISNNLLQGQMPSNI  493

Query  1170  HYQ-RDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVN-PNLQII  1343
                  +L  L +SRN+ EG  PS+      KL +  ++NN FTG +     +  P+L+ +
Sbjct  494   SVSLPNLMFLNVSRNSFEGSIPSF--GGMRKLLFLDLSNNLFTGGIPEDLAMGCPSLEYL  551

Query  1344  NVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTH-LGFLDLSNNSFTGEIP  1520
              +S N L G++     S+ P++  L L  N FSG++  L  +  L  L +S+NS +G++P
Sbjct  552   ILSKNDLHGQMFPRV-SNLPSLRHLELDDNHFSGKIPDLSNSSGLERLYVSHNSISGKLP  610

Query  1521  KEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI------------  1664
                + + S+L  L + NN LEG I  EF  L +LE L L  NN  G++            
Sbjct  611   G-WIGNMSNLAALVMPNNSLEGPIPVEFCSLDALELLDLSNNNLSGSLPSCFSPSLLIHV  669

Query  1665  ------------pnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIP  1808
                              ++ L +LDIR+N LSG IP W+   + L  L L  NH +G IP
Sbjct  670   HLQENHLTGPLTKAFTRSMDLATLDIRNNNLSGGIPDWISMFSGLSILLLKGNHFQGKIP  729

Query  1809  IEFCNLKSLSILDLSENNLTGSIPSCLN-------------------PSS--------IK  1907
              + C L  ++ILDLS N+L+G IPSCLN                   PS          +
Sbjct  730   YQLCQLSKITILDLSYNSLSGHIPSCLNKIQFRTGFRSGKFSIISYFPSPGFSSYLYHSQ  789

Query  1908  HVSLSK-----HQLSGQLTRAFFNNT------------ALVILDLSYNSFVGIIPEWIGT  2036
             H+ LS+     + ++     A F               ++  +DLS N   G IP  IG 
Sbjct  790   HIELSQVNVNSYPIAYDKAMAEFTTKNRTDFYKGNFLYSMTGIDLSSNKLTGAIPPEIGN  849

Query  2037  IsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKIS  2186
             +S++ +L L+ N   G +P     L  +  LDLS N L+G IP  L +++
Sbjct  850   LSQVHALNLSHNILTGPIPAAFSGLKSIESLDLSYNNLTGTIPGELTELT  899


 Score =   114 bits (285),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 191/709 (27%), Positives = 294/709 (41%), Gaps = 84/709 (12%)
 Frame = +3

Query  84    GNERLTGLINLEELH----MRYTQMEEINILS-VLNLKDFI-SLKVLDI---GFNKFQSF  236
             G  +L G + L EL+    +    +   NI S +L + + + SLK L +   G N  Q+ 
Sbjct  231   GGNKLEGSVTLRELNNLRNLEVLDLSSTNISSSILQIVEVMTSLKALSLRSNGINGSQT-  289

Query  237   GPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLR  416
               +  +   K L+EL L +  F  S+   L    SL+ LDL  N F  G L       L 
Sbjct  290   -ALQGLCKLKNLQELDLSDNGFEGSVSPCLGNLTSLRALDLSKNRF-SGNLDSSLFAGLM  347

Query  417   NLKELYLSDNYFEGF---ETSANHSG----------------SSRHTIRNKSYLEVLHLN  539
              L+ L LS N F+ F    + A HS                 S   T      L+V  L+
Sbjct  348   KLEFLSLSHNVFQTFPPISSFAKHSKLEVLDLICGNNTLLLESEDQTWVPSFQLKVFRLS  407

Query  540   NISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLS  719
             +       + S L     ++ ++L   ++        +KN + LEEL+L  ++L   F  
Sbjct  408   SCILKTGSIPSFLHYQHDLRVVDLSNSSLEEDFPTWLMKNNTRLEELNLKNNSLTGYFHL  467

Query  720   NIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYV  899
                P      + +S   + G +P+     L NL  L +S N  EG IPS FG +  L ++
Sbjct  468   PYRPNIFTSAIDISNNLLQGQMPSNISVSLPNLMFLNVSRNSFEGSIPS-FGGMRKLLFL  526

Query  900   NLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD  1079
             +LS N  +G I         SLEYL +  N       F   +N   LR +  D      D
Sbjct  527   DLSNNLFTGGIPEDLAMGCPSLEYLILSKNDLH-GQMFPRVSNLPSLRHLELD------D  579

Query  1080  TQLQGFVPKFQ----LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQ  1247
                 G +P       L+ L +S+     KLP ++    +L  L +  N+LEG  P     
Sbjct  580   NHFSGKIPDLSNSSGLERLYVSHNSISGKLPGWIGNMSNLAALVMPNNSLEGPIPVEFCS  639

Query  1248  NNTKLQYFLMNNNAFTGSLKLSSHVNPNLQI-INVSNNKLCGEISGNFSSSFPNILALNL  1424
              +  L+   ++NN  +GSL   S  +P+L I +++  N L G ++  F+ S  ++  L++
Sbjct  640   LDA-LELLDLSNNNLSGSLP--SCFSPSLLIHVHLQENHLTGPLTKAFTRSM-DLATLDI  695

Query  1425  SSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ  1598
              +N  SG +   I   + L  L L  N F G+IP + L   S + IL LS N L G I  
Sbjct  696   RNNNLSGGIPDWISMFSGLSILLLKGNHFQGKIPYQ-LCQLSKITILDLSYNSLSGHIPS  754

Query  1599  EFD--------------------------YLSSLEYLHLDGNNFEGTIpnslsnlplhsl  1700
               +                          YL   +++ L   N           +   + 
Sbjct  755   CLNKIQFRTGFRSGKFSIISYFPSPGFSSYLYHSQHIELSQVNVNSYPIAYDKAMAEFTT  814

Query  1701  DIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP  1880
               R +   G        L S+  + LS N L G IP E  NL  +  L+LS N LTG IP
Sbjct  815   KNRTDFYKGNF------LYSMTGIDLSSNKLTGAIPPEIGNLSQVHALNLSHNILTGPIP  868

Query  1881  SCLNP-SSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPE  2024
             +  +   SI+ + LS + L+G +       T L +  ++YN+  G IPE
Sbjct  869   AAFSGLKSIESLDLSYNNLTGTIPGELTELTNLAVFSVAYNNLSGKIPE  917



>ref|XP_006382343.1| hypothetical protein POPTR_0005s01230g, partial [Populus trichocarpa]
 gb|ERP60140.1| hypothetical protein POPTR_0005s01230g, partial [Populus trichocarpa]
Length=880

 Score =   376 bits (965),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 288/723 (40%), Positives = 401/723 (55%), Gaps = 59/723 (8%)
 Frame = +3

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
             + LEELYL   +FN SI  SL GF +LK LD                          LS+
Sbjct  2     RNLEELYLGSNKFNDSILLSLSGFSTLKSLD--------------------------LSN  35

Query  444   NYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVN  623
             N F G         +  + +RN   LE L+L++  F  + L+ SL A PS+KTL+    N
Sbjct  36    NSFTG--------STGLNGLRN---LETLYLDSTDFKESILIESLGALPSLKTLDASYSN  84

Query  624   VTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLC  803
              T+      L N SSLEE+ LD S+L   FL NIGP+ +LKVLSL+G     TLP +G C
Sbjct  85    FTHFG--KGLCNSSSLEEVFLDDSSLPASFLRNIGPLSTLKVLSLAGVDFNSTLPAQGWC  142

Query  804   ELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIM  983
             ELKNL+EL+LS N L+G +P   GNL+ L+ ++LS N+L GNI  S LS L  L  LSI 
Sbjct  143   ELKNLEELYLSGNNLKGVLPPCLGNLSFLQILDLSHNQLEGNIAFSYLSHLKQLRSLSIK  202

Query  984   NNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCI-DLLK--  1154
             NN F+V  SF SF N S L++I  D N++IA    Q   PKFQL   S SNC    LK  
Sbjct  203   NNYFQVPISFGSFMNLSNLKLIACDNNELIAAPSFQPSAPKFQLLFFSASNCTPKPLKAG  262

Query  1155  LPRFLHYQRDLKVLRISRNNLEGE-FPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPN  1331
                FLH Q DL  + +S N   GE FPSWL +NN KL    + + + TG L+L  H  P 
Sbjct  263   FTNFLHSQYDLMFVDLSHNKFVGEPFPSWLFENNRKLNRLYLRDTSITGPLQLPQHPTPY  322

Query  1332  LQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSF  1505
             LQ +++S N + G+I+ N  S FP +    +++N  +G +    G  + L FLDLSNN  
Sbjct  323   LQTVDISGNTIHGQIARNICSIFPRLKNFLMANNSLTGCIPRCFGNMSSLEFLDLSNNHM  382

Query  1506  TGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIp-nslsn  1682
             + E+ +  L +  SL  L+LSNN   G++      ++ L YL LDGN F G +P      
Sbjct  383   SCELLEHNLPTVGSLWSLQLSNNNFSGRLPPSVFNMTYLLYLLLDGNKFVGEVPGTFSLE  442

Query  1683  lplhslDIRDNKLSGEIPRWMGRLTS--LVQLTLSKNHLEGHIPIEFCNLKSLSILDLSE  1856
               L  LDI +N LSG +PR +G  +   L  + LS+NH EG IPIE+ N   L  +DLSE
Sbjct  443   SSLLWLDISNNLLSGMLPRGIGNSSKNQLDGIDLSRNHFEGTIPIEYFNSSGLEFVDLSE  502

Query  1857  NNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGT  2036
             NNL+GS+P   +   +++V L  ++LSG L   F+N ++LV LDL  N+  G IP WI +
Sbjct  503   NNLSGSLPLGFHALDLRYVHLYGNRLSGPLPYDFYNLSSLVTLDLGDNNLTGPIPNWIDS  562

Query  2037  IsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRG  2216
             +S LS  +L  N+F GK+P Q+C L +LS+LDLS N  SG++P CL  ++L  ++E+   
Sbjct  563   LSELSIFVLKSNQFNGKLPHQLCLLRKLSILDLSENNFSGLLPSCLSNLNLTASDEK---  619

Query  2217  INLPFEYYSINDAILDRLHYEWG------SDDEYIPMLAVDVLPEVQFRTKGNLYNYQNS  2378
              ++  ++ S +    + +    G      SD    P ++V +   V+   K N Y Y+  
Sbjct  620   TSVEPDWGSRDYWSEEEMFSSMGGRGFSPSDTMLWPEISVKI--AVELTAKKNFYTYEGG  677

Query  2379  ILK  2387
             IL+
Sbjct  678   ILR  680


 Score =   120 bits (302),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 194/734 (26%), Positives = 305/734 (42%), Gaps = 147/734 (20%)
 Frame = +3

Query  102   GLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEEL  281
             GL N   L   +     +    + N+    +LKVL +    F S  P       K LEEL
Sbjct  91    GLCNSSSLEEVFLDDSSLPASFLRNIGPLSTLKVLSLAGVDFNSTLPAQGWCELKNLEEL  150

Query  282   YLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGF  461
             YL        +   L     L+ILDL  N   +G +    ++ L+ L+ L + +NYF+  
Sbjct  151   YLSGNNLKGVLPPCLGNLSFLQILDLSHNQL-EGNIAFSYLSHLKQLRSLSIKNNYFQ--  207

Query  462   ETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTN---  632
                          I   S++ + +L  I+ D  +L+++ +  PS    +L   + +N   
Sbjct  208   -----------VPISFGSFMNLSNLKLIACDNNELIAAPSFQPSAPKFQLLFFSASNCTP  256

Query  633   -------------------IDAIH-----------ALKNLSSLEELHLDGSNLHKDFLSN  722
                                +D  H             +N   L  L+L  +++       
Sbjct  257   KPLKAGFTNFLHSQYDLMFVDLSHNKFVGEPFPSWLFENNRKLNRLYLRDTSITGPLQLP  316

Query  723   IGPMESLKVLSLSGAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGNLTSLRYV  899
               P   L+ + +SG  + G +  + +C +   L+   ++ N L G IP  FGN++SL ++
Sbjct  317   QHPTPYLQTVDISGNTIHGQIA-RNICSIFPRLKNFLMANNSLTGCIPRCFGNMSSLEFL  375

Query  900   NLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD  1079
             +LS N +S  +    L T+ SL  L + NN+F        F N + L  +L D NK + +
Sbjct  376   DLSNNHMSCELLEHNLPTVGSLWSLQLSNNNFSGRLPPSVF-NMTYLLYLLLDGNKFVGE  434

Query  1080  TQLQGFVP-KFQLDS----LSLSNCIDLLKLPRFL--HYQRDLKVLRISRNNLEGEFPSW  1238
                   VP  F L+S    L +SN +    LPR +    +  L  + +SRN+ EG  P  
Sbjct  435   ------VPGTFSLESSLLWLDISNNLLSGMLPRGIGNSSKNQLDGIDLSRNHFEGTIPIE  488

Query  1239  LLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILAL  1418
                N++ L++  ++ N  +GSL L  H   +L+ +++  N+L G +  +F          
Sbjct  489   YF-NSSGLEFVDLSENNLSGSLPLGFHA-LDLRYVHLYGNRLSGPLPYDF---------Y  537

Query  1419  NLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ  1598
             NLSS              L  LDL +N+ TG IP   + S S L I  L +N+  G++  
Sbjct  538   NLSS--------------LVTLDLGDNNLTGPIPN-WIDSLSELSIFVLKSNQFNGKLPH  582

Query  1599  EFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGR---------  1751
             +   L  L  L L  NNF G +P+ LSNL L +    D K S E P W  R         
Sbjct  583   QLCLLRKLSILDLSENNFSGLLPSCLSNLNLTA---SDEKTSVE-PDWGSRDYWSEEEMF  638

Query  1752  ----------------------------------------LTSLVQLTLSKNHLEGHIPI  1811
                                                     L  +  L LS N   G IP 
Sbjct  639   SSMGGRGFSPSDTMLWPEISVKIAVELTAKKNFYTYEGGILRYMSALDLSCNRFTGEIPT  698

Query  1812  EFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHV---SLSKHQLSGQLTRAFFNNTALVI  1982
             E+ NL  +  L+LS+NNLTG IPS    S++KH+    LS + L+G++       T L +
Sbjct  699   EWGNLSGIYSLNLSQNNLTGLIPSSF--SNLKHIESLDLSHNNLNGRIPAQLVELTFLAV  756

Query  1983  LDLSYNSFVGIIPE  2024
              ++SYN+  G  PE
Sbjct  757   FNVSYNNLSGRTPE  770



>ref|XP_006489888.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X7 [Citrus sinensis]
Length=1126

 Score =   380 bits (977),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 296/779 (38%), Positives = 430/779 (55%), Gaps = 62/779 (8%)
 Frame = +3

Query  78    NSGNERLTGLINLEELHMRY-------------------TQMEEINILSVLNLKDFISLK  200
             N G ERL+ L NL+ L++ Y                    ++   N+   +++K+F SL+
Sbjct  120   NEGLERLSRLNNLKMLNLSYNWFNNSILSSLTRLSSLRSLKLYANNLEGSIDVKEFDSLR  179

Query  201   ---VLDIGFNKFQSF----GPINDV-------------------GGAKKLEELYLFECRF  302
                 LDIG+N    F    G  N +                    G  KL+ L L   + 
Sbjct  180   DLEELDIGWNMIDKFVVSKGTTNTIKKCQLLQISWILCHLVYYFTGLSKLKSLGLAGIKL  239

Query  303   NQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHS  482
             N+SI  SL  F SL+ L L D  F  G   +++ +   NL+ L +S+N  +         
Sbjct  240   NRSILSSLTVFSSLRELHLRDTGF-KGTFDVREFDSFNNLEVLDMSNNEIDNLVVP---Q  295

Query  483   GSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNL  662
             G     + N + LE L L+  S  ++ L S  + FPS+K L +    V  +       + 
Sbjct  296   GKQLKELHNFTNLEYLTLDFSSLHISLLQSIASLFPSLKNLSISHCEVNGVLRGQGFPHF  355

Query  663   SSLEELHLDGSN--LHKDFLSNIG-PMESLKVLSLSGAQVG---GTLPNKGLCELKNLQE  824
              SLE   +  +   L+  FL  IG  M SLK L LS + +G     + ++GLC L +LQE
Sbjct  356   KSLEHFDMRFARIALNTSFLQIIGESMPSLKYLLLSYSTLGTNSSRILHQGLCSLVHLQE  415

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
             L++  N L G +P    N+TSLR +++S N+L+G+I  SPL  LTS+E L + NN F + 
Sbjct  416   LYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEKLDLSNNHFWIP  475

Query  1005  SSFRSFANNSKLRVILADRNKVIAD-TQLQGF-VPKFQLDSLSLSNCI-DLLKLPRFLHY  1175
              S     N+S+L++  AD N++ A+ T+      P FQL  LSLS+   D +  P+FL++
Sbjct  476   ISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPKFLYH  535

Query  1176  QRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSN  1355
             Q DL+ + +S  N+ GEFP+WLL+NNT L+Y  + N++  G  +L  H +  L+++++SN
Sbjct  536   QHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLLDISN  595

Query  1356  NKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEM  1529
             N + G I        P + +LN++ N   G + S  G    L FLDLSNN  TGEIPK +
Sbjct  596   NNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEIPKHL  655

Query  1530  LISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDI  1706
              + C +L  L LSNN LEG +      L++L++L L+ N+F G IP SLS       L +
Sbjct  656   AVGCVNLESLALSNNNLEGHMFSRNFNLTNLKWLQLESNHFVGEIPQSLSKCSSLEGLYL  715

Query  1707  RDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSC  1886
              +N LSG+IPRW+G LT L  + +  NHLEG IP+EFC L+SL ILD+S+NN++GS+PSC
Sbjct  716   NNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLESLQILDISDNNISGSLPSC  775

Query  1887  LNPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslll  2063
              +P SIK V LSK+ L GQL R  FFN ++LV LDLSYN   G IP+W+  +S+LS L+L
Sbjct  776   FHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLIL  835

Query  2064  NGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYY  2240
               N  EG+VP Q+C+L +L LLDLSNN L G+IP C    +L  +       +  FE Y
Sbjct  836   GHNNLEGEVPIQLCELNQLQLLDLSNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIY  894


 Score =   131 bits (329),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 190/691 (27%), Positives = 297/691 (43%), Gaps = 134/691 (19%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L ++++L LS+N+
Sbjct  413   LQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEKLDLSNNH  471

Query  450   FE---GFETSANHSG---------------SSRHTIRNKSY-LEVLHLNNISFDMTKLLS  572
             F      E   NHS                +  H++   ++ L+ L L++   D      
Sbjct  472   FWIPISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPK  531

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
              L     ++ ++L  +N++       L+N ++LE + L   +L   F   I   + L++L
Sbjct  532   FLYHQHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLL  591

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S   + G +P +    L  L  L ++ N L+G IPS FGN+  L++++LS N+L+G I
Sbjct  592   DISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEI  651

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                      +LE L++ NN+ E     R+F N + L+ +  + N  +      G +P+  
Sbjct  652   PKHLAVGCVNLESLALSNNNLEGHMFSRNF-NLTNLKWLQLESNHFV------GEIPQ--  702

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C               L+ L ++ N+L G+ P WL  N T LQY +M NN  
Sbjct  703   ----SLSKC-------------SSLEGLYLNNNSLSGKIPRWL-GNLTWLQYIIMPNNHL  744

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP--NILALNLSSNLFSGQLH----  1454
              G + +      +LQI+++S+N     ISG+  S F   +I  ++LS N+  GQL     
Sbjct  745   EGPIPVEFCQLESLQILDISDNN----ISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTF  800

Query  1455  ----SLIGTHLGF-------------------LDLSNNSFTGEIPKEMLISCSSLVILKL  1565
                 SL+   L +                   L L +N+  GE+P + L   + L +L L
Sbjct  801   FNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQ-LCELNQLQLLDL  859

Query  1566  SNNKLEGQIVQEFDYLSSLE--------------YLHLDGNN----------FEGT----  1661
             SNN L G I   FD  +  E              Y+ ++G            FE T    
Sbjct  860   SNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIYVFIEGPQGGVEKKIHEIFEFTTKNI  919

Query  1662  --IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSL  1835
               I        L  LD+  NKL G IP  +G LT +  L LS ++L G IP  F NLK +
Sbjct  920   AYIYQGKVFSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHHNLTGSIPSTFSNLKHV  979

Query  1836  SILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGI  2015
               LDLS N L G IP               HQL    T        L +  ++YN+  G 
Sbjct  980   ESLDLSNNKLNGKIP---------------HQLVELKT--------LEVFSVAYNNLSGE  1016

Query  2016  IPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
             I EW    +  +     GN F   +P  +C+
Sbjct  1017  ILEWKAQFATFNGSSYEGNTFLCGLPLPICR  1047



>ref|XP_009615115.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR2 
[Nicotiana tomentosiformis]
Length=776

 Score =   372 bits (954),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 265/593 (45%), Positives = 375/593 (63%), Gaps = 39/593 (7%)
 Frame = +3

Query  660   LSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSE  839
             L +++ L LDG+ L K+FL + G M SLKVLS+S   + GTLP  GLC LK L+EL LS 
Sbjct  9     LRNIKYLLLDGNTLDKNFLQSSGVMPSLKVLSVSNCGLNGTLPIPGLCNLKYLEELSLSF  68

Query  840   NQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRS  1019
             N   G +P   GNLT LR ++L+ N+ +GNI  SPLS+L SLEYL + NN+FE+  SF S
Sbjct  69    NNFHGNLPPCLGNLTLLRVIDLTQNQFTGNIASSPLSSLLSLEYLLLKNNNFEIPISFES  128

Query  1020  FANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLS-NCIDLLKLPRFLHYQRDLKVL  1196
             FAN+S L+ ++ D N ++  T  + ++PKFQL++LSL+ NC     +P FLHYQ  L+ L
Sbjct  129   FANHSNLKYVIPDGNSLVVKTSTRNWIPKFQLEALSLTKNCS---VIPNFLHYQHQLRQL  185

Query  1197  RISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEI  1376
              +S  N+ G FP+WLL+NN +L+   ++ NAFTGSL   S + PN++  ++S NK+ G++
Sbjct  186   SLSDCNIGGNFPNWLLENNPRLEEVYLDGNAFTGSLHELSFL-PNMKFFDISRNKIQGQL  244

Query  1377  SGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSL  1550
               N SS FPNIL L +S+N+  G L S      +L FLDL++N  +G++P E+  + + L
Sbjct  245   PPNISSIFPNILRLKMSNNMLEGMLPSSFSDMKNLLFLDLADNKLSGDLPIEL--ARNGL  302

Query  1551  VILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGE  1730
               L+LSNN LEG+I      +++L+YL+LDGNNF G+IP  LS+  L SLD+ +N LSG 
Sbjct  303   FFLRLSNNMLEGEIFPVSTNINNLQYLYLDGNNFSGSIPQKLSSASLSSLDLSNNSLSGN  362

Query  1731  IPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPS-SIK  1907
             +P W+G + SL  L LS+NHL+G IP ++C L+ L +LDLS NNL G IPSC + S ++K
Sbjct  363   LPSWIGYIPSLTSLALSRNHLKGPIPADYCRLEKLEVLDLSRNNLVGVIPSCFSASQNLK  422

Query  1908  HVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGK  2087
              V LSK+ L GQ    F N++ L +LDL  N+F G IP+W+G+I  +++LLL GN  +G 
Sbjct  423   RVYLSKNNLRGQFD-VFSNSSDLTVLDLKDNNFTGSIPKWLGSI-EINTLLLKGNHLQGN  480

Query  2088  VPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSINDAILDR  2267
             +PT++C    L ++DLS+N LSG IPRC G I       Q  GI+  + Y  I      R
Sbjct  481   IPTELCHASELRIMDLSHNNLSGPIPRCFGNII------QIAGISEAYPYGPIFS--YPR  532

Query  2268  LHYEWGSDDEYIPMLAVDVLPE--------------VQFRTKGNLYNYQNSIL  2384
             L   WG D     M+ V+   E               +F TK N Y+Y+ SI+
Sbjct  533   LQ-TWGRDT----MVYVEDSMERSTVSYQDNYAWVGAEFTTKYNTYSYEGSIV  580


 Score =   120 bits (301),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 186/707 (26%), Positives = 296/707 (42%), Gaps = 114/707 (16%)
 Frame = +3

Query  192   SLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDND  371
             SLKVL +         PI  +   K LEEL L    F+ ++   L     L+++DL  N 
Sbjct  35    SLKVLSVSNCGLNGTLPIPGLCNLKYLEELSLSFNNFHGNLPPCLGNLTLLRVIDLTQNQ  94

Query  372   FYDGPLHIQDINDLRNLKELYLSDNYFE---GFETSANHS--------GSS---RHTIRN  509
             F  G +    ++ L +L+ L L +N FE    FE+ ANHS        G+S   + + RN
Sbjct  95    F-TGNIASSPLSSLLSLEYLLLKNNNFEIPISFESFANHSNLKYVIPDGNSLVVKTSTRN  153

Query  510   KSYLEVLHLNNISFDMTKLLSSLAAF----PSIKTLELQRVNVTNIDAIHALKNLSSLEE  677
               ++    L  +S  +TK  S +  F      ++ L L   N+        L+N   LEE
Sbjct  154   --WIPKFQLEALS--LTKNCSVIPNFLHYQHQLRQLSLSDCNIGGNFPNWLLENNPRLEE  209

Query  678   LHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGK  857
             ++LDG N     L  +  + ++K   +S  ++ G LP        N+  L +S N LEG 
Sbjct  210   VYLDG-NAFTGSLHELSFLPNMKFFDISRNKIQGQLPPNISSIFPNILRLKMSNNMLEGM  268

Query  858   IPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSK  1037
             +PS F ++ +L +++L+ NKLSG++          L +L + NN  E    F    N + 
Sbjct  269   LPSSFSDMKNLLFLDLADNKLSGDL--PIELARNGLFFLRLSNNMLE-GEIFPVSTNINN  325

Query  1038  LRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLL----KLPRFLHYQRDLKVLRIS  1205
             L+ +  D N         G +P+    +   S  +        LP ++ Y   L  L +S
Sbjct  326   LQYLYLDGN------NFSGSIPQKLSSASLSSLDLSNNSLSGNLPSWIGYIPSLTSLALS  379

Query  1206  RNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGN  1385
             RN+L+G  P+    +  +L+                      L+++++S N L G I   
Sbjct  380   RNHLKGPIPA----DYCRLE---------------------KLEVLDLSRNNLVGVIPSC  414

Query  1386  FSSSFPNILALNLSSNLFSGQLHSLI-GTHLGFLDLSNNSFTGEIPKEMLISCSSLVILK  1562
             FS+S  N+  + LS N   GQ       + L  LDL +N+FTG IPK   +    +  L 
Sbjct  415   FSAS-QNLKRVYLSKNNLRGQFDVFSNSSDLTVLDLKDNNFTGSIPK--WLGSIEINTLL  471

Query  1563  LSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEI---  1733
             L  N L+G I  E  + S L  + L  NN  G I        +    I +    G I   
Sbjct  472   LKGNHLQGNIPTELCHASELRIMDLSHNNLSGPI-PRCFGNIIQIAGISEAYPYGPIFSY  530

Query  1734  PR----------------------------WMGR---------------LTSLVQLTLSK  1784
             PR                            W+G                +  +  + LS 
Sbjct  531   PRLQTWGRDTMVYVEDSMERSTVSYQDNYAWVGAEFTTKYNTYSYEGSIVDYMFGIDLSY  590

Query  1785  NHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQLTRAFF  1961
             N L G IP E CNL  +  L+LS N++TG+I S   N  +I+ + LS + L+G++     
Sbjct  591   NQLSGDIPKELCNLTEIRALNLSHNHITGAISSEFSNLQNIESLDLSYNNLTGRIPSQLV  650

Query  1962  NNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQV  2102
               T+L I  +++N+  G+ P+     +  +     GN F    P  +
Sbjct  651   ELTSLAIFSVAHNNLTGMTPQRTSQFATFTESSYQGNPFLCGTPLHI  697



>ref|XP_006489887.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X6 [Citrus sinensis]
Length=1139

 Score =   380 bits (976),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 298/800 (37%), Positives = 430/800 (54%), Gaps = 91/800 (11%)
 Frame = +3

Query  78    NSGNERLTGLINLEELHMRYTQMEE-------------INILSVLNLKDFISLKV-LDIG  215
             N G ERL+ L NL+ L++ Y                     L   NL+  I +K  LDIG
Sbjct  120   NEGLERLSRLNNLKMLNLSYNWFNNSILSSLTRLSSLRSLKLYANNLEGSIDVKEELDIG  179

Query  216   FNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHI  395
             +N    F       G  KL+ L L   + N+SI  SL  F SL+ L L D  F  G   +
Sbjct  180   WNMIDKFVV---SKGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGF-KGTFDV  235

Query  396   QDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISF-DMTKLLS  572
             ++ +   NL+ L +S+N  +       + G  +        L+ LHL+ +   D +KLL 
Sbjct  236   REFDSFNNLEVLDMSNNEIDNLVVPQGYRGLRK--------LKSLHLSGVGIRDGSKLLQ  287

Query  573   SLAAFPSIKTLELQRVN-VTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPM-ESLK  746
             S+ +FPS+ TL +   N +    A   L N ++LE L LD S+LH   L +I  +  SLK
Sbjct  288   SIGSFPSLNTLYISWNNFIDTATATQELHNFTNLEYLTLDFSSLHISLLQSIASLFPSLK  347

Query  747   VLSLSGAQV-----------------------------------GGTLP-----------  788
              LS+S  +V                                   G ++P           
Sbjct  348   NLSISHCEVNGVLRGQGFPHFKSLEHFDMRFARIALNTSFLQIIGESMPSLKYLLLSYST  407

Query  789   ---------NKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIels  941
                      ++GLC L +LQEL++  N L G +P    N+TSLR +++S N+L+G+I  S
Sbjct  408   LGTNSSRILHQGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSS  467

Query  942   plstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQGF-VPKFQL  1115
             PL  LTS+E L + NN F +  S     N+S+L++  AD N++ A+ T+      P FQL
Sbjct  468   PLVHLTSIEKLDLSNNHFWIPISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQL  527

Query  1116  DSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
               LSLS+   D +  P+FL++Q DL+ + +S  N+ GEFP+WLL+NNT L+Y  + N++ 
Sbjct  528   KYLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSL  587

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--  1466
              G  +L  H +  L+++++SNN + G I        P + +LN++ N   G + S  G  
Sbjct  588   AGPFRLPIHSHKRLRLLDISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNM  647

Query  1467  THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGN  1646
               L FLDLSNN  TGEIPK + + C +L  L LSNN LEG +      L++L++L L+ N
Sbjct  648   KFLQFLDLSNNQLTGEIPKHLAVGCVNLESLALSNNNLEGHMFSRNFNLTNLKWLQLESN  707

Query  1647  NFEGTI-pnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCN  1823
             +F G I  +      L  L + +N LSG+IPRW+G LT L  + +  NHLEG IP+EFC 
Sbjct  708   HFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQ  767

Query  1824  LKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYN  2000
             L+SL ILD+S+NN++GS+PSC +P SIK V LSK+ L GQL R  FFN ++LV LDLSYN
Sbjct  768   LESLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYN  827

Query  2001  SFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGK  2180
                G IP+W+  +S+LS L+L  N  EG+VP Q+C+L +L LLDLSNN L G+IP C   
Sbjct  828   RLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHGLIPPCFDN  887

Query  2181  ISLEGTNEQFRGINLPFEYY  2240
              +L  +       +  FE Y
Sbjct  888   TTLHESYNNSSSPDEQFEIY  907


 Score =   131 bits (329),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 190/691 (27%), Positives = 297/691 (43%), Gaps = 134/691 (19%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L ++++L LS+N+
Sbjct  426   LQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEKLDLSNNH  484

Query  450   FE---GFETSANHSG---------------SSRHTIRNKSY-LEVLHLNNISFDMTKLLS  572
             F      E   NHS                +  H++   ++ L+ L L++   D      
Sbjct  485   FWIPISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPK  544

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
              L     ++ ++L  +N++       L+N ++LE + L   +L   F   I   + L++L
Sbjct  545   FLYHQHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLL  604

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S   + G +P +    L  L  L ++ N L+G IPS FGN+  L++++LS N+L+G I
Sbjct  605   DISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEI  664

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                      +LE L++ NN+ E     R+F N + L+ +  + N  +      G +P+  
Sbjct  665   PKHLAVGCVNLESLALSNNNLEGHMFSRNF-NLTNLKWLQLESNHFV------GEIPQ--  715

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C               L+ L ++ N+L G+ P WL  N T LQY +M NN  
Sbjct  716   ----SLSKC-------------SSLEGLYLNNNSLSGKIPRWL-GNLTWLQYIIMPNNHL  757

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP--NILALNLSSNLFSGQLH----  1454
              G + +      +LQI+++S+N     ISG+  S F   +I  ++LS N+  GQL     
Sbjct  758   EGPIPVEFCQLESLQILDISDNN----ISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTF  813

Query  1455  ----SLIGTHLGF-------------------LDLSNNSFTGEIPKEMLISCSSLVILKL  1565
                 SL+   L +                   L L +N+  GE+P + L   + L +L L
Sbjct  814   FNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQ-LCELNQLQLLDL  872

Query  1566  SNNKLEGQIVQEFDYLSSLE--------------YLHLDGNN----------FEGT----  1661
             SNN L G I   FD  +  E              Y+ ++G            FE T    
Sbjct  873   SNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIYVFIEGPQGGVEKKIHEIFEFTTKNI  932

Query  1662  --IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSL  1835
               I        L  LD+  NKL G IP  +G LT +  L LS ++L G IP  F NLK +
Sbjct  933   AYIYQGKVFSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHHNLTGSIPSTFSNLKHV  992

Query  1836  SILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGI  2015
               LDLS N L G IP               HQL    T        L +  ++YN+  G 
Sbjct  993   ESLDLSNNKLNGKIP---------------HQLVELKT--------LEVFSVAYNNLSGE  1029

Query  2016  IPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
             I EW    +  +     GN F   +P  +C+
Sbjct  1030  ILEWKAQFATFNGSSYEGNTFLCGLPLPICR  1060



>ref|XP_006382369.1| hypothetical protein POPTR_0005s01500g, partial [Populus trichocarpa]
 gb|ERP60166.1| hypothetical protein POPTR_0005s01500g, partial [Populus trichocarpa]
Length=892

 Score =   373 bits (958),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 281/702 (40%), Positives = 387/702 (55%), Gaps = 26/702 (4%)
 Frame = +3

Query  315   FQSLK-GFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSS  491
             FQ L  G  +L+ LDL  N   D  + +  +     LK LYLS N F G         + 
Sbjct  1     FQVLASGLKNLEELDLTHNKLND--IILSALGGFSTLKSLYLSGNMFTG--------STG  50

Query  492   RHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSL  671
              + +RN   LE L+L    F  + L+ SL A PS+KTL        +      L N SSL
Sbjct  51    LNGLRN---LETLYLYWTDFKESILIESLGALPSLKTLYASYSKFKHFG--KGLSNSSSL  105

Query  672   EELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLE  851
             EE+ L  S L   FL NIG + +LKVLSL+G     TLP +G CELKNL++L LS N L+
Sbjct  106   EEVFLYYSYLPASFLRNIGHLSTLKVLSLAGVDFSSTLPAEGWCELKNLEQLSLSGNNLK  165

Query  852   GKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANN  1031
             G +P   GNL+ L++++LS N+L GNI  S LS LT L+YLS+ NN F+V  SF SF N 
Sbjct  166   GVLPPCLGNLSFLQFLDLSRNQLEGNIASSHLSHLTRLQYLSVSNNHFQVPISFGSFMNL  225

Query  1032  SKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDL---LKLPRFLHYQRDLKVLRI  1202
             S L+    D N++IA    Q   PKFQL   S SNC         P FL  Q DL V+ +
Sbjct  226   SNLKFFACDNNELIAAPSFQPSAPKFQLRFFSASNCTSKPHEAGFPNFLQSQYDLVVVDL  285

Query  1203  SRNNLEGE-FPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEIS  1379
             S N   GE FPSWL +NNTKL    + + +F G L+L  H  PNLQ +++S N + G+I+
Sbjct  286   SHNKFVGEPFPSWLFENNTKLNRLYLRDTSFIGPLQLPQHPTPNLQTVDMSGNSIHGQIA  345

Query  1380  GNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISC-SSL  1550
              N  S FP +    +++N  +G +    G  + LG+LDLSNN  + E+ +    +  SSL
Sbjct  346   RNICSIFPRLKNFMMANNSLTGCIPPCFGNMSSLGYLDLSNNHMSCELLEHNFPTVGSSL  405

Query  1551  VILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDIRDNKLSG  1727
               LKLSNN  +G++      ++ L YL LDGN   G + ++ S        DI +N LSG
Sbjct  406   WFLKLSNNNFKGRLPLSVFNMTGLLYLFLDGNKLAGQVSDTFSLASSFLWFDISNNILSG  465

Query  1728  EIPRWMG--RLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSS  1901
              +PR +G   L SL  + LS+NH EG IPIE+ N   L  LDLSENNL+GS+P   N   
Sbjct  466   MLPRGIGNSSLNSLQGIDLSRNHFEGTIPIEYFNSSGLEFLDLSENNLSGSLPLGFNALD  525

Query  1902  IKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFE  2081
             +++V L  ++LSG L   F+N ++L  LDL  N+  G IP WI T+S LS  +L  N+F 
Sbjct  526   LRYVHLYGNRLSGPLPFDFYNLSSLATLDLGDNNLTGPIPNWIDTLSELSIFVLKSNQFN  585

Query  2082  GKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSINDAIL  2261
             GK+P Q+C+L +LS+LDLS N  SG++P CL  ++   ++E+          Y   + I 
Sbjct  586   GKLPHQLCKLRKLSILDLSENNFSGLLPSCLRNLNFTASDEKTLDAPRTGSDYGSGEEIF  645

Query  2262  DRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSILK  2387
               +     S D+ I    + V   V+   K N Y Y+  IL+
Sbjct  646   ASIGGRGFSLDDNILWAEISVKISVELTAKKNFYTYEGDILR  687


 Score =   122 bits (306),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 197/777 (25%), Positives = 323/777 (42%), Gaps = 124/777 (16%)
 Frame = +3

Query  81    SGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGG  260
             +G+  L GL NLE L++ +T  +E +IL + +L    SLK L   ++KF+ FG    +  
Sbjct  46    TGSTGLNGLRNLETLYLYWTDFKE-SIL-IESLGALPSLKTLYASYSKFKHFG--KGLSN  101

Query  261   AKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLS  440
             +  LEE++L+      S  +++    +LK+L L   DF    L  +   +L+NL++L LS
Sbjct  102   SSSLEEVFLYYSYLPASFLRNIGHLSTLKVLSLAGVDF-SSTLPAEGWCELKNLEQLSLS  160

Query  441   DNYFEGF-------------------ETSANHSGSSRHTIRNKSYLEV------------  527
              N  +G                    +   N + S    +    YL V            
Sbjct  161   GNNLKGVLPPCLGNLSFLQFLDLSRNQLEGNIASSHLSHLTRLQYLSVSNNHFQVPISFG  220

Query  528   --LHLNNISF---DMTKLLSSLAAFPSIKTLELQRVNVTN--------------------  632
               ++L+N+ F   D  +L+++ +  PS    +L+  + +N                    
Sbjct  221   SFMNLSNLKFFACDNNELIAAPSFQPSAPKFQLRFFSASNCTSKPHEAGFPNFLQSQYDL  280

Query  633   --IDAIH-----------ALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQV  773
               +D  H             +N + L  L+L  ++          P  +L+ + +SG  +
Sbjct  281   VVVDLSHNKFVGEPFPSWLFENNTKLNRLYLRDTSFIGPLQLPQHPTPNLQTVDMSGNSI  340

Query  774   GGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIels-pls  950
              G +          L+   ++ N L G IP  FGN++SL Y++LS N +S  +      +
Sbjct  341   HGQIARNICSIFPRLKNFMMANNSLTGCIPPCFGNMSSLGYLDLSNNHMSCELLEHNFPT  400

Query  951   tltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKV------------------IA  1076
               +SL +L + NN+F+       F N + L  +  D NK+                  I+
Sbjct  401   VGSSLWFLKLSNNNFKGRLPLSVF-NMTGLLYLFLDGNKLAGQVSDTFSLASSFLWFDIS  459

Query  1077  DTQLQGFVPK-FQLDSLSLSNCIDLLK------LPRFLHYQRDLKVLRISRNNLEGEFPS  1235
             +  L G +P+     SL+    IDL +      +P        L+ L +S NNL G  P 
Sbjct  460   NNILSGMLPRGIGNSSLNSLQGIDLSRNHFEGTIPIEYFNSSGLEFLDLSENNLSGSLP-  518

Query  1236  WLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILA  1415
              L  N   L+Y  +  N  +G L    +   +L  +++ +N L G I  N+  +   +  
Sbjct  519   -LGFNALDLRYVHLYGNRLSGPLPFDFYNLSSLATLDLGDNNLTGPIP-NWIDTLSELSI  576

Query  1416  LNLSSNLFSGQL-HSLIGTH-LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQ  1589
               L SN F+G+L H L     L  LDLS N+F+G +P     SC   +    S+ K    
Sbjct  577   FVLKSNQFNGKLPHQLCKLRKLSILDLSENNFSGLLP-----SCLRNLNFTASDEKTLDA  631

Query  1590  IVQEFDYLSSLE-YLHLDGNNF---EGTIpnslsnlplhslDIRDN--KLSGEIPRWMGR  1751
                  DY S  E +  + G  F   +  +   +S      L  + N     G+I R+M  
Sbjct  632   PRTGSDYGSGEEIFASIGGRGFSLDDNILWAEISVKISVELTAKKNFYTYEGDILRYMS-  690

Query  1752  LTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSC-LNPSSIKHVSLSKH  1928
                   + LS N   G IP E+ NL  +  L+LS+NNLTG IPS   N   I+ + LS +
Sbjct  691   -----VMDLSCNRFNGEIPTEWGNLSGIYSLNLSQNNLTGLIPSSFFNLKQIESLDLSHN  745

Query  1929  QLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQ  2099
              L+G++       T L + ++SYN+  G  PE     +        GN      P Q
Sbjct  746   NLNGRIPAQLVELTFLEVFNVSYNNLSGRTPEMKNQFATFDESSYKGNPLLCGPPLQ  802



>ref|XP_006489890.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X9 [Citrus sinensis]
Length=1121

 Score =   378 bits (970),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 295/779 (38%), Positives = 429/779 (55%), Gaps = 67/779 (9%)
 Frame = +3

Query  78    NSGNERLTGLINLEELHMRY-------------------TQMEEINILSVLNLKDFISLK  200
             N G ERL+ L NL+ L++ Y                    ++   N+   +++K+F SL+
Sbjct  120   NEGLERLSRLNNLKMLNLSYNWFNNSILSSLTRLSSLRSLKLYANNLEGSIDVKEFDSLR  179

Query  201   ---VLDIGFNKFQSF----GPINDV-------------------GGAKKLEELYLFECRF  302
                 LDIG+N    F    G  N +                    G  KL+ L L   + 
Sbjct  180   DLEELDIGWNMIDKFVVSKGTTNTIKKCQLLQISWILCHLVYYFTGLSKLKSLGLAGIKL  239

Query  303   NQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHS  482
             N+SI  SL  F SL+ L L D  F  G   +++ +   NL+ L +S+N  +         
Sbjct  240   NRSILSSLTVFSSLRELHLRDTGF-KGTFDVREFDSFNNLEVLDMSNNEIDNLVVP----  294

Query  483   GSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNL  662
                   + N + LE L L+  S  ++ L S  + FPS+K L +    V  +       + 
Sbjct  295   ----QELHNFTNLEYLTLDFSSLHISLLQSIASLFPSLKNLSISHCEVNGVLRGQGFPHF  350

Query  663   SSLEELHLDGSN--LHKDFLSNIG-PMESLKVLSLSGAQVG---GTLPNKGLCELKNLQE  824
              SLE   +  +   L+  FL  IG  M SLK L LS + +G     + ++GLC L +LQE
Sbjct  351   KSLEHFDMRFARIALNTSFLQIIGESMPSLKYLLLSYSTLGTNSSRILHQGLCSLVHLQE  410

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
             L++  N L G +P    N+TSLR +++S N+L+G+I  SPL  LTS+E L + NN F + 
Sbjct  411   LYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEKLDLSNNHFWIP  470

Query  1005  SSFRSFANNSKLRVILADRNKVIAD-TQLQGF-VPKFQLDSLSLSNCI-DLLKLPRFLHY  1175
              S     N+S+L++  AD N++ A+ T+      P FQL  LSLS+   D +  P+FL++
Sbjct  471   ISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPKFLYH  530

Query  1176  QRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSN  1355
             Q DL+ + +S  N+ GEFP+WLL+NNT L+Y  + N++  G  +L  H +  L+++++SN
Sbjct  531   QHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLLDISN  590

Query  1356  NKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEM  1529
             N + G I        P + +LN++ N   G + S  G    L FLDLSNN  TGEIPK +
Sbjct  591   NNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEIPKHL  650

Query  1530  LISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDI  1706
              + C +L  L LSNN LEG +      L++L++L L+ N+F G IP SLS       L +
Sbjct  651   AVGCVNLESLALSNNNLEGHMFSRNFNLTNLKWLQLESNHFVGEIPQSLSKCSSLEGLYL  710

Query  1707  RDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSC  1886
              +N LSG+IPRW+G LT L  + +  NHLEG IP+EFC L+SL ILD+S+NN++GS+PSC
Sbjct  711   NNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLESLQILDISDNNISGSLPSC  770

Query  1887  LNPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslll  2063
              +P SIK V LSK+ L GQL R  FFN ++LV LDLSYN   G IP+W+  +S+LS L+L
Sbjct  771   FHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLIL  830

Query  2064  NGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYY  2240
               N  EG+VP Q+C+L +L LLDLSNN L G+IP C    +L  +       +  FE Y
Sbjct  831   GHNNLEGEVPIQLCELNQLQLLDLSNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIY  889


 Score =   130 bits (328),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 190/691 (27%), Positives = 297/691 (43%), Gaps = 134/691 (19%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L ++++L LS+N+
Sbjct  408   LQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEKLDLSNNH  466

Query  450   FE---GFETSANHSG---------------SSRHTIRNKSY-LEVLHLNNISFDMTKLLS  572
             F      E   NHS                +  H++   ++ L+ L L++   D      
Sbjct  467   FWIPISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPK  526

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
              L     ++ ++L  +N++       L+N ++LE + L   +L   F   I   + L++L
Sbjct  527   FLYHQHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLL  586

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S   + G +P +    L  L  L ++ N L+G IPS FGN+  L++++LS N+L+G I
Sbjct  587   DISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEI  646

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                      +LE L++ NN+ E     R+F N + L+ +  + N  +      G +P+  
Sbjct  647   PKHLAVGCVNLESLALSNNNLEGHMFSRNF-NLTNLKWLQLESNHFV------GEIPQ--  697

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C               L+ L ++ N+L G+ P WL  N T LQY +M NN  
Sbjct  698   ----SLSKC-------------SSLEGLYLNNNSLSGKIPRWL-GNLTWLQYIIMPNNHL  739

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP--NILALNLSSNLFSGQLH----  1454
              G + +      +LQI+++S+N     ISG+  S F   +I  ++LS N+  GQL     
Sbjct  740   EGPIPVEFCQLESLQILDISDNN----ISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTF  795

Query  1455  ----SLIGTHLGF-------------------LDLSNNSFTGEIPKEMLISCSSLVILKL  1565
                 SL+   L +                   L L +N+  GE+P + L   + L +L L
Sbjct  796   FNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQ-LCELNQLQLLDL  854

Query  1566  SNNKLEGQIVQEFDYLSSLE--------------YLHLDGNN----------FEGT----  1661
             SNN L G I   FD  +  E              Y+ ++G            FE T    
Sbjct  855   SNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIYVFIEGPQGGVEKKIHEIFEFTTKNI  914

Query  1662  --IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSL  1835
               I        L  LD+  NKL G IP  +G LT +  L LS ++L G IP  F NLK +
Sbjct  915   AYIYQGKVFSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHHNLTGSIPSTFSNLKHV  974

Query  1836  SILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGI  2015
               LDLS N L G IP               HQL    T        L +  ++YN+  G 
Sbjct  975   ESLDLSNNKLNGKIP---------------HQLVELKT--------LEVFSVAYNNLSGE  1011

Query  2016  IPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
             I EW    +  +     GN F   +P  +C+
Sbjct  1012  ILEWKAQFATFNGSSYEGNTFLCGLPLPICR  1042



>ref|XP_006389352.1| hypothetical protein POPTR_0027s003001g, partial [Populus trichocarpa]
 gb|ERP48266.1| hypothetical protein POPTR_0027s003001g, partial [Populus trichocarpa]
Length=835

 Score =   371 bits (952),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 252/615 (41%), Positives = 376/615 (61%), Gaps = 23/615 (4%)
 Frame = +3

Query  564   LLSSLAAFPSIKTLELQRVNVTNIDAIHA-LKNLSSLEELHLDGSNLHKDFLSNIGPMES  740
             +LS L  F  +K+L L    +     ++    N S+LEEL+LD ++L  +FL NIG + +
Sbjct  25    ILSHLRGFSYLKSLNLSGNMLLGSTTVNGTFFNSSTLEELNLDRTSLPVNFLQNIGALPA  84

Query  741   LKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKL  920
             LKVLS+ G  + GTLP +G CELKNL++L +S N L G +P   GNL+SL+ +++S N  
Sbjct  85    LKVLSVGGCDLHGTLPAQGWCELKNLKQLDISGNNLGGSLPDCMGNLSSLQLLDVSENHF  144

Query  921   SGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQGF  1097
             +GNI  SPL+ L SLE+LS+ NN FEV +S + F N+S L+   ++ NK++AD       
Sbjct  145   TGNIASSPLTNLISLEFLSLSNNLFEVPTSMKPFLNHSSLKFFSSENNKLVADPAAFHDL  204

Query  1098  VPKFQLDSLSLSNCIDLL--KLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYF  1271
             +PKFQL  LSLS   + L  ++P FL+YQ  L+ L +S NN+ G FPSWLL+NNT+L+  
Sbjct  205   IPKFQLVFLSLSKTTEALNVEIPNFLYYQYHLRFLHLSHNNITGMFPSWLLKNNTRLEQL  264

Query  1272  LMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQL  1451
              ++ N+F G+L+L  H+ PN+  +++SNN + G+I  +    F N+ +L ++ N F+G +
Sbjct  265   YLSENSFVGTLQLQDHLYPNMTELDISNNNMSGQIPKDICLIFQNLKSLRMAKNGFTGCI  324

Query  1452  HSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLE  1625
              S +G  + LG LDLSNN    ++    L   +++  LKLSNN L GQ+       S+LE
Sbjct  325   PSCLGNISSLGILDLSNN----QLSTVKLEQLTTIWFLKLSNNNLGGQLPTSLFNSSTLE  380

Query  1626  YLHLDGNNFEGTIp--nslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEG  1799
             YL+L GNNF G I   +         LD+ +N+ SG +PR     T L  + LSKNH +G
Sbjct  381   YLYLGGNNFWGQISDFSLYRWKMWIVLDLSNNQFSGMLPRSFLNSTILAAIDLSKNHFKG  440

Query  1800  HIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALV  1979
              IP +FC L  L  L+LSENNL+G IPSC +PS++ H+ LS+++LSG LT  F+N++ LV
Sbjct  441   PIPRDFCKLDQLEYLNLSENNLSGYIPSCFSPSTLIHMHLSENRLSGPLTYRFYNSSFLV  500

Query  1980  ILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGV  2159
              +DL  NSF G IP WIG +S LS LLL  N F+G++P Q+C L  LS+LD+S N LS  
Sbjct  501   TMDLQDNSFTGSIPNWIGNLSSLSVLLLRANHFDGELPVQLCLLEHLSILDVSQNQLSSP  560

Query  2160  IPRCLGKISLEGTNEQFRGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEVQ  2339
             +P CLG ++ + ++++         +  +   +L R   +   +    P++  +V   ++
Sbjct  561   LPSCLGNLTFKESSQK--------AFTDLGAGVLSRSIEKAYYETMGPPLVEKEV---IE  609

Query  2340  FRTKGNLYNYQNSIL  2384
             F TK   Y Y+   L
Sbjct  610   FTTKNMYYGYKGKTL  624


 Score =   100 bits (250),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 179/723 (25%), Positives = 297/723 (41%), Gaps = 104/723 (14%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             LEEL++  T +  +N L   N+    +LKVL +G        P       K L++L +  
Sbjct  61    LEELNLDRTSLP-VNFLQ--NIGALPALKVLSVGGCDLHGTLPAQGWCELKNLKQLDISG  117

Query  294   CRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---GFE  464
                  S+   +    SL++LD+ +N F  G +    + +L +L+ L LS+N FE     +
Sbjct  118   NNLGGSLPDCMGNLSSLQLLDVSENHF-TGNIASSPLTNLISLEFLSLSNNLFEVPTSMK  176

Query  465   TSANHSG---------------SSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFP-SI  596
                NHS                ++ H +  K  L  L L+  +  +   + +   +   +
Sbjct  177   PFLNHSSLKFFSSENNKLVADPAAFHDLIPKFQLVFLSLSKTTEALNVEIPNFLYYQYHL  236

Query  597   KTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVG  776
             + L L   N+T +     LKN + LE+L+L  ++             ++  L +S   + 
Sbjct  237   RFLHLSHNNITGMFPSWLLKNNTRLEQLYLSENSFVGTLQLQDHLYPNMTELDISNNNMS  296

Query  777   GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLS-----------  923
             G +P       +NL+ L +++N   G IPS  GN++SL  ++LS N+LS           
Sbjct  297   GQIPKDICLIFQNLKSLRMAKNGFTGCIPSCLGNISSLGILDLSNNQLSTVKLEQLTTIW  356

Query  924   ----------GNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVI  1073
                       G +  S  ++ T        NN +   S F  +    K+ ++L      +
Sbjct  357   FLKLSNNNLGGQLPTSLFNSSTLEYLYLGGNNFWGQISDFSLY--RWKMWIVLD-----L  409

Query  1074  ADTQLQGFVPKFQLDSLSLSNCIDLLK------LPRFLHYQRDLKVLRISRNNLEGEFPS  1235
             ++ Q  G +P+  L+S  L+  IDL K      +PR       L+ L +S NNL G  PS
Sbjct  410   SNNQFSGMLPRSFLNSTILA-AIDLSKNHFKGPIPRDFCKLDQLEYLNLSENNLSGYIPS  468

Query  1236  WLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILA  1415
                 + + L +  ++ N  +G L    + +  L  +++ +N   G I  N+  +  ++  
Sbjct  469   CF--SPSTLIHMHLSENRLSGPLTYRFYNSSFLVTMDLQDNSFTGSIP-NWIGNLSSLSV  525

Query  1416  LNLSSNLFSGQL--HSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNK----  1577
             L L +N F G+L     +  HL  LD+S N  +  +P     SC   +  K S+ K    
Sbjct  526   LLLRANHFDGELPVQLCLLEHLSILDVSQNQLSSPLP-----SCLGNLTFKESSQKAFTD  580

Query  1578  LEGQIVQ---EFDYLSSLEYLHLDGNNFEGTIpns------lsnlplhslDIRDNKLSGE  1730
             L   ++    E  Y  ++    ++    E T  N        +   +  +D+ +N   G 
Sbjct  581   LGAGVLSRSIEKAYYETMGPPLVEKEVIEFTTKNMYYGYKGKTLNYMSGIDLSNNNFVGA  640

Query  1731  IPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKH  1910
             IP   G L+ ++ L LS N+L G IP  F NLK +  LDLS NNL G IP          
Sbjct  641   IPPEFGNLSKILSLNLSHNNLTGSIPATFSNLKQIESLDLSYNNLNGVIPP---------  691

Query  1911  VSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKV  2090
                       QLT      T L +  ++YN+     PE              GN F    
Sbjct  692   ----------QLTEI----TTLEVFSVAYNNLSCKTPERKYQFGTFDESCYEGNPFLCGP  737

Query  2091  PTQ  2099
             P Q
Sbjct  738   PLQ  740



>ref|XP_006389367.1| hypothetical protein POPTR_0027s00410g [Populus trichocarpa]
 gb|ERP48281.1| hypothetical protein POPTR_0027s00410g [Populus trichocarpa]
Length=1014

 Score =   375 bits (963),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 272/665 (41%), Positives = 400/665 (60%), Gaps = 38/665 (6%)
 Frame = +3

Query  270   LEELYLFECRFNQSI-------FQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKE  428
              +EL   E RFN  +       F+ L    +L+ LDL DN F +    +  +  L  LK 
Sbjct  96    FKELQSLELRFNGLVGCLENEGFEVLSS--NLRNLDLSDNRFNNDKSILSCMTGLSTLKS  153

Query  429   LYLSDNYF--EGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDM--TKLLSSLAAFPSI  596
             L LS N     GFE  ++H             LE L   ++S+++    +LS L     +
Sbjct  154   LDLSGNGLTGSGFEIISSH-------------LEKLDNLDLSYNIFNDSILSHLRGLSYL  200

Query  597   KTLELQRVNVTNIDAIHA-LKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQV  773
             K+L L    +     ++    N S+LEEL+LD ++L  +FL NIG +  LKVLS++   +
Sbjct  201   KSLNLSGNMLLGSTTVNGTFFNSSTLEELYLDRTSLPINFLQNIGALPDLKVLSVAECDL  260

Query  774   GGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplst  953
              GTLP +G CELKNL++L LS N L G +P   GNL+SL+ +++S N+ +GNI   PL+ 
Sbjct  261   HGTLPAQGWCELKNLRQLDLSGNNLGGSLPDCLGNLSSLQLLDVSENQFTGNIASGPLTN  320

Query  954   ltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQGFVPKFQLDSLSL  1130
             LTSLE+LS+ NN FEV  S + F N+S L+   ++ NK++ +       +PKFQL    L
Sbjct  321   LTSLEFLSLSNNLFEVPISMKPFMNHSSLKFFSSENNKLVTEPAAFDNLIPKFQLVFFRL  380

Query  1131  SNCIDLL--KLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSL  1304
             S   + L  K+P FL+YQ D++VL +S NN+   FPSWLL+NNT+L+   ++NN+F G+L
Sbjct  381   SKTTEALNVKIPDFLYYQYDIRVLDLSHNNITAMFPSWLLKNNTRLEQLYLSNNSFVGTL  440

Query  1305  KLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLG  1478
             +L  H   N+  +++SNN + G+I  +    FPN+ +L +++N F+G + S +G  + L 
Sbjct  441   QLQDHPYLNMTELDISNNNMNGQIPKDICLIFPNMWSLRMANNGFTGCIPSCLGNISSLK  500

Query  1479  FLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEG  1658
              LDLSNN  +  I K  L   +++  LKLSNN L GQ+       S+LEYL+L GNNF G
Sbjct  501   ILDLSNNQLS--IVK--LEQLTTIWFLKLSNNNLGGQLPTSVFNSSTLEYLYLHGNNFWG  556

Query  1659  TIpn--slsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKS  1832
              I +          +LD+ DN+ SG +PRW+   T L+ + LSKN+ +G I  +FC L  
Sbjct  557   QISDFLLYGWKMWSTLDLSDNQFSGMLPRWLVNSTGLIAIDLSKNYFKGPILRDFCKLNQ  616

Query  1833  LSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVG  2012
             L  LDLSENNL+G IPSC +P  I HV LS+++LSG LT  F+NN++LV +DL  N+F G
Sbjct  617   LEYLDLSENNLSGYIPSCFSPPQITHVHLSENRLSGPLTYGFYNNSSLVTMDLRDNNFTG  676

Query  2013  IIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLE  2192
               P WIG +S LS LLL  N F+G++P Q+C L +LS+LD+S N LSG +P CLG ++ +
Sbjct  677   SFPNWIGNLSSLSVLLLRANHFDGELPVQLCLLEQLSILDVSQNQLSGPLPSCLGNLTFK  736

Query  2193  GTNEQ  2207
              ++++
Sbjct  737   ESSQK  741


 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 183/696 (26%), Positives = 300/696 (43%), Gaps = 86/696 (12%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             LEEL++  T +  IN L   N+     LKVL +         P       K L +L L  
Sbjct  226   LEELYLDRTSLP-INFLQ--NIGALPDLKVLSVAECDLHGTLPAQGWCELKNLRQLDLSG  282

Query  294   CRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---GFE  464
                  S+   L    SL++LD+ +N F  G +    + +L +L+ L LS+N FE     +
Sbjct  283   NNLGGSLPDCLGNLSSLQLLDVSENQF-TGNIASGPLTNLTSLEFLSLSNNLFEVPISMK  341

Query  465   TSANHSGSSRHTIRN-KSYLEVLHLNN-------ISFDMTKLLSSL-AAFPS-------I  596
                NHS     +  N K   E    +N       + F ++K   +L    P        I
Sbjct  342   PFMNHSSLKFFSSENNKLVTEPAAFDNLIPKFQLVFFRLSKTTEALNVKIPDFLYYQYDI  401

Query  597   KTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVG  776
             + L+L   N+T +     LKN + LE+L+L  ++          P  ++  L +S   + 
Sbjct  402   RVLDLSHNNITAMFPSWLLKNNTRLEQLYLSNNSFVGTLQLQDHPYLNMTELDISNNNMN  461

Query  777   GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstl  956
             G +P        N+  L ++ N   G IPS  GN++SL+ ++LS N+LS    +  L  L
Sbjct  462   GQIPKDICLIFPNMWSLRMANNGFTGCIPSCLGNISSLKILDLSNNQLS----IVKLEQL  517

Query  957   tsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKV-------------------IAD  1079
             T++ +L + NN+         F N+S L  +    N                     ++D
Sbjct  518   TTIWFLKLSNNNLGGQLPTSVF-NSSTLEYLYLHGNNFWGQISDFLLYGWKMWSTLDLSD  576

Query  1080  TQLQGFVPKFQLDSLSLSNCIDL----LKLPRFLHYQR--DLKVLRISRNNLEGEFPSWL  1241
              Q  G +P++ ++S  L   IDL     K P    + +   L+ L +S NNL G  PS  
Sbjct  577   NQFSGMLPRWLVNSTGLI-AIDLSKNYFKGPILRDFCKLNQLEYLDLSENNLSGYIPSCF  635

Query  1242  LQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILA--  1415
               +  ++ +  ++ N  +G L    + N +L  +++ +N        NF+ SFPN +   
Sbjct  636   --SPPQITHVHLSENRLSGPLTYGFYNNSSLVTMDLRDN--------NFTGSFPNWIGNL  685

Query  1416  -----LNLSSNLFSGQL--HSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNN  1574
                  L L +N F G+L     +   L  LD+S N  +G +P     SC   +  K S+ 
Sbjct  686   SSLSVLLLRANHFDGELPVQLCLLEQLSILDVSQNQLSGPLP-----SCLGNLTFKESSQ  740

Query  1575  KLEGQIVQEFDYLS-SLE---YLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRW  1742
             K    +    D LS S+E   Y  +     E         L   + ++ +        R+
Sbjct  741   KTLADLGA--DVLSRSIEKAYYETMGPPLVESMYNLRKGFLLNFTEEVIEFTTKNMYYRY  798

Query  1743  MGR-LTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVS  1916
              G+ L+ +  + LS N+  G IP EF +L  +  L+LS NNLTGSIP+   N   I+ + 
Sbjct  799   KGKTLSYMSGIDLSNNNFVGAIPPEFGDLSKILSLNLSHNNLTGSIPATFSNLKQIESLD  858

Query  1917  LSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPE  2024
             LS + L+G +     + T L +  +++N+  G  PE
Sbjct  859   LSYNNLNGVIPPQLTDITTLEVFSVAHNNLSGNTPE  894


 Score =   105 bits (263),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 154/546 (28%), Positives = 250/546 (46%), Gaps = 20/546 (4%)
 Frame = +3

Query  582   AFPSIKTLELQRVNVTNIDAIHALKNLSS-LEELHLDGSNLHKD--FLSNIGPMESLKVL  752
              F  +++LEL+   +         + LSS L  L L  +  + D   LS +  + +LK L
Sbjct  95    PFKELQSLELRFNGLVGCLENEGFEVLSSNLRNLDLSDNRFNNDKSILSCMTGLSTLKSL  154

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              LSG  + G+        L+ L  L LS N     I S+   L+ L+ +NLS N L G+ 
Sbjct  155   DLSGNGLTGSGFEIISSHLEKLDNLDLSYNIFNDSILSHLRGLSYLKSLNLSGNMLLGST  214

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
              ++     +S      ++ +    +  ++      L+V+      +      QG+     
Sbjct  215   TVNGTFFNSSTLEELYLDRTSLPINFLQNIGALPDLKVLSVAECDLHGTLPAQGWCELKN  274

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
             L  L LS       LP  L     L++L +S N   G   S  L N T L++  ++NN F
Sbjct  275   LRQLDLSGNNLGGSLPDCLGNLSSLQLLDVSENQFTGNIASGPLTNLTSLEFLSLSNNLF  334

Query  1293  TGSLKLSSHVN-PNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGT  1469
                + +   +N  +L+  +  NNKL  E +  F +  P    +    +  +  L+  I  
Sbjct  335   EVPISMKPFMNHSSLKFFSSENNKLVTEPAA-FDNLIPKFQLVFFRLSKTTEALNVKIPD  393

Query  1470  HLGF------LDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI-VQEFDYLSSLEY  1628
              L +      LDLS+N+ T   P  +L + + L  L LSNN   G + +Q+  YL+  E 
Sbjct  394   FLYYQYDIRVLDLSHNNITAMFPSWLLKNNTRLEQLYLSNNSFVGTLQLQDHPYLNMTE-  452

Query  1629  LHLDGNNFEGTIpnslsnlplhslDIR--DNKLSGEIPRWMGRLTSLVQLTLSKNHLEGH  1802
             L +  NN  G IP  +  +  +   +R  +N  +G IP  +G ++SL  L LS N L   
Sbjct  453   LDISNNNMNGQIPKDICLIFPNMWSLRMANNGFTGCIPSCLGNISSLKILDLSNNQLS--  510

Query  1803  IPIEFCNLKSLSILDLSENNLTGSIP-SCLNPSSIKHVSLSKHQLSGQLTR-AFFNNTAL  1976
               ++   L ++  L LS NNL G +P S  N S+++++ L  +   GQ++    +     
Sbjct  511   -IVKLEQLTTIWFLKLSNNNLGGQLPTSVFNSSTLEYLYLHGNNFWGQISDFLLYGWKMW  569

Query  1977  VILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsG  2156
               LDLS N F G++P W+   + L ++ L+ N F+G +    C+L +L  LDLS N LSG
Sbjct  570   STLDLSDNQFSGMLPRWLVNSTGLIAIDLSKNYFKGPILRDFCKLNQLEYLDLSENNLSG  629

Query  2157  VIPRCL  2174
              IP C 
Sbjct  630   YIPSCF  635



>ref|XP_007011796.1| Receptor like protein 1, putative [Theobroma cacao]
 gb|EOY29415.1| Receptor like protein 1, putative [Theobroma cacao]
Length=1064

 Score =   375 bits (964),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 276/648 (43%), Positives = 395/648 (61%), Gaps = 17/648 (3%)
 Frame = +3

Query  267   KLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDN  446
             KL  L L E  FN SI   +    SL  L L  N    G  H Q++  LRNL+EL LS+N
Sbjct  171   KLRFLDLSESYFNDSILVHVGAISSLATLSLASN-VMTGATHFQELAALRNLEELDLSNN  229

Query  447   YFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNV  626
               E F             +RN S L+VL+LN+   +M  L  SL    S+K L L   ++
Sbjct  230   PLESF--------MEIQGLRNMSKLKVLNLNSCKLNMNTL-QSLGNLHSLKKLYLNENSL  280

Query  627   TNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCE  806
                  +  L +L +LE L +  S+L+  FL  +  M+SLK LSL    + GTL + GLC+
Sbjct  281   EGSITVQELNSLRNLEVLDVSSSHLNSSFLQVLEQMKSLKGLSLRENSLNGTLHSLGLCK  340

Query  807   LKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMN  986
             LKNL+EL +S N   G +P     LTSLR +++S N+ SGNI  S +S+L SLE+LS+ +
Sbjct  341   LKNLEELDISYNSFTGTMPPCIETLTSLRVLDISRNRFSGNISSSFISSLVSLEFLSLSH  400

Query  987   NSFEVASSFRSFANNSKLRV--ILADRNKVIADTQLQGFVPKFQLDSLSLSNC-IDLLKL  1157
             N F+  +SF SFAN+S+L V  ++ + N  + +     +VP+FQL  L L++C +D   L
Sbjct  401   NEFQSLTSFSSFANHSRLEVFELICNNNGSVVEIDDHMWVPRFQLKILRLASCSVDKGSL  460

Query  1158  PRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQ  1337
              +FL YQ DL+V+ +S NNL+G+FP+WL++NNT+++     NN+F G   L S  +  + 
Sbjct  461   LKFLSYQYDLRVINLSNNNLDGDFPTWLMENNTRIEGLHFKNNSFKGQFPLPSCPSTFIS  520

Query  1338  IINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTG  1511
             ++++SNN+L G I  N S   PN+  LNLS N F G + S  G    L  LDLS N F+G
Sbjct  521   VVDISNNQLQGYIPSNISVYLPNLKFLNLSKNSFKGGIPSSFGDMKTLLVLDLSVNEFSG  580

Query  1512  EIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnsls-nlp  1688
             +IP  +++ C SL  L LS N L GQ+  +   L+SLE L L+GN F G IP+SL  +  
Sbjct  581   DIPDSLVLGCFSLRALLLSKNHLTGQMFPKLSNLTSLEILRLNGNLFRGKIPDSLLNSSA  640

Query  1689  lhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLT  1868
             L +LD+  N LSG++P WMG LT L  L ++ NHLEG IP+EFC+L+ + ILDLS+N+L+
Sbjct  641   LKTLDVSHNSLSGKLPTWMGNLTDLQTLLMAGNHLEGPIPVEFCSLEGIEILDLSQNDLS  700

Query  1869  GSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrl  2048
             GSIPSC +P S+  V L  ++L+G ++++F  +++LVILD+  NS  G IP WI  +S  
Sbjct  701   GSIPSCFSPKSLLRVHLYDNKLTGSISKSFSGSSSLVILDIRNNSLTGSIPSWISNLSLS  760

Query  2049  sslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLE  2192
               LL   N+ EG++P  +CQ   +++LDLS+N LSG IP CL KI  +
Sbjct  761   ILLLKE-NQLEGRIPAALCQCSMMTILDLSHNNLSGPIPSCLNKIPFK  807


 Score =   101 bits (252),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 179/692 (26%), Positives = 292/692 (42%), Gaps = 116/692 (17%)
 Frame = +3

Query  51    DNPLNSHLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQ  230
             +N LN  L++ G   L  L NLEEL + Y          +   +   SL+VLDI  N+F 
Sbjct  326   ENSLNGTLHSLG---LCKLKNLEELDISYNSFTGTMPPCI---ETLTSLRVLDISRNRFS  379

Query  231   SFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDIND  410
                  + +     LE L L     + + FQSL  F S                       
Sbjct  380   GNISSSFISSLVSLEFLSL-----SHNEFQSLTSFSS-----------------------  411

Query  411   LRNLKELYLSDNYFEGFETSANHSGS----SRHTIRNKSYLEVLHLNNISFDMTKLLSSL  578
                    + + +  E FE   N++GS      H    +  L++L L + S D   LL  L
Sbjct  412   -------FANHSRLEVFELICNNNGSVVEIDDHMWVPRFQLKILRLASCSVDKGSLLKFL  464

Query  579   AAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSL  758
             +    ++ + L   N+        ++N + +E LH   ++    F     P   + V+ +
Sbjct  465   SYQYDLRVINLSNNNLDGDFPTWLMENNTRIEGLHFKNNSFKGQFPLPSCPSTFISVVDI  524

Query  759   SGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
             S  Q+ G +P+     L NL+ L LS+N  +G IPS FG++ +L  ++LS+N+ SG+I  
Sbjct  525   SNNQLQGYIPSNISVYLPNLKFLNLSKNSFKGGIPSSFGDMKTLLVLDLSVNEFSGDIPD  584

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLD  1118
             S +    SL  L +  N       F   +N + L ++  + N        +G +P   L+
Sbjct  585   SLVLGCFSLRALLLSKNHL-TGQMFPKLSNLTSLEILRLNGN------LFRGKIPDSLLN  637

Query  1119  SLSLSNCIDLL------KLPRFLHYQRDLKVLRISRNNLEGEFPSW-----------LLQ  1247
             S +L   +D+       KLP ++    DL+ L ++ N+LEG  P             L Q
Sbjct  638   SSALKT-LDVSHNSLSGKLPTWMGNLTDLQTLLMAGNHLEGPIPVEFCSLEGIEILDLSQ  696

Query  1248  NN-----------TKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSS  1394
             N+             L    + +N  TGS+  S   + +L I+++ NN L G I    S+
Sbjct  697   NDLSGSIPSCFSPKSLLRVHLYDNKLTGSISKSFSGSSSLVILDIRNNSLTGSIPSWISN  756

Query  1395  SFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLS  1568
                ++  L L  N   G++ + +   + +  LDLS+N+ +G IP     SC + +  K+ 
Sbjct  757   L--SLSILLLKENQLEGRIPAALCQCSMMTILDLSHNNLSGPIP-----SCLNKIPFKID  809

Query  1569  --NNKLEGQIVQEFD-----YLSSLEYLHLD-----GNNFEGTIpnslsnlp--------  1688
               + K    I    D     Y     Y+ L       N     I ++             
Sbjct  810   YRSGKFRLSISLNIDQELPAYSYQTGYVKLSQRPSYANPVGYEIASAEFTTKNRSDFYRN  869

Query  1689  -----lhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLS  1853
                  +  +D+  NKL+G IP  MG L  ++ L +S N L G IP  F  LK +  LDLS
Sbjct  870   NFLYNMTGIDLSWNKLTGRIPPEMGHLKLILALDISHNELSGSIPTNFSGLKDIESLDLS  929

Query  1854  ENNLTGSIPSCLNP-SSIKHVSLSKHQLSGQL  1946
              N LTG IP  L   +++ + S++ + LS ++
Sbjct  930   HNKLTGPIPEQLTELNALGYFSVAYNNLSSKI  961



>ref|XP_006489882.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X1 [Citrus sinensis]
Length=1173

 Score =   377 bits (969),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 300/831 (36%), Positives = 439/831 (53%), Gaps = 119/831 (14%)
 Frame = +3

Query  78    NSGNERLTGLINLEELHMRY-------------------TQMEEINILSVLNLKDFISLK  200
             N G ERL+ L NL+ L++ Y                    ++   N+   +++K+F SL+
Sbjct  120   NEGLERLSRLNNLKMLNLSYNWFNNSILSSLTRLSSLRSLKLYANNLEGSIDVKEFDSLR  179

Query  201   ---VLDIGFNKFQSF----GPINDV-------------------GGAKKLEELYLFECRF  302
                 LDIG+N    F    G  N +                    G  KL+ L L   + 
Sbjct  180   DLEELDIGWNMIDKFVVSKGTTNTIKKCQLLQISWILCHLVYYFTGLSKLKSLGLAGIKL  239

Query  303   NQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHS  482
             N+SI  SL  F SL+ L L D  F  G   +++ +   NL+ L +S+N  +       + 
Sbjct  240   NRSILSSLTVFSSLRELHLRDTGF-KGTFDVREFDSFNNLEVLDMSNNEIDNLVVPQGYR  298

Query  483   GSSRHTIRNKSYLEVLHLNNISF-DMTKLLSSLAAFPSIKTLELQRVN-VTNIDAIHALK  656
             G  +        L+ LHL+ +   D +KLL S+ +FPS+ TL +   N +    A   L 
Sbjct  299   GLRK--------LKSLHLSGVGIRDGSKLLQSIGSFPSLNTLYISWNNFIDTATATQELH  350

Query  657   NLSSLEELHLDGSNLHKDFLSNIGPM-ESLKVLSLSGAQV--------------------  773
             N ++LE L LD S+LH   L +I  +  SLK LS+S  +V                    
Sbjct  351   NFTNLEYLTLDFSSLHISLLQSIASLFPSLKNLSISHCEVNGVLRGQGFPHFKSLEHFDM  410

Query  774   ---------------GGTLP--------------------NKGLCELKNLQELWLSENQL  848
                            G ++P                    ++GLC L +LQEL++  N L
Sbjct  411   RFARIALNTSFLQIIGESMPSLKYLLLSYSTLGTNSSRILHQGLCSLVHLQELYIDNNDL  470

Query  849   EGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFAN  1028
              G +P    N+TSLR +++S N+L+G+I  SPL  LTS+E L + NN F +  S     N
Sbjct  471   RGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEKLDLSNNHFWIPISLEPLFN  530

Query  1029  NSKLRVILADRNKVIAD-TQLQGF-VPKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLR  1199
             +S+L++  AD N++ A+ T+      P FQL  LSLS+   D +  P+FL++Q DL+ + 
Sbjct  531   HSRLKLFYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPKFLYHQHDLEYVD  590

Query  1200  ISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEIS  1379
             +S  N+ GEFP+WLL+NNT L+Y  + N++  G  +L  H +  L+++++SNN + G I 
Sbjct  591   LSHINMSGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLLDISNNNIRGHIP  650

Query  1380  GNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLV  1553
                    P + +LN++ N   G + S  G    L FLDLSNN  TGEIPK + + C +L 
Sbjct  651   VEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEIPKHLAVGCVNLE  710

Query  1554  ILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGE  1730
              L LSNN LEG +      L++L++L L+ N+F G I  +      L  L + +N LSG+
Sbjct  711   SLALSNNNLEGHMFSRNFNLTNLKWLQLESNHFVGEIPQSLSKCSSLEGLYLNNNSLSGK  770

Query  1731  IPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKH  1910
             IPRW+G LT L  + +  NHLEG IP+EFC L+SL ILD+S+NN++GS+PSC +P SIK 
Sbjct  771   IPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLESLQILDISDNNISGSLPSCFHPLSIKQ  830

Query  1911  VSLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGK  2087
             V LSK+ L GQL R  FFN ++LV LDLSYN   G IP+W+  +S+LS L+L  N  EG+
Sbjct  831   VHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGE  890

Query  2088  VPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYY  2240
             VP Q+C+L +L LLDLSNN L G+IP C    +L  +       +  FE Y
Sbjct  891   VPIQLCELNQLQLLDLSNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIY  941


 Score =   130 bits (328),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 190/691 (27%), Positives = 297/691 (43%), Gaps = 134/691 (19%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L ++++L LS+N+
Sbjct  460   LQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEKLDLSNNH  518

Query  450   FE---GFETSANHSG---------------SSRHTIRNKSY-LEVLHLNNISFDMTKLLS  572
             F      E   NHS                +  H++   ++ L+ L L++   D      
Sbjct  519   FWIPISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPK  578

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
              L     ++ ++L  +N++       L+N ++LE + L   +L   F   I   + L++L
Sbjct  579   FLYHQHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLL  638

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S   + G +P +    L  L  L ++ N L+G IPS FGN+  L++++LS N+L+G I
Sbjct  639   DISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEI  698

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                      +LE L++ NN+ E     R+F N + L+ +  + N  +      G +P+  
Sbjct  699   PKHLAVGCVNLESLALSNNNLEGHMFSRNF-NLTNLKWLQLESNHFV------GEIPQ--  749

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C               L+ L ++ N+L G+ P WL  N T LQY +M NN  
Sbjct  750   ----SLSKC-------------SSLEGLYLNNNSLSGKIPRWL-GNLTWLQYIIMPNNHL  791

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP--NILALNLSSNLFSGQLH----  1454
              G + +      +LQI+++S+N     ISG+  S F   +I  ++LS N+  GQL     
Sbjct  792   EGPIPVEFCQLESLQILDISDNN----ISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTF  847

Query  1455  ----SLIGTHLGF-------------------LDLSNNSFTGEIPKEMLISCSSLVILKL  1565
                 SL+   L +                   L L +N+  GE+P + L   + L +L L
Sbjct  848   FNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQ-LCELNQLQLLDL  906

Query  1566  SNNKLEGQIVQEFDYLSSLE--------------YLHLDGNN----------FEGT----  1661
             SNN L G I   FD  +  E              Y+ ++G            FE T    
Sbjct  907   SNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIYVFIEGPQGGVEKKIHEIFEFTTKNI  966

Query  1662  --IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSL  1835
               I        L  LD+  NKL G IP  +G LT +  L LS ++L G IP  F NLK +
Sbjct  967   AYIYQGKVFSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHHNLTGSIPSTFSNLKHV  1026

Query  1836  SILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGI  2015
               LDLS N L G IP               HQL    T        L +  ++YN+  G 
Sbjct  1027  ESLDLSNNKLNGKIP---------------HQLVELKT--------LEVFSVAYNNLSGE  1063

Query  2016  IPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
             I EW    +  +     GN F   +P  +C+
Sbjct  1064  ILEWKAQFATFNGSSYEGNTFLCGLPLPICR  1094



>ref|XP_011009774.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Populus euphratica]
Length=811

 Score =   369 bits (948),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 247/589 (42%), Positives = 362/589 (61%), Gaps = 19/589 (3%)
 Frame = +3

Query  663   SSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSEN  842
             S+LEELHLD ++L  +FL NIG + +LKVLS++   + GTLP +G CELKNL++L L+ N
Sbjct  26    STLEELHLDYTSLPINFLQNIGALPALKVLSVAECDLNGTLPAQGWCELKNLKQLDLARN  85

Query  843   QLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSF  1022
                G +P   GN++SL+ +++S N  +GNI   PL+ L SL++LS+ NN FEV  S + F
Sbjct  86    NFGGSLPDCLGNMSSLQQLDVSDNHFTGNIAFGPLTNLISLKFLSLSNNLFEVPISMKPF  145

Query  1023  ANNSKLRVILADRNKVIAD-TQLQGFVPKFQLDSLSLSNCID----LLKLPRFLHYQRDL  1187
              N+S L+   ++ N+++ +       +PKFQL    LS+       ++++P FL+YQ DL
Sbjct  146   MNHSSLKFFYSENNRLVTEPAAFDNLIPKFQLLFFRLSSNPTSEALIVEIPDFLYYQYDL  205

Query  1188  KVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLC  1367
             +VL +S NN+ G FPSWLL+NNT+L+   ++ N+F G+L+L  H+ PN+  +++SNN + 
Sbjct  206   RVLDLSHNNITGMFPSWLLKNNTRLEQLYLSENSFVGALQLQDHLYPNMTALDISNNNMH  265

Query  1368  GEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISC  1541
             G+I  +    FPN+  L ++ N F+G + S +G  + LG LDLSNN  +  +  E+L   
Sbjct  266   GQIPKDICLIFPNLENLRVAKNGFTGCIPSCLGNISSLGVLDLSNNQLS-TVKLELL---  321

Query  1542  SSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlp--lhslDIRDN  1715
             ++   LKLSNN L GQI       S+LE+L+L GNNF G I +   N       LD+  N
Sbjct  322   TTTWFLKLSNNNLGGQIPTSLFNSSTLEFLYLSGNNFWGQISDFPLNAWNNWAVLDLSHN  381

Query  1716  KLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNP  1895
             +  G +P W    TSL  + LSKNH  G IP +FC L  L  LDLSENNL+G IPSC +P
Sbjct  382   QFLGMLPTWFVNSTSLGAIDLSKNHFIGPIPRDFCKLDRLEYLDLSENNLSGYIPSCFSP  441

Query  1896  SSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNR  2075
               + HV LSK++LSG LT  FFN++ LV +DL  +SF G IP WIG  S  S LLL  N 
Sbjct  442   PPLTHVHLSKNRLSGPLTYGFFNSSYLVTMDLRDSSFTGSIPNWIGNHSSFSVLLLRANH  501

Query  2076  FEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQ-FRGINLPFEYYSIND  2252
             F+G++P Q+C L +LS+LD+S N LSG +P CLG ++ + ++ + F G+   F   S+  
Sbjct  502   FDGELPVQLCLLEQLSILDVSQNQLSGPLPSCLGNLTFKKSSHKVFAGLVAAFGSSSLEW  561

Query  2253  AILDRLHYEWGS-DDEYIPMLAVDVL----PEVQFRTKGNLYNYQNSIL  2384
             ++    H   G    + +  L  D+L      ++FRTK   Y Y+  +L
Sbjct  562   SMEKAYHEAMGPLLVDSMNNLGKDILLNFTEVIEFRTKNMYYGYKGKVL  610


 Score =   120 bits (301),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 186/691 (27%), Positives = 307/691 (44%), Gaps = 71/691 (10%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             LEELH+ YT +  IN L   N+    +LKVL +         P       K L++L L  
Sbjct  28    LEELHLDYTSLP-INFLQ--NIGALPALKVLSVAECDLNGTLPAQGWCELKNLKQLDLAR  84

Query  294   CRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---GFE  464
               F  S+   L    SL+ LD+ DN F  G +    + +L +LK L LS+N FE     +
Sbjct  85    NNFGGSLPDCLGNMSSLQQLDVSDNHF-TGNIAFGPLTNLISLKFLSLSNNLFEVPISMK  143

Query  465   TSANHSG-SSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPS----------------  593
                NHS     ++  N+   E    +N+      L   L++ P+                
Sbjct  144   PFMNHSSLKFFYSENNRLVTEPAAFDNLIPKFQLLFFRLSSNPTSEALIVEIPDFLYYQY  203

Query  594   -IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQ  770
              ++ L+L   N+T +     LKN + LE+L+L  ++             ++  L +S   
Sbjct  204   DLRVLDLSHNNITGMFPSWLLKNNTRLEQLYLSENSFVGALQLQDHLYPNMTALDISNNN  263

Query  771   VGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
             + G +P        NL+ L +++N   G IPS  GN++SL  ++LS N+LS       L 
Sbjct  264   MHGQIPKDICLIFPNLENLRVAKNGFTGCIPSCLGNISSLGVLDLSNNQLS----TVKLE  319

Query  951   tltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKV---IADTQLQGFVPKFQLDS  1121
              LT+  +L + NN+        S  N+S L  +    N     I+D  L  +     LD 
Sbjct  320   LLTTTWFLKLSNNNLG-GQIPTSLFNSSTLEFLYLSGNNFWGQISDFPLNAWNNWAVLD-  377

Query  1122  LSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGS  1301
               LS+   L  LP +      L  + +S+N+  G  P    + + +L+Y  ++ N  +G 
Sbjct  378   --LSHNQFLGMLPTWFVNSTSLGAIDLSKNHFIGPIPRDFCKLD-RLEYLDLSENNLSGY  434

Query  1302  LKLSSHVNPNLQIINVSNNKLCGEIS-GNFSSSFPNILALNLSSNLFSGQLHSLIGTHLG  1478
             +  S    P L  +++S N+L G ++ G F+SS+  ++ ++L  + F+G + + IG H  
Sbjct  435   IP-SCFSPPPLTHVHLSKNRLSGPLTYGFFNSSY--LVTMDLRDSSFTGSIPNWIGNHSS  491

Query  1479  F--LDLSNNSFTGEIPKEM-------------------LISCSSLVILKLSNNKLEGQIV  1595
             F  L L  N F GE+P ++                   L SC   +  K S++K+   +V
Sbjct  492   FSVLLLRANHFDGELPVQLCLLEQLSILDVSQNQLSGPLPSCLGNLTFKKSSHKVFAGLV  551

Query  1596  QEFDYLSSLE------YLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLT  1757
               F   SSLE      Y    G     ++ N   ++ L+  ++ + +       + G++ 
Sbjct  552   AAFGS-SSLEWSMEKAYHEAMGPLLVDSMNNLGKDILLNFTEVIEFRTKNMYYGYKGKVL  610

Query  1758  SLVQ-LTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQ  1931
             S +  + LS N+  G IP EF NL  +   +LS NNLTGSIP    N   I+ + LS + 
Sbjct  611   SYMNGIDLSNNNFVGAIPPEFGNLSEILSFNLSHNNLTGSIPPIFSNLKQIESLDLSYNN  670

Query  1932  LSGQLTRAFFNNTALVILDLSYNSFVGIIPE  2024
             L+G +       T L +  +++N+  G  PE
Sbjct  671   LNGVIPPQLTEITTLEVFSVAHNNLSGRTPE  701



>gb|KDO40877.1| hypothetical protein CISIN_1g001036mg [Citrus sinensis]
 gb|KDO40878.1| hypothetical protein CISIN_1g001036mg [Citrus sinensis]
Length=967

 Score =   372 bits (956),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 280/707 (40%), Positives = 394/707 (56%), Gaps = 35/707 (5%)
 Frame = +3

Query  303   NQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHS  482
             N  + +  +G   LK LDL      DG   +Q +    +L  L+L  N F    T+    
Sbjct  85    NVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTT---  141

Query  483   GSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNL  662
                   + N + LE L L++ S  ++ L S  + FPS+K L +    V  + +     + 
Sbjct  142   ----QELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHF  197

Query  663   SSLEELHLDGSN--LHKDFLSNIG-PMESLKVLSLSGAQVG---GTLPNKGLCELKNLQE  824
              SLE L +  +   L+  FL  IG  M SLK LSLSG+ +G     + ++GLC L +LQE
Sbjct  198   KSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQE  257

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
             L++  N L G +P    N TSLR +++S N+L+G+I  SPL  LTS+E L + NN F + 
Sbjct  258   LYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIP  317

Query  1005  SSFRSFANNSKLRVILADRNKVIADT-QLQGFVPKFQLDSLSLS-NCIDLLKLPRFLHYQ  1178
              S     N+SKL++  A  N++  +  +     PKFQL SLSLS N  D +  P+FL++Q
Sbjct  318   VSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQ  377

Query  1179  RDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNN  1358
              +LK   +S   + GEFP+WLL+NNTKL++  + N++  G  +L  H +  L+ ++VSNN
Sbjct  378   HELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNN  437

Query  1359  KLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEML  1532
                G I        P+++  N+S N   G + S  G    L FLDLSNN  TGEIP  + 
Sbjct  438   NFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLA  497

Query  1533  ISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDIR  1709
             + C +L  L LSNN L+G I      L +L +L L+GN+F G IP SLS       L + 
Sbjct  498   MCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLN  557

Query  1710  DNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL  1889
             +N LSG+IPRW+G L  L  + + KNHLEG IP+EFC L SL ILD+S+NN++GS+PSC 
Sbjct  558   NNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCF  617

Query  1890  NPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllN  2066
              P SIK V LSK+ L GQL    FFN ++LV LDLSYN   G IP+WI  +S+LS L L 
Sbjct  618   YPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLA  677

Query  2067  GNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEY-YS  2243
              N  EG+VP Q+C+L +L LLDLS+N L G+IP C    +L  +       + PF+  +S
Sbjct  678   HNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFS  737

Query  2244  INDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
             I+           GS ++ I       L   +F TK   Y YQ  +L
Sbjct  738   ISGP--------QGSVEKKI-------LEIFEFTTKNIAYAYQGRVL  769


 Score =   142 bits (358),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 200/729 (27%), Positives = 318/729 (44%), Gaps = 104/729 (14%)
 Frame = +3

Query  114   LEELHMRYTQME------EINILSVLNLKDFISLKVLDIGFNKF----QSFGPINDVGGA  263
             LE L MR+ ++       +I   S+ +LK ++SL    +G N      Q   P+      
Sbjct  200   LEHLDMRFARIALNTSFLQIIGESMPSLK-YLSLSGSTLGTNSSRILDQGLCPL------  252

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
               L+ELY+       S+   L    SL+ILD+  N    G +    +  L +++EL LS+
Sbjct  253   AHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQL-TGSISSSPLVHLTSIEELRLSN  311

Query  444   NYFE---GFETSANHSG---------------SSRHTIRNKSYLEVLHLNNISFDMTKLL  569
             N+F      E   NHS                +  H++  K  L+ L L++   D     
Sbjct  312   NHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFP  371

Query  570   SSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKV  749
               L     +K  EL  + +        L+N + LE L+L   +L   F   I   + L+ 
Sbjct  372   KFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRF  431

Query  750   LSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGN  929
             L +S     G +P +    L +L    +S N L+G IPS FGN+  L++++LS NKL+G 
Sbjct  432   LDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGE  491

Query  930   IelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKF  1109
             I         +LE+LS+ NNS +    F    +   LR +L + N  + +   Q      
Sbjct  492   IPDHLAMCCVNLEFLSLSNNSLK-GHIFSRIFSLRNLRWLLLEGNHFVGEIP-QSLSKCS  549

Query  1110  QLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNA  1289
              L  L L+N     K+PR+L   + L+ + + +N+LEG  P    + ++ LQ   +++N 
Sbjct  550   SLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDS-LQILDISDNN  608

Query  1290  FTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG-  1466
              +GSL  S     +++ +++S N L G++      +  +++ L+LS N  +G +   I  
Sbjct  609   ISGSLP-SCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDG  667

Query  1467  -THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDG  1643
              + L  L+L++N+  GE+P + L   + L +L LS+N L G I   FD  +    LH   
Sbjct  668   LSQLSHLNLAHNNLEGEVPIQ-LCRLNQLQLLDLSDNNLHGLIPSCFDNTT----LHESY  722

Query  1644  NN----------------------------FEGTIpnslsnlp------lhslDIRDNKL  1721
             NN                            FE T  N            L  LD+  NKL
Sbjct  723   NNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKL  782

Query  1722  SGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSS  1901
              G IP  +G LT +  L LS N+L G IP+ F NL+ +  LDLS N L+G IP       
Sbjct  783   VGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIP-------  835

Query  1902  IKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFE  2081
                             R   +   L I  ++YN+  G IPEW    +  +    +GN F 
Sbjct  836   ----------------RQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFL  879

Query  2082  GKVPTQVCQ  2108
               +P  +C+
Sbjct  880   CGLPLPICR  888



>ref|XP_006489891.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X10 [Citrus sinensis]
Length=1011

 Score =   372 bits (956),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 288/758 (38%), Positives = 420/758 (55%), Gaps = 83/758 (11%)
 Frame = +3

Query  171   LNLKDFISLK---VLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPS  341
             +++K+F SL+    LDIG+N+   F       G +KL+ L L   + N+SI  SL     
Sbjct  37    IDVKEFDSLRDLEELDIGWNEIDKFVV---SKGLRKLKSLGLSGTKLNRSILSSLSW---  90

Query  342   LKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYL  521
             L+ LD+    F  G   I++ +   NL+ L +S+N  +       + G  +        L
Sbjct  91    LRELDISYTGF-KGTFDIREFDSFNNLEVLDMSNNEIDNLVVPQGYRGLRK--------L  141

Query  522   EVLHLNNISF-DMTKLLSSLAAFPSIKTLELQRVN-VTNIDAIHALKNLSSLEELHLDGS  695
             + LHL+ +   D +KLL S+ +FPS+ TL +   N +    A   L N ++LE L LD S
Sbjct  142   KSLHLSGVGIRDGSKLLQSIGSFPSLNTLYISWNNFIDTATATQELHNFTNLEYLTLDFS  201

Query  696   NLHKDFLSNIGPM-ESLKVLSLSGAQV---------------------------------  773
             +LH   L +I  +  SLK LS+S  +V                                 
Sbjct  202   SLHISLLQSIASLFPSLKNLSISHCEVNGVLRGQGFPHFKSLEHFDMRFARIALNTSFLQ  261

Query  774   --GGTLP--------------------NKGLCELKNLQELWLSENQLEGKIPSYFGNLTS  887
               G ++P                    ++GLC L +LQEL++  N L G +P    N+TS
Sbjct  262   IIGESMPSLKYLLLSYSTLGTNSSRILHQGLCSLVHLQELYIDNNDLRGSLPWCLANMTS  321

Query  888   LRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNK  1067
             LR +++S N+L+G+I  SPL  LTS+E L + NN F +  S     N+S+L++  AD N+
Sbjct  322   LRILDVSSNQLTGSISSSPLVHLTSIEKLDLSNNHFWIPISLEPLFNHSRLKLFYADNNE  381

Query  1068  VIAD-TQLQGF-VPKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSW  1238
             + A+ T+      P FQL  LSLS+   D +  P+FL++Q DL+ + +S  N+ GEFP+W
Sbjct  382   IKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHINMSGEFPNW  441

Query  1239  LLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILAL  1418
             LL+NNT L+Y  + N++  G  +L  H +  L+++++SNN + G I        P + +L
Sbjct  442   LLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLLDISNNNIRGHIPVEIGDVLPGLFSL  501

Query  1419  NLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI  1592
             N++ N   G + S  G    L FLDLSNN  TGEIPK + + C +L  L LSNN LEG +
Sbjct  502   NIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEIPKHLAVGCVNLESLALSNNNLEGHM  561

Query  1593  VQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGRLTSLVQ  1769
                   L++L++L L+ N+F G IP SLS       L + +N LSG+IPRW+G LT L  
Sbjct  562   FSRNFNLTNLKWLQLESNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLQY  621

Query  1770  LTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLT  1949
             + +  NHLEG IP+EFC L+SL ILD+S+NN++GS+PSC +P SIK V LSK+ L GQL 
Sbjct  622   IIMPNNHLEGPIPVEFCQLESLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLK  681

Query  1950  RA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlsl  2126
             R  FFN ++LV LDLSYN   G IP+W+  +S+LS L+L  N  EG+VP Q+C+L +L L
Sbjct  682   RGTFFNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQL  741

Query  2127  ldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYY  2240
             LDLSNN L G+IP C    +L  +       +  FE Y
Sbjct  742   LDLSNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIY  779


 Score =   131 bits (330),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 187/689 (27%), Positives = 295/689 (43%), Gaps = 130/689 (19%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L ++++L LS+N+
Sbjct  298   LQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEKLDLSNNH  356

Query  450   FE---GFETSANHSG---------------SSRHTIRNKSY-LEVLHLNNISFDMTKLLS  572
             F      E   NHS                +  H++   ++ L+ L L++   D      
Sbjct  357   FWIPISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPK  416

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
              L     ++ ++L  +N++       L+N ++LE + L   +L   F   I   + L++L
Sbjct  417   FLYHQHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLL  476

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S   + G +P +    L  L  L ++ N L+G IPS FGN+  L++++LS N+L+G I
Sbjct  477   DISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEI  536

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                      +LE L++ NN+ E     R+F N + L+ +  + N  +      G +P+  
Sbjct  537   PKHLAVGCVNLESLALSNNNLEGHMFSRNF-NLTNLKWLQLESNHFV------GEIPQ--  587

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C               L+ L ++ N+L G+ P WL  N T LQY +M NN  
Sbjct  588   ----SLSKC-------------SSLEGLYLNNNSLSGKIPRWL-GNLTWLQYIIMPNNHL  629

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLH------  1454
              G + +      +LQI+++S+N + G +   F     +I  ++LS N+  GQL       
Sbjct  630   EGPIPVEFCQLESLQILDISDNNISGSLPSCFHPL--SIKQVHLSKNMLHGQLKRGTFFN  687

Query  1455  --SLIGTHLGF-------------------LDLSNNSFTGEIPKEMLISCSSLVILKLSN  1571
               SL+   L +                   L L +N+  GE+P + L   + L +L LSN
Sbjct  688   CSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQ-LCELNQLQLLDLSN  746

Query  1572  NKLEGQIVQEFDYLSSLE--------------YLHLDGNN----------FEGT------  1661
             N L G I   FD  +  E              Y+ ++G            FE T      
Sbjct  747   NNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIYVFIEGPQGGVEKKIHEIFEFTTKNIAY  806

Query  1662  IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSI  1841
             I        L  LD+  NKL G IP  +G LT +  L LS ++L G IP  F NLK +  
Sbjct  807   IYQGKVFSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHHNLTGSIPSTFSNLKHVES  866

Query  1842  LDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIP  2021
             LDLS N L G IP               HQL    T        L +  ++YN+  G I 
Sbjct  867   LDLSNNKLNGKIP---------------HQLVELKT--------LEVFSVAYNNLSGEIL  903

Query  2022  EWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
             EW    +  +     GN F   +P  +C+
Sbjct  904   EWKAQFATFNGSSYEGNTFLCGLPLPICR  932


 Score = 90.5 bits (223),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 175/656 (27%), Positives = 279/656 (43%), Gaps = 126/656 (19%)
 Frame = +3

Query  582   A----------------------FPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGS  695
                                    F S++ LE   +    ID     K L  L+ L L G+
Sbjct  19    RLSSLRSLKLSHNKLEGSIDVKEFDSLRDLEELDIGWNEIDKFVVSKGLRKLKSLGLSGT  78

Query  696   NLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEG-KIPSYF  872
              L++  LS+   +  L+ L +S     GT   +      NL+ L +S N+++   +P  +
Sbjct  79    KLNRSILSS---LSWLRELDISYTGFKGTFDIREFDSFNNLEVLDMSNNEIDNLVVPQGY  135

Query  873   GNLTSLRYVNLS-LNKLSGNIelsplstltsleylsI-MNNSFEVASSFRSFANNSKLRV  1046
               L  L+ ++LS +    G+  L  + +  SL  L I  NN  + A++ +   N + L  
Sbjct  136   RGLRKLKSLHLSGVGIRDGSKLLQSIGSFPSLNTLYISWNNFIDTATATQELHNFTNLEY  195

Query  1047  ILADRNKVIADTQLQGFVPKF-QLDSLSLSNCI--DLLKLPRFLHYQR----DLKVLRIS  1205
             +  D +  +  + LQ     F  L +LS+S+C    +L+   F H++     D++  RI+
Sbjct  196   LTLDFSS-LHISLLQSIASLFPSLKNLSISHCEVNGVLRGQGFPHFKSLEHFDMRFARIA  254

Query  1206  RNN----LEGE-FPS---WLLQNNT-----------------KLQYFLMNNNAFTGSLKL  1310
              N     + GE  PS    LL  +T                  LQ   ++NN   GSL  
Sbjct  255   LNTSFLQIIGESMPSLKYLLLSYSTLGTNSSRILHQGLCSLVHLQELYIDNNDLRGSLPW  314

Query  1311  SSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLF--SGQLHSLIG-THLGF  1481
                   +L+I++VS+N+L G IS +      +I  L+LS+N F     L  L   + L  
Sbjct  315   CLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEKLDLSNNHFWIPISLEPLFNHSRLKL  374

Query  1482  LDLSNNSFTGEIPKEMLISCSS--LVILKLSNNKLEGQIVQEFDYL--------------  1613
                 NN    EI +   ++  +  L  L LS+   +G    +F Y               
Sbjct  375   FYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHINM  434

Query  1614  ------------SSLEYLHLDGNNFEGTIpn-slsnlplhslDIRDNKLSGEIPRWMGR-  1751
                         ++LEY+ L  ++  G       S+  L  LDI +N + G IP  +G  
Sbjct  435   SGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLLDISNNNIRGHIPVEIGDV  494

Query  1752  LTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP-----SCLNPSSIKHVS  1916
             L  L  L ++ N L+G IP  F N+K L  LDLS N LTG IP      C+N   ++ ++
Sbjct  495   LPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEIPKHLAVGCVN---LESLA  551

Query  1917  LSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPE------------------------  2024
             LS + L G +    FN T L  L L  N FVG IP+                        
Sbjct  552   LSNNNLEGHMFSRNFNLTNLKWLQLESNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPR  611

Query  2025  WIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLE  2192
             W+G ++ L  +++  N  EG +P + CQL  L +LD+S+N +SG +P C   +S++
Sbjct  612   WLGNLTWLQYIIMPNNHLEGPIPVEFCQLESLQILDISDNNISGSLPSCFHPLSIK  667



>ref|XP_011015511.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X1 [Populus euphratica]
Length=830

 Score =   368 bits (945),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 255/625 (41%), Positives = 371/625 (59%), Gaps = 44/625 (7%)
 Frame = +3

Query  591   SIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQ  770
             S+KTL L+  N++         N S+LEELHLD + L  +FL NIG + +LKVLS++   
Sbjct  24    SLKTLSLKDTNLSQ----GTFFNSSTLEELHLDRTPLLINFLQNIGALPALKVLSVAECD  79

Query  771   VGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
             + GTLP +G CELKNL++L LS N L G +P   GNL+SL+ +++S N+ +GNI   PL+
Sbjct  80    LHGTLPAQGWCELKNLKQLDLSGNNLGGSLPDCLGNLSSLQLLDVSNNQFTGNIAFGPLT  139

Query  951   tltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQGFVPKFQLDSLS  1127
              L SLE+LS+ NN FEV +S + F N+S L+   ++ N+++ +        PKFQL    
Sbjct  140   NLISLEFLSLSNNLFEVPTSMKPFMNHSSLKFFSSENNRLVTEPAAFDNLTPKFQLLFFR  199

Query  1128  LSNCIDL----LKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
             LS+        +++P FL+YQ DL+VL +S NN+ G FPSWLL+NNT+++   ++ N+F 
Sbjct  200   LSSSPTSEALNVEIPDFLYYQYDLRVLDLSHNNITGMFPSWLLKNNTRMEQLYLSENSFV  259

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--T  1469
             G+L+L  H+ PN+  +++SNN + G+I  +    FPN+  L ++ N F+G + S +G  +
Sbjct  260   GTLQLQDHLYPNMTALDISNNNMHGQIPKDICLIFPNLENLWMAKNGFTGCIPSCLGNIS  319

Query  1470  HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN  1649
              LG LDLSNN  +  +  E+L   ++   LKLSNN L GQI       S+L++L+L GNN
Sbjct  320   SLGVLDLSNNQLS-TVKLELL---TTTWFLKLSNNNLSGQIPTSLFNSSTLQFLYLSGNN  375

Query  1650  FEGTIpnslsnlp--lhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCN  1823
             F G I +   N       LD+  N+  G +P W    T+L  + LSKNH  G IP +FC 
Sbjct  376   FWGQISDFPLNAWNNWVVLDLSHNQFLGMLPTWFVNSTTLGAIDLSKNHFIGPIPRDFCK  435

Query  1824  LKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNS  2003
             L  +  LDLSENNL+G IPSC +P  + HV LSK++LSG LT  FFN++ LV +DL  NS
Sbjct  436   LDQVEYLDLSENNLSGYIPSCFSPPPLTHVHLSKNRLSGPLTYGFFNSSYLVTMDLRDNS  495

Query  2004  FVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKI  2183
             F G IP WIG  S LS LLL  N F+G++P Q+C L +LS+LD+S N LSG +P CLG +
Sbjct  496   FTGSIPNWIGNHSSLSVLLLRANHFDGELPVQLCLLEQLSILDVSQNQLSGPLPSCLGNL  555

Query  2184  SLEGTNEQ-FRGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLA---VDVL--------  2327
             + + ++ + F G+   F   S+          EW ++  Y   +    VD +        
Sbjct  556   TFKKSSHKVFAGLVAAFGSSSL----------EWSTEKAYYEAMGPLLVDSMNNLGKYIL  605

Query  2328  -----PEVQFRTKGNLYNYQNSILK  2387
                    ++F TK   Y Y   +L 
Sbjct  606   LNFTEEVIEFTTKNMYYGYTGKVLS  630


 Score =   119 bits (299),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 187/740 (25%), Positives = 302/740 (41%), Gaps = 134/740 (18%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             LEELH+  T +  IN L   N+    +LKVL +         P       K L++L L  
Sbjct  46    LEELHLDRTPLL-INFLQ--NIGALPALKVLSVAECDLHGTLPAQGWCELKNLKQLDLSG  102

Query  294   CRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---GFE  464
                  S+   L    SL++LD+ +N F  G +    + +L +L+ L LS+N FE     +
Sbjct  103   NNLGGSLPDCLGNLSSLQLLDVSNNQF-TGNIAFGPLTNLISLEFLSLSNNLFEVPTSMK  161

Query  465   TSANHSGSSRHTIRNKSYL-EVLHLNNISFDMTKLLSSLAAFPS----------------  593
                NHS     +  N   + E    +N++     L   L++ P+                
Sbjct  162   PFMNHSSLKFFSSENNRLVTEPAAFDNLTPKFQLLFFRLSSSPTSEALNVEIPDFLYYQY  221

Query  594   -IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQ  770
              ++ L+L   N+T +     LKN + +E+L+L  ++             ++  L +S   
Sbjct  222   DLRVLDLSHNNITGMFPSWLLKNNTRMEQLYLSENSFVGTLQLQDHLYPNMTALDISNNN  281

Query  771   VGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
             + G +P        NL+ LW+++N   G IPS  GN++SL  ++LS N+LS       L 
Sbjct  282   MHGQIPKDICLIFPNLENLWMAKNGFTGCIPSCLGNISSLGVLDLSNNQLS----TVKLE  337

Query  951   tltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSL  1130
              LT+  +L + NN+        S  N+S L+ +    N         G +  F L++ + 
Sbjct  338   LLTTTWFLKLSNNNLS-GQIPTSLFNSSTLQFLYLSGNN------FWGQISDFPLNAWN-  389

Query  1131  SNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKL  1310
                              +  VL +S N   G  P+W + N+T L    ++ N F G +  
Sbjct  390   -----------------NWVVLDLSHNQFLGMLPTWFV-NSTTLGAIDLSKNHFIGPIPR  431

Query  1311  SSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHS--LIGTHLGFL  1484
                    ++ +++S N L G I   FS   P +  ++LS N  SG L       ++L  +
Sbjct  432   DFCKLDQVEYLDLSENNLSGYIPSCFSP--PPLTHVHLSKNRLSGPLTYGFFNSSYLVTM  489

Query  1485  DLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI  1664
             DL +NSFTG IP   + + SSL +L L  N  +G++  +   L  L  L           
Sbjct  490   DLRDNSFTGSIPN-WIGNHSSLSVLLLRANHFDGELPVQLCLLEQLSIL-----------  537

Query  1665  pnslsnlplhslDIRDNKLSGEIPRWMGRLT------------------SLVQLTLSKNH  1790
                         D+  N+LSG +P  +G LT                  S ++ +  K +
Sbjct  538   ------------DVSQNQLSGPLPSCLGNLTFKKSSHKVFAGLVAAFGSSSLEWSTEKAY  585

Query  1791  LEGHIP---------------------IEFCN-----------LKSLSILDLSENNLTGS  1874
              E   P                     IEF             L  ++ +DLS NN  G+
Sbjct  586   YEAMGPLLVDSMNNLGKYILLNFTEEVIEFTTKNMYYGYTGKVLSYMNGIDLSNNNFVGA  645

Query  1875  IPSCL-NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrls  2051
             IP    N S I  ++LS + L+G +   F N   +  LDLSYN+  G+IP  +  I+ L 
Sbjct  646   IPPEFGNLSEILSLNLSHNNLTGSIPPIFSNLKQIESLDLSYNNLNGVIPPQLIEITSLE  705

Query  2052  slllNGNRFEGKVPTQVCQL  2111
                +  N   G+ P +  Q 
Sbjct  706   VFSVAHNNLSGRTPERKYQF  725



>ref|XP_006489884.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X3 [Citrus sinensis]
Length=1165

 Score =   375 bits (963),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 300/823 (36%), Positives = 433/823 (53%), Gaps = 111/823 (13%)
 Frame = +3

Query  78    NSGNERLTGLINLEELHMRYTQMEE-------------INILSVLNLKDFISLKV-LDIG  215
             N G ERL+ L NL+ L++ Y                     L   NL+  I +K  LDIG
Sbjct  120   NEGLERLSRLNNLKMLNLSYNWFNNSILSSLTRLSSLRSLKLYANNLEGSIDVKEELDIG  179

Query  216   FNKFQSF----GPINDV-------------------GGAKKLEELYLFECRFNQSIFQSL  326
             +N    F    G  N +                    G  KL+ L L   + N+SI  SL
Sbjct  180   WNMIDKFVVSKGTTNTIKKCQLLQISWILCHLVYYFTGLSKLKSLGLAGIKLNRSILSSL  239

Query  327   KGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIR  506
               F SL+ L L D  F  G   +++ +   NL+ L +S+N  +       + G  +    
Sbjct  240   TVFSSLRELHLRDTGF-KGTFDVREFDSFNNLEVLDMSNNEIDNLVVPQGYRGLRK----  294

Query  507   NKSYLEVLHLNNISF-DMTKLLSSLAAFPSIKTLELQRVN-VTNIDAIHALKNLSSLEEL  680
                 L+ LHL+ +   D +KLL S+ +FPS+ TL +   N +    A   L N ++LE L
Sbjct  295   ----LKSLHLSGVGIRDGSKLLQSIGSFPSLNTLYISWNNFIDTATATQELHNFTNLEYL  350

Query  681   HLDGSNLHKDFLSNIGPM-ESLKVLSLSGAQV----------------------------  773
              LD S+LH   L +I  +  SLK LS+S  +V                            
Sbjct  351   TLDFSSLHISLLQSIASLFPSLKNLSISHCEVNGVLRGQGFPHFKSLEHFDMRFARIALN  410

Query  774   -------GGTLP--------------------NKGLCELKNLQELWLSENQLEGKIPSYF  872
                    G ++P                    ++GLC L +LQEL++  N L G +P   
Sbjct  411   TSFLQIIGESMPSLKYLLLSYSTLGTNSSRILHQGLCSLVHLQELYIDNNDLRGSLPWCL  470

Query  873   GNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVIL  1052
              N+TSLR +++S N+L+G+I  SPL  LTS+E L + NN F +  S     N+S+L++  
Sbjct  471   ANMTSLRILDVSSNQLTGSISSSPLVHLTSIEKLDLSNNHFWIPISLEPLFNHSRLKLFY  530

Query  1053  ADRNKVIAD-TQLQGF-VPKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEG  1223
             AD N++ A+ T+      P FQL  LSLS+   D +  P+FL++Q DL+ + +S  N+ G
Sbjct  531   ADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHINMSG  590

Query  1224  EFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP  1403
             EFP+WLL+NNT L+Y  + N++  G  +L  H +  L+++++SNN + G I        P
Sbjct  591   EFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLLDISNNNIRGHIPVEIGDVLP  650

Query  1404  NILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNK  1577
              + +LN++ N   G + S  G    L FLDLSNN  TGEIPK + + C +L  L LSNN 
Sbjct  651   GLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEIPKHLAVGCVNLESLALSNNN  710

Query  1578  LEGQIVQEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGEIPRWMGRL  1754
             LEG +      L++L++L L+ N+F G I  +      L  L + +N LSG+IPRW+G L
Sbjct  711   LEGHMFSRNFNLTNLKWLQLESNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNL  770

Query  1755  TSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQL  1934
             T L  + +  NHLEG IP+EFC L+SL ILD+S+NN++GS+PSC +P SIK V LSK+ L
Sbjct  771   TWLQYIIMPNNHLEGPIPVEFCQLESLQILDISDNNISGSLPSCFHPLSIKQVHLSKNML  830

Query  1935  SGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQL  2111
              GQL R  FFN ++LV LDLSYN   G IP+W+  +S+LS L+L  N  EG+VP Q+C+L
Sbjct  831   HGQLKRGTFFNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQLCEL  890

Query  2112  MRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYY  2240
              +L LLDLSNN L G+IP C    +L  +       +  FE Y
Sbjct  891   NQLQLLDLSNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIY  933


 Score =   131 bits (330),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 190/691 (27%), Positives = 297/691 (43%), Gaps = 134/691 (19%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L ++++L LS+N+
Sbjct  452   LQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEKLDLSNNH  510

Query  450   FE---GFETSANHSG---------------SSRHTIRNKSY-LEVLHLNNISFDMTKLLS  572
             F      E   NHS                +  H++   ++ L+ L L++   D      
Sbjct  511   FWIPISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPK  570

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
              L     ++ ++L  +N++       L+N ++LE + L   +L   F   I   + L++L
Sbjct  571   FLYHQHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLL  630

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S   + G +P +    L  L  L ++ N L+G IPS FGN+  L++++LS N+L+G I
Sbjct  631   DISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEI  690

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                      +LE L++ NN+ E     R+F N + L+ +  + N  +      G +P+  
Sbjct  691   PKHLAVGCVNLESLALSNNNLEGHMFSRNF-NLTNLKWLQLESNHFV------GEIPQ--  741

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C               L+ L ++ N+L G+ P WL  N T LQY +M NN  
Sbjct  742   ----SLSKC-------------SSLEGLYLNNNSLSGKIPRWL-GNLTWLQYIIMPNNHL  783

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP--NILALNLSSNLFSGQLH----  1454
              G + +      +LQI+++S+N     ISG+  S F   +I  ++LS N+  GQL     
Sbjct  784   EGPIPVEFCQLESLQILDISDNN----ISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTF  839

Query  1455  ----SLIGTHLGF-------------------LDLSNNSFTGEIPKEMLISCSSLVILKL  1565
                 SL+   L +                   L L +N+  GE+P + L   + L +L L
Sbjct  840   FNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQ-LCELNQLQLLDL  898

Query  1566  SNNKLEGQIVQEFDYLSSLE--------------YLHLDGNN----------FEGT----  1661
             SNN L G I   FD  +  E              Y+ ++G            FE T    
Sbjct  899   SNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIYVFIEGPQGGVEKKIHEIFEFTTKNI  958

Query  1662  --IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSL  1835
               I        L  LD+  NKL G IP  +G LT +  L LS ++L G IP  F NLK +
Sbjct  959   AYIYQGKVFSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHHNLTGSIPSTFSNLKHV  1018

Query  1836  SILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGI  2015
               LDLS N L G IP               HQL    T        L +  ++YN+  G 
Sbjct  1019  ESLDLSNNKLNGKIP---------------HQLVELKT--------LEVFSVAYNNLSGE  1055

Query  2016  IPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
             I EW    +  +     GN F   +P  +C+
Sbjct  1056  ILEWKAQFATFNGSSYEGNTFLCGLPLPICR  1086



>ref|XP_006489889.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X8 [Citrus sinensis]
Length=1121

 Score =   374 bits (961),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 283/739 (38%), Positives = 410/739 (55%), Gaps = 52/739 (7%)
 Frame = +3

Query  72    LNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPIND  251
             LN S    LT   +L ELH+R T  +      V     F +L+VLD+  N+  +      
Sbjct  187   LNRSILSSLTVFSSLRELHLRDTGFK--GTFDVREFDSFNNLEVLDMSNNEIDNLVVPQG  244

Query  252   VGGAKKLEELYL--FECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLK  425
               G +KL+ L+L     R    + QS+  FPSL  L +  N+F D     Q++++  NL+
Sbjct  245   YRGLRKLKSLHLSGVGIRDGSKLLQSIGSFPSLNTLYISWNNFIDTATATQELHNFTNLE  304

Query  426   ELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAA-FPSIKT  602
              L L                              LH++        LL S+A+ FPS+K 
Sbjct  305   YLTLD--------------------------FSSLHIS--------LLQSIASLFPSLKN  330

Query  603   LELQRVNVTNIDAIHALKNLSSLEELHLDGSN--LHKDFLSNIG-PMESLKVLSLSGAQV  773
             L +    V  +       +  SLE   +  +   L+  FL  IG  M SLK L LS + +
Sbjct  331   LSISHCEVNGVLRGQGFPHFKSLEHFDMRFARIALNTSFLQIIGESMPSLKYLLLSYSTL  390

Query  774   G---GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsp  944
             G     + ++GLC L +LQEL++  N L G +P    N+TSLR +++S N+L+G+I  SP
Sbjct  391   GTNSSRILHQGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSP  450

Query  945   lstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQGF-VPKFQLD  1118
             L  LTS+E L + NN F +  S     N+S+L++  AD N++ A+ T+      P FQL 
Sbjct  451   LVHLTSIEKLDLSNNHFWIPISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQLK  510

Query  1119  SLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
              LSLS+   D +  P+FL++Q DL+ + +S  N+ GEFP+WLL+NNT L+Y  + N++  
Sbjct  511   YLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSLA  570

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--T  1469
             G  +L  H +  L+++++SNN + G I        P + +LN++ N   G + S  G   
Sbjct  571   GPFRLPIHSHKRLRLLDISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMK  630

Query  1470  HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN  1649
              L FLDLSNN  TGEIPK + + C +L  L LSNN LEG +      L++L++L L+ N+
Sbjct  631   FLQFLDLSNNQLTGEIPKHLAVGCVNLESLALSNNNLEGHMFSRNFNLTNLKWLQLESNH  690

Query  1650  FEGTI-pnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNL  1826
             F G I  +      L  L + +N LSG+IPRW+G LT L  + +  NHLEG IP+EFC L
Sbjct  691   FVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQL  750

Query  1827  KSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYNS  2003
             +SL ILD+S+NN++GS+PSC +P SIK V LSK+ L GQL R  FFN ++LV LDLSYN 
Sbjct  751   ESLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNR  810

Query  2004  FVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKI  2183
               G IP+W+  +S+LS L+L  N  EG+VP Q+C+L +L LLDLSNN L G+IP C    
Sbjct  811   LNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHGLIPPCFDNT  870

Query  2184  SLEGTNEQFRGINLPFEYY  2240
             +L  +       +  FE Y
Sbjct  871   TLHESYNNSSSPDEQFEIY  889


 Score =   131 bits (330),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 190/691 (27%), Positives = 297/691 (43%), Gaps = 134/691 (19%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L ++++L LS+N+
Sbjct  408   LQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEKLDLSNNH  466

Query  450   FE---GFETSANHSG---------------SSRHTIRNKSY-LEVLHLNNISFDMTKLLS  572
             F      E   NHS                +  H++   ++ L+ L L++   D      
Sbjct  467   FWIPISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPK  526

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
              L     ++ ++L  +N++       L+N ++LE + L   +L   F   I   + L++L
Sbjct  527   FLYHQHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLL  586

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S   + G +P +    L  L  L ++ N L+G IPS FGN+  L++++LS N+L+G I
Sbjct  587   DISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEI  646

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                      +LE L++ NN+ E     R+F N + L+ +  + N  +      G +P+  
Sbjct  647   PKHLAVGCVNLESLALSNNNLEGHMFSRNF-NLTNLKWLQLESNHFV------GEIPQ--  697

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C               L+ L ++ N+L G+ P WL  N T LQY +M NN  
Sbjct  698   ----SLSKC-------------SSLEGLYLNNNSLSGKIPRWL-GNLTWLQYIIMPNNHL  739

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP--NILALNLSSNLFSGQLH----  1454
              G + +      +LQI+++S+N     ISG+  S F   +I  ++LS N+  GQL     
Sbjct  740   EGPIPVEFCQLESLQILDISDNN----ISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTF  795

Query  1455  ----SLIGTHLGF-------------------LDLSNNSFTGEIPKEMLISCSSLVILKL  1565
                 SL+   L +                   L L +N+  GE+P + L   + L +L L
Sbjct  796   FNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQ-LCELNQLQLLDL  854

Query  1566  SNNKLEGQIVQEFDYLSSLE--------------YLHLDGNN----------FEGT----  1661
             SNN L G I   FD  +  E              Y+ ++G            FE T    
Sbjct  855   SNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIYVFIEGPQGGVEKKIHEIFEFTTKNI  914

Query  1662  --IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSL  1835
               I        L  LD+  NKL G IP  +G LT +  L LS ++L G IP  F NLK +
Sbjct  915   AYIYQGKVFSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHHNLTGSIPSTFSNLKHV  974

Query  1836  SILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGI  2015
               LDLS N L G IP               HQL    T        L +  ++YN+  G 
Sbjct  975   ESLDLSNNKLNGKIP---------------HQLVELKT--------LEVFSVAYNNLSGE  1011

Query  2016  IPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
             I EW    +  +     GN F   +P  +C+
Sbjct  1012  ILEWKAQFATFNGSSYEGNTFLCGLPLPICR  1042



>ref|XP_006489883.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X2 [Citrus sinensis]
Length=1173

 Score =   375 bits (962),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 298/831 (36%), Positives = 439/831 (53%), Gaps = 119/831 (14%)
 Frame = +3

Query  78    NSGNERLTGLINLEELHMRY-------------------TQMEEINILSVLNLKDFISLK  200
             N G ERL+ L NL+ L++ Y                    ++   N+   +++K+F SL+
Sbjct  120   NEGLERLSRLNNLKMLNLSYNWFNNSILSSLTRLSSLRSLKLYANNLEGSIDVKEFDSLR  179

Query  201   ---VLDIGFNKFQSF----GPINDV-------------------GGAKKLEELYLFECRF  302
                 LDIG+N    F    G  N +                    G  KL+ L L   + 
Sbjct  180   DLEELDIGWNMIDKFVVSKGTTNTIKKCQLLQISWILCHLVYYFTGLSKLKSLGLAGIKL  239

Query  303   NQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHS  482
             N+SI  SL  F SL+ L L D  F  G   +++ +   NL+ L +S+N  +       + 
Sbjct  240   NRSILSSLTVFSSLRELHLRDTGF-KGTFDVREFDSFNNLEVLDMSNNEIDNLVVPQGYR  298

Query  483   GSSRHTIRNKSYLEVLHLNNISF-DMTKLLSSLAAFPSIKTLELQRVN-VTNIDAIHALK  656
             G  +        L+ LHL+ +   D +KLL S+ +FPS+ TL +   N +    A   L 
Sbjct  299   GLRK--------LKSLHLSGVGIRDGSKLLQSIGSFPSLNTLYISWNNFIDTATATQELH  350

Query  657   NLSSLEELHLDGSNLHKDFLSNIGPM-ESLKVLSLSGAQV--------------------  773
             N ++LE L LD S+LH   L +I  +  SLK LS+S  +V                    
Sbjct  351   NFTNLEYLTLDFSSLHISLLQSIASLFPSLKNLSISHCEVNGVLRGQGFPHFKSLEHFDM  410

Query  774   ---------------GGTLP--------------------NKGLCELKNLQELWLSENQL  848
                            G ++P                    ++GLC L +LQEL++  N L
Sbjct  411   DDAPTALNTNFLQIIGVSMPSLKYLSLSVSTLSTNSSRILDQGLCSLVHLQELYIDNNDL  470

Query  849   EGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFAN  1028
              G +P    N+TSLR +++S N+L+G+I  SPL  LTS+E L + +N F +  S     N
Sbjct  471   RGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELRLSDNHFRIPISLEPLFN  530

Query  1029  NSKLRVILADRNKVIAD-TQLQGF-VPKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLR  1199
             +S+L++  A  N++ A+ T+      P FQL SLSL++   D +  P+FL++Q DL+ +R
Sbjct  531   HSRLKIFYAYNNEINAEITESHSLTAPNFQLQSLSLTSGYGDGVTFPKFLYHQHDLEDVR  590

Query  1200  ISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEIS  1379
             +S   + GEFP+WLL+NNT L+Y  + N++  G  +L  H +  L+++++SNN + G I 
Sbjct  591   LSNIKMNGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLLDISNNNIRGHIP  650

Query  1380  GNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLV  1553
                    P + +LN++ N   G + S  G    L FLDLSNN  TGEIPK + + C +L 
Sbjct  651   VEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEIPKHLAVGCVNLE  710

Query  1554  ILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGE  1730
              L LSNN LEG +      L++L++L L+ N+F G I  +      L  L + +N LSG+
Sbjct  711   SLALSNNNLEGHMFSRNFNLTNLKWLQLESNHFVGEIPQSLSKCSSLEGLYLNNNSLSGK  770

Query  1731  IPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKH  1910
             IPRW+G LT L  + +  NHLEG IP+EFC L+SL ILD+S+NN++GS+PSC +P SIK 
Sbjct  771   IPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLESLQILDISDNNISGSLPSCFHPLSIKQ  830

Query  1911  VSLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGK  2087
             V LSK+ L GQL R  FFN ++LV LDLSYN   G IP+W+  +S+LS L+L  N  EG+
Sbjct  831   VHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGE  890

Query  2088  VPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYY  2240
             VP Q+C+L +L LLDLSNN L G+IP C    +L  +       +  FE Y
Sbjct  891   VPIQLCELNQLQLLDLSNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIY  941


 Score =   134 bits (336),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 194/691 (28%), Positives = 295/691 (43%), Gaps = 134/691 (19%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L +++EL LSDN+
Sbjct  460   LQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEELRLSDNH  518

Query  450   FE---GFETSANHSG-SSRHTIRNKSYLEVLHLNNI--------SFDMTKLLSSLAAFPS  593
             F      E   NHS     +   N+   E+   +++        S  +T        FP 
Sbjct  519   FRIPISLEPLFNHSRLKIFYAYNNEINAEITESHSLTAPNFQLQSLSLTSGYGDGVTFPK  578

Query  594   I--KTLELQRVNVTNID-----AIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
                   +L+ V ++NI          L+N ++LE + L   +L   F   I   + L++L
Sbjct  579   FLYHQHDLEDVRLSNIKMNGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLL  638

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S   + G +P +    L  L  L ++ N L+G IPS FGN+  L++++LS N+L+G I
Sbjct  639   DISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEI  698

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                      +LE L++ NN+ E     R+F N + L+ +  + N  +      G +P+  
Sbjct  699   PKHLAVGCVNLESLALSNNNLEGHMFSRNF-NLTNLKWLQLESNHFV------GEIPQ--  749

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C               L+ L ++ N+L G+ P WL  N T LQY +M NN  
Sbjct  750   ----SLSKC-------------SSLEGLYLNNNSLSGKIPRWL-GNLTWLQYIIMPNNHL  791

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP--NILALNLSSNLFSGQLH----  1454
              G + +      +LQI+++S+N     ISG+  S F   +I  ++LS N+  GQL     
Sbjct  792   EGPIPVEFCQLESLQILDISDNN----ISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTF  847

Query  1455  ----SLIGTHLGF-------------------LDLSNNSFTGEIPKEMLISCSSLVILKL  1565
                 SL+   L +                   L L +N+  GE+P + L   + L +L L
Sbjct  848   FNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQ-LCELNQLQLLDL  906

Query  1566  SNNKLEGQIVQEFDYLSSLE--------------YLHLDGNN----------FEGT----  1661
             SNN L G I   FD  +  E              Y+ ++G            FE T    
Sbjct  907   SNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIYVFIEGPQGGVEKKIHEIFEFTTKNI  966

Query  1662  --IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSL  1835
               I        L  LD+  NKL G IP  +G LT +  L LS ++L G IP  F NLK +
Sbjct  967   AYIYQGKVFSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHHNLTGSIPSTFSNLKHV  1026

Query  1836  SILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGI  2015
               LDLS N L G IP               HQL    T        L +  ++YN+  G 
Sbjct  1027  ESLDLSNNKLNGKIP---------------HQLVELKT--------LEVFSVAYNNLSGE  1063

Query  2016  IPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
             I EW    +  +     GN F   +P  +C+
Sbjct  1064  ILEWKAQFATFNGSSYEGNTFLCGLPLPICR  1094



>ref|XP_010244882.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 isoform X2 [Nelumbo nucifera]
Length=907

 Score =   369 bits (947),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 248/562 (44%), Positives = 346/562 (62%), Gaps = 19/562 (3%)
 Frame = +3

Query  741   LKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKL  920
             L+VL+L   ++G      GLC LKNL+EL LS N  EG +PS   NLTSLR ++LS N+ 
Sbjct  176   LEVLNLGNNEIGSFPTVAGLCTLKNLEELDLSMNGFEGNLPSCLENLTSLRVLDLSSNQF  235

Query  921   SGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFV  1100
              GNI  S +++L SLEYLS+ +N F+   SF S AN+SKL       N+++ +T    +V
Sbjct  236   GGNISSSLITSLRSLEYLSLSDNRFQGPFSFSSLANHSKLEAFANSNNELVLETDYSPWV  295

Query  1101  PKFQLDSLSLSN-CIDLLK--LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYF  1271
             P FQL  L  SN  I  L   +P+FL YQ DL+V+ +S NN EGEFP+WLL+NNT+L+  
Sbjct  296   PTFQLKILLFSNSTIKRLSGSIPKFLQYQYDLRVVDLSHNNFEGEFPNWLLENNTRLEIL  355

Query  1272  LMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQL  1451
              + NN+ TG   L SH N +  I+++S N + GEI  N  +  PN+L LN+SSN   G++
Sbjct  356   NLKNNSLTGQFLLPSHPNRDTSILDISRNHISGEIPTNIGTILPNLLVLNMSSNSLRGRI  415

Query  1452  HSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLE  1625
              S +G    L  LDLSNN F G IP+ +    +SL ++KLSN  L+GQI+  F  L+ L 
Sbjct  416   PSSLGDMKRLQALDLSNNRFLGGIPENLATGYTSLELIKLSNCNLKGQILPSFSNLTRLH  475

Query  1626  YLHLDGNNFEGTIpnsls-nlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGH  1802
             YL+LDGN F G IP+ LS +  L  LDI  N +SG++P WMG ++SL  L ++ NHLEG 
Sbjct  476   YLYLDGNQFTGEIPDILSNSSELKRLDISHNNISGKLPWWMGNMSSLEALKITNNHLEGP  535

Query  1803  IPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVI  1982
             IP+EFC+L  L I+DLSENNL+GSIP C +P  + H    K+  +G +T AF  ++ LV 
Sbjct  536   IPVEFCSLNDLRIIDLSENNLSGSIPDCFSPPFLFHARFQKNGFTGPMTTAFSKSSYLVT  595

Query  1983  LDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVI  2162
             L+++ N   G IP+WIG +  LS LLL+ N F+GK+PTQ+CQL ++++LDLS+N LSG I
Sbjct  596   LNIAKNYLTGRIPDWIGKLQSLSILLLDENNFQGKIPTQLCQLSKITILDLSHNNLSGTI  655

Query  2163  PRCLG----KISLEGTNEQFRGINLPFEYYSINDAILDRLHYEWGSDDEY----IPMLAV  2318
             P CL     K+       + +  +  +  YS    +      E G  D Y       +AV
Sbjct  656   PSCLSNLTFKVGFRSGKYRLQQGSPIYSSYSFQSLV-----KESGDLDLYQVNFYSYIAV  710

Query  2319  DVLPEVQFRTKGNLYNYQNSIL  2384
               + E++F TK   YNY+ + L
Sbjct  711   YEVTEMEFTTKTRSYNYKGNSL  732


 Score =   148 bits (374),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 195/744 (26%), Positives = 313/744 (42%), Gaps = 154/744 (21%)
 Frame = +3

Query  72    LNNSGNERLTGLINLEELHMRYTQMEEINILS----------------------VLNLKD  185
             + N G ERL+ L NLE L + +  + +    S                      +  L  
Sbjct  113   VENEGFERLSRLRNLEVLDLSWNSLNDTVFSSLKMLSSLKSLNLSNNAIFESTHIQELAG  172

Query  186   FISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMD  365
              I+L+VL++G N+  SF  +  +   K LEEL L    F  ++   L+   SL++LDL  
Sbjct  173   LINLEVLNLGNNEIGSFPTVAGLCTLKNLEELDLSMNGFEGNLPSCLENLTSLRVLDLSS  232

Query  366   NDFYDGPLHIQDINDLRNLKELYLSDNYFEG---FETSANHS------GSSRHTIRNKSY  518
             N F  G +    I  LR+L+ L LSDN F+G   F + ANHS       S+   +    Y
Sbjct  233   NQF-GGNISSSLITSLRSLEYLSLSDNRFQGPFSFSSLANHSKLEAFANSNNELVLETDY  291

Query  519   --------LEVLHLNNISFDMTKLLSSLAAF----PSIKTLELQRVNVTNIDAIHALKNL  662
                     L++L  +N +  + +L  S+  F      ++ ++L   N         L+N 
Sbjct  292   SPWVPTFQLKILLFSNST--IKRLSGSIPKFLQYQYDLRVVDLSHNNFEGEFPNWLLENN  349

Query  663   SSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSEN  842
             + LE L+L  ++L   FL    P     +L +S   + G +P      L NL  L +S N
Sbjct  350   TRLEILNLKNNSLTGQFLLPSHPNRDTSILDISRNHISGEIPTNIGTILPNLLVLNMSSN  409

Query  843   QLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSF  1022
              L G+IPS  G++  L+ ++LS N+  G I  +  +  TSLE + + N + +      SF
Sbjct  410   SLRGRIPSSLGDMKRLQALDLSNNRFLGGIPENLATGYTSLELIKLSNCNLK-GQILPSF  468

Query  1023  ANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRI  1202
             +N ++L  +  D N+   +                         +P  L    +LK L I
Sbjct  469   SNLTRLHYLYLDGNQFTGE-------------------------IPDILSNSSELKRLDI  503

Query  1203  SRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISG  1382
             S NN+ G+ P W + N + L+   + NN   G + +      +L+II++S N L G I  
Sbjct  504   SHNNISGKLP-WWMGNMSSLEALKITNNHLEGPIPVEFCSLNDLRIIDLSENNLSGSIPD  562

Query  1383  NFSSSF----------------------PNILALNLSSNLFSGQLHSLIG----------  1466
              FS  F                        ++ LN++ N  +G++   IG          
Sbjct  563   CFSPPFLFHARFQKNGFTGPMTTAFSKSSYLVTLNIAKNYLTGRIPDWIGKLQSLSILLL  622

Query  1467  ----------------THLGFLDLSNNSFTGEIPKEM---------------------LI  1535
                             + +  LDLS+N+ +G IP  +                     + 
Sbjct  623   DENNFQGKIPTQLCQLSKITILDLSHNNLSGTIPSCLSNLTFKVGFRSGKYRLQQGSPIY  682

Query  1536  SCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLD------GNNFEGTIpnslsnlplhs  1697
             S  S   L   +  L+   V  + Y++  E   ++        N++G      S   +  
Sbjct  683   SSYSFQSLVKESGDLDLYQVNFYSYIAVYEVTEMEFTTKTRSYNYKGN-----SLYYMTG  737

Query  1698  lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSI  1877
             +D   N+L+G+IP  +G L  L    LS N L G IP  F NL+ +  LDLS NNL G+I
Sbjct  738   IDFSSNRLTGDIPPEIGNLGRLRAFNLSHNLLAGPIPTSFSNLEKIESLDLSYNNLAGTI  797

Query  1878  PSCL-NPSSIKHVSLSKHQLSGQL  1946
             PS L N +S+   S++ + LSGQ+
Sbjct  798   PSELSNLNSLAVFSVAHNNLSGQI  821


 Score = 70.1 bits (170),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 142/523 (27%), Positives = 213/523 (41%), Gaps = 127/523 (24%)
 Frame = +3

Query  1023  ANNSKLRVI-LADRNKVIADTQLQG--FVPKFQLDSLS-----LSNCIDLLKLPRFLHYQ  1178
              NN+  RVI ++       D  L    F+P  +L SL+     LS  ++     R L   
Sbjct  66    CNNTTKRVIQISLSGARQGDWNLNASLFLPFEELQSLNLSSCLLSGWVENEGFER-LSRL  124

Query  1179  RDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNP-----NLQII  1343
             R+L+VL +S N+L     S L     K+   L + N    ++  S+H+       NL+++
Sbjct  125   RNLEVLDLSWNSLNDTVFSSL-----KMLSSLKSLNLSNNAIFESTHIQELAGLINLEVL  179

Query  1344  NVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEI  1517
             N+ NN++    +     +  N+  L+LS N F G L S +   T L  LDLS+N F G I
Sbjct  180   NLGNNEIGSFPTVAGLCTLKNLEELDLSMNGFEGNLPSCLENLTSLRVLDLSSNQFGGNI  239

Query  1518  PKEMLISCSSLVILKLSNNKLEG---------------------QIVQEFDYLS------  1616
                ++ S  SL  L LS+N+ +G                     ++V E DY        
Sbjct  240   SSSLITSLRSLEYLSLSDNRFQGPFSFSSLANHSKLEAFANSNNELVLETDYSPWVPTFQ  299

Query  1617  --------------------------SLEYLHLDGNNFEGTIpnslsn--lplhslDIRD  1712
                                        L  + L  NNFEG  PN L      L  L++++
Sbjct  300   LKILLFSNSTIKRLSGSIPKFLQYQYDLRVVDLSHNNFEGEFPNWLLENNTRLEILNLKN  359

Query  1713  NKLSGE--IPRWMGRLTS-----------------------LVQLTLSKNHLEGHIPIEF  1817
             N L+G+  +P    R TS                       L+ L +S N L G IP   
Sbjct  360   NSLTGQFLLPSHPNRDTSILDISRNHISGEIPTNIGTILPNLLVLNMSSNSLRGRIPSSL  419

Query  1818  CNLKSLSILDLSENNLTGSIPSCL--------------------------NPSSIKHVSL  1919
              ++K L  LDLS N   G IP  L                          N + + ++ L
Sbjct  420   GDMKRLQALDLSNNRFLGGIPENLATGYTSLELIKLSNCNLKGQILPSFSNLTRLHYLYL  479

Query  1920  SKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQ  2099
               +Q +G++     N++ L  LD+S+N+  G +P W+G +S L +L +  N  EG +P +
Sbjct  480   DGNQFTGEIPDILSNSSELKRLDISHNNISGKLPWWMGNMSSLEALKITNNHLEGPIPVE  539

Query  2100  VCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLP  2228
              C L  L ++DLS N LSG IP C     L     Q  G   P
Sbjct  540   FCSLNDLRIIDLSENNLSGSIPDCFSPPFLFHARFQKNGFTGP  582



>gb|KDO40876.1| hypothetical protein CISIN_1g001036mg [Citrus sinensis]
Length=1066

 Score =   372 bits (956),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 280/707 (40%), Positives = 394/707 (56%), Gaps = 35/707 (5%)
 Frame = +3

Query  303   NQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHS  482
             N  + +  +G   LK LDL      DG   +Q +    +L  L+L  N F    T+    
Sbjct  184   NVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTT---  240

Query  483   GSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNL  662
                   + N + LE L L++ S  ++ L S  + FPS+K L +    V  + +     + 
Sbjct  241   ----QELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHF  296

Query  663   SSLEELHLDGSN--LHKDFLSNIG-PMESLKVLSLSGAQVG---GTLPNKGLCELKNLQE  824
              SLE L +  +   L+  FL  IG  M SLK LSLSG+ +G     + ++GLC L +LQE
Sbjct  297   KSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQE  356

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
             L++  N L G +P    N TSLR +++S N+L+G+I  SPL  LTS+E L + NN F + 
Sbjct  357   LYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIP  416

Query  1005  SSFRSFANNSKLRVILADRNKVIADT-QLQGFVPKFQLDSLSLS-NCIDLLKLPRFLHYQ  1178
              S     N+SKL++  A  N++  +  +     PKFQL SLSLS N  D +  P+FL++Q
Sbjct  417   VSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQ  476

Query  1179  RDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNN  1358
              +LK   +S   + GEFP+WLL+NNTKL++  + N++  G  +L  H +  L+ ++VSNN
Sbjct  477   HELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNN  536

Query  1359  KLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGT--HLGFLDLSNNSFTGEIPKEML  1532
                G I        P+++  N+S N   G + S  G    L FLDLSNN  TGEIP  + 
Sbjct  537   NFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLA  596

Query  1533  ISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDIR  1709
             + C +L  L LSNN L+G I      L +L +L L+GN+F G IP SLS       L + 
Sbjct  597   MCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLN  656

Query  1710  DNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL  1889
             +N LSG+IPRW+G L  L  + + KNHLEG IP+EFC L SL ILD+S+NN++GS+PSC 
Sbjct  657   NNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCF  716

Query  1890  NPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllN  2066
              P SIK V LSK+ L GQL    FFN ++LV LDLSYN   G IP+WI  +S+LS L L 
Sbjct  717   YPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLA  776

Query  2067  GNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEY-YS  2243
              N  EG+VP Q+C+L +L LLDLS+N L G+IP C    +L  +       + PF+  +S
Sbjct  777   HNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFS  836

Query  2244  INDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
             I+           GS ++ I       L   +F TK   Y YQ  +L
Sbjct  837   ISGP--------QGSVEKKI-------LEIFEFTTKNIAYAYQGRVL  868


 Score =   142 bits (357),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 187/669 (28%), Positives = 295/669 (44%), Gaps = 91/669 (14%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L +++EL LS+N+
Sbjct  354   LQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQL-TGSISSSPLVHLTSIEELRLSNNH  412

Query  450   FE---GFETSANHSG---------------SSRHTIRNKSYLEVLHLNNISFDMTKLLSS  575
             F      E   NHS                +  H++  K  L+ L L++   D       
Sbjct  413   FRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKF  472

Query  576   LAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLS  755
             L     +K  EL  + +        L+N + LE L+L   +L   F   I   + L+ L 
Sbjct  473   LYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLD  532

Query  756   LSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIe  935
             +S     G +P +    L +L    +S N L+G IPS FGN+  L++++LS NKL+G I 
Sbjct  533   VSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIP  592

Query  936   lsplstltsleylsIMNNSFE--VASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKF  1109
                     +LE+LS+ NNS +  + S   S  N   LR +L + N  + +   Q      
Sbjct  593   DHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRN---LRWLLLEGNHFVGEIP-QSLSKCS  648

Query  1110  QLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNA  1289
              L  L L+N     K+PR+L   + L+ + + +N+LEG  P    + ++ LQ   +++N 
Sbjct  649   SLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDS-LQILDISDNN  707

Query  1290  FTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG-  1466
              +GSL  S     +++ +++S N L G++      +  +++ L+LS N  +G +   I  
Sbjct  708   ISGSLP-SCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDG  766

Query  1467  -THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDG  1643
              + L  L+L++N+  GE+P + L   + L +L LS+N L G I   FD  +    LH   
Sbjct  767   LSQLSHLNLAHNNLEGEVPIQ-LCRLNQLQLLDLSDNNLHGLIPSCFDNTT----LHESY  821

Query  1644  NN----------------------------FEGTIpnslsnlp------lhslDIRDNKL  1721
             NN                            FE T  N            L  LD+  NKL
Sbjct  822   NNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKL  881

Query  1722  SGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSS  1901
              G IP  +G LT +  L LS N+L G IP+ F NL+ +  LDLS N L+G IP       
Sbjct  882   VGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIP-------  934

Query  1902  IKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFE  2081
                             R   +   L I  ++YN+  G IPEW    +  +    +GN F 
Sbjct  935   ----------------RQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFL  978

Query  2082  GKVPTQVCQ  2108
               +P  +C+
Sbjct  979   CGLPLPICR  987


 Score = 82.8 bits (203),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 184/697 (26%), Positives = 302/697 (43%), Gaps = 117/697 (17%)
 Frame = +3

Query  441   DNYFEGF-------------ETSANHSGSSRHTI-RNKSYLEVLHLNNISFDMTKLLSSL  578
             DN  EG              E     +   +  + +  S L+ L L+   F  T  +   
Sbjct  30    DNRLEGSIDVKELDSLRDLEELDIGGNKIDKFMVSKGLSKLKSLGLSGTGFKGTFDVREF  89

Query  579   AAFPSIKTLELQRVNVTNI---DAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKV  749
              +F +++ L++    + N+     +  L  LS L++L L G+  +   LS++  + SL  
Sbjct  90    DSFNNLEVLDMSGNEIDNLVVPQGLERLSRLSKLKKLDLRGNLCNNSILSSVARLSSLTS  149

Query  750   LSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEG-KIPSYFGNLTSLRYVNLS-LNKLS  923
             L LS   + G++  K    L NL+EL +++N+++  ++   +  L  L+ ++LS +    
Sbjct  150   LHLSHNILQGSIDAKEFDSLSNLEELDINDNEIDNVEVSRGYRGLRKLKSLDLSGVGIRD  209

Query  924   GNIelsplstltsleylsIMNNSFEVA-SSFRSFANNSKLRVILADRNKVIADTQLQGFV  1100
             GN  L  + +  SL  L + +N+F    ++ +   N + L  +  D +  +  + LQ   
Sbjct  210   GNKLLQSMGSFPSLNTLHLESNNFTATLTTTQELHNFTNLEYLTLD-DSSLHISLLQSIG  268

Query  1101  PKF-QLDSLSLSNCI--DLLKLPRFLHYQR----DLKVLRISRNN----LEGE-FPSW--  1238
               F  L +LS+S C    +L    F H++     D++  RI+ N     + GE  PS   
Sbjct  269   SIFPSLKNLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKY  328

Query  1239  -------LLQNNTK-----------LQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKL  1364
                    L  N+++           LQ   ++NN   GSL        +L+I++VS N+L
Sbjct  329   LSLSGSTLGTNSSRILDQGLCPLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQL  388

Query  1365  CGEISGNFSSSFPNILALNLSSNLF--SGQLHSLIG-THLGFLDLSNNSFTGEI------  1517
              G IS +      +I  L LS+N F     L  L   + L   D  NN   GEI      
Sbjct  389   TGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSL  448

Query  1518  -PKEMLISCS-------------------SLVILKLSNNKLEGQIVQE-FDYLSSLEYLH  1634
              PK  L S S                    L   +LS+ K+ G+      +  + LE+L+
Sbjct  449   TPKFQLKSLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLY  508

Query  1635  LDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGR-LTSLVQLTLSKNHLEGHIP  1808
             L  ++  G     + +      LD+ +N   G IP  +G  L SLV   +S N L+G IP
Sbjct  509   LVNDSLAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIP  568

Query  1809  IEFCNLKSLSILDLSENNLTGSIP-----SCLNPSSIKHVSLSKHQLSGQLTRAFFNNTA  1973
               F N+  L  LDLS N LTG IP      C+N   ++ +SLS + L G +    F+   
Sbjct  569   SSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVN---LEFLSLSNNSLKGHIFSRIFSLRN  625

Query  1974  LVILDLSYNSFVGIIPE------------------------WIGTIsrlsslllNGNRFE  2081
             L  L L  N FVG IP+                        W+G +  L  +++  N  E
Sbjct  626   LRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLE  685

Query  2082  GKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLE  2192
             G +P + C+L  L +LD+S+N +SG +P C   +S++
Sbjct  686   GPIPVEFCRLDSLQILDISDNNISGSLPSCFYPLSIK  722



>gb|KDO40875.1| hypothetical protein CISIN_1g001036mg [Citrus sinensis]
Length=1056

 Score =   372 bits (955),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 279/709 (39%), Positives = 394/709 (56%), Gaps = 39/709 (6%)
 Frame = +3

Query  303   NQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHS  482
             N  + +  +G   LK LDL      DG   +Q +    +L  L+L  N F    T+    
Sbjct  174   NVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTT---  230

Query  483   GSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNL  662
                   + N + LE L L++ S  ++ L S  + FPS+K L +    V  + +     + 
Sbjct  231   ----QELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHF  286

Query  663   SSLEELHLDGSN--LHKDFLSNIG-PMESLKVLSLSGAQVG---GTLPNKGLCELKNLQE  824
              SLE L +  +   L+  FL  IG  M SLK LSLSG+ +G     + ++GLC L +LQE
Sbjct  287   KSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQE  346

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
             L++  N L G +P    N TSLR +++S N+L+G+I  SPL  LTS+E L + NN F + 
Sbjct  347   LYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIP  406

Query  1005  SSFRSFANNSKLRVILADRNKVIADT-QLQGFVPKFQLDSLSLS-NCIDLLKLPRFLHYQ  1178
              S     N+SKL++  A  N++  +  +     PKFQL SLSLS N  D +  P+FL++Q
Sbjct  407   VSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQ  466

Query  1179  RDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNN  1358
              +LK   +S   + GEFP+WLL+NNTKL++  + N++  G  +L  H +  L+ ++VSNN
Sbjct  467   HELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNN  526

Query  1359  KLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEML  1532
                G I        P+++  N+S N   G + S  G    L FLDLSNN  TGEIP  + 
Sbjct  527   NFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLA  586

Query  1533  ISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDIR  1709
             + C +L  L LSNN L+G I      L +L +L L+GN+F G IP SLS       L + 
Sbjct  587   MCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLN  646

Query  1710  DNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL  1889
             +N LSG+IPRW+G L  L  + + KNHLEG IP+EFC L SL ILD+S+NN++GS+PSC 
Sbjct  647   NNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCF  706

Query  1890  NPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllN  2066
              P SIK V LSK+ L GQL    FFN ++LV LDLSYN   G IP+WI  +S+LS L L 
Sbjct  707   YPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLA  766

Query  2067  GNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEY-YS  2243
              N  EG+VP Q+C+L +L LLDLS+N L G+IP C    +L  +       + PF+  +S
Sbjct  767   HNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFS  826

Query  2244  INDAILDRLHYEWGSDDEYIPMLAVD--VLPEVQFRTKGNLYNYQNSIL  2384
             I+                  P  +V+  +L   +F TK   Y YQ  +L
Sbjct  827   ISG-----------------PQGSVEKKILEIFEFTTKNIAYAYQGRVL  858


 Score =   142 bits (358),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 200/730 (27%), Positives = 319/730 (44%), Gaps = 104/730 (14%)
 Frame = +3

Query  111   NLEELHMRYTQME------EINILSVLNLKDFISLKVLDIGFNKF----QSFGPINDVGG  260
             +LE L MR+ ++       +I   S+ +LK ++SL    +G N      Q   P+     
Sbjct  288   SLEHLDMRFARIALNTSFLQIIGESMPSLK-YLSLSGSTLGTNSSRILDQGLCPL-----  341

Query  261   AKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLS  440
                L+ELY+       S+   L    SL+ILD+  N    G +    +  L +++EL LS
Sbjct  342   -AHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQL-TGSISSSPLVHLTSIEELRLS  399

Query  441   DNYFE---GFETSANHSG---------------SSRHTIRNKSYLEVLHLNNISFDMTKL  566
             +N+F      E   NHS                +  H++  K  L+ L L++   D    
Sbjct  400   NNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTF  459

Query  567   LSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLK  746
                L     +K  EL  + +        L+N + LE L+L   +L   F   I   + L+
Sbjct  460   PKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLR  519

Query  747   VLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSG  926
              L +S     G +P +    L +L    +S N L+G IPS FGN+  L++++LS NKL+G
Sbjct  520   FLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTG  579

Query  927   NIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPK  1106
              I         +LE+LS+ NNS +    F    +   LR +L + N  + +   Q     
Sbjct  580   EIPDHLAMCCVNLEFLSLSNNSLK-GHIFSRIFSLRNLRWLLLEGNHFVGEIP-QSLSKC  637

Query  1107  FQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNN  1286
               L  L L+N     K+PR+L   + L+ + + +N+LEG  P    + ++ LQ   +++N
Sbjct  638   SSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDS-LQILDISDN  696

Query  1287  AFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG  1466
               +GSL  S     +++ +++S N L G++      +  +++ L+LS N  +G +   I 
Sbjct  697   NISGSLP-SCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWID  755

Query  1467  --THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLD  1640
               + L  L+L++N+  GE+P + L   + L +L LS+N L G I   FD  +    LH  
Sbjct  756   GLSQLSHLNLAHNNLEGEVPIQ-LCRLNQLQLLDLSDNNLHGLIPSCFDNTT----LHES  810

Query  1641  GNN----------------------------FEGTIpnslsnlp------lhslDIRDNK  1718
              NN                            FE T  N            L  LD+  NK
Sbjct  811   YNNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNK  870

Query  1719  LSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPS  1898
             L G IP  +G LT +  L LS N+L G IP+ F NL+ +  LDLS N L+G IP      
Sbjct  871   LVGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIP------  924

Query  1899  SIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRF  2078
                              R   +   L I  ++YN+  G IPEW    +  +    +GN F
Sbjct  925   -----------------RQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPF  967

Query  2079  EGKVPTQVCQ  2108
                +P  +C+
Sbjct  968   LCGLPLPICR  977



>ref|XP_006489886.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X5 [Citrus sinensis]
Length=1145

 Score =   372 bits (956),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 298/810 (37%), Positives = 436/810 (54%), Gaps = 102/810 (13%)
 Frame = +3

Query  72    LNNSGNERLTGLINLEELHMRYTQMEEI-------------------NILSVLNLKDFIS  194
             + N G ERL+ L NL+ L++ Y                          +   +++K+F S
Sbjct  119   VENEGLERLSRLNNLKMLNLSYNSFNNSILSSLSRLSSLRSLKLSHNKLEGSIDVKEFDS  178

Query  195   LK---VLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMD  365
             L+    LDIG+N+   F       G +KL+ L L   + N+SI  SL     L+ LD+  
Sbjct  179   LRDLEELDIGWNEIDKFVV---SKGLRKLKSLGLSGTKLNRSILSSLSW---LRELDISY  232

Query  366   NDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNI  545
               F  G   I++ +   NL+ L +S+N  +       + G  +        L+ LHL+ +
Sbjct  233   TGF-KGTFDIREFDSFNNLEVLDMSNNEIDNLVVPQGYRGLRK--------LKSLHLSGV  283

Query  546   SF-DMTKLLSSLAAFPSIKTLELQRVN-VTNIDAIHALKNLSSLEELHLDGSNLHKDFLS  719
                D +KLL S+ +FPS+ TL +   N +    A   L N ++LE L LD S+LH   L 
Sbjct  284   GIRDGSKLLQSIGSFPSLNTLYISWNNFIDTATATQELHNFTNLEYLTLDFSSLHISLLQ  343

Query  720   NIGPM-ESLKVLSLSGAQV-----------------------------------GGTLP-  788
             +I  +  SLK LS+S  +V                                   G ++P 
Sbjct  344   SIASLFPSLKNLSISHCEVNGVLRGQGFPHFKSLEHFDMRFARIALNTSFLQIIGESMPS  403

Query  789   -------------------NKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSL  911
                                ++GLC L +LQEL++  N L G +P    N+TSLR +++S 
Sbjct  404   LKYLLLSYSTLGTNSSRILHQGLCSLVHLQELYIDNNDLRGSLPWCLANMTSLRILDVSS  463

Query  912   NKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQL  1088
             N+L+G+I  SPL  LTS+E L + NN F +  S     N+S+L++  AD N++ A+ T+ 
Sbjct  464   NQLTGSISSSPLVHLTSIEKLDLSNNHFWIPISLEPLFNHSRLKLFYADNNEIKAEITES  523

Query  1089  QGF-VPKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKL  1262
                  P FQL  LSLS+   D +  P+FL++Q DL+ + +S  N+ GEFP+WLL+NNT L
Sbjct  524   HSLTAPNFQLKYLSLSSGYEDGVTFPKFLYHQHDLEYVDLSHINMSGEFPNWLLENNTNL  583

Query  1263  QYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFS  1442
             +Y  + N++  G  +L  H +  L+++++SNN + G I        P + +LN++ N   
Sbjct  584   EYIFLVNDSLAGPFRLPIHSHKRLRLLDISNNNIRGHIPVEIGDVLPGLFSLNIAMNALD  643

Query  1443  GQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLS  1616
             G + S  G    L FLDLSNN  TGEIPK + + C +L  L LSNN LEG +      L+
Sbjct  644   GCIPSSFGNMKFLQFLDLSNNQLTGEIPKHLAVGCVNLESLALSNNNLEGHMFSRNFNLT  703

Query  1617  SLEYLHLDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHL  1793
             +L++L L+ N+F G IP SLS       L + +N LSG+IPRW+G LT L  + +  NHL
Sbjct  704   NLKWLQLESNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHL  763

Query  1794  EGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNT  1970
             EG IP+EFC L+SL ILD+S+NN++GS+PSC +P SIK V LSK+ L GQL R  FFN +
Sbjct  764   EGPIPVEFCQLESLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCS  823

Query  1971  ALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnll  2150
             +LV LDLSYN   G IP+W+  +S+LS L+L  N  EG+VP Q+C+L +L LLDLSNN L
Sbjct  824   SLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNL  883

Query  2151  sGVIPRCLGKISLEGTNEQFRGINLPFEYY  2240
              G+IP C    +L  +       +  FE Y
Sbjct  884   HGLIPPCFDNTTLHESYNNSSSPDEQFEIY  913


 Score =   131 bits (329),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 190/691 (27%), Positives = 297/691 (43%), Gaps = 134/691 (19%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L ++++L LS+N+
Sbjct  432   LQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEKLDLSNNH  490

Query  450   FE---GFETSANHSG---------------SSRHTIRNKSY-LEVLHLNNISFDMTKLLS  572
             F      E   NHS                +  H++   ++ L+ L L++   D      
Sbjct  491   FWIPISLEPLFNHSRLKLFYADNNEIKAEITESHSLTAPNFQLKYLSLSSGYEDGVTFPK  550

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
              L     ++ ++L  +N++       L+N ++LE + L   +L   F   I   + L++L
Sbjct  551   FLYHQHDLEYVDLSHINMSGEFPNWLLENNTNLEYIFLVNDSLAGPFRLPIHSHKRLRLL  610

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S   + G +P +    L  L  L ++ N L+G IPS FGN+  L++++LS N+L+G I
Sbjct  611   DISNNNIRGHIPVEIGDVLPGLFSLNIAMNALDGCIPSSFGNMKFLQFLDLSNNQLTGEI  670

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                      +LE L++ NN+ E     R+F N + L+ +  + N  +      G +P+  
Sbjct  671   PKHLAVGCVNLESLALSNNNLEGHMFSRNF-NLTNLKWLQLESNHFV------GEIPQ--  721

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C               L+ L ++ N+L G+ P WL  N T LQY +M NN  
Sbjct  722   ----SLSKC-------------SSLEGLYLNNNSLSGKIPRWL-GNLTWLQYIIMPNNHL  763

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP--NILALNLSSNLFSGQLH----  1454
              G + +      +LQI+++S+N     ISG+  S F   +I  ++LS N+  GQL     
Sbjct  764   EGPIPVEFCQLESLQILDISDNN----ISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTF  819

Query  1455  ----SLIGTHLGF-------------------LDLSNNSFTGEIPKEMLISCSSLVILKL  1565
                 SL+   L +                   L L +N+  GE+P + L   + L +L L
Sbjct  820   FNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVPIQ-LCELNQLQLLDL  878

Query  1566  SNNKLEGQIVQEFDYLSSLE--------------YLHLDGNN----------FEGT----  1661
             SNN L G I   FD  +  E              Y+ ++G            FE T    
Sbjct  879   SNNNLHGLIPPCFDNTTLHESYNNSSSPDEQFEIYVFIEGPQGGVEKKIHEIFEFTTKNI  938

Query  1662  --IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSL  1835
               I        L  LD+  NKL G IP  +G LT +  L LS ++L G IP  F NLK +
Sbjct  939   AYIYQGKVFSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHHNLTGSIPSTFSNLKHV  998

Query  1836  SILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGI  2015
               LDLS N L G IP               HQL    T        L +  ++YN+  G 
Sbjct  999   ESLDLSNNKLNGKIP---------------HQLVELKT--------LEVFSVAYNNLSGE  1035

Query  2016  IPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
             I EW    +  +     GN F   +P  +C+
Sbjct  1036  ILEWKAQFATFNGSSYEGNTFLCGLPLPICR  1066



>ref|XP_010250309.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Nelumbo nucifera]
Length=1252

 Score =   374 bits (960),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 294/737 (40%), Positives = 418/737 (57%), Gaps = 34/737 (5%)
 Frame = +3

Query  63    NSHLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNK---FQS  233
             NS  N    E LTGL NL+ L + Y ++  I    ++ +++   L + D G N     Q 
Sbjct  246   NSFTNPFSCEELTGLENLQMLDLSYNRLNGIQ--ELVGMENLRKLDLSDSGLNGTIGLQG  303

Query  234   FGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDL  413
             F  ++D    K LE L L     + SI   L    SLK LDL  N+  +G    +++ DL
Sbjct  304   FKHLSDR--LKNLEVLDLSVNSLDTSIIPYLGALKSLKSLDLSWNEM-EGVFPGEELADL  360

Query  414   RNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPS  593
              NL+ L LS N   G              I+    LEVL ++  +F+ T L       P 
Sbjct  361   HNLQMLDLSGNRLNGTPQILG--------IKRLKKLEVLDISGNNFNTTILQYIGLLAPK  412

Query  594   IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQV  773
             IK+L LQ  +++       L  LS LE L L  ++L  DFL NIG M SLK+L ++G Q 
Sbjct  413   IKSLHLQDNDMSGPITNKELGTLSDLEFLDLSDASLSYDFLQNIGEMVSLKLLVMAGIQG  472

Query  774   --GGTLPNKGLCELKNLQELWLSENQ--------LEGKIPSYFGNLTSLRYVNLSLNKLS  923
               G  LP KGLC+L NLQEL L+  +        + G + S  GN+TSLR ++LS N+  
Sbjct  473   LNGIRLPFKGLCKLNNLQELDLNLQEDNSYNNYGVVGDVHSCSGNMTSLRVLDLSYNQFD  532

Query  924   GNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVI-ADTQLQGFV  1100
              NI  S +  LTSL+YL + N  F+ + SF   AN SKL V L + N+++  +T     V
Sbjct  533   ENIVQSIIRGLTSLKYLDLSNIRFQGSFSFNLLANLSKLEVFLFENNQLLQVETDFPAVV  592

Query  1101  PKFQLDSLSLS--NCIDLLKL-PRFLHYQRDLKVLRISRNNLE-GEFPSWLLQNNTKLQY  1268
             P +QL +L L+   C +   L P FLHYQ DL+V+ +S +N    +FP+WLL+NNT L+ 
Sbjct  593   PTYQLKTLYLARFTCNNAPGLMPNFLHYQFDLRVVDLSHSNFNNSQFPTWLLENNTGLEV  652

Query  1269  FLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQ  1448
               + NN+FT +  L S  + NL I+ VS+N   G+I  N    FPN++ L +  N F+G+
Sbjct  653   LSLINNSFTATFVLPSRPHMNLSILIVSHNHFHGQIPDNIGVIFPNLVILKMPKNSFTGK  712

Query  1449  LHSLIGT--HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSL  1622
             + S IG    L   DLS+NS +G+IP  ++I C  L  LKLSNN L+GQ++     L++L
Sbjct  713   IPSSIGNMRWLKLFDLSDNSLSGQIPNHLVIGCLRLCCLKLSNNNLDGQMLPTVANLTTL  772

Query  1623  EYLHLDGNNFEGTIpnslsnl-plhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEG  1799
             +YL LDGN F G IP SLS    L  L++  N ++G +P W G L+ L  L ++ NHLEG
Sbjct  773   KYLFLDGNKFTGNIPYSLSKSFALELLNVSYNNITGRLPGWFGNLSYLEVLIMANNHLEG  832

Query  1800  HIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALV  1979
              +PI FC+L  L+ +DLS+NNL+GSI SC +P  +++    K++  G +T AF  +T LV
Sbjct  833   SLPISFCSLGGLAFVDLSKNNLSGSILSCFSPGGLRYAHFQKNKFQGPMTEAFSKSTNLV  892

Query  1980  ILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGV  2159
              LD+S N   G IP WIG +S L +LLL GN+ EG +P Q+C L ++S++DLS+N LSG 
Sbjct  893   TLDISDNLLNGSIPRWIGNLSSLGALLLKGNQLEGHIPIQLCYLDKISVMDLSHNNLSGP  952

Query  2160  IPRCLGKISLEGTNEQF  2210
             IP CL  ++ E   + F
Sbjct  953   IPCCLKNMTFERVEDPF  969


 Score =   116 bits (290),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 175/706 (25%), Positives = 270/706 (38%), Gaps = 151/706 (21%)
 Frame = +3

Query  219   NKFQSFGPINDV----GGAKKLEELYLFECRFNQSIFQSL-KGFPSLKILDLMDNDFYDG  383
             N + ++G + DV    G    L  L L   +F+++I QS+ +G  SLK LDL  N  + G
Sbjct  500   NSYNNYGVVGDVHSCSGNMTSLRVLDLSYNQFDENIVQSIIRGLTSLKYLDL-SNIRFQG  558

Query  384   PLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKS-YLEVLHLNNISFDMT  560
                   + +L  L+     +N     ET      +   T + K+ YL     NN    M 
Sbjct  559   SFSFNLLANLSKLEVFLFENNQLLQVETDF---PAVVPTYQLKTLYLARFTCNNAPGLMP  615

Query  561   KLLSSLAAFPSIKTLELQRVNVTNID-AIHALKNLSSLEELHLDGSNLHKDFLSNIGPME  737
               L        ++ ++L   N  N       L+N + LE L L  ++    F+    P  
Sbjct  616   NFLHYQF---DLRVVDLSHSNFNNSQFPTWLLENNTGLEVLSLINNSFTATFVLPSRPHM  672

Query  738   SLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNK  917
             +L +L +S     G +P+       NL  L + +N   GKIPS  GN+  L+  +LS N 
Sbjct  673   NLSILIVSHNHFHGQIPDNIGVIFPNLVILKMPKNSFTGKIPSSIGNMRWLKLFDLSDNS  732

Query  918   LSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGF  1097
             LSG I    +     L  L + NN+ +      + AN + L+ +  D NK   +      
Sbjct  733   LSGQIPNHLVIGCLRLCCLKLSNNNLD-GQMLPTVANLTTLKYLFLDGNKFTGN------  785

Query  1098  VPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLM  1277
                                +P  L     L++L +S NN+ G  P W   N + L+  +M
Sbjct  786   -------------------IPYSLSKSFALELLNVSYNNITGRLPGWF-GNLSYLEVLIM  825

Query  1278  NNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFS----------------------  1391
              NN   GSL +S      L  +++S N L G I   FS                      
Sbjct  826   ANNHLEGSLPISFCSLGGLAFVDLSKNNLSGSILSCFSPGGLRYAHFQKNKFQGPMTEAF  885

Query  1392  SSFPNILALNLSSNLFSGQLHSLIGT--------------------------HLGFLDLS  1493
             S   N++ L++S NL +G +   IG                            +  +DLS
Sbjct  886   SKSTNLVTLDISDNLLNGSIPRWIGNLSSLGALLLKGNQLEGHIPIQLCYLDKISVMDLS  945

Query  1494  NNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI-------------------------VQ  1598
             +N+ +G IP      C   +  +   +  +  I                         ++
Sbjct  946   HNNLSGPIP-----CCLKNMTFERVEDPFDASIRFNVIRYGKGFIRNLFCLPYKYQSRLK  1000

Query  1599  EFD--------YLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRL  1754
             EF         Y S++E +     N    +   +    +  LD+  N+L+G+IP  +G L
Sbjct  1001  EFQPNQQHYGVYESNMEQVEFTTKN-RYDVYKGIVLGLMLGLDLSCNQLTGDIPPEIGEL  1059

Query  1755  TSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQL  1934
               +  L LS NHL GHIP    NLK L  LDLS NNL GS+P                  
Sbjct  1060  YGIRALNLSHNHLTGHIPTTISNLKQLESLDLSCNNLVGSVPP-----------------  1102

Query  1935  SGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGN  2072
               Q+   +F +T +V    ++N+  G IPE  G           GN
Sbjct  1103  --QMMDLYFLSTFMV----AHNNLSGKIPERKGQFITFGESSYEGN  1142


 Score = 88.6 bits (218),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 211/776 (27%), Positives = 319/776 (41%), Gaps = 143/776 (18%)
 Frame = +3

Query  144   MEEINILSVLNLKDFIS---LKVLDI------GFNKFQSFGPINDVGGAKKLEELYLFEC  296
             M E   L  LN   F+S   L+ LD+      GF + Q   P++ +   KKLE L L   
Sbjct  89    MNEYTYLVGLNASLFLSFEELQHLDLSENSLEGFVENQGLKPLSRL---KKLEVLDLSSN  145

Query  297   RFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSAN  476
              FN +I  SL    SLK L L  N F + P   +++  L  L+ L LS N   G      
Sbjct  146   FFNNNILPSLGSLKSLKNLSLSTNSFTN-PFPYEELAGLEKLQMLDLSGNRLNG-----T  199

Query  477   HSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALK  656
                     +     L +L L+N   D   +L SL    S+K L L   + TN  +   L 
Sbjct  200   PGLQGLEPLGKWKKLAILDLSNNGLD-NSILPSLGLLKSLKNLSLHGNSFTNPFSCEELT  258

Query  657   NLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLC----ELKNLQE  824
              L +L+ L L  + L+   +  +  ME+L+ L LS + + GT+  +G       LKNL+ 
Sbjct  259   GLENLQMLDLSYNRLNG--IQELVGMENLRKLDLSDSGLNGTIGLQGFKHLSDRLKNLEV  316

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
             L LS N L+  I  Y G L SL+ ++LS N++ G      L+ L +L+ L +  N     
Sbjct  317   LDLSVNSLDTSIIPYLGALKSLKSLDLSWNEMEGVFPGEELADLHNLQMLDLSGNRLNGT  376

Query  1005  SSFRSFANNSKLRVI-LADRNKVIADTQLQGFV-PKFQLDSLSLS-NCIDLLKLPRFLHY  1175
                       KL V+ ++  N      Q  G + PK +  SL L  N +      + L  
Sbjct  377   PQILGIKRLKKLEVLDISGNNFNTTILQYIGLLAPKIK--SLHLQDNDMSGPITNKELGT  434

Query  1176  QRDLKVLRISRNNLE-------GEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSS--HVNP  1328
               DL+ L +S  +L        GE  S  L     +Q        F G  KL++   ++ 
Sbjct  435   LSDLEFLDLSDASLSYDFLQNIGEMVSLKLLVMAGIQGLNGIRLPFKGLCKLNNLQELDL  494

Query  1329  NLQIINVSNN-KLCGEI---SGNFSSSFPNILALNLSSNLFSGQL-HSLIG--THLGFLD  1487
             NLQ  N  NN  + G++   SGN +S    +  L+LS N F   +  S+I   T L +LD
Sbjct  495   NLQEDNSYNNYGVVGDVHSCSGNMTS----LRVLDLSYNQFDENIVQSIIRGLTSLKYLD  550

Query  1488  LSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDY------LSSLEYLHLDGNN  1649
             LSN  F G     +L + S L +    NN+L  Q+  +F        L +L       NN
Sbjct  551   LSNIRFQGSFSFNLLANLSKLEVFLFENNQLL-QVETDFPAVVPTYQLKTLYLARFTCNN  609

Query  1650  FEGTIpnslsnlplhslDIRDNKLS------GEIPRWM------GRLTSLVQ--------  1769
               G +     N   +  D+R   LS       + P W+        + SL+         
Sbjct  610   APGLM----PNFLHYQFDLRVVDLSHSNFNNSQFPTWLLENNTGLEVLSLINNSFTATFV  665

Query  1770  -----------LTLSKNHLEGH-------------------------IPIEFCNLKSLSI  1841
                        L +S NH  G                          IP    N++ L +
Sbjct  666   LPSRPHMNLSILIVSHNHFHGQIPDNIGVIFPNLVILKMPKNSFTGKIPSSIGNMRWLKL  725

Query  1842  LDLSENNLTGSIP-----SCL---------------------NPSSIKHVSLSKHQLSGQ  1943
              DLS+N+L+G IP      CL                     N +++K++ L  ++ +G 
Sbjct  726   FDLSDNSLSGQIPNHLVIGCLRLCCLKLSNNNLDGQMLPTVANLTTLKYLFLDGNKFTGN  785

Query  1944  LTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQL  2111
             +  +   + AL +L++SYN+  G +P W G +S L  L++  N  EG +P   C L
Sbjct  786   IPYSLSKSFALELLNVSYNNITGRLPGWFGNLSYLEVLIMANNHLEGSLPISFCSL  841



>ref|XP_011015513.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X2 [Populus euphratica]
Length=803

 Score =   364 bits (934),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 251/603 (42%), Positives = 363/603 (60%), Gaps = 40/603 (7%)
 Frame = +3

Query  657   NLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLS  836
             N S+LEELHLD + L  +FL NIG + +LKVLS++   + GTLP +G CELKNL++L LS
Sbjct  15    NSSTLEELHLDRTPLLINFLQNIGALPALKVLSVAECDLHGTLPAQGWCELKNLKQLDLS  74

Query  837   ENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFR  1016
              N L G +P   GNL+SL+ +++S N+ +GNI   PL+ L SLE+LS+ NN FEV +S +
Sbjct  75    GNNLGGSLPDCLGNLSSLQLLDVSNNQFTGNIAFGPLTNLISLEFLSLSNNLFEVPTSMK  134

Query  1017  SFANNSKLRVILADRNKVIAD-TQLQGFVPKFQLDSLSLSNCIDL----LKLPRFLHYQR  1181
              F N+S L+   ++ N+++ +        PKFQL    LS+        +++P FL+YQ 
Sbjct  135   PFMNHSSLKFFSSENNRLVTEPAAFDNLTPKFQLLFFRLSSSPTSEALNVEIPDFLYYQY  194

Query  1182  DLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNK  1361
             DL+VL +S NN+ G FPSWLL+NNT+++   ++ N+F G+L+L  H+ PN+  +++SNN 
Sbjct  195   DLRVLDLSHNNITGMFPSWLLKNNTRMEQLYLSENSFVGTLQLQDHLYPNMTALDISNNN  254

Query  1362  LCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLI  1535
             + G+I  +    FPN+  L ++ N F+G + S +G  + LG LDLSNN  +  +  E+L 
Sbjct  255   MHGQIPKDICLIFPNLENLWMAKNGFTGCIPSCLGNISSLGVLDLSNNQLS-TVKLELL-  312

Query  1536  SCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlp--lhslDIR  1709
               ++   LKLSNN L GQI       S+L++L+L GNNF G I +   N       LD+ 
Sbjct  313   --TTTWFLKLSNNNLSGQIPTSLFNSSTLQFLYLSGNNFWGQISDFPLNAWNNWVVLDLS  370

Query  1710  DNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL  1889
              N+  G +P W    T+L  + LSKNH  G IP +FC L  +  LDLSENNL+G IPSC 
Sbjct  371   HNQFLGMLPTWFVNSTTLGAIDLSKNHFIGPIPRDFCKLDQVEYLDLSENNLSGYIPSCF  430

Query  1890  NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNG  2069
             +P  + HV LSK++LSG LT  FFN++ LV +DL  NSF G IP WIG  S LS LLL  
Sbjct  431   SPPPLTHVHLSKNRLSGPLTYGFFNSSYLVTMDLRDNSFTGSIPNWIGNHSSLSVLLLRA  490

Query  2070  NRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQ-FRGINLPFEYYSI  2246
             N F+G++P Q+C L +LS+LD+S N LSG +P CLG ++ + ++ + F G+   F   S+
Sbjct  491   NHFDGELPVQLCLLEQLSILDVSQNQLSGPLPSCLGNLTFKKSSHKVFAGLVAAFGSSSL  550

Query  2247  NDAILDRLHYEWGSDDEYI----PMLA-----------VDVLPEV-QFRTKGNLYNYQNS  2378
                       EW ++  Y     P+L            ++   EV +F TK   Y Y   
Sbjct  551   ----------EWSTEKAYYEAMGPLLVDSMNNLGKYILLNFTEEVIEFTTKNMYYGYTGK  600

Query  2379  ILK  2387
             +L 
Sbjct  601   VLS  603


 Score =   119 bits (299),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 187/740 (25%), Positives = 301/740 (41%), Gaps = 134/740 (18%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             LEELH+  T +  IN L   N+    +LKVL +         P       K L++L L  
Sbjct  19    LEELHLDRTPLL-INFLQ--NIGALPALKVLSVAECDLHGTLPAQGWCELKNLKQLDLSG  75

Query  294   CRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---GFE  464
                  S+   L    SL++LD+ +N F  G +    + +L +L+ L LS+N FE     +
Sbjct  76    NNLGGSLPDCLGNLSSLQLLDVSNNQF-TGNIAFGPLTNLISLEFLSLSNNLFEVPTSMK  134

Query  465   TSANHSGSSRHTIRNKSYL-EVLHLNNISFDMTKLLSSLAAFPS----------------  593
                NHS     +  N   + E    +N++     L   L++ P+                
Sbjct  135   PFMNHSSLKFFSSENNRLVTEPAAFDNLTPKFQLLFFRLSSSPTSEALNVEIPDFLYYQY  194

Query  594   -IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQ  770
              ++ L+L   N+T +     LKN + +E+L+L  ++             ++  L +S   
Sbjct  195   DLRVLDLSHNNITGMFPSWLLKNNTRMEQLYLSENSFVGTLQLQDHLYPNMTALDISNNN  254

Query  771   VGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
             + G +P        NL+ LW+++N   G IPS  GN++SL  ++LS N+LS       L 
Sbjct  255   MHGQIPKDICLIFPNLENLWMAKNGFTGCIPSCLGNISSLGVLDLSNNQLS----TVKLE  310

Query  951   tltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSL  1130
              LT+  +L + NN+        S  N+S L+ +    N         G +  F L++   
Sbjct  311   LLTTTWFLKLSNNNLS-GQIPTSLFNSSTLQFLYLSGNN------FWGQISDFPLNA---  360

Query  1131  SNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKL  1310
                              +  VL +S N   G  P+W + N+T L    ++ N F G +  
Sbjct  361   ---------------WNNWVVLDLSHNQFLGMLPTWFV-NSTTLGAIDLSKNHFIGPIPR  404

Query  1311  SSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHS--LIGTHLGFL  1484
                    ++ +++S N L G I   FS   P +  ++LS N  SG L       ++L  +
Sbjct  405   DFCKLDQVEYLDLSENNLSGYIPSCFSP--PPLTHVHLSKNRLSGPLTYGFFNSSYLVTM  462

Query  1485  DLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI  1664
             DL +NSFTG IP   + + SSL +L L  N  +G++  +   L  L  L           
Sbjct  463   DLRDNSFTGSIPN-WIGNHSSLSVLLLRANHFDGELPVQLCLLEQLSIL-----------  510

Query  1665  pnslsnlplhslDIRDNKLSGEIPRWMGRLT------------------SLVQLTLSKNH  1790
                         D+  N+LSG +P  +G LT                  S ++ +  K +
Sbjct  511   ------------DVSQNQLSGPLPSCLGNLTFKKSSHKVFAGLVAAFGSSSLEWSTEKAY  558

Query  1791  LEGHIP---------------------IEFCN-----------LKSLSILDLSENNLTGS  1874
              E   P                     IEF             L  ++ +DLS NN  G+
Sbjct  559   YEAMGPLLVDSMNNLGKYILLNFTEEVIEFTTKNMYYGYTGKVLSYMNGIDLSNNNFVGA  618

Query  1875  IPSCL-NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrls  2051
             IP    N S I  ++LS + L+G +   F N   +  LDLSYN+  G+IP  +  I+ L 
Sbjct  619   IPPEFGNLSEILSLNLSHNNLTGSIPPIFSNLKQIESLDLSYNNLNGVIPPQLIEITSLE  678

Query  2052  slllNGNRFEGKVPTQVCQL  2111
                +  N   G+ P +  Q 
Sbjct  679   VFSVAHNNLSGRTPERKYQF  698



>gb|KDO40874.1| hypothetical protein CISIN_1g001036mg [Citrus sinensis]
Length=1180

 Score =   372 bits (956),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 276/709 (39%), Positives = 392/709 (55%), Gaps = 39/709 (6%)
 Frame = +3

Query  303   NQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHS  482
             N  + +  +G   LK LDL      DG   +Q +    +L  L+L  N F    T+    
Sbjct  298   NVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTT---  354

Query  483   GSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNL  662
                   + N + LE L L++ S  ++ L S  + FPS+K L +    V  + +     + 
Sbjct  355   ----QELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHF  410

Query  663   SSLEELHLDGSN--LHKDFLSNIG-PMESLKVLSLSGAQVG---GTLPNKGLCELKNLQE  824
              SLE L +  +   L+  FL  IG  M SLK LSLSG+ +G     + ++GLC L +LQE
Sbjct  411   KSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQE  470

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
             L++  N L G +P    N TSLR +++S N+L+G+I  SPL  LTS+E L + NN F + 
Sbjct  471   LYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIP  530

Query  1005  SSFRSFANNSKLRVILADRNKVIADT-QLQGFVPKFQLDSLSLS-NCIDLLKLPRFLHYQ  1178
              S     N+SKL++  A  N++  +  +     PKFQL SLSLS N  D +  P+FL++Q
Sbjct  531   VSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQ  590

Query  1179  RDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNN  1358
              +LK   +S   + GEFP+WLL+NNTKL++  + N++  G  +L  H +  L+ ++VSNN
Sbjct  591   HELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNN  650

Query  1359  KLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEML  1532
                G I        P+++  N+S N   G + S  G    L FLDLSNN  TGEIP  + 
Sbjct  651   NFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLA  710

Query  1533  ISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhslDIR  1709
             + C +L  L LSNN L+G I      L +L +L L+GN+F G I  +      L  L + 
Sbjct  711   MCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLN  770

Query  1710  DNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL  1889
             +N LSG+IPRW+G L  L  + + KNHLEG IP+EFC L SL ILD+S+NN++GS+PSC 
Sbjct  771   NNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCF  830

Query  1890  NPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllN  2066
              P SIK V LSK+ L GQL    FFN ++LV LDLSYN   G IP+WI  +S+LS L L 
Sbjct  831   YPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLA  890

Query  2067  GNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEY-YS  2243
              N  EG+VP Q+C+L +L LLDLS+N L G+IP C    +L  +       + PF+  +S
Sbjct  891   HNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFS  950

Query  2244  INDAILDRLHYEWGSDDEYIPMLAVD--VLPEVQFRTKGNLYNYQNSIL  2384
             I+                  P  +V+  +L   +F TK   Y YQ  +L
Sbjct  951   ISG-----------------PQGSVEKKILEIFEFTTKNIAYAYQGRVL  982


 Score =   142 bits (357),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 201/729 (28%), Positives = 320/729 (44%), Gaps = 104/729 (14%)
 Frame = +3

Query  114   LEELHMRYTQME------EINILSVLNLKDFISLKVLDIGFNKF----QSFGPINDVGGA  263
             LE L MR+ ++       +I   S+ +LK ++SL    +G N      Q   P+      
Sbjct  413   LEHLDMRFARIALNTSFLQIIGESMPSLK-YLSLSGSTLGTNSSRILDQGLCPL------  465

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
               L+ELY+       S+   L    SL+ILD+  N    G +    +  L +++EL LS+
Sbjct  466   AHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQL-TGSISSSPLVHLTSIEELRLSN  524

Query  444   NYFE---GFETSANHSG---------------SSRHTIRNKSYLEVLHLNNISFDMTKLL  569
             N+F      E   NHS                +  H++  K  L+ L L++   D     
Sbjct  525   NHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFP  584

Query  570   SSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKV  749
               L     +K  EL  + +        L+N + LE L+L   +L   F   I   + L+ 
Sbjct  585   KFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRF  644

Query  750   LSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGN  929
             L +S     G +P +    L +L    +S N L+G IPS FGN+  L++++LS NKL+G 
Sbjct  645   LDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGE  704

Query  930   IelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKF  1109
             I         +LE+LS+ NNS +     R F+  + LR +L + N  + +   Q      
Sbjct  705   IPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRN-LRWLLLEGNHFVGEIP-QSLSKCS  762

Query  1110  QLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNA  1289
              L  L L+N     K+PR+L   + L+ + + +N+LEG  P    + ++ LQ   +++N 
Sbjct  763   SLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDS-LQILDISDNN  821

Query  1290  FTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG-  1466
              +GSL  S     +++ +++S N L G++      +  +++ L+LS N  +G +   I  
Sbjct  822   ISGSLP-SCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDG  880

Query  1467  -THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDG  1643
              + L  L+L++N+  GE+P + L   + L +L LS+N L G I   FD  +    LH   
Sbjct  881   LSQLSHLNLAHNNLEGEVPIQ-LCRLNQLQLLDLSDNNLHGLIPSCFDNTT----LHESY  935

Query  1644  NN----------------------------FEGTIpnslsnlp------lhslDIRDNKL  1721
             NN                            FE T  N            L  LD+  NKL
Sbjct  936   NNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKL  995

Query  1722  SGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSS  1901
              G IP  +G LT +  L LS N+L G IP+ F NL+ +  LDLS N L+G IP       
Sbjct  996   VGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIP-------  1048

Query  1902  IKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFE  2081
                             R   +   L I  ++YN+  G IPEW    +  +    +GN F 
Sbjct  1049  ----------------RQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFL  1092

Query  2082  GKVPTQVCQ  2108
               +P  +C+
Sbjct  1093  CGLPLPICR  1101


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 155/614 (25%), Positives = 259/614 (42%), Gaps = 103/614 (17%)
 Frame = +3

Query  642   IHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQ  821
             +  L +L  LEEL + G+ + K F+ + G +  LK L LSG    GT   +      NL+
Sbjct  153   VKELDSLRDLEELDIGGNKIDK-FMVSKG-LSKLKSLGLSGTGFKGTFDVREFDSFNNLE  210

Query  822   ELWLSENQLEG-KIP---SYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNN  989
              L +S N+++   +P        L+ L+ ++L  N L  N  LS ++ L+SL  L + +N
Sbjct  211   VLDMSGNEIDNLVVPQGLERLSRLSKLKKLDLRGN-LCNNSILSSVARLSSLTSLHLSHN  269

Query  990   SFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNC--IDLLKLPR  1163
               + +   + F + S L  +  + N++      +G+    +L SL LS     D  KL +
Sbjct  270   ILQGSIDAKEFDSLSNLEELDINDNEIDNVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQ  329

Query  1164  FLHYQRDLKVLRISRNNLEGEFPSWL-LQNNTKLQYFLMNNNAFTGSLKLS-SHVNPNLQ  1337
              +     L  L +  NN      +   L N T L+Y  +++++   SL  S   + P+L+
Sbjct  330   SMGSFPSLNTLHLESNNFTATLTTTQELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLK  389

Query  1338  IINVSNNKLCGEISGN-------------------FSSSFPNILALNLSSNLFSGQLHSL  1460
              +++S  ++ G +SG                     ++SF  I+  ++ S  +     S 
Sbjct  390   NLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGST  449

Query  1461  IGT--------------HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ  1598
             +GT              HL  L + NN   G +P   L + +SL IL +S N+L G I  
Sbjct  450   LGTNSSRILDQGLCPLAHLQELYIDNNDLRGSLPW-CLANTTSLRILDVSFNQLTGSISS  508

Query  1599  E-FDYLSSLEYLHLDGNNFE--GTIpnslsnlplhslDIRDNKLSGEI------------  1733
                 +L+S+E L L  N+F    ++    ++  L   D ++N+++GEI            
Sbjct  509   SPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQL  568

Query  1734  ---------------PRWMGRLTSLVQLTLSKNHLEGHIP---------IEFCNL-----  1826
                            P+++     L +  LS   + G  P         +EF  L     
Sbjct  569   KSLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSL  628

Query  1827  -----------KSLSILDLSENNLTGSIPSCLNP--SSIKHVSLSKHQLSGQLTRAFFNN  1967
                        K L  LD+S NN  G IP  +     S+ + ++S + L G +  +F N 
Sbjct  629   AGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNV  688

Query  1968  TALVILDLSYNSFVGIIPEWIG-TIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnn  2144
               L  LDLS N   G IP+ +      L  L L+ N  +G + +++  L  L  L L  N
Sbjct  689   IFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGN  748

Query  2145  llsGVIPRCLGKIS  2186
                G IP+ L K S
Sbjct  749   HFVGEIPQSLSKCS  762



>ref|XP_006382336.1| hypothetical protein POPTR_0005s01150g [Populus trichocarpa]
 gb|ERP60133.1| hypothetical protein POPTR_0005s01150g [Populus trichocarpa]
Length=1179

 Score =   370 bits (951),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 284/723 (39%), Positives = 404/723 (56%), Gaps = 60/723 (8%)
 Frame = +3

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
             +KLE L L   + N SI  +L GFPSLK L+L  N      L    IN LR L       
Sbjct  290   RKLENLDLSYNKLNDSILSNLCGFPSLKSLNLSGNIL----LRSTAINGLRKL-------  338

Query  444   NYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVN  623
                                       EVL L+ ++   + LL SL A PS+KTL LQ  N
Sbjct  339   --------------------------EVLGLDKLTIIGSFLLQSLGALPSLKTLSLQETN  372

Query  624   VTNIDAIHA-LKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGL  800
             ++          N + LEEL+LD + L  +FL NIGP+ +LKVLS+    + GTL  +G 
Sbjct  373   LSRTSISQGTFFNSTILEELYLDHTALPINFLQNIGPLPALKVLSVGECDLHGTLLAQGC  432

Query  801   CELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsI  980
             CELKNL++L LS N LEG +P    NL+SL+ +++S N+ +GN    PL+ + SLE+LS+
Sbjct  433   CELKNLEQLDLSGNNLEGSLPDCLKNLSSLKLLDVSGNQFTGNFTSGPLTNIISLEFLSL  492

Query  981   MNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQGFVPKFQLDSLSLSNCIDL---  1148
              NN FEV  S + F N+S L+   +D N ++ + T     +PKFQL   SLSN       
Sbjct  493   SNNHFEVPISMKPFMNHSSLKFFSSDNNILVTEPTAFHNLIPKFQLVYFSLSNSSTSEAL  552

Query  1149  -LKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVN  1325
              L++  FL+ Q +L+ L +S  N  G FPSWLL+NNT+L+   ++ N+F G+L+L  H N
Sbjct  553   NLEIFSFLYNQYNLRFLDLSHINFSGMFPSWLLKNNTRLEQLFLSENSFVGTLQLQDHPN  612

Query  1326  PNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNN  1499
             P++ I+++SNN + G+   +    FPN++ L ++ N  +G + S +G  + L  LDLS+N
Sbjct  613   PHMTILDISNNNMRGQFPKHICLMFPNLVTLRMAKNGITGCIPSCLGNISSLRDLDLSSN  672

Query  1500  SFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpn--s  1673
                 ++    L   ++L  L LS N L GQ+       ++L YL L GN F G I +  S
Sbjct  673   ----QLSTVKLEQFTTLTFLDLSKNNLGGQLPVSVVNSTTLNYLCLSGNKFWGQITDFPS  728

Query  1674  lsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLS  1853
             L      +L + +N+ SG +PRW    T L  L LSKNH +G IPI+FC L  L  LDLS
Sbjct  729   LLKKKWAALGLSNNQFSGMLPRWFVNSTQLRTLDLSKNHFKGPIPIDFCKLDGLKYLDLS  788

Query  1854  ENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIG  2033
             EN L GSIPSC NP +I HV LSK++LSG LT  F N+++LV LDL  N+F   IP W G
Sbjct  789   ENKLFGSIPSCFNPPNITHVHLSKNRLSGPLTYGFHNSSSLVTLDLRDNNFTSTIPNWFG  848

Query  2034  TIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISL-EGTNEQF  2210
              +S L+ LLL  N F+G+ P Q+C L +LS+LD+S N LSG +P CLG ++  E + +  
Sbjct  849   NLSTLNVLLLRANHFDGEFPVQLCFLEQLSILDVSQNQLSGPLPSCLGNLTFKESSKKAL  908

Query  2211  RGINLPFEYYSINDAILDRLHYE-----WGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQN  2375
               + + F   SI  A  + +        +  D  Y+P+   +V   ++F TK   Y+Y+ 
Sbjct  909   VYLGIVFSSRSIRKAYYETMGPPLVESIYNLDSSYLPITIEEV---IEFATKSMYYSYKG  965

Query  2376  SIL  2384
              IL
Sbjct  966   KIL  968


 Score =   112 bits (280),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 193/742 (26%), Positives = 302/742 (41%), Gaps = 142/742 (19%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             LEEL++ +T +  IN L   N+    +LKVL +G                K LE+L L  
Sbjct  389   LEELYLDHTALP-INFLQ--NIGPLPALKVLSVGECDLHGTLLAQGCCELKNLEQLDLSG  445

Query  294   CRFNQSIFQSLKGFPSLKILDLMDN----DFYDGPLHIQDINDLRNLKELYLSDNYFE--  455
                  S+   LK   SLK+LD+  N    +F  GPL      ++ +L+ L LS+N+FE  
Sbjct  446   NNLEGSLPDCLKNLSSLKLLDVSGNQFTGNFTSGPL-----TNIISLEFLSLSNNHFEVP  500

Query  456   -GFETSANHSG---------------SSRHTIRNKSYLEVLHLNNISFDMT---KLLSSL  578
                +   NHS                ++ H +  K  L    L+N S       ++ S L
Sbjct  501   ISMKPFMNHSSLKFFSSDNNILVTEPTAFHNLIPKFQLVYFSLSNSSTSEALNLEIFSFL  560

Query  579   AAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSL  758
                 +++ L+L  +N + +     LKN + LE+L L  ++          P   + +L +
Sbjct  561   YNQYNLRFLDLSHINFSGMFPSWLLKNNTRLEQLFLSENSFVGTLQLQDHPNPHMTILDI  620

Query  759   SGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
             S   + G  P        NL  L +++N + G IPS  GN++SLR ++LS N+LS     
Sbjct  621   SNNNMRGQFPKHICLMFPNLVTLRMAKNGITGCIPSCLGNISSLRDLDLSSNQLSTVKLE  680

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLD  1118
                +        + +     V     S  N++ L  +    NK     Q+  F       
Sbjct  681   QFTTLTFLDLSKNNLGGQLPV-----SVVNSTTLNYLCLSGNKFWG--QITDF-------  726

Query  1119  SLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTG  1298
                          P  L  ++    L +S N   G  P W + N+T+L+   ++ N F G
Sbjct  727   -------------PSLL--KKKWAALGLSNNQFSGMLPRWFV-NSTQLRTLDLSKNHFKG  770

Query  1299  SLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTH--  1472
              + +       L+ +++S NKL G I   F+   PNI  ++LS N  SG L    G H  
Sbjct  771   PIPIDFCKLDGLKYLDLSENKLFGSIPSCFNP--PNITHVHLSKNRLSGPLT--YGFHNS  826

Query  1473  --LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGN  1646
               L  LDL +N+FT  IP     + S+L +L L  N  +G+   +  +L  L  L     
Sbjct  827   SSLVTLDLRDNNFTSTIPN-WFGNLSTLNVLLLRANHFDGEFPVQLCFLEQLSIL-----  880

Query  1647  NFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLT-------SLVQL-------TLSK  1784
                               D+  N+LSG +P  +G LT       +LV L       ++ K
Sbjct  881   ------------------DVSQNQLSGPLPSCLGNLTFKESSKKALVYLGIVFSSRSIRK  922

Query  1785  NHLEGHIP---------------------IEFCN-----------LKSLSILDLSENNLT  1868
              + E   P                     IEF             L  +S +DLS NN  
Sbjct  923   AYYETMGPPLVESIYNLDSSYLPITIEEVIEFATKSMYYSYKGKILSFMSGIDLSNNNFF  982

Query  1869  GSIPSCL-NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsr  2045
             G+IP  L N S +  ++LS + L+G +   F N   +  LDLSYN+  G+IP  +  ++ 
Sbjct  983   GAIPPKLGNLSEVHSLNLSHNYLTGSIPATFSNLKQIESLDLSYNNLNGVIPPQLTVLNT  1042

Query  2046  lsslllNGNRFEGKVPTQVCQL  2111
             L    +  N   G+ P +  Q 
Sbjct  1043  LEVFSVAHNNLSGETPERKYQF  1064



>ref|XP_010250260.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 isoform X2 [Nelumbo nucifera]
Length=1051

 Score =   366 bits (940),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 293/737 (40%), Positives = 418/737 (57%), Gaps = 39/737 (5%)
 Frame = +3

Query  258   GAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYL  437
             G KKL+ L L + + N SI   L    SL+ L L  N+  +G L +++ + LRNLK L L
Sbjct  136   GLKKLQVLNLSDNQLNSSILPFLGALTSLETLSLRSNEL-EGSLPLREFSQLRNLKILDL  194

Query  438   SDNYFEGFETSANHSGSSR----------HTIRNKSYLEVLHLNNISFDMTKLLSSLAAF  587
             S N       +   + + R            ++  S LE L L+   FD + +L  + AF
Sbjct  195   SQNRLGSGSLTIQGNFTKRTVQYTRLPPIQGVKRLSKLERLDLSENHFDKS-ILKFVGAF  253

Query  588   PSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGA  767
             PS+ TL L    +    + HAL+ LS LE L L  ++       +IG + SLK LSL+  
Sbjct  254   PSLNTLSLGSNGMEGSLSAHALEALSKLEILDLSYNSFTWSIPPSIGNLSSLKHLSLAYN  313

Query  768   QVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspl  947
             +  G+LP +GLC+LK+LQ+L L  N  EG IPS   NLTSLR ++LS N+L G+I  S +
Sbjct  314   RFNGSLPIQGLCKLKSLQDLVLGGNSFEGVIPSCLSNLTSLRMLDLSENQLRGSIPSSLI  373

Query  948   stltsleylsIMNNSFEVASSFRSFANNSKLRVIL--ADRNKVIADTQLQGFVPKFQLDS  1121
             ++LTSLEY+S+ NN+FE A  F SFAN+S+L V+   +  NK+   T+   +VP FQL  
Sbjct  374   TSLTSLEYISLENNNFEGAFWFGSFANSSRLEVVKLSSGGNKLEVQTEYPSWVPSFQLKV  433

Query  1122  LSLSNCIDLLK----LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNA  1289
             L L+NC +L K    +P+FL  Q DL+ + +S N+L G  PSWLL N TKL+   + NN+
Sbjct  434   LVLTNC-NLNKPAGIIPKFLSLQYDLREIDLSHNSLRGNLPSWLLHNKTKLELLNVQNNS  492

Query  1290  FTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG-  1466
              TG L L+S ++ N+  + +S N   G++  N     PN+  L+ S N F G + S IG 
Sbjct  493   LTGHLNLTSRLSLNISWLFISENHFHGQLPANIGEVLPNLEVLHASQNNFEGSIPSSIGE  552

Query  1467  -THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDG  1643
               +L  LDLSNN+F+GEIP+++ I C SLV LKLSNNKL+GQI  +   L+ L  L+LDG
Sbjct  553   MRNLFTLDLSNNNFSGEIPEQLAIGCQSLVSLKLSNNKLQGQIFPKLSNLTRLIELYLDG  612

Query  1644  NNFEG-TIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFC  1820
             N+F G  +  +     L  LDI +N +SG+IP W+G  T LV L +  N  EGHIP E  
Sbjct  613   NHFSGNALNGAYEGFLLVRLDIGNNYISGKIPSWIGNFTGLVTLDMRDNLFEGHIPTEIG  672

Query  1821  NLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSG-QLTRAFFNNTALVILDLSY  1997
             NLK L +LDLS N L+G IP   +  S++ + L ++   G        ++++LV LD+  
Sbjct  673   NLKELYLLDLSGNFLSGPIPLSSDSPSLRFIHLGRNGFRGSLPISLLNSSSSLVTLDIGG  732

Query  1998  NSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLG  2177
             N+F G IP WIG  S L  LL  GN  +G +P Q+CQL ++ ++DLSNN +SG IP+C  
Sbjct  733   NNFSGHIPYWIGEFSELRILLFEGNNLQGPIPPQLCQLKKIRIMDLSNNTISGSIPKCFS  792

Query  2178  KISLEGTNEQFRGINLPFEYYSINDAILDRL---HYEWGS----DDEYIPMLAVDVLPE-  2333
              I       +FR      EY  +      R     Y++ S    +++Y      +  PE 
Sbjct  793   DIPF--GRSEFR------EYMFMETGAGTRYSLQSYKYQSVVEGNNDYDADEVFENKPEK  844

Query  2334  VQFRTKGNLYNYQNSIL  2384
             V+F TK    +Y+ SIL
Sbjct  845   VKFTTKRRSNSYEGSIL  861


 Score =   115 bits (288),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 186/673 (28%), Positives = 278/673 (41%), Gaps = 98/673 (15%)
 Frame = +3

Query  96    LTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLE  275
             L  L  LE L + Y         S+ NL    SLK L + +N+F    PI  +   K L+
Sbjct  275   LEALSKLEILDLSYNSFTWSIPPSIGNLS---SLKHLSLAYNRFNGSLPIQGLCKLKSLQ  331

Query  276   ELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE  455
             +L L    F   I   L    SL++LDL +N    G +    I  L +L+ + L +N FE
Sbjct  332   DLVLGGNSFEGVIPSCLSNLTSLRMLDLSENQL-RGSIPSSLITSLTSLEYISLENNNFE  390

Query  456   G---FETSAN---------HSGSSRHTIRNK--SYLEVLHLNNISFDMTKLLSSLAAFPS  593
             G   F + AN          SG ++  ++ +  S++    L  +      L       P 
Sbjct  391   GAFWFGSFANSSRLEVVKLSSGGNKLEVQTEYPSWVPSFQLKVLVLTNCNLNKPAGIIP-  449

Query  594   IKTLELQRVNVTNIDAIH----------ALKNLSSLEELHLDGSNLHKDFLSNIGPMESL  743
              K L LQ  ++  ID  H           L N + LE L++  ++L      N+    SL
Sbjct  450   -KFLSLQ-YDLREIDLSHNSLRGNLPSWLLHNKTKLELLNVQNNSLTGHL--NLTSRLSL  505

Query  744   KV--LSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNK  917
              +  L +S     G LP      L NL+ L  S+N  EG IPS  G + +L  ++LS N 
Sbjct  506   NISWLFISENHFHGQLPANIGEVLPNLEVLHASQNNFEGSIPSSIGEMRNLFTLDLSNNN  565

Query  918   LSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGF  1097
              SG I         SL  L + NN  +    F   +N ++L  +  D N   +   L G 
Sbjct  566   FSGEIPEQLAIGCQSLVSLKLSNNKLQ-GQIFPKLSNLTRLIELYLDGNH-FSGNALNGA  623

Query  1098  VPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFL-  1274
                F L  L + N     K+P ++     L  L +  N  EG  P+ +   N K  Y L 
Sbjct  624   YEGFLLVRLDIGNNYISGKIPSWIGNFTGLVTLDMRDNLFEGHIPTEI--GNLKELYLLD  681

Query  1275  MNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLH  1454
             ++ N  +G + LSS  +P+L+ I++  N   G +  +  +S  +++ L++  N FSG + 
Sbjct  682   LSGNFLSGPIPLSSD-SPSLRFIHLGRNGFRGSLPISLLNSSSSLVTLDIGGNNFSGHIP  740

Query  1455  SLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI------------  1592
               IG  + L  L    N+  G IP + L     + I+ LSNN + G I            
Sbjct  741   YWIGEFSELRILLFEGNNLQGPIPPQ-LCQLKKIRIMDLSNNTISGSIPKCFSDIPFGRS  799

Query  1593  -----------------VQEFDYLSSLE--------------------YLHLDGNNFEGT  1661
                              +Q + Y S +E                          N++EG+
Sbjct  800   EFREYMFMETGAGTRYSLQSYKYQSVVEGNNDYDADEVFENKPEKVKFTTKRRSNSYEGS  859

Query  1662  IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSI  1841
             I        +  LD+  N L+GEIP  MG L  ++ L LS N   G I   F NL  +  
Sbjct  860   I-----LDFMSGLDLSSNLLTGEIPPEMGNLNEILALNLSHNQFSGSISKSFSNLTQIES  914

Query  1842  LDLSENNLTGSIP  1880
             LDLS NNL+G IP
Sbjct  915   LDLSHNNLSGQIP  927



>gb|KDO40879.1| hypothetical protein CISIN_1g001036mg [Citrus sinensis]
Length=850

 Score =   362 bits (928),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 269/668 (40%), Positives = 378/668 (57%), Gaps = 35/668 (5%)
 Frame = +3

Query  420   LKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIK  599
             L  L+L  N F    T+          + N + LE L L++ S  ++ L S  + FPS+K
Sbjct  7     LNTLHLESNNFTATLTTT-------QELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLK  59

Query  600   TLELQRVNVTNIDAIHALKNLSSLEELHLDGSN--LHKDFLSNIG-PMESLKVLSLSGAQ  770
              L +    V  + +     +  SLE L +  +   L+  FL  IG  M SLK LSLSG+ 
Sbjct  60    NLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGST  119

Query  771   VG---GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIels  941
             +G     + ++GLC L +LQEL++  N L G +P    N TSLR +++S N+L+G+I  S
Sbjct  120   LGTNSSRILDQGLCPLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSS  179

Query  942   plstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADT-QLQGFVPKFQLD  1118
             PL  LTS+E L + NN F +  S     N+SKL++  A  N++  +  +     PKFQL 
Sbjct  180   PLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLK  239

Query  1119  SLSLS-NCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
             SLSLS N  D +  P+FL++Q +LK   +S   + GEFP+WLL+NNTKL++  + N++  
Sbjct  240   SLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLA  299

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--T  1469
             G  +L  H +  L+ ++VSNN   G I        P+++  N+S N   G + S  G   
Sbjct  300   GPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVI  359

Query  1470  HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN  1649
              L FLDLSNN  TGEIP  + + C +L  L LSNN L+G I      L +L +L L+GN+
Sbjct  360   FLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNH  419

Query  1650  FEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNL  1826
             F G IP SLS       L + +N LSG+IPRW+G L  L  + + KNHLEG IP+EFC L
Sbjct  420   FVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRL  479

Query  1827  KSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYNS  2003
              SL ILD+S+NN++GS+PSC  P SIK V LSK+ L GQL    FFN ++LV LDLSYN 
Sbjct  480   DSLQILDISDNNISGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNY  539

Query  2004  FVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKI  2183
               G IP+WI  +S+LS L L  N  EG+VP Q+C+L +L LLDLS+N L G+IP C    
Sbjct  540   LNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNT  599

Query  2184  SLEGTNEQFRGINLPFEY-YSINDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNL  2360
             +L  +       + PF+  +SI+           GS ++        +L   +F TK   
Sbjct  600   TLHESYNNNSSPDKPFKTSFSISGP--------QGSVEK-------KILEIFEFTTKNIA  644

Query  2361  YNYQNSIL  2384
             Y YQ  +L
Sbjct  645   YAYQGRVL  652


 Score =   142 bits (359),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 201/727 (28%), Positives = 319/727 (44%), Gaps = 100/727 (14%)
 Frame = +3

Query  114   LEELHMRYTQME------EINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVG--GAKK  269
             LE L MR+ ++       +I   S+ +LK ++SL    +G N  +    I D G      
Sbjct  83    LEHLDMRFARIALNTSFLQIIGESMPSLK-YLSLSGSTLGTNSSR----ILDQGLCPLAH  137

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L +++EL LS+N+
Sbjct  138   LQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQL-TGSISSSPLVHLTSIEELRLSNNH  196

Query  450   FE---GFETSANHSG---------------SSRHTIRNKSYLEVLHLNNISFDMTKLLSS  575
             F      E   NHS                +  H++  K  L+ L L++   D       
Sbjct  197   FRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKF  256

Query  576   LAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLS  755
             L     +K  EL  + +        L+N + LE L+L   +L   F   I   + L+ L 
Sbjct  257   LYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLD  316

Query  756   LSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIe  935
             +S     G +P +    L +L    +S N L+G IPS FGN+  L++++LS NKL+G I 
Sbjct  317   VSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIP  376

Query  936   lsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQL  1115
                     +LE+LS+ NNS +    F    +   LR +L + N  + +   Q       L
Sbjct  377   DHLAMCCVNLEFLSLSNNSLK-GHIFSRIFSLRNLRWLLLEGNHFVGEIP-QSLSKCSSL  434

Query  1116  DSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
               L L+N     K+PR+L   + L+ + + +N+LEG  P    + ++ LQ   +++N  +
Sbjct  435   KGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDS-LQILDISDNNIS  493

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--T  1469
             GSL  S     +++ +++S N L G++      +  +++ L+LS N  +G +   I   +
Sbjct  494   GSLP-SCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLS  552

Query  1470  HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN  1649
              L  L+L++N+  GE+P + L   + L +L LS+N L G I   FD  +    LH   NN
Sbjct  553   QLSHLNLAHNNLEGEVPIQ-LCRLNQLQLLDLSDNNLHGLIPSCFDNTT----LHESYNN  607

Query  1650  ----------------------------FEGTIpnslsnlp------lhslDIRDNKLSG  1727
                                         FE T  N            L  LD+  NKL G
Sbjct  608   NSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVG  667

Query  1728  EIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIK  1907
              IP  +G LT +  L LS N+L G IP+ F NL+ +  LDLS N L+G IP         
Sbjct  668   HIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIP---------  718

Query  1908  HVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGK  2087
                           R   +   L I  ++YN+  G IPEW    +  +    +GN F   
Sbjct  719   --------------RQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCG  764

Query  2088  VPTQVCQ  2108
             +P  +C+
Sbjct  765   LPLPICR  771



>ref|XP_010250259.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 isoform X1 [Nelumbo nucifera]
Length=1060

 Score =   366 bits (940),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 293/737 (40%), Positives = 418/737 (57%), Gaps = 39/737 (5%)
 Frame = +3

Query  258   GAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYL  437
             G KKL+ L L + + N SI   L    SL+ L L  N+  +G L +++ + LRNLK L L
Sbjct  136   GLKKLQVLNLSDNQLNSSILPFLGALTSLETLSLRSNEL-EGSLPLREFSQLRNLKILDL  194

Query  438   SDNYFEGFETSANHSGSSR----------HTIRNKSYLEVLHLNNISFDMTKLLSSLAAF  587
             S N       +   + + R            ++  S LE L L+   FD + +L  + AF
Sbjct  195   SQNRLGSGSLTIQGNFTKRTVQYTRLPPIQGVKRLSKLERLDLSENHFDKS-ILKFVGAF  253

Query  588   PSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGA  767
             PS+ TL L    +    + HAL+ LS LE L L  ++       +IG + SLK LSL+  
Sbjct  254   PSLNTLSLGSNGMEGSLSAHALEALSKLEILDLSYNSFTWSIPPSIGNLSSLKHLSLAYN  313

Query  768   QVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspl  947
             +  G+LP +GLC+LK+LQ+L L  N  EG IPS   NLTSLR ++LS N+L G+I  S +
Sbjct  314   RFNGSLPIQGLCKLKSLQDLVLGGNSFEGVIPSCLSNLTSLRMLDLSENQLRGSIPSSLI  373

Query  948   stltsleylsIMNNSFEVASSFRSFANNSKLRVIL--ADRNKVIADTQLQGFVPKFQLDS  1121
             ++LTSLEY+S+ NN+FE A  F SFAN+S+L V+   +  NK+   T+   +VP FQL  
Sbjct  374   TSLTSLEYISLENNNFEGAFWFGSFANSSRLEVVKLSSGGNKLEVQTEYPSWVPSFQLKV  433

Query  1122  LSLSNCIDLLK----LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNA  1289
             L L+NC +L K    +P+FL  Q DL+ + +S N+L G  PSWLL N TKL+   + NN+
Sbjct  434   LVLTNC-NLNKPAGIIPKFLSLQYDLREIDLSHNSLRGNLPSWLLHNKTKLELLNVQNNS  492

Query  1290  FTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG-  1466
              TG L L+S ++ N+  + +S N   G++  N     PN+  L+ S N F G + S IG 
Sbjct  493   LTGHLNLTSRLSLNISWLFISENHFHGQLPANIGEVLPNLEVLHASQNNFEGSIPSSIGE  552

Query  1467  -THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDG  1643
               +L  LDLSNN+F+GEIP+++ I C SLV LKLSNNKL+GQI  +   L+ L  L+LDG
Sbjct  553   MRNLFTLDLSNNNFSGEIPEQLAIGCQSLVSLKLSNNKLQGQIFPKLSNLTRLIELYLDG  612

Query  1644  NNFEG-TIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFC  1820
             N+F G  +  +     L  LDI +N +SG+IP W+G  T LV L +  N  EGHIP E  
Sbjct  613   NHFSGNALNGAYEGFLLVRLDIGNNYISGKIPSWIGNFTGLVTLDMRDNLFEGHIPTEIG  672

Query  1821  NLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSG-QLTRAFFNNTALVILDLSY  1997
             NLK L +LDLS N L+G IP   +  S++ + L ++   G        ++++LV LD+  
Sbjct  673   NLKELYLLDLSGNFLSGPIPLSSDSPSLRFIHLGRNGFRGSLPISLLNSSSSLVTLDIGG  732

Query  1998  NSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLG  2177
             N+F G IP WIG  S L  LL  GN  +G +P Q+CQL ++ ++DLSNN +SG IP+C  
Sbjct  733   NNFSGHIPYWIGEFSELRILLFEGNNLQGPIPPQLCQLKKIRIMDLSNNTISGSIPKCFS  792

Query  2178  KISLEGTNEQFRGINLPFEYYSINDAILDRL---HYEWGS----DDEYIPMLAVDVLPE-  2333
              I       +FR      EY  +      R     Y++ S    +++Y      +  PE 
Sbjct  793   DIPF--GRSEFR------EYMFMETGAGTRYSLQSYKYQSVVEGNNDYDADEVFENKPEK  844

Query  2334  VQFRTKGNLYNYQNSIL  2384
             V+F TK    +Y+ SIL
Sbjct  845   VKFTTKRRSNSYEGSIL  861


 Score =   115 bits (288),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 186/673 (28%), Positives = 278/673 (41%), Gaps = 98/673 (15%)
 Frame = +3

Query  96    LTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLE  275
             L  L  LE L + Y         S+ NL    SLK L + +N+F    PI  +   K L+
Sbjct  275   LEALSKLEILDLSYNSFTWSIPPSIGNLS---SLKHLSLAYNRFNGSLPIQGLCKLKSLQ  331

Query  276   ELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE  455
             +L L    F   I   L    SL++LDL +N    G +    I  L +L+ + L +N FE
Sbjct  332   DLVLGGNSFEGVIPSCLSNLTSLRMLDLSENQL-RGSIPSSLITSLTSLEYISLENNNFE  390

Query  456   G---FETSAN---------HSGSSRHTIRNK--SYLEVLHLNNISFDMTKLLSSLAAFPS  593
             G   F + AN          SG ++  ++ +  S++    L  +      L       P 
Sbjct  391   GAFWFGSFANSSRLEVVKLSSGGNKLEVQTEYPSWVPSFQLKVLVLTNCNLNKPAGIIP-  449

Query  594   IKTLELQRVNVTNIDAIH----------ALKNLSSLEELHLDGSNLHKDFLSNIGPMESL  743
              K L LQ  ++  ID  H           L N + LE L++  ++L      N+    SL
Sbjct  450   -KFLSLQ-YDLREIDLSHNSLRGNLPSWLLHNKTKLELLNVQNNSLTGHL--NLTSRLSL  505

Query  744   KV--LSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNK  917
              +  L +S     G LP      L NL+ L  S+N  EG IPS  G + +L  ++LS N 
Sbjct  506   NISWLFISENHFHGQLPANIGEVLPNLEVLHASQNNFEGSIPSSIGEMRNLFTLDLSNNN  565

Query  918   LSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGF  1097
              SG I         SL  L + NN  +    F   +N ++L  +  D N   +   L G 
Sbjct  566   FSGEIPEQLAIGCQSLVSLKLSNNKLQ-GQIFPKLSNLTRLIELYLDGNH-FSGNALNGA  623

Query  1098  VPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFL-  1274
                F L  L + N     K+P ++     L  L +  N  EG  P+ +   N K  Y L 
Sbjct  624   YEGFLLVRLDIGNNYISGKIPSWIGNFTGLVTLDMRDNLFEGHIPTEI--GNLKELYLLD  681

Query  1275  MNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLH  1454
             ++ N  +G + LSS  +P+L+ I++  N   G +  +  +S  +++ L++  N FSG + 
Sbjct  682   LSGNFLSGPIPLSSD-SPSLRFIHLGRNGFRGSLPISLLNSSSSLVTLDIGGNNFSGHIP  740

Query  1455  SLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI------------  1592
               IG  + L  L    N+  G IP + L     + I+ LSNN + G I            
Sbjct  741   YWIGEFSELRILLFEGNNLQGPIPPQ-LCQLKKIRIMDLSNNTISGSIPKCFSDIPFGRS  799

Query  1593  -----------------VQEFDYLSSLE--------------------YLHLDGNNFEGT  1661
                              +Q + Y S +E                          N++EG+
Sbjct  800   EFREYMFMETGAGTRYSLQSYKYQSVVEGNNDYDADEVFENKPEKVKFTTKRRSNSYEGS  859

Query  1662  IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSI  1841
             I        +  LD+  N L+GEIP  MG L  ++ L LS N   G I   F NL  +  
Sbjct  860   I-----LDFMSGLDLSSNLLTGEIPPEMGNLNEILALNLSHNQFSGSISKSFSNLTQIES  914

Query  1842  LDLSENNLTGSIP  1880
             LDLS NNL+G IP
Sbjct  915   LDLSHNNLSGQIP  927



>ref|XP_006495105.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Citrus sinensis]
Length=1015

 Score =   365 bits (936),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 296/807 (37%), Positives = 431/807 (53%), Gaps = 97/807 (12%)
 Frame = +3

Query  171   LNLKDFISLK---VLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPS  341
             +++K+F SL+    LDIG NK   F    D+    KL+ L L   + N SI  SL  F S
Sbjct  37    IDVKEFDSLRDLEELDIGGNKIDKFVVSKDL---SKLKSLGLSGIKLNCSILSSLTVFSS  93

Query  342   LKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYL  521
             L+ LD+ +  F  G   +++ +   NL+ L +S N  +       + G  +        L
Sbjct  94    LRELDISETGF-KGTFDVREFDSFNNLEVLDMSGNEIDNLVVPQGYGGLRK--------L  144

Query  522   EVLHLNNISF-DMTKLLSSLAAFPSIKTLELQRVNVTNI--DAIHALKNLSSLEELHLDG  692
             +   L+ +   D +KLL S+ +FPS+ TL+L   N T+I       L N ++LE L LD 
Sbjct  145   KSFGLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDE  204

Query  693   SNLH----------------------------------------------------KDFL  716
             S+LH                                                      FL
Sbjct  205   SSLHISLLQSIASLFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFL  264

Query  717   SNIG-PMESLKVLSLSGAQVG---GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLT  884
               IG  M SLK LSLSG+ +G     + ++GLC L +LQEL +++N L G +P    N+T
Sbjct  265   QIIGESMPSLKYLSLSGSILGTNSSRILDQGLCSLVHLQELRMADNDLRGSLPWCLANMT  324

Query  885   SLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRN  1064
             SLR +++S N+L+G+I  SPL  LTS+E L + +N F++  S     N+S+L++  AD N
Sbjct  325   SLRILDVSFNQLTGSISSSPLVHLTSIEMLILSDNHFQIPISLEPLFNHSRLKIFYADNN  384

Query  1065  KVIAD-TQLQGF-VPKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPS  1235
             ++ A+ TQ      P FQL+ L LS+   D    P+FL++Q DL+ + +S   + GEFP+
Sbjct  385   ELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGEFPT  444

Query  1236  WLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILA  1415
             WLL+NN KL+   + N++  G  +L  H +  L+ ++VSNN   G +        P++ +
Sbjct  445   WLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSLFS  504

Query  1416  LNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQ  1589
              N+S+N   G + S  G    L  LDLSNN  TGEIP+ + + C +L  L LSNN L+G 
Sbjct  505   FNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGEIPEYLAVGCVNLNSLALSNNNLQGH  564

Query  1590  IVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGRLTSLV  1766
             +      L++L++L L+GN F G IP SLS       L + +N LSG+IPRW+G LT L 
Sbjct  565   MFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQ  624

Query  1767  QLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQL  1946
              + +  NHLEG IP+EFC L  L ILD+S+NN++GS+PSC +P +IK V LSK+ L GQL
Sbjct  625   YIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLNIKQVHLSKNMLHGQL  684

Query  1947  TRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRls  2123
              R  FFN ++LV LDLSYN   G IP+W+  +S+LS L+L  N  EGKVP Q+C+L +L 
Sbjct  685   KRGTFFNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGKVPVQLCELNQLQ  744

Query  2124  lldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEY-YSINDAILDRLHYEWGSDDEY  2300
             LLDLSNN L G IP C    +L  +      ++  FE  +SI+           G D + 
Sbjct  745   LLDLSNNNLHGPIPPCFDNTTLHDSYSNSSSLDEQFEISFSID-----------GPDGD-  792

Query  2301  IPMLAVDVLPEVQFRTKGNLYNYQNSI  2381
                +   +    +F TK   Y YQ  +
Sbjct  793   ---VEKQIRENFEFTTKNIAYIYQGKV  816


 Score =   135 bits (340),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 195/689 (28%), Positives = 287/689 (42%), Gaps = 132/689 (19%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+EL + +     S+   L    SL+ILD+  N    G +    +  L +++ L LSDN+
Sbjct  302   LQELRMADNDLRGSLPWCLANMTSLRILDVSFNQL-TGSISSSPLVHLTSIEMLILSDNH  360

Query  450   FE---GFETSANHSG----SSRHTIRNKSYLEVLHLNNISFDMTKLLSSLA-----AFPS  593
             F+     E   NHS      + +   N    +   L   +F + +LL S +      FP 
Sbjct  361   FQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPK  420

Query  594   -------IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
                    ++ ++L  + +        L+N + LE L L   ++   F   I P   L+ L
Sbjct  421   FLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFL  480

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S     G +P +    L +L    +S N L G IPS FGN+  L+ ++LS N L+G I
Sbjct  481   DVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGEI  540

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                      +L  L++ NN+ +     R+F N + L+ +L + N+ +      G +P+  
Sbjct  541   PEYLAVGCVNLNSLALSNNNLQGHMFSRNF-NLTNLKWLLLEGNRFV------GEIPQ--  591

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C               L+ L ++ N+L G+ P WL  N T+LQY +M NN  
Sbjct  592   ----SLSKC-------------SSLEGLYLNNNSLSGKIPRWL-GNLTRLQYIIMPNNHL  633

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGT-  1469
              G + +       LQI+++S+N + G +   F     NI  ++LS N+  GQL    GT 
Sbjct  634   EGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPL--NIKQVHLSKNMLHGQLKR--GTF  689

Query  1470  ----HLGFLDLSNNSFTGEIPKEM-----------------------LISCSSLVILKLS  1568
                  L  LDLS N   G IP  +                       L   + L +L LS
Sbjct  690   FNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGKVPVQLCELNQLQLLDLS  749

Query  1569  NNKLEGQIVQEFDYL---------SSLE-----YLHLDG----------NNFEGT-----  1661
             NN L G I   FD           SSL+        +DG           NFE T     
Sbjct  750   NNNLHGPIPPCFDNTTLHDSYSNSSSLDEQFEISFSIDGPDGDVEKQIRENFEFTTKNIA  809

Query  1662  -IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLS  1838
              I        L  LD+  NKL G IP  +G LT +  L LS N+L G IP  F NLK + 
Sbjct  810   YIYQGKVLSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIE  869

Query  1839  ILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGII  2018
              LDLS N L G +P               HQL    T        L +  ++YN+  G I
Sbjct  870   SLDLSYNKLNGKMP---------------HQLVELKT--------LEVFSVAYNNLSGEI  906

Query  2019  PEWIGTIsrlsslllNGNRFEGKVPTQVC  2105
             PEW    +  +     GN F   +P  +C
Sbjct  907   PEWTAQFATFNESSYEGNIFLCGLPLPIC  935



>ref|XP_006471615.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1-like 
isoform X4 [Citrus sinensis]
Length=1272

 Score =   369 bits (946),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 287/751 (38%), Positives = 419/751 (56%), Gaps = 54/751 (7%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             L  L + Y    +I I +   L +F +L+ L + ++       +  +     L+ L +  
Sbjct  303   LNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDYSSLH-ISLLQSIASFTSLKNLSMSY  361

Query  294   CRFNQSIF-QSLKGFPSLKILDLMDNDF-----------------------YDGPLHIQD  401
             C  N  +  Q L+   +LK+LDL  N F                        +G +++++
Sbjct  362   CEVNGVLSGQGLERLANLKMLDLRGNLFNNSILSSLARLSSLTSLDLSYNRLEGSINVKE  421

Query  402   INDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISF-DMTKLLSSL  578
              + L NL+EL +S N  + FE    + G  +        L+ L+L  +   D +KLL S+
Sbjct  422   FDSLSNLEELDMSGNEIDNFEVPQGYKGLRK--------LKTLYLLGVGIRDGSKLLQSM  473

Query  579   AAFPSIKTLELQRVNVTN-IDAIHALKNLSSLEELHLDGSN--LHKDFLSNIG-PMESLK  746
              +FPS+  L+L   N T+ +       +  SLE L +D     L+  FL  IG  M SLK
Sbjct  474   GSFPSLNNLDLSYNNFTDTVTTTQGFPHFKSLEHLDMDDLRIVLNTSFLQIIGESMPSLK  533

Query  747   VLSLSGAQV----GGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLN  914
              LSLS +       G L  +GLC L +LQEL +++N+L G +P    N+TSLR +++S N
Sbjct  534   YLSLSYSSAITNSSGIL--QGLCSLVHLQELHMADNELRGSLPWCLANMTSLRILDVSSN  591

Query  915   KLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQG  1094
             +L+G+I  SPL  LTS+E LS+ NN F +  S     N+S+L++  AD N + A      
Sbjct  592   QLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSH  651

Query  1095  FV--PKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQ  1265
              +  PKFQL SLSLS+   D +  P+FL+YQ DL+ +  SR  + GEFP+WLL+NNTKL+
Sbjct  652   TLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLR  711

Query  1266  YFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSG  1445
                + N++  G  +L  H + +L++++VSNN   G I        P +++ N+S N   G
Sbjct  712   QLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDG  771

Query  1446  QLHSLIGTH--LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSS  1619
              + S  G    L  LDLSNN  TGEIP+ + + C +L  L LSNN L+G +      L +
Sbjct  772   SIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGHMFSRNFNLIN  831

Query  1620  LEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLE  1796
             L +L L+GN+F G I  +      L  L + +N LSG+IPRW+G LT L+ + + KNHLE
Sbjct  832   LRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLE  891

Query  1797  GHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNTA  1973
             G IP+EFC+L SL ILD+S+NN++GS+PSC +P SI  V LSK+ L GQL    FFN ++
Sbjct  892   GPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLSKNMLHGQLKGGTFFNCSS  951

Query  1974  LVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnlls  2153
             LV LDLSYN   G IP+WI  +S+LS L+L  N  EG+VP Q+C L +L LLDLSNN L 
Sbjct  952   LVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGLNQLQLLDLSNNNLH  1011

Query  2154  GVIPRCLGKISLEGTNEQFRGINLPFEYYSI  2246
             G+IP C     L   +E +   + P E + I
Sbjct  1012  GLIPPCFDNTKL---HESYNNSSSPDEQFKI  1039


 Score =   146 bits (369),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 222/805 (28%), Positives = 340/805 (42%), Gaps = 179/805 (22%)
 Frame = +3

Query  171   LNLKDFISLK---VLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPS  341
             +++K+F SL+    LDIG NK   F    D+    KL+ L L   + N+SI  SL  F S
Sbjct  170   IDVKEFDSLRDLEELDIGRNKIDKFVVSKDL---SKLKSLGLSGVKLNRSILSSLTVFYS  226

Query  342   LKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYL  521
             L+ LD+ +  F  G   ++D +   NL+ L +S N  +       + G  +        L
Sbjct  227   LRELDISETGF-KGTFDVRDFDSFNNLEVLDMSGNEIDNLVVPQGYKGLRK--------L  277

Query  522   EVLHLNNISF-DMTKLLSSLAAFPSIKTLELQRVNVTNI--DAIHALKNLSSLEELHLDG  692
             + L L+ +   D +KLL S+ +FPS+ TL+L   N T+I       L N ++LE L LD 
Sbjct  278   KSLDLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDY  337

Query  693   SNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYF  872
             S+LH   L +I    SLK LS+S  +V G L  +GL  L NL+ L L  N     I S  
Sbjct  338   SSLHISLLQSIASFTSLKNLSMSYCEVNGVLSGQGLERLANLKMLDLRGNLFNNSILSSL  397

Query  873   GNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNN---SFEVASSFRSFANNSKLR  1043
               L+SL  ++LS N+L G+I +    +L++LE L +  N   +FEV   ++       L 
Sbjct  398   ARLSSLTSLDLSYNRLEGSINVKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLRKLKTLY  457

Query  1044  VI---LADRNKVIAD---------------------TQLQGF------------------  1097
             ++   + D +K++                       T  QGF                  
Sbjct  458   LLGVGIRDGSKLLQSMGSFPSLNNLDLSYNNFTDTVTTTQGFPHFKSLEHLDMDDLRIVL  517

Query  1098  -----------VPKFQLDSLSLSNCID-----LLKLPRFLHYQRDLKVLRISRNNLEGEF  1229
                        +P  +  SLS S+ I      L  L   +H Q     L ++ N L G  
Sbjct  518   NTSFLQIIGESMPSLKYLSLSYSSAITNSSGILQGLCSLVHLQE----LHMADNELRGSL  573

Query  1230  PSWLLQNNTKLQYFLMNNNAFTGSLKLSS-----------------HV---------NPN  1331
             P W L N T L+   +++N  TGS+  S                  H+         +  
Sbjct  574   P-WCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSR  632

Query  1332  LQIINVSNNKLCGEISGNFSSSFPNI-LALNLSSNLFSGQL---------HSLIGTHLGF  1481
             L+I    NN +  +I+ + + + P   LA    S+ +   +         H L   H   
Sbjct  633   LKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSR  692

Query  1482  LDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGT  1661
             + ++     GE P  +L + + L  L L N+ L G           L  L +  NNF+G 
Sbjct  693   IQMN-----GEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGH  747

Query  1662  IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSI  1841
             IP                ++   +PR       L+   +S N L+G IP  F N+  L I
Sbjct  748   IPV---------------EIGDILPR-------LISFNISMNALDGSIPSSFGNMNLLQI  785

Query  1842  LDLSENNLTGSIP-----SCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSF  2006
             LDLS N LTG IP      C+N   ++ ++LS + L G +    FN   L  L L  N F
Sbjct  786   LDLSNNQLTGEIPEHLAMGCVN---LEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHF  842

Query  2007  VGIIPE------------------------WIGTIsrlsslllNGNRFEGKVPTQVCQLM  2114
             VG IP+                        W+G ++ L  +++  N  EG +P + C L 
Sbjct  843   VGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLY  902

Query  2115  RlslldlsnnllsGVIPRCLGKISL  2189
              L +LD+S+N +SG +P C   +S+
Sbjct  903   SLQILDISDNNISGSLPSCFHPLSI  927


 Score =   127 bits (320),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 193/704 (27%), Positives = 296/704 (42%), Gaps = 106/704 (15%)
 Frame = +3

Query  192   SLKVLDIGFNKF--QSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMD  365
             SLK L + ++     S G +  +     L+EL++ +     S+   L    SL+ILD+  
Sbjct  531   SLKYLSLSYSSAITNSSGILQGLCSLVHLQELHMADNELRGSLPWCLANMTSLRILDVSS  590

Query  366   NDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNN-  542
             N    G +    +  L +++EL LS+N+F        H   S   + N S L++ + +N 
Sbjct  591   NQL-TGSISSSPLFYLTSIEELSLSNNHF--------HIPISLEPLFNHSRLKIFYADNN  641

Query  543   -ISFDMTK------------------LLSSLAAFPS-------IKTLELQRVNVTNIDAI  644
              I+  +TK                         FP        ++ +   R+ +      
Sbjct  642   PINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPN  701

Query  645   HALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQE  824
               L+N + L +L L   +L   F   I     L++L +S     G +P +    L  L  
Sbjct  702   WLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLIS  761

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
               +S N L+G IPS FGN+  L+ ++LS N+L+G I         +LE+L++ NNS +  
Sbjct  762   FNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGH  821

Query  1005  SSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRD  1184
                R+F N   LR +  + N  + +   Q       L+ L L+N     K+PR+L     
Sbjct  822   MFSRNF-NLINLRWLQLEGNHFVGEIP-QSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTW  879

Query  1185  LKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKL  1364
             L  + + +N+LEG  P       + LQ   +++N  +GSL    H     Q+ ++S N L
Sbjct  880   LIHIIMPKNHLEGPIPVEFCHLYS-LQILDISDNNISGSLPSCFHPLSITQV-HLSKNML  937

Query  1365  CGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLIS  1538
              G++ G    +  +++ L+LS NL +G +   I   + L  L L NN+  GE+P + L  
Sbjct  938   HGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQ-LCG  996

Query  1539  CSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN-----------------------  1649
              + L +L LSNN L G I   FD       LH   NN                       
Sbjct  997   LNQLQLLDLSNNNLHGLIPPCFDNTK----LHESYNNSSSPDEQFKILFSIKGHQGHVEK  1052

Query  1650  -----FEGT------IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLE  1796
                  FE T      I        L  LD+  NKL G IP  +G LT +  L LS N+L 
Sbjct  1053  KIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLT  1112

Query  1797  GHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTAL  1976
             G IP  F NLK +  LDLS N L G IP               HQL             L
Sbjct  1113  GLIPSTFSNLKQIESLDLSYNKLNGKIP---------------HQL--------VELKEL  1149

Query  1977  VILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
              +  ++YN+  G IPEW    +  +     GN F   +P  +C+
Sbjct  1150  AVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICR  1193



>gb|KDO38692.1| hypothetical protein CISIN_1g039739mg, partial [Citrus sinensis]
Length=628

 Score =   352 bits (904),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 258/618 (42%), Positives = 367/618 (59%), Gaps = 20/618 (3%)
 Frame = +3

Query  420   LKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIK  599
             L  LYLS N F    T+          + N + LE L L++ S  ++ L S  + FPS+K
Sbjct  7     LNTLYLSSNNFTDIATAT-------QELHNFTNLEYLTLDSSSLHISLLQSIASIFPSLK  59

Query  600   TLELQRVNVTNIDAIHALKNLSSLEELHLDGS--NLHKDFLSNIG-PMESLKVLSLSGAQ  770
              L +    V  +       +  SLE L ++G+   L+  FL  IG  M SLK LSL G+ 
Sbjct  60    NLSMIGCEVNGLVRGQGFPHFKSLEHLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSI  119

Query  771   VG---GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIels  941
             +G     + ++GLC L +LQ L ++ N L G +P    N+TSLR +++S N+L+G+I  S
Sbjct  120   LGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSS  179

Query  942   plstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQGF-VPKFQL  1115
             PL  LTS+E L + NN F++  S   F N+S+L+   AD N++ A+ TQ      P FQL
Sbjct  180   PLVHLTSIEELYLSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQL  239

Query  1116  DSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
               LSLS+   D    P+FL++Q DL+ + +S   + GEFP+WLL+NNTKL+   + N++ 
Sbjct  240   SRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSL  299

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--  1466
              G  +L  H +  L ++++SNN   G I        P++ +LN+S N   G + S  G  
Sbjct  300   GGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSIPSSFGNM  359

Query  1467  THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGN  1646
               L  LDLSNN  TGEIP+ +++ C +L  L LSNN LEG +      L++L +L L+GN
Sbjct  360   KFLQILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLEGN  419

Query  1647  NFEGTIpnslsnl-plhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCN  1823
             +F G IP SLS    L  L + +N LSG+IPRW+G LT L  + + KNHLEG IP+EFC 
Sbjct  420   HFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQ  479

Query  1824  LKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYN  2000
             L  L ILD+S+NN++GS+PSC +P S++ V LSK+ L GQL R  FFN+ +LV LDLSYN
Sbjct  480   LDWLQILDISDNNISGSLPSCFHPLSVEQVHLSKNMLHGQLKRGTFFNSYSLVTLDLSYN  539

Query  2001  SFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGK  2180
                G I +W+  +S+LS L+L  N  EG+VP Q+C+L +L LLDLSNN L G IP CL  
Sbjct  540   RLNGNISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNSLHGSIPLCLDN  599

Query  2181  ISLEGTNEQFRGINLPFE  2234
              +L  +      ++  FE
Sbjct  600   TTLHESYNNSSSLDKQFE  617



>ref|XP_006471618.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1-like 
isoform X7 [Citrus sinensis]
Length=1081

 Score =   363 bits (933),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 290/708 (41%), Positives = 402/708 (57%), Gaps = 63/708 (9%)
 Frame = +3

Query  171   LNLKDFISL---KVLDIGFNKFQSFGPINDVGGAKKLEELYLFEC--RFNQSIFQSLKGF  335
             +N+K+F SL   + LD+  N+  +F       G +KL+ LYL     R    + QS+  F
Sbjct  176   INVKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLRKLKTLYLLGVGIRDGSKLLQSMGSF  235

Query  336   PSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKS  515
             PSL  LDL  N+F D     Q++++  NL+ L L               GSS H      
Sbjct  236   PSLNNLDLSYNNFTDTVTTTQELHNFANLEYLTLH--------------GSSLH------  275

Query  516   YLEVLHLNNISFDMTKLLSSLA-AFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDG  692
                      ISF     L S+A  FPS+K L +    V  +       +  SLE L +D 
Sbjct  276   ---------ISF-----LQSIALMFPSLKNLSMLDCKVNGVVRGQGFPHFKSLEHLDMDD  321

Query  693   SN--LHKDFLSNIG-PMESLKVLSLSGAQV----GGTLPNKGLCELKNLQELWLSENQLE  851
                 L+  FL  IG  M SLK LSLS +       G L  +GLC L +LQEL +++N+L 
Sbjct  322   LRIVLNTSFLQIIGESMPSLKYLSLSYSSAITNSSGIL--QGLCSLVHLQELHMADNELR  379

Query  852   GKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANN  1031
             G +P    N+TSLR +++S N+L+G+I  SPL  LTS+E LS+ NN F +  S     N+
Sbjct  380   GSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNH  439

Query  1032  SKLRVILADRNKVIADTQLQGFV--PKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRI  1202
             S+L++  AD N + A       +  PKFQL SLSLS+   D +  P+FL+YQ DL+ +  
Sbjct  440   SRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHF  499

Query  1203  SRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISG  1382
             SR  + GEFP+WLL+NNTKL+   + N++  G  +L  H + +L++++VSNN   G I  
Sbjct  500   SRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPV  559

Query  1383  NFSSSFPNILALNLSSNLFSGQLHSLIGTH--LGFLDLSNNSFTGEIPKEMLISCSSLVI  1556
                   P +++ N+S N   G + S  G    L  LDLSNN  TGEIP+ + + C +L  
Sbjct  560   EIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEF  619

Query  1557  LKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEI  1733
             L LSNN L+G +      L +L +L L+GN+F G IP SLS       L + +N LSG+I
Sbjct  620   LALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKI  679

Query  1734  PRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHV  1913
             PRW+G LT L+ + + KNHLEG IP+EFC+L SL ILD+S+NN++GS+PSC +P SI  V
Sbjct  680   PRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQV  739

Query  1914  SLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKV  2090
              LSK+ L GQL    FFN ++LV LDLSYN   G IP+WI  +S+LS L+L  N  EG+V
Sbjct  740   HLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEV  799

Query  2091  PTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGT-------NEQFR  2213
             P Q+C L +L LLDLSNN L G+IP C     L  +       +EQF+
Sbjct  800   PVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSSPDEQFK  847


 Score =   128 bits (321),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 193/704 (27%), Positives = 296/704 (42%), Gaps = 106/704 (15%)
 Frame = +3

Query  192   SLKVLDIGFNKF--QSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMD  365
             SLK L + ++     S G +  +     L+EL++ +     S+   L    SL+ILD+  
Sbjct  340   SLKYLSLSYSSAITNSSGILQGLCSLVHLQELHMADNELRGSLPWCLANMTSLRILDVSS  399

Query  366   NDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNN-  542
             N    G +    +  L +++EL LS+N+F        H   S   + N S L++ + +N 
Sbjct  400   NQL-TGSISSSPLFYLTSIEELSLSNNHF--------HIPISLEPLFNHSRLKIFYADNN  450

Query  543   -ISFDMTK------------------LLSSLAAFPS-------IKTLELQRVNVTNIDAI  644
              I+  +TK                         FP        ++ +   R+ +      
Sbjct  451   PINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPN  510

Query  645   HALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQE  824
               L+N + L +L L   +L   F   I     L++L +S     G +P +    L  L  
Sbjct  511   WLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLIS  570

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
               +S N L+G IPS FGN+  L+ ++LS N+L+G I         +LE+L++ NNS +  
Sbjct  571   FNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGH  630

Query  1005  SSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRD  1184
                R+F N   LR +  + N  + +   Q       L+ L L+N     K+PR+L     
Sbjct  631   MFSRNF-NLINLRWLQLEGNHFVGEIP-QSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTW  688

Query  1185  LKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKL  1364
             L  + + +N+LEG  P       + LQ   +++N  +GSL    H     Q+ ++S N L
Sbjct  689   LIHIIMPKNHLEGPIPVEFCHLYS-LQILDISDNNISGSLPSCFHPLSITQV-HLSKNML  746

Query  1365  CGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLIS  1538
              G++ G    +  +++ L+LS NL +G +   I   + L  L L NN+  GE+P + L  
Sbjct  747   HGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQ-LCG  805

Query  1539  CSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN-----------------------  1649
              + L +L LSNN L G I   FD       LH   NN                       
Sbjct  806   LNQLQLLDLSNNNLHGLIPPCFDNTK----LHESYNNSSSPDEQFKILFSIKGHQGHVEK  861

Query  1650  -----FEGT------IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLE  1796
                  FE T      I        L  LD+  NKL G IP  +G LT +  L LS N+L 
Sbjct  862   KIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLT  921

Query  1797  GHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTAL  1976
             G IP  F NLK +  LDLS N L G IP               HQL             L
Sbjct  922   GLIPSTFSNLKQIESLDLSYNKLNGKIP---------------HQL--------VELKEL  958

Query  1977  VILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
              +  ++YN+  G IPEW    +  +     GN F   +P  +C+
Sbjct  959   AVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICR  1002


 Score = 87.0 bits (214),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 182/634 (29%), Positives = 290/634 (46%), Gaps = 55/634 (9%)
 Frame = +3

Query  399   DINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISF-DMTKLLSS  575
             + + L NL+EL +S N  + FE    + G  +        L+ L L+ +   + +KLL S
Sbjct  4     EFDSLSNLEELDMSGNEIDNFEVPQGYRGLRK--------LKSLGLSGVGITNGSKLLQS  55

Query  576   LAAFPSIKTLELQ--RVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKV  749
             + +FPS+ TL L       T       L N ++LE L LD S+LH   L +I    SLK 
Sbjct  56    MGSFPSLNTLHLSFNEFTETVTTTTQELHNFTNLEYLTLDYSSLHISLLQSIASFTSLKN  115

Query  750   LSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGN  929
             LS+S  +V G L  +GL  L NL+ L L  N     I S    L+SL  ++LS N+L G+
Sbjct  116   LSMSYCEVNGVLSGQGLERLANLKMLDLRGNLFNNSILSSLARLSSLTSLDLSYNRLEGS  175

Query  930   IelsplstltsleylsIMNN---SFEVASSFRSFANNSKLRVI---LADRNKVIADTQLQ  1091
             I +    +L++LE L +  N   +FEV   ++       L ++   + D +K++   Q  
Sbjct  176   INVKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLRKLKTLYLLGVGIRDGSKLL---QSM  232

Query  1092  GFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYF  1271
             G  P      LS +N  D +   + LH   +L+ L +  ++L   F   +      L+  
Sbjct  233   GSFPSLNNLDLSYNNFTDTVTTTQELHNFANLEYLTLHGSSLHISFLQSIALMFPSLKNL  292

Query  1272  LMNNNAFTGSL--------KLSSHVN-PNLQII-NVSNNKLCGEISGNFSSSFPNI--LA  1415
              M +    G +        K   H++  +L+I+ N S  ++ GE       S P++  L+
Sbjct  293   SMLDCKVNGVVRGQGFPHFKSLEHLDMDDLRIVLNTSFLQIIGE-------SMPSLKYLS  345

Query  1416  LNLSSNLF--SGQLHSLIG-THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEG  1586
             L+ SS +   SG L  L    HL  L +++N   G +P   L + +SL IL +S+N+L G
Sbjct  346   LSYSSAITNSSGILQGLCSLVHLQELHMADNELRGSLPW-CLANMTSLRILDVSSNQLTG  404

Query  1587  QIVQE-FDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIR--DNKLSGEIPRWMGRLT  1757
              I      YL+S+E L L  N+F   I                 +N ++ +I +     T
Sbjct  405   SISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSHTLTT  464

Query  1758  SLVQLTLSKNHLEGHIPIEFCNL----KSLSILDLSENNLTGSIPSCL--NPSSIKHVSL  1919
                QL            + F         L  +  S   + G  P+ L  N + ++ +SL
Sbjct  465   PKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSL  524

Query  1920  SKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIs-rlsslllNGNRFEGKVPT  2096
                 L+G       ++  L +LD+S N+F G IP  IG I  RL S  ++ N  +G +P+
Sbjct  525   VNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPS  584

Query  2097  QVCQLMRlslldlsnnllsGVIPR--CLGKISLE  2192
                 +  L +LDLSNN L+G IP    +G ++LE
Sbjct  585   SFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLE  618


 Score = 76.6 bits (187),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 198/773 (26%), Positives = 326/773 (42%), Gaps = 155/773 (20%)
 Frame = +3

Query  195   LKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFN--QSIFQSLKGFPSLKILDLMDN  368
             L+ LD+  N+  +F       G +KL+ L L          + QS+  FPSL  L L  N
Sbjct  11    LEELDMSGNEIDNFEVPQGYRGLRKLKSLGLSGVGITNGSKLLQSMGSFPSLNTLHLSFN  70

Query  369   DF-YDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNI  545
             +F        Q++++  NL+  YL+ +Y            SS H                
Sbjct  71    EFTETVTTTTQELHNFTNLE--YLTLDY------------SSLH----------------  100

Query  546   SFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNI  725
                   LL S+A+F S+K L +    V  + +   L+ L++L+ L L G+  +   LS++
Sbjct  101   ----ISLLQSIASFTSLKNLSMSYCEVNGVLSGQGLERLANLKMLDLRGNLFNNSILSSL  156

Query  726   GPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEG-KIPSYFGNLTSLRYVN  902
               + SL  L LS  ++ G++  K    L NL+EL +S N+++  ++P  +  L  L+ + 
Sbjct  157   ARLSSLTSLDLSYNRLEGSINVKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLRKLKTLY  216

Query  903   -LSLNKLSGNIelsplstltsleylsIMNNSF-EVASSFRSFANNSKLRVILADRNKVIA  1076
              L +    G+  L  + +  SL  L +  N+F +  ++ +   N + L   L      + 
Sbjct  217   LLGVGIRDGSKLLQSMGSFPSLNNLDLSYNNFTDTVTTTQELHNFANLEY-LTLHGSSLH  275

Query  1077  DTQLQGFVPKF-QLDSLSLSNCI--DLLKLPRFLHYQR----DLKVLRISRNNLEGEFPS  1235
              + LQ     F  L +LS+ +C    +++   F H++     D+  LRI  N     F  
Sbjct  276   ISFLQSIALMFPSLKNLSMLDCKVNGVVRGQGFPHFKSLEHLDMDDLRIVLNT---SFLQ  332

Query  1236  WLLQNNTKLQYF-LMNNNAFTGS----LKLSSHVNPNLQIINVSNNKLCGEISGNFSSSF  1400
              + ++   L+Y  L  ++A T S      L S V  +LQ +++++N+L G +     ++ 
Sbjct  333   IIGESMPSLKYLSLSYSSAITNSSGILQGLCSLV--HLQELHMADNELRGSLPWCL-ANM  389

Query  1401  PNILALNLSSNLFSGQLHS---LIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSN  1571
              ++  L++SSN  +G + S      T +  L LSNN F   I  E L + S L I    N
Sbjct  390   TSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADN  449

Query  1572  NKLEGQIVQEFDYLSSLEYL--------HLDGNNFEGTIpnslsnlplhslDIRDNKLSG  1727
             N +  +I +     +    L        + DG  F   +        +H   I+ N   G
Sbjct  450   NPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMN---G  506

Query  1728  EIPRWM------GRLTSLVQ-------------------LTLSKNHLEGHIPIE------  1814
             E P W+       R  SLV                    L +S N+ +GHIP+E      
Sbjct  507   EFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILP  566

Query  1815  -------------------FCNLKSLSILDLSENNLTGSIP-----SCLNPSSIKHVSLS  1922
                                F N+  L ILDLS N LTG IP      C+N   ++ ++LS
Sbjct  567   RLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVN---LEFLALS  623

Query  1923  KHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPE------------------------WI  2030
              + L G +    FN   L  L L  N FVG IP+                        W+
Sbjct  624   NNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWL  683

Query  2031  GTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISL  2189
             G ++ L  +++  N  EG +P + C L  L +LD+S+N +SG +P C   +S+
Sbjct  684   GNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSI  736



>ref|XP_010324746.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X2 [Solanum lycopersicum]
Length=1013

 Score =   362 bits (929),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 261/646 (40%), Positives = 364/646 (56%), Gaps = 67/646 (10%)
 Frame = +3

Query  102   GLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEEL  281
             GL NL EL      +++INILS L                           G  + LE+L
Sbjct  147   GLSNLRELWFEGYGIDDINILSAL---------------------------GRLRNLEKL  179

Query  282   YLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGF  461
              L +  FN +IF SLK FPSLK L+L  N+  +G + + DI  L NLK L LSDN  E F
Sbjct  180   NLNDNNFNSTIFSSLKIFPSLKHLNLAANEI-NGYIEMNDIIALSNLKHLDLSDNNIESF  238

Query  462   ETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDA  641
              T     GS +   R+ S+   L L + + + ++++ SL +F S+K+L  +  ++T    
Sbjct  239   VTDK---GSKK---RSTSF-RSLLLGSSNSNSSRVIQSLKSFSSLKSLSYENSDLTAPTI  291

Query  642   IHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQ  821
             I+AL+NLS+LE L+LDGS+++ +FL NIG M SLKVLS++      T+PN+G CELK+L+
Sbjct  292   IYALRNLSTLEYLYLDGSSINDNFLPNIGHMTSLKVLSIAFGSNNDTIPNQGWCELKHLE  351

Query  822   ELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleyl-sIMNNSFE  998
             EL    N  EG +PS  GNLTSLR ++L+ N L GNI    +    +     SI +N F+
Sbjct  352   ELDFVNNNFEGTLPSCLGNLTSLRRLSLAGNNLRGNIASHSILRRLTSLEYLSIEDNQFD  411

Query  999   VASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQ  1178
             V  SF  F N +KL  +    + +I DT+ Q ++P FQL+   +  CI L KLP FLHYQ
Sbjct  412   VPLSFSQFYNYTKLIYLDVGDSTIIPDTEFQNWIPNFQLEFFGIYGCIKLQKLPSFLHYQ  471

Query  1179  RDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNN  1358
              DL++L I  N L+G+FP+WLL+NNT++      +NAF G  KL S V+  L+ I+VSNN
Sbjct  472   YDLRILVIDENQLQGKFPTWLLENNTRIAGVYSRDNAFDGPFKLPSIVHLYLKTIDVSNN  531

Query  1359  KLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI-GTHLGFLDLSNNSFTGEIPKEMLI  1535
             KL G I    S +FP + +LN+S N   G + S I G HL  LDLSNN  +GEIP +++I
Sbjct  532   KLNGHIPDKMSLAFPKLTSLNMSQNFLEGPIPSKISGIHLETLDLSNNLLSGEIPSDVVI  591

Query  1536  SCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDN  1715
                 L+ L+LSNNKL+G+I  E      L +L+L+GNN EG +P++     L  LD   N
Sbjct  592   GSPQLLFLRLSNNKLKGKIFLEVKS-HILSFLYLNGNNLEGPLPSNTFITSLFILDASRN  650

Query  1716  KLSGEIPRWMGRLTSLVQLTLSKNHLEGH------------------------IPIEFCN  1823
               +GEIPRW+   T L+ L LSKNHL GH                        IPI+ C 
Sbjct  651   NFTGEIPRWITDNTRLLLLDLSKNHLTGHIPHTIGSLNSLNYLLLSHNQLEGQIPIQICM  710

Query  1824  LKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFF  1961
             L  LSI+DLS N L G +  CL      +++ +K     ++T  F+
Sbjct  711   LNMLSIMDLSFNKLYGPLFPCLG-----NLTQAKKDAKKRITYYFY  751


 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 155/642 (24%), Positives = 263/642 (41%), Gaps = 63/642 (10%)
 Frame = +3

Query  96    LTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLE  275
             +  L NL  L   Y     IN   + N+    SLKVL I F       P       K LE
Sbjct  292   IYALRNLSTLEYLYLDGSSINDNFLPNIGHMTSLKVLSIAFGSNNDTIPNQGWCELKHLE  351

Query  276   ELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE  455
             EL      F  ++   L    SL+ L L  N+          +  L +L+ L + DN F+
Sbjct  352   ELDFVNNNFEGTLPSCLGNLTSLRRLSLAGNNLRGNIASHSILRRLTSLEYLSIEDNQFD  411

Query  456   ---GFETSANHSGSSRHTIRNKSYLEVLHLNNI-------------SFDMTKLLSSLAAF  587
                 F    N++      + + + +      N                 + KL S L   
Sbjct  412   VPLSFSQFYNYTKLIYLDVGDSTIIPDTEFQNWIPNFQLEFFGIYGCIKLQKLPSFLHYQ  471

Query  588   PSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDF-LSNIGPMESLKVLSLSG  764
               ++ L +    +        L+N + +  ++   +     F L +I  +  LK + +S 
Sbjct  472   YDLRILVIDENQLQGKFPTWLLENNTRIAGVYSRDNAFDGPFKLPSIVHLY-LKTIDVSN  530

Query  765   AQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsp  944
              ++ G +P+K       L  L +S+N LEG IPS    +  L  ++LS N LSG I    
Sbjct  531   NKLNGHIPDKMSLAFPKLTSLNMSQNFLEGPIPSKISGI-HLETLDLSNNLLSGEIPSDV  589

Query  945   lstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSL  1124
             +     L +L + NN               K ++ L  ++ +++   L G   +  L S 
Sbjct  590   VIGSPQLLFLRLSNNKL-------------KGKIFLEVKSHILSFLYLNGNNLEGPLPSN  636

Query  1125  SLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSL  1304
             +               +   L +L  SRNN  GE P W+  +NT+L    ++ N  TG +
Sbjct  637   T---------------FITSLFILDASRNNFTGEIPRWI-TDNTRLLLLDLSKNHLTGHI  680

Query  1305  KLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILA-LNLSSNLFSGQLHSLIGTHLGF  1481
               +     +L  + +S+N+L G+I         N+L+ ++LS N   G L   +G     
Sbjct  681   PHTIGSLNSLNYLLLSHNQLEGQIP--IQICMLNMLSIMDLSFNKLYGPLFPCLGNLTQA  738

Query  1482  LDLSNNSFTGEIPKEML---ISCSSLVILKLSNNKLEGQIVQEF--DYLSSLEY-LHLDG  1643
                +    T    K      ++    + L+   +   G +V     D  + +++    + 
Sbjct  739   KKDAKKRITYYFYKTYWNPWLTFLRWIWLERHYHNRHGILVDTLLMDAETVVQFSTKRNS  798

Query  1644  NNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCN  1823
               ++G+I   +S +     D+  N+L+GEIP  +G ++++  L LS NHL G IP  F N
Sbjct  799   YTYKGSILKYMSGI-----DLSSNRLTGEIPIEIGNMSNIHTLNLSHNHLIGRIPNTFSN  853

Query  1824  LKSLSILDLSENNLTGSIP-SCLNPSSIKHVSLSKHQLSGQL  1946
             L+ +  LDLS N L GSIP   +  +S+   S++ + LSG +
Sbjct  854   LQEIESLDLSCNRLNGSIPVGLIELNSLAVFSVAYNNLSGAV  895



>ref|XP_006385240.1| hypothetical protein POPTR_0003s02030g [Populus trichocarpa]
 gb|ERP63037.1| hypothetical protein POPTR_0003s02030g [Populus trichocarpa]
Length=1008

 Score =   362 bits (929),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 244/584 (42%), Positives = 357/584 (61%), Gaps = 15/584 (3%)
 Frame = +3

Query  663   SSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSEN  842
             S+LEEL+LD ++L  +FL NIG + +LKVLS++G  + GTLP +G CELKNL++L LS N
Sbjct  229   STLEELYLDNTSLPINFLQNIGALHALKVLSVAGCDLHGTLPVQGWCELKNLKQLDLSGN  288

Query  843   QLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSF  1022
                G +P   GNL+SL+ +++S N+  GNI   P + L SLE+LS+ NN FEV +S + F
Sbjct  289   NFGGSLPDCLGNLSSLQLLDVSENQFIGNIASGPFTNLISLEFLSLSNNLFEVPTSMKPF  348

Query  1023  ANNSKLRVILADRNKVIAD-TQLQGFVPKFQLDSLSLSNCIDLL--KLPRFLHYQRDLKV  1193
              N+S L+   ++ NK++ +       +PKFQL    LS     L  ++P FL+YQ DL+V
Sbjct  349   MNHSSLKFFSSENNKLVTEPAAFDNLIPKFQLVFFRLSKTTKALNVEIPDFLYYQYDLRV  408

Query  1194  LRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGE  1373
             L +S NN+ G FPSWLL+NNT+L+   ++ N+F G+L+L  H   N+  +++SNN + G+
Sbjct  409   LDLSHNNITGMFPSWLLKNNTRLEELWLSENSFVGALQLQDHPYSNMIELDISNNNMNGQ  468

Query  1374  ISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSS  1547
             I  +    FPN+ +L ++ N F+G + S +G  +    LDLSNN  +  I K  L   ++
Sbjct  469   IPKDICLIFPNLWSLKMAKNGFTGGIPSCLGNISSFSVLDLSNNQLS--IVK--LEQLTA  524

Query  1548  LVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnsls--nlplhslDIRDNKL  1721
             ++ L LSNN L GQI       SSL+ L L GNNF G I +           LD+ +N+ 
Sbjct  525   IMFLNLSNNNLGGQIPTSVFNSSSLDVLFLSGNNFWGQISDFPLNGWKEWVVLDLSNNQF  584

Query  1722  SGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSS  1901
             SG++PRW    T L  + LSKNH +G IP +FC L  L  LDLS+NNL+G IPSC +P +
Sbjct  585   SGKVPRWFVNSTFLRSIDLSKNHFKGPIPGDFCKLDQLLYLDLSKNNLSGYIPSCFSPRT  644

Query  1902  IKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFE  2081
             + HV LS+++LSG LT  F+N+++LV +DL  NSF G IP WIG +S LS LLL  N F+
Sbjct  645   LIHVHLSENRLSGPLTHGFYNSSSLVTMDLRDNSFTGSIPNWIGNLSSLSVLLLKANHFD  704

Query  2082  GKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISL-EGTNEQFRGINLPFEYYSINDAI  2258
             G++P Q+C L +L++LD+S N L G +P CLG ++  E + + F  +   F   SI +A 
Sbjct  705   GELPVQLCLLEKLNILDVSQNQLFGPLPSCLGNLTFKESSQKAFVYLRYVFLTKSIKEAY  764

Query  2259  LDRLHYEWGSDDEY--IPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
              + +      D  Y       ++    ++F TK   Y+Y   IL
Sbjct  765   YETMGPPL-VDSMYNLEKGFQLNFTEVIEFTTKNMYYSYMGKIL  807


 Score =   125 bits (314),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 180/661 (27%), Positives = 287/661 (43%), Gaps = 102/661 (15%)
 Frame = +3

Query  498   TIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEE  677
             T    S LE L+L+N S  +   L ++ A  ++K L +   ++     +     L +L++
Sbjct  224   TFFYSSTLEELYLDNTSLPI-NFLQNIGALHALKVLSVAGCDLHGTLPVQGWCELKNLKQ  282

Query  678   LHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGK  857
             L L G+N        +G + SL++L +S  Q  G + +     L +L+ L LS N  E  
Sbjct  283   LDLSGNNFGGSLPDCLGNLSSLQLLDVSENQFIGNIASGPFTNLISLEFLSLSNNLFEVP  342

Query  858   I------------------------PSYFGNLT-SLRYVNLSLNKLSGNIelsplstlts  962
                                      P+ F NL    + V   L+K +  + +     L  
Sbjct  343   TSMKPFMNHSSLKFFSSENNKLVTEPAAFDNLIPKFQLVFFRLSKTTKALNVEIPDFLYY  402

Query  963   leylsIMNNSFE-VASSFRSF--ANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLS  1133
                L +++ S   +   F S+   NN++L  +    N  +   QLQ   P   +  L +S
Sbjct  403   QYDLRVLDLSHNNITGMFPSWLLKNNTRLEELWLSENSFVGALQLQDH-PYSNMIELDIS  461

Query  1134  NCIDLLKLPR-FLHYQRDLKVLRISRNNLEGEFPSWL----------LQNN---------  1253
             N     ++P+       +L  L++++N   G  PS L          L NN         
Sbjct  462   NNNMNGQIPKDICLIFPNLWSLKMAKNGFTGGIPSCLGNISSFSVLDLSNNQLSIVKLEQ  521

Query  1254  -TKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSS  1430
              T + +  ++NN   G +  S   + +L ++ +S N   G+IS    + +   + L+LS+
Sbjct  522   LTAIMFLNLSNNNLGGQIPTSVFNSSSLDVLFLSGNNFWGQISDFPLNGWKEWVVLDLSN  581

Query  1431  NLFSGQLHSLI--GTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEF  1604
             N FSG++       T L  +DLS N F G IP +       L+ L LS N L G I   F
Sbjct  582   NQFSGKVPRWFVNSTFLRSIDLSKNHFKGPIPGD-FCKLDQLLYLDLSKNNLSGYIPSCF  640

Query  1605  DYLSSLEYLHLDGNNFEGTIpnsls-nlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLS  1781
                 +L ++HL  N   G + +    +  L ++D+RDN  +G IP W+G L+SL  L L 
Sbjct  641   S-PRTLIHVHLSENRLSGPLTHGFYNSSSLVTMDLRDNSFTGSIPNWIGNLSSLSVLLLK  699

Query  1782  KNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIK-----------HVSLSK-  1925
              NH +G +P++ C L+ L+ILD+S+N L G +PSCL   + K           +V L+K 
Sbjct  700   ANHFDGELPVQLCLLEKLNILDVSQNQLFGPLPSCLGNLTFKESSQKAFVYLRYVFLTKS  759

Query  1926  -----HQLSG--------QLTRAFFNNTALVI---------------------LDLSYNS  2003
                  ++  G         L + F  N   VI                     +DLS N+
Sbjct  760   IKEAYYETMGPPLVDSMYNLEKGFQLNFTEVIEFTTKNMYYSYMGKILNYMYGIDLSNNN  819

Query  2004  FVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKI  2183
             FVG IP   G +S + SL L+ N   G +P     L  +  LDLS N L+G IP  L +I
Sbjct  820   FVGAIPPEFGNLSAILSLNLSHNNLTGSIPATFSNLKHIESLDLSYNNLNGAIPPQLTEI  879

Query  2184  S  2186
             +
Sbjct  880   T  880


 Score =   118 bits (296),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 192/712 (27%), Positives = 318/712 (45%), Gaps = 69/712 (10%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             LEEL++  T +  IN L   N+    +LKVL +         P+      K L++L L  
Sbjct  231   LEELYLDNTSLP-INFLQ--NIGALHALKVLSVAGCDLHGTLPVQGWCELKNLKQLDLSG  287

Query  294   CRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---GFE  464
               F  S+   L    SL++LD+ +N F  G +      +L +L+ L LS+N FE     +
Sbjct  288   NNFGGSLPDCLGNLSSLQLLDVSENQFI-GNIASGPFTNLISLEFLSLSNNLFEVPTSMK  346

Query  465   TSANHSGSSRHTIRN-KSYLEVLHLNN-------ISFDMTKLLSSL-AAFPS-------I  596
                NHS     +  N K   E    +N       + F ++K   +L    P        +
Sbjct  347   PFMNHSSLKFFSSENNKLVTEPAAFDNLIPKFQLVFFRLSKTTKALNVEIPDFLYYQYDL  406

Query  597   KTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVG  776
             + L+L   N+T +     LKN + LEEL L  ++          P  ++  L +S   + 
Sbjct  407   RVLDLSHNNITGMFPSWLLKNNTRLEELWLSENSFVGALQLQDHPYSNMIELDISNNNMN  466

Query  777   GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstl  956
             G +P        NL  L +++N   G IPS  GN++S   ++LS N+LS    +  L  L
Sbjct  467   GQIPKDICLIFPNLWSLKMAKNGFTGGIPSCLGNISSFSVLDLSNNQLS----IVKLEQL  522

Query  957   tsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKV---IADTQLQGFVPKFQLDSLS  1127
             T++ +L++ NN+         F N+S L V+    N     I+D  L G+     LD   
Sbjct  523   TAIMFLNLSNNNLGGQIPTSVF-NSSSLDVLFLSGNNFWGQISDFPLNGWKEWVVLD---  578

Query  1128  LSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLK  1307
             LSN     K+PR+      L+ + +S+N+ +G  P    + + +L Y  ++ N  +G   
Sbjct  579   LSNNQFSGKVPRWFVNSTFLRSIDLSKNHFKGPIPGDFCKLD-QLLYLDLSKNNLSG--Y  635

Query  1308  LSSHVNPNLQI-INVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLG  1478
             + S  +P   I +++S N+L G ++  F +S  +++ ++L  N F+G + + IG  + L 
Sbjct  636   IPSCFSPRTLIHVHLSENRLSGPLTHGFYNS-SSLVTMDLRDNSFTGSIPNWIGNLSSLS  694

Query  1479  FLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIV-------------QEFDYLSS  1619
              L L  N F GE+P ++ +    L IL +S N+L G +              + F YL  
Sbjct  695   VLLLKANHFDGELPVQLCL-LEKLNILDVSQNQLFGPLPSCLGNLTFKESSQKAFVYLRY  753

Query  1620  L--------EYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGR-LTSLVQL  1772
             +         Y    G     ++ N      L+  ++ +         +MG+ L  +  +
Sbjct  754   VFLTKSIKEAYYETMGPPLVDSMYNLEKGFQLNFTEVIEFTTKNMYYSYMGKILNYMYGI  813

Query  1773  TLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVS---LSKHQLSGQ  1943
              LS N+  G IP EF NL ++  L+LS NNLTGSIP+    S++KH+    LS + L+G 
Sbjct  814   DLSNNNFVGAIPPEFGNLSAILSLNLSHNNLTGSIPATF--SNLKHIESLDLSYNNLNGA  871

Query  1944  LTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQ  2099
             +       T L +  +++N+  G  PE         +    GN F    P Q
Sbjct  872   IPPQLTEITTLEVFSVAHNNLSGKTPERKYQFGTFDASCYKGNPFLCGTPLQ  923



>ref|XP_006471617.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1-like 
isoform X6 [Citrus sinensis]
Length=1100

 Score =   362 bits (930),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 286/710 (40%), Positives = 400/710 (56%), Gaps = 30/710 (4%)
 Frame = +3

Query  171   LNLKDFISLK---VLDIGFNKFQSFGPINDVGGAKKLEELYLFECRF-NQSIFQSLKGFP  338
             +++K+F SL+    LDIG NK   F    +      LEEL +      N  + Q  KG  
Sbjct  170   IDVKEFDSLRDLEELDIGRNKIDKFVVSKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLR  229

Query  339   SLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSY  518
              LK L L+     DG   +Q +    +L  L LS N F    T+          + N + 
Sbjct  230   KLKTLYLLGVGIRDGSKLLQSMGSFPSLNNLDLSYNNFTDTVTTT-------QELHNFAN  282

Query  519   LEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSN  698
             LE L L+  S  ++ L S    FPS+K L +    V  +       +  SLE L +D   
Sbjct  283   LEYLTLHGSSLHISFLQSIALMFPSLKNLSMLDCKVNGVVRGQGFPHFKSLEHLDMDDLR  342

Query  699   --LHKDFLSNIG-PMESLKVLSLSGAQV----GGTLPNKGLCELKNLQELWLSENQLEGK  857
               L+  FL  IG  M SLK LSLS +       G L  +GLC L +LQEL +++N+L G 
Sbjct  343   IVLNTSFLQIIGESMPSLKYLSLSYSSAITNSSGIL--QGLCSLVHLQELHMADNELRGS  400

Query  858   IPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSK  1037
             +P    N+TSLR +++S N+L+G+I  SPL  LTS+E LS+ NN F +  S     N+S+
Sbjct  401   LPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSR  460

Query  1038  LRVILADRNKVIADTQLQGFV--PKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISR  1208
             L++  AD N + A       +  PKFQL SLSLS+   D +  P+FL+YQ DL+ +  SR
Sbjct  461   LKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSR  520

Query  1209  NNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNF  1388
               + GEFP+WLL+NNTKL+   + N++  G  +L  H + +L++++VSNN   G I    
Sbjct  521   IQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEI  580

Query  1389  SSSFPNILALNLSSNLFSGQLHSLIGTH--LGFLDLSNNSFTGEIPKEMLISCSSLVILK  1562
                 P +++ N+S N   G + S  G    L  LDLSNN  TGEIP+ + + C +L  L 
Sbjct  581   GDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLA  640

Query  1563  LSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGEIPR  1739
             LSNN L+G +      L +L +L L+GN+F G I  +      L  L + +N LSG+IPR
Sbjct  641   LSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPR  700

Query  1740  WMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSL  1919
             W+G LT L+ + + KNHLEG IP+EFC+L SL ILD+S+NN++GS+PSC +P SI  V L
Sbjct  701   WLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHL  760

Query  1920  SKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPT  2096
             SK+ L GQL    FFN ++LV LDLSYN   G IP+WI  +S+LS L+L  N  EG+VP 
Sbjct  761   SKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPV  820

Query  2097  QVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSI  2246
             Q+C L +L LLDLSNN L G+IP C     L   +E +   + P E + I
Sbjct  821   QLCGLNQLQLLDLSNNNLHGLIPPCFDNTKL---HESYNNSSSPDEQFKI  867


 Score =   128 bits (321),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 193/704 (27%), Positives = 296/704 (42%), Gaps = 106/704 (15%)
 Frame = +3

Query  192   SLKVLDIGFNKF--QSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMD  365
             SLK L + ++     S G +  +     L+EL++ +     S+   L    SL+ILD+  
Sbjct  359   SLKYLSLSYSSAITNSSGILQGLCSLVHLQELHMADNELRGSLPWCLANMTSLRILDVSS  418

Query  366   NDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNN-  542
             N    G +    +  L +++EL LS+N+F        H   S   + N S L++ + +N 
Sbjct  419   NQL-TGSISSSPLFYLTSIEELSLSNNHF--------HIPISLEPLFNHSRLKIFYADNN  469

Query  543   -ISFDMTK------------------LLSSLAAFPS-------IKTLELQRVNVTNIDAI  644
              I+  +TK                         FP        ++ +   R+ +      
Sbjct  470   PINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPN  529

Query  645   HALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQE  824
               L+N + L +L L   +L   F   I     L++L +S     G +P +    L  L  
Sbjct  530   WLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLIS  589

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
               +S N L+G IPS FGN+  L+ ++LS N+L+G I         +LE+L++ NNS +  
Sbjct  590   FNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGH  649

Query  1005  SSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRD  1184
                R+F N   LR +  + N  + +   Q       L+ L L+N     K+PR+L     
Sbjct  650   MFSRNF-NLINLRWLQLEGNHFVGEIP-QSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTW  707

Query  1185  LKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKL  1364
             L  + + +N+LEG  P       + LQ   +++N  +GSL    H     Q+ ++S N L
Sbjct  708   LIHIIMPKNHLEGPIPVEFCHLYS-LQILDISDNNISGSLPSCFHPLSITQV-HLSKNML  765

Query  1365  CGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLIS  1538
              G++ G    +  +++ L+LS NL +G +   I   + L  L L NN+  GE+P + L  
Sbjct  766   HGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQ-LCG  824

Query  1539  CSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN-----------------------  1649
              + L +L LSNN L G I   FD       LH   NN                       
Sbjct  825   LNQLQLLDLSNNNLHGLIPPCFDNTK----LHESYNNSSSPDEQFKILFSIKGHQGHVEK  880

Query  1650  -----FEGT------IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLE  1796
                  FE T      I        L  LD+  NKL G IP  +G LT +  L LS N+L 
Sbjct  881   KIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLT  940

Query  1797  GHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTAL  1976
             G IP  F NLK +  LDLS N L G IP               HQL             L
Sbjct  941   GLIPSTFSNLKQIESLDLSYNKLNGKIP---------------HQL--------VELKEL  977

Query  1977  VILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
              +  ++YN+  G IPEW    +  +     GN F   +P  +C+
Sbjct  978   AVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICR  1021


 Score = 82.8 bits (203),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 170/680 (25%), Positives = 274/680 (40%), Gaps = 128/680 (19%)
 Frame = +3

Query  393   IQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLS  572
             I+ ++ L NLK L LS+N F       N+S  S  T  +      L+ N +   +     
Sbjct  123   IERLSRLNNLKVLDLSENSF-------NNSILSSLTRLSSLRSLNLYGNRLEGSI-----  170

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALK---NLSSLEELHLDGSNLHK-DFLSNIGPMES  740
              +  F S++ LE   +    ID     K   +LS+LEEL + G+ +   +       +  
Sbjct  171   DVKEFDSLRDLEELDIGRNKIDKFVVSKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLRK  230

Query  741   LKVLSLSGAQV-GGTLPNKGLCELKNLQELWLSENQLEGKIPSY--FGNLTSLRYVNLSL  911
             LK L L G  +  G+   + +    +L  L LS N     + +     N  +L Y+ L  
Sbjct  231   LKTLYLLGVGIRDGSKLLQSMGSFPSLNNLDLSYNNFTDTVTTTQELHNFANLEYLTLHG  290

Query  912   NKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQ  1091
             + L  +   S      SL+ LS+++         + F +   L  +  D  +++ +T   
Sbjct  291   SSLHISFLQSIALMFPSLKNLSMLDCKVNGVVRGQGFPHFKSLEHLDMDDLRIVLNTSFL  350

Query  1092  GFV----PKFQLDSLSLSNCID-----LLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLL  1244
               +    P  +  SLS S+ I      L  L   +H Q     L ++ N L G  P W L
Sbjct  351   QIIGESMPSLKYLSLSYSSAITNSSGILQGLCSLVHLQE----LHMADNELRGSLP-WCL  405

Query  1245  QNNTKLQYFLMNNNAFTGSLKLSS-----------------HV---------NPNLQIIN  1346
              N T L+   +++N  TGS+  S                  H+         +  L+I  
Sbjct  406   ANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFY  465

Query  1347  VSNNKLCGEISGNFSSSFPNI-LALNLSSNLFSGQL---------HSLIGTHLGFLDLSN  1496
               NN +  +I+ + + + P   LA    S+ +   +         H L   H   + ++ 
Sbjct  466   ADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMN-  524

Query  1497  NSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnsl  1676
                 GE P  +L + + L  L L N+ L G           L  L +  NNF+G IP   
Sbjct  525   ----GEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPV--  578

Query  1677  snlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSE  1856
                          ++   +PR       L+   +S N L+G IP  F N+  L ILDLS 
Sbjct  579   -------------EIGDILPR-------LISFNISMNALDGSIPSSFGNMNLLQILDLSN  618

Query  1857  NNLTGSIP-----SCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIP  2021
             N LTG IP      C+N   ++ ++LS + L G +    FN   L  L L  N FVG IP
Sbjct  619   NQLTGEIPEHLAMGCVN---LEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIP  675

Query  2022  E------------------------WIGTIsrlsslllNGNRFEGKVPTQVCQLMRlsll  2129
             +                        W+G ++ L  +++  N  EG +P + C L  L +L
Sbjct  676   QSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQIL  735

Query  2130  dlsnnllsGVIPRCLGKISL  2189
             D+S+N +SG +P C   +S+
Sbjct  736   DISDNNISGSLPSCFHPLSI  755



>ref|XP_006471613.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1-like 
isoform X2 [Citrus sinensis]
Length=1286

 Score =   365 bits (937),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 290/765 (38%), Positives = 422/765 (55%), Gaps = 68/765 (9%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             L  L + Y    +I I +   L +F +L+ L + ++       +  +     L+ L +  
Sbjct  303   LNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDYSSLH-ISLLQSIASFTSLKNLSMSY  361

Query  294   CRFNQSIF-QSLKGFPSLKILDLMDNDF-----------------------YDGPLHIQD  401
             C  N  +  Q L+   +LK+LDL  N F                        +G +++++
Sbjct  362   CEVNGVLSGQGLERLANLKMLDLRGNLFNNSILSSLARLSSLTSLDLSYNRLEGSINVKE  421

Query  402   INDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISF-DMTKLLSSL  578
              + L NL+EL +S N  + FE    + G  +        L+ L+L  +   D +KLL S+
Sbjct  422   FDSLSNLEELDMSGNEIDNFEVPQGYKGLRK--------LKTLYLLGVGIRDGSKLLQSM  473

Query  579   AAFPSIKTLELQRVNVTN-IDAIHALKNLSSLEEL------------HLDGSNLH----K  707
              +FPS+  L+L   N T+ +     L N ++LE L            HLD  +L      
Sbjct  474   GSFPSLNNLDLSYNNFTDTVTTTQELHNFANLEYLTLHGFPHFKSLEHLDMDDLRIVLNT  533

Query  708   DFLSNIG-PMESLKVLSLSGAQV----GGTLPNKGLCELKNLQELWLSENQLEGKIPSYF  872
              FL  IG  M SLK LSLS +       G L  +GLC L +LQEL +++N+L G +P   
Sbjct  534   SFLQIIGESMPSLKYLSLSYSSAITNSSGIL--QGLCSLVHLQELHMADNELRGSLPWCL  591

Query  873   GNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVIL  1052
              N+TSLR +++S N+L+G+I  SPL  LTS+E LS+ NN F +  S     N+S+L++  
Sbjct  592   ANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFY  651

Query  1053  ADRNKVIADTQLQGFV--PKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEG  1223
             AD N + A       +  PKFQL SLSLS+   D +  P+FL+YQ DL+ +  SR  + G
Sbjct  652   ADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNG  711

Query  1224  EFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP  1403
             EFP+WLL+NNTKL+   + N++  G  +L  H + +L++++VSNN   G I        P
Sbjct  712   EFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILP  771

Query  1404  NILALNLSSNLFSGQLHSLIGTH--LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNK  1577
              +++ N+S N   G + S  G    L  LDLSNN  TGEIP+ + + C +L  L LSNN 
Sbjct  772   RLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNS  831

Query  1578  LEGQIVQEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGEIPRWMGRL  1754
             L+G +      L +L +L L+GN+F G I  +      L  L + +N LSG+IPRW+G L
Sbjct  832   LKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNL  891

Query  1755  TSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQL  1934
             T L+ + + KNHLEG IP+EFC+L SL ILD+S+NN++GS+PSC +P SI  V LSK+ L
Sbjct  892   TWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLSKNML  951

Query  1935  SGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQL  2111
              GQL    FFN ++LV LDLSYN   G IP+WI  +S+LS L+L  N  EG+VP Q+C L
Sbjct  952   HGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGL  1011

Query  2112  MRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSI  2246
              +L LLDLSNN L G+IP C     L   +E +   + P E + I
Sbjct  1012  NQLQLLDLSNNNLHGLIPPCFDNTKL---HESYNNSSSPDEQFKI  1053


 Score =   141 bits (355),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 226/802 (28%), Positives = 346/802 (43%), Gaps = 159/802 (20%)
 Frame = +3

Query  171   LNLKDFISLK---VLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPS  341
             +++K+F SL+    LDIG NK   F    D+    KL+ L L   + N+SI  SL  F S
Sbjct  170   IDVKEFDSLRDLEELDIGRNKIDKFVVSKDL---SKLKSLGLSGVKLNRSILSSLTVFYS  226

Query  342   LKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYL  521
             L+ LD+ +  F  G   ++D +   NL+ L +S N  +       + G  +        L
Sbjct  227   LRELDISETGF-KGTFDVRDFDSFNNLEVLDMSGNEIDNLVVPQGYKGLRK--------L  277

Query  522   EVLHLNNISF-DMTKLLSSLAAFPSIKTLELQRVNVTNI--DAIHALKNLSSLEELHLDG  692
             + L L+ +   D +KLL S+ +FPS+ TL+L   N T+I       L N ++LE L LD 
Sbjct  278   KSLDLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDY  337

Query  693   SNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYF  872
             S+LH   L +I    SLK LS+S  +V G L  +GL  L NL+ L L  N     I S  
Sbjct  338   SSLHISLLQSIASFTSLKNLSMSYCEVNGVLSGQGLERLANLKMLDLRGNLFNNSILSSL  397

Query  873   GNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNN---SFEVASSFRSFANNSKLR  1043
               L+SL  ++LS N+L G+I +    +L++LE L +  N   +FEV   ++       L 
Sbjct  398   ARLSSLTSLDLSYNRLEGSINVKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLRKLKTLY  457

Query  1044  VI---LADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNN  1214
             ++   + D +K++   Q  G  P      LS +N  D +   + LH   +L+ L      
Sbjct  458   LLGVGIRDGSKLL---QSMGSFPSLNNLDLSYNNFTDTVTTTQELHNFANLEYL-----T  509

Query  1215  LEGEFPSWLLQNNTKLQYFLMNNNAF---TGSLKLSSHVNPNLQIINVSNNKLCGEISGN  1385
             L G FP +       L++  M++      T  L++     P+L+ +++S +      SG 
Sbjct  510   LHG-FPHF-----KSLEHLDMDDLRIVLNTSFLQIIGESMPSLKYLSLSYSSAITNSSGI  563

Query  1386  FSS--SFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLV  1553
                  S  ++  L+++ N   G L   +   T L  LD+S+N  TG I    L   +S+ 
Sbjct  564   LQGLCSLVHLQELHMADNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIE  623

Query  1554  ILKLSNNKLEGQIVQE--FDYLSSLEYLHLDGNNFEGTIpnslsnlp-------------  1688
              L LSNN     I  E  F++ S L+  + D N     I  S +                
Sbjct  624   ELSLSNNHFHIPISLEPLFNH-SRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSS  682

Query  1689  -----------lhslDIRDNKLS-----GEIPRWM------GRLTSLVQ-----------  1769
                         +  D+ D   S     GE P W+       R  SLV            
Sbjct  683   YGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPI  742

Query  1770  --------LTLSKNHLEGHIPIE-------------------------FCNLKSLSILDL  1850
                     L +S N+ +GHIP+E                         F N+  L ILDL
Sbjct  743   HSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDL  802

Query  1851  SENNLTGSIP-----SCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGI  2015
             S N LTG IP      C+N   ++ ++LS + L G +    FN   L  L L  N FVG 
Sbjct  803   SNNQLTGEIPEHLAMGCVN---LEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGE  859

Query  2016  IPE------------------------WIGTIsrlsslllNGNRFEGKVPTQVCQLMRls  2123
             IP+                        W+G ++ L  +++  N  EG +P + C L  L 
Sbjct  860   IPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQ  919

Query  2124  lldlsnnllsGVIPRCLGKISL  2189
             +LD+S+N +SG +P C   +S+
Sbjct  920   ILDISDNNISGSLPSCFHPLSI  941


 Score =   127 bits (320),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 193/704 (27%), Positives = 296/704 (42%), Gaps = 106/704 (15%)
 Frame = +3

Query  192   SLKVLDIGFNKF--QSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMD  365
             SLK L + ++     S G +  +     L+EL++ +     S+   L    SL+ILD+  
Sbjct  545   SLKYLSLSYSSAITNSSGILQGLCSLVHLQELHMADNELRGSLPWCLANMTSLRILDVSS  604

Query  366   NDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNN-  542
             N    G +    +  L +++EL LS+N+F        H   S   + N S L++ + +N 
Sbjct  605   NQL-TGSISSSPLFYLTSIEELSLSNNHF--------HIPISLEPLFNHSRLKIFYADNN  655

Query  543   -ISFDMTK------------------LLSSLAAFPS-------IKTLELQRVNVTNIDAI  644
              I+  +TK                         FP        ++ +   R+ +      
Sbjct  656   PINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPN  715

Query  645   HALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQE  824
               L+N + L +L L   +L   F   I     L++L +S     G +P +    L  L  
Sbjct  716   WLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLIS  775

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
               +S N L+G IPS FGN+  L+ ++LS N+L+G I         +LE+L++ NNS +  
Sbjct  776   FNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGH  835

Query  1005  SSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRD  1184
                R+F N   LR +  + N  + +   Q       L+ L L+N     K+PR+L     
Sbjct  836   MFSRNF-NLINLRWLQLEGNHFVGEIP-QSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTW  893

Query  1185  LKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKL  1364
             L  + + +N+LEG  P       + LQ   +++N  +GSL    H     Q+ ++S N L
Sbjct  894   LIHIIMPKNHLEGPIPVEFCHLYS-LQILDISDNNISGSLPSCFHPLSITQV-HLSKNML  951

Query  1365  CGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLIS  1538
              G++ G    +  +++ L+LS NL +G +   I   + L  L L NN+  GE+P + L  
Sbjct  952   HGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQ-LCG  1010

Query  1539  CSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN-----------------------  1649
              + L +L LSNN L G I   FD       LH   NN                       
Sbjct  1011  LNQLQLLDLSNNNLHGLIPPCFDNTK----LHESYNNSSSPDEQFKILFSIKGHQGHVEK  1066

Query  1650  -----FEGT------IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLE  1796
                  FE T      I        L  LD+  NKL G IP  +G LT +  L LS N+L 
Sbjct  1067  KIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLT  1126

Query  1797  GHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTAL  1976
             G IP  F NLK +  LDLS N L G IP               HQL             L
Sbjct  1127  GLIPSTFSNLKQIESLDLSYNKLNGKIP---------------HQL--------VELKEL  1163

Query  1977  VILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
              +  ++YN+  G IPEW    +  +     GN F   +P  +C+
Sbjct  1164  AVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICR  1207



>ref|XP_006385264.1| hypothetical protein POPTR_0003s02250g [Populus trichocarpa]
 gb|ERP63061.1| hypothetical protein POPTR_0003s02250g [Populus trichocarpa]
Length=953

 Score =   359 bits (921),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 247/594 (42%), Positives = 361/594 (61%), Gaps = 30/594 (5%)
 Frame = +3

Query  657   NLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLS  836
             N S+LEEL+LD ++L  +FL NIG + +LKVLS++   + GTLP +G CELKNL++L L+
Sbjct  171   NSSTLEELYLDNTSLRINFLQNIGALPALKVLSVAECDLHGTLPAQGWCELKNLKQLDLA  230

Query  837   ENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFR  1016
              N   G +P   GNL+SL+ +++S N+ +GN    PL+ L SLE+L + NN FEV  S +
Sbjct  231   RNNFGGSLPDCLGNLSSLQLLDVSENQFTGNFTSGPLTNLISLEFLLLSNNLFEVPISMK  290

Query  1017  SFANNSKLRVILADRNKVIAD-TQLQGFVPKFQLDSLSLSNCID---LLKLPRFLHYQRD  1184
              F N+S L+   ++ N+++ +       +PKFQL    LS+      L  +P FL+YQ D
Sbjct  291   PFLNHSSLKFFSSENNRLVTEPVAFDNLIPKFQLVFFRLSSSPTSEALNVIPDFLYYQLD  350

Query  1185  LKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKL  1364
             L+ L +S NN+ G FPSWLL+NNT+L+   ++ N F G+L+L  H   N+  +++SNN +
Sbjct  351   LRALDLSHNNITGMFPSWLLKNNTRLEQLYLSANFFVGTLQLQDHPYSNMVELDISNNNM  410

Query  1365  CGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLIS  1538
              G+IS +    FPN+  L ++ N F+G + S +G  + L FLDLSNN  +    +++ I 
Sbjct  411   SGQISKDICLIFPNLWTLRMAKNGFTGCIPSCLGNISSLLFLDLSNNQLSTVQLEQLTIP  470

Query  1539  CSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplh--slDIRD  1712
                  +LKLSNN L GQI       S+ ++L+L+GNNF G I +           LD+ +
Sbjct  471   -----VLKLSNNSLGGQIPTSVFNSSTSQFLYLNGNNFSGQISDFPLYGWKELNVLDLSN  525

Query  1713  NKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLN  1892
             N+ SG +PR     T L  L LSKNH +G IP +FC L  L  LDLSENNL+G IPSC +
Sbjct  526   NQFSGMLPRIFVNFTDLRVLDLSKNHYKGPIPKDFCKLGRLQYLDLSENNLSGYIPSCFS  585

Query  1893  PSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGN  2072
             P  + HV LSK++LSG LT  FFN++ LV +DL  NS  G IP WIG  S LS LLL  N
Sbjct  586   PPPLTHVHLSKNRLSGPLTYGFFNSSYLVTMDLRDNSLTGSIPNWIGNHSSLSVLLLRAN  645

Query  2073  RFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFR---GINLPFE---  2234
              F+G++P Q+C L +LS+LD+S N LSG +P CLG ++ + ++++ R   G ++  E   
Sbjct  646   HFDGELPVQLCLLEQLSILDVSQNQLSGPLPSCLGNLTFKESSQKARMDLGASIVLESME  705

Query  2235  ---YYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEV-QFRTKGNLYNYQNSIL  2384
                Y ++   ++D + Y  G D        ++   EV +FRTK   Y Y+ +IL
Sbjct  706   KAYYKTMGPPLVDSV-YLLGKD------FRLNFTEEVIEFRTKNMYYGYKGNIL  752


 Score =   129 bits (324),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 174/605 (29%), Positives = 267/605 (44%), Gaps = 74/605 (12%)
 Frame = +3

Query  156   NILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGF  335
             +ILS  N  +  +LK LD+  N   +         +  LEELYL       +  Q++   
Sbjct  140   SILSCFN-GNLSTLKSLDLSANGLTAGS--GTFFNSSTLEELYLDNTSLRINFLQNIGAL  196

Query  336   PSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKS  515
             P+LK+L + + D + G L  Q   +L+NLK+L L+ N         N  GS    + N S
Sbjct  197   PALKVLSVAECDLH-GTLPAQGWCELKNLKQLDLARN---------NFGGSLPDCLGNLS  246

Query  516   YLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGS  695
              L++L ++   F        L    S++ L L         ++    N SSL+    + +
Sbjct  247   SLQLLDVSENQFTGNFTSGPLTNLISLEFLLLSNNLFEVPISMKPFLNHSSLKFFSSENN  306

Query  696   NLHKDFLS--NIGPMESLKVLSLSGAQVGGTL---PNKGLCELKNLQELWLSENQLEGKI  860
              L  + ++  N+ P   L    LS +     L   P+    +L +L+ L LS N + G  
Sbjct  307   RLVTEPVAFDNLIPKFQLVFFRLSSSPTSEALNVIPDFLYYQL-DLRALDLSHNNITGMF  365

Query  861   PSY-FGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNN-SFEVASSFR-SFANN  1031
             PS+   N T L  + LS N   G ++L        +E     NN S +++      F N 
Sbjct  366   PSWLLKNNTRLEQLYLSANFFVGTLQLQDHPYSNMVELDISNNNMSGQISKDICLIFPNL  425

Query  1032  SKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLL-------KLPRFLHYQRDLK  1190
               LR         +A     G +P        L N   LL       +L      Q  + 
Sbjct  426   WTLR---------MAKNGFTGCIPS------CLGNISSLLFLDLSNNQLSTVQLEQLTIP  470

Query  1191  VLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCG  1370
             VL++S N+L G+ P+ +  ++T  Q+  +N N F+G                +S+  L G
Sbjct  471   VLKLSNNSLGGQIPTSVFNSSTS-QFLYLNGNNFSGQ---------------ISDFPLYG  514

Query  1371  EISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCS  1544
                      +  +  L+LS+N FSG L  +    T L  LDLS N + G IPK+      
Sbjct  515   ---------WKELNVLDLSNNQFSGMLPRIFVNFTDLRVLDLSKNHYKGPIPKD-FCKLG  564

Query  1545  SLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpn-slsnlplhslDIRDNKL  1721
              L  L LS N L G I   F     L ++HL  N   G +     ++  L ++D+RDN L
Sbjct  565   RLQYLDLSENNLSGYIPSCFSP-PPLTHVHLSKNRLSGPLTYGFFNSSYLVTMDLRDNSL  623

Query  1722  SGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSS  1901
             +G IP W+G  +SL  L L  NH +G +P++ C L+ LSILD+S+N L+G +PSCL   +
Sbjct  624   TGSIPNWIGNHSSLSVLLLRANHFDGELPVQLCLLEQLSILDVSQNQLSGPLPSCLGNLT  683

Query  1902  IKHVS  1916
              K  S
Sbjct  684   FKESS  688


 Score =   125 bits (314),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 181/688 (26%), Positives = 315/688 (46%), Gaps = 70/688 (10%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             LEEL++  T +  IN L   N+    +LKVL +         P       K L++L L  
Sbjct  175   LEELYLDNTSLR-INFLQ--NIGALPALKVLSVAECDLHGTLPAQGWCELKNLKQLDLAR  231

Query  294   CRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---GFE  464
               F  S+   L    SL++LD+ +N F  G      + +L +L+ L LS+N FE     +
Sbjct  232   NNFGGSLPDCLGNLSSLQLLDVSENQF-TGNFTSGPLTNLISLEFLLLSNNLFEVPISMK  290

Query  465   TSANHSGSSRHTIRNKSYL-EVLHLNNISFDMTKLLSSLAAFPS----------------  593
                NHS     +  N   + E +  +N+      +   L++ P+                
Sbjct  291   PFLNHSSLKFFSSENNRLVTEPVAFDNLIPKFQLVFFRLSSSPTSEALNVIPDFLYYQLD  350

Query  594   IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQV  773
             ++ L+L   N+T +     LKN + LE+L+L  +           P  ++  L +S   +
Sbjct  351   LRALDLSHNNITGMFPSWLLKNNTRLEQLYLSANFFVGTLQLQDHPYSNMVELDISNNNM  410

Query  774   GGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
              G + +K +C +  NL  L +++N   G IPS  GN++SL +++LS N+LS     +   
Sbjct  411   SGQI-SKDICLIFPNLWTLRMAKNGFTGCIPSCLGNISSLLFLDLSNNQLS-----TVQL  464

Query  951   tltsleylsIMNNSF--EVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSL  1124
                ++  L + NNS   ++ +S  + + +  L +   + +  I+D  L G+    +L+ L
Sbjct  465   EQLTIPVLKLSNNSLGGQIPTSVFNSSTSQFLYLNGNNFSGQISDFPLYGWK---ELNVL  521

Query  1125  SLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSL  1304
              LSN      LPR      DL+VL +S+N+ +G  P    +   +LQY  ++ N  +G +
Sbjct  522   DLSNNQFSGMLPRIFVNFTDLRVLDLSKNHYKGPIPKDFCKLG-RLQYLDLSENNLSGYI  580

Query  1305  KLSSHVNPNLQIINVSNNKLCGEIS-GNFSSSFPNILALNLSSNLFSGQLHSLIGTH--L  1475
               S    P L  +++S N+L G ++ G F+SS+  ++ ++L  N  +G + + IG H  L
Sbjct  581   P-SCFSPPPLTHVHLSKNRLSGPLTYGFFNSSY--LVTMDLRDNSLTGSIPNWIGNHSSL  637

Query  1476  GFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ--------------EFDYL  1613
               L L  N F GE+P ++ +    L IL +S N+L G +                  D  
Sbjct  638   SVLLLRANHFDGELPVQLCL-LEQLSILDVSQNQLSGPLPSCLGNLTFKESSQKARMDLG  696

Query  1614  SSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGR----------LTSL  1763
             +S+    ++   ++   P  + ++ L   D R N  + E+  +  +          L+ +
Sbjct  697   ASIVLESMEKAYYKTMGPPLVDSVYLLGKDFRLN-FTEEVIEFRTKNMYYGYKGNILSYM  755

Query  1764  VQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSG  1940
               + LS N+  G IP EF NL  +  L+LS NN T SIP+   N   I+ + LS + L+G
Sbjct  756   SGIDLSNNNFGGAIPQEFGNLSEIRSLNLSHNNPTESIPATFSNLKQIESLDLSYNNLNG  815

Query  1941  QLTRAFFNNTALVILDLSYNSFVGIIPE  2024
              +       T L +  +++N+  G  PE
Sbjct  816   VIPPQLTEITTLEVFSVAHNNLSGWTPE  843



>ref|XP_010250305.1| PREDICTED: receptor-like protein kinase [Nelumbo nucifera]
Length=1142

 Score =   362 bits (928),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 295/760 (39%), Positives = 422/760 (56%), Gaps = 53/760 (7%)
 Frame = +3

Query  90    ERLTGLINLEELHMR-----YTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDV  254
             + L GL NL+ L +      Y  ++++  L+ L       L+VLD+ +N F +   +  +
Sbjct  135   QELAGLENLQMLDLSGNTIFYGTLQDLEPLNRLK-----KLEVLDLSYNGFDN-SILPSL  188

Query  255   GGAKKLEELYLFECRF-NQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRN-LKE  428
             G  K L+ L L    F N   F+ L G  +L++LDL  N    G L +Q +  L + LK 
Sbjct  189   GALKSLKNLSLSRNDFTNPFPFEELAGLENLRMLDLSGNGL-KGTLGLQGLKHLFDRLKN  247

Query  429   LYLSDNYFEGFETSA------------------NHSGSSR-HTIRNKSYLEVLHLNNISF  551
             L + D  +  F+TS                   N  G+ R   ++    LEVL ++  +F
Sbjct  248   LEVLDLSYNSFDTSIFTYLEALLSLKFLYLRGNNMVGTFRWEGVKRLRKLEVLDISGNNF  307

Query  552   DMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGP  731
             + T L +     P+IKTL L   +++       L  L  LE L L GS L  DFL NIG 
Sbjct  308   NTTNLQNIGLLAPNIKTLYLGGNDLSGPITDQELGTLRELEFLDLFGSTLSYDFLQNIGE  367

Query  732   MESLKVLSLSGAQV--GGTLPNKGLCELKNLQELWLS------ENQ--LEGKIPSYFGNL  881
             M SLK L ++  +   G  LP KGLC+L  LQEL LS      EN     G + S  GNL
Sbjct  368   MVSLKFLRMANIKGLNGTRLPCKGLCKLNKLQELDLSQLDGNYENNYGFVGDLDSCLGNL  427

Query  882   TSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADR  1061
             TSLR ++LS N+  GNI LS +  L+SLEYL + +  F+   SF + AN SKL V   D 
Sbjct  428   TSLRVLDLSYNQFDGNIVLSTIRGLSSLEYLDLSSIRFQGYFSFNTLANLSKLEVFRFDN  487

Query  1062  NKVI-ADTQLQGFVPKFQLDSLSLSNCIDLLK----LPRFLHYQRDLKVLRISRNNLEG-  1223
             N+++  +T     VP++QL  L L+      K    +P FLHYQ DL+V+ +  NN    
Sbjct  488   NQLLQVETDFPFLVPRYQLKFLYLAR-FSFNKPPGLMPNFLHYQFDLRVVSLYYNNFNST  546

Query  1224  EFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP  1403
             +FP+WLL+NN  L+   + NN+FTG+L L S    NL I+ VS N L G+I  N    FP
Sbjct  547   QFPTWLLENNAGLEVLHLKNNSFTGTLVLPSRSCMNLSILIVSGNHLHGQIPDNIGVIFP  606

Query  1404  NILALNLSSNLFSGQLHSLIGTH--LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNK  1577
             N++AL + SN F G++ S IG+   L  LDLS NS +G+IP  ++  CS L  LKLSNN 
Sbjct  607   NLVALQMPSNAFIGKIPSSIGSMRWLQLLDLSGNSLSGQIPMHLVTGCSRLYSLKLSNNN  666

Query  1578  LEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsn-lplhslDIRDNKLSGEIPRWMGRL  1754
             L GQ++     L+ L +L LDGN F   IP+SLS  + L  L++R+N ++G +P W+G L
Sbjct  667   LHGQMLPIVSNLTGLRHLFLDGNKFTRNIPHSLSRNVALELLNVRNNNITGRLPGWIGNL  726

Query  1755  TSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQL  1934
             + L  L ++ N LEG +P  FC L  LS +DLS N  +G++PSC +P  +++    K++L
Sbjct  727   SYLKVLIMANNQLEGALPASFCALGKLSAIDLSNNYFSGAVPSCFSPRGLRYAHFEKNKL  786

Query  1935  SGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLM  2114
              G +T AF  +T+LV LD+S N   G +P WIG +  L +LLL  N+ EG +P Q+C L 
Sbjct  787   EGPMTEAFSKSTSLVTLDMSDNLLNGSLPTWIGNLLSLGALLLKRNQLEGNIPIQICHLK  846

Query  2115  RlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFE  2234
             R++++DLS+N LSG IP CL  ++ +G      GI+  FE
Sbjct  847   RINIMDLSHNNLSGPIPSCLKNLTFKGQGYIHDGIDARFE  886


 Score =   107 bits (267),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 207/749 (28%), Positives = 307/749 (41%), Gaps = 126/749 (17%)
 Frame = +3

Query  186   FISLKVLDIGFNKFQSF---GPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILD  356
             F  L+ LD+  N F+ F     +  +G  KKLE L L    F+ SI +SL    SLK L 
Sbjct  63    FDELQHLDLSHNHFKGFVEDQGLEALGRLKKLEVLDLSSNEFDNSIMRSLGALKSLKNLS  122

Query  357   LMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHL  536
             L  NDF + P   Q++  L NL+ L LS N      T    +      +     LEVL L
Sbjct  123   LGWNDFTN-PFPYQELAGLENLQMLDLSGN------TIFYGTLQDLEPLNRLKKLEVLDL  175

Query  537   NNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFL  716
             +   FD   +L SL A  S+K L L R + TN      L  L                  
Sbjct  176   SYNGFD-NSILPSLGALKSLKNLSLSRNDFTNPFPFEELAGL------------------  216

Query  717   SNIGPMESLKVLSLSGAQVGGTLPNKGLC----ELKNLQELWLSENQLEGKIPSYFGNLT  884
                   E+L++L LSG  + GTL  +GL      LKNL+ L LS N  +  I +Y   L 
Sbjct  217   ------ENLRMLDLSGNGLKGTLGLQGLKHLFDRLKNLEVLDLSYNSFDTSIFTYLEALL  270

Query  885   SLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVAS--SFRSFANNSKLRVILA-  1055
             SL+++ L  N + G      +  L  LE L I  N+F   +  +    A N K   +   
Sbjct  271   SLKFLYLRGNNMVGTFRWEGVKRLRKLEVLDISGNNFNTTNLQNIGLLAPNIKTLYLGGN  330

Query  1056  DRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEG----  1223
             D +  I D +L        LD    +   D L+    +     LK LR++  N++G    
Sbjct  331   DLSGPITDQELGTLRELEFLDLFGSTLSYDFLQ---NIGEMVSLKFLRMA--NIKGLNGT  385

Query  1224  EFPSWLLQNNTKLQYFLM--------NNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEIS  1379
               P   L    KLQ   +        NN  F G L        +L+++++S N+  G I 
Sbjct  386   RLPCKGLCKLNKLQELDLSQLDGNYENNYGFVGDLDSCLGNLTSLRVLDLSYNQFDGNIV  445

Query  1380  GNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDL---SNNS-------FTGEIPKEM  1529
              +      ++  L+LSS  F G        +L  L++    NN        F   +P+  
Sbjct  446   LSTIRGLSSLEYLDLSSIRFQGYFSFNTLANLSKLEVFRFDNNQLLQVETDFPFLVPRYQ  505

Query  1530  LISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDI-  1706
             L     L + + S NK  G +     Y   L  + L  NNF  T   +        L++ 
Sbjct  506   L---KFLYLARFSFNKPPGLMPNFLHYQFDLRVVSLYYNNFNSTQFPTWLLENNAGLEVL  562

Query  1707  --RDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIP----IEFCNL--------------  1826
               ++N  +G +        +L  L +S NHL G IP    + F NL              
Sbjct  563   HLKNNSFTGTLVLPSRSCMNLSILIVSGNHLHGQIPDNIGVIFPNLVALQMPSNAFIGKI  622

Query  1827  -------KSLSILDLSENNLTGSIPSCL--------------------------NPSSIK  1907
                    + L +LDLS N+L+G IP  L                          N + ++
Sbjct  623   PSSIGSMRWLQLLDLSGNSLSGQIPMHLVTGCSRLYSLKLSNNNLHGQMLPIVSNLTGLR  682

Query  1908  HVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGK  2087
             H+ L  ++ +  +  +   N AL +L++  N+  G +P WIG +S L  L++  N+ EG 
Sbjct  683   HLFLDGNKFTRNIPHSLSRNVALELLNVRNNNITGRLPGWIGNLSYLKVLIMANNQLEGA  742

Query  2088  VPTQVCQLMRlslldlsnnllsGVIPRCL  2174
             +P   C L +LS +DLSNN  SG +P C 
Sbjct  743   LPASFCALGKLSAIDLSNNYFSGAVPSCF  771


 Score =   105 bits (261),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 184/702 (26%), Positives = 284/702 (40%), Gaps = 120/702 (17%)
 Frame = +3

Query  96    LTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLE  275
             L  L +L  L + Y Q +   +LS +  +   SL+ LD+   +FQ +   N +    KLE
Sbjct  424   LGNLTSLRVLDLSYNQFDGNIVLSTI--RGLSSLEYLDLSSIRFQGYFSFNTLANLSKLE  481

Query  276   ELYLFECRFNQSIFQSLKGFP------SLKILDLMDNDFYDGP------LHIQDINDLRN  419
              ++ F+   N  + Q    FP       LK L L    F   P      LH Q   DLR 
Sbjct  482   -VFRFD---NNQLLQVETDFPFLVPRYQLKFLYLARFSFNKPPGLMPNFLHYQF--DLR-  534

Query  420   LKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFP-SI  596
                  +   Y+  F    N +      + N + LEVLHL N SF  T +L S +    SI
Sbjct  535   -----VVSLYYNNF----NSTQFPTWLLENNAGLEVLHLKNNSFTGTLVLPSRSCMNLSI  585

Query  597   KTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVG  776
               +    ++    D I  +    +L  L +  +       S+IG M  L++L LSG  + 
Sbjct  586   LIVSGNHLHGQIPDNIGVI--FPNLVALQMPSNAFIGKIPSSIGSMRWLQLLDLSGNSLS  643

Query  777   GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstl  956
             G +P   +     L  L LS N L G++     NLT LR++ L  NK + NI  S    +
Sbjct  644   GQIPMHLVTGCSRLYSLKLSNNNLHGQMLPIVSNLTGLRHLFLDGNKFTRNIPHSLSRNV  703

Query  957   tsleylsIMNNSFEVASSFRSFANN-SKLRVILADRNKVIADTQLQGFVPKF-----QLD  1118
                      NN   +      +  N S L+V+      ++A+ QL+G +P       +L 
Sbjct  704   ALELLNVRNNN---ITGRLPGWIGNLSYLKVL------IMANNQLEGALPASFCALGKLS  754

Query  1119  SLSLSNCIDLLKLP--------RFLHYQRD---------------LKVLRISRNNLEGEF  1229
             ++ LSN      +P        R+ H++++               L  L +S N L G  
Sbjct  755   AIDLSNNYFSGAVPSCFSPRGLRYAHFEKNKLEGPMTEAFSKSTSLVTLDMSDNLLNGSL  814

Query  1230  PSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNI  1409
             P+W+  N   L   L+  N   G++ +       + I+++S+N L G I        P+ 
Sbjct  815   PTWI-GNLLSLGALLLKRNQLEGNIPIQICHLKRINIMDLSHNNLSGPI--------PSC  865

Query  1410  LALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLV-ILKLSNNKLEG  1586
             L  NL+   F GQ         G++   ++       K   +  ++L   +    ++LE 
Sbjct  866   LK-NLT---FKGQ---------GYI---HDGIDARFEKGYGMDVTNLFQFIYTYKSRLED  909

Query  1587  QIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLV  1766
             Q  Q ++     E            +   +    +  LD+  N+L+G+IP  +G L  + 
Sbjct  910   QSSQFYNTNERTEEQVEFTTKSRYDVYTGIVLGLMLGLDLSCNQLAGDIPPEIGELYEIR  969

Query  1767  QLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQL  1946
              L  S N L GHIP    NLK L  LDLS NNL GSIP    P  I+  SLS        
Sbjct  970   ALNFSHNLLSGHIPTTISNLKQLESLDLSYNNLVGSIP----PQMIELYSLSTFM-----  1020

Query  1947  TRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGN  2072
                           +++N+  G IPEW G  +        GN
Sbjct  1021  --------------VAHNNLSGKIPEWKGQFATFGESSYEGN  1048



>ref|XP_006471616.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1-like 
isoform X5 [Citrus sinensis]
Length=1252

 Score =   363 bits (932),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 290/708 (41%), Positives = 402/708 (57%), Gaps = 63/708 (9%)
 Frame = +3

Query  171   LNLKDFISL---KVLDIGFNKFQSFGPINDVGGAKKLEELYLFEC--RFNQSIFQSLKGF  335
             +N+K+F SL   + LD+  N+  +F       G +KL+ LYL     R    + QS+  F
Sbjct  347   INVKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLRKLKTLYLLGVGIRDGSKLLQSMGSF  406

Query  336   PSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKS  515
             PSL  LDL  N+F D     Q++++  NL+ L L               GSS H      
Sbjct  407   PSLNNLDLSYNNFTDTVTTTQELHNFANLEYLTLH--------------GSSLH------  446

Query  516   YLEVLHLNNISFDMTKLLSSLA-AFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDG  692
                      ISF     L S+A  FPS+K L +    V  +       +  SLE L +D 
Sbjct  447   ---------ISF-----LQSIALMFPSLKNLSMLDCKVNGVVRGQGFPHFKSLEHLDMDD  492

Query  693   SN--LHKDFLSNIG-PMESLKVLSLSGAQV----GGTLPNKGLCELKNLQELWLSENQLE  851
                 L+  FL  IG  M SLK LSLS +       G L  +GLC L +LQEL +++N+L 
Sbjct  493   LRIVLNTSFLQIIGESMPSLKYLSLSYSSAITNSSGIL--QGLCSLVHLQELHMADNELR  550

Query  852   GKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANN  1031
             G +P    N+TSLR +++S N+L+G+I  SPL  LTS+E LS+ NN F +  S     N+
Sbjct  551   GSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNH  610

Query  1032  SKLRVILADRNKVIADTQLQGFV--PKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRI  1202
             S+L++  AD N + A       +  PKFQL SLSLS+   D +  P+FL+YQ DL+ +  
Sbjct  611   SRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHF  670

Query  1203  SRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISG  1382
             SR  + GEFP+WLL+NNTKL+   + N++  G  +L  H + +L++++VSNN   G I  
Sbjct  671   SRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPV  730

Query  1383  NFSSSFPNILALNLSSNLFSGQLHSLIGTH--LGFLDLSNNSFTGEIPKEMLISCSSLVI  1556
                   P +++ N+S N   G + S  G    L  LDLSNN  TGEIP+ + + C +L  
Sbjct  731   EIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEF  790

Query  1557  LKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEI  1733
             L LSNN L+G +      L +L +L L+GN+F G IP SLS       L + +N LSG+I
Sbjct  791   LALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKI  850

Query  1734  PRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHV  1913
             PRW+G LT L+ + + KNHLEG IP+EFC+L SL ILD+S+NN++GS+PSC +P SI  V
Sbjct  851   PRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQV  910

Query  1914  SLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKV  2090
              LSK+ L GQL    FFN ++LV LDLSYN   G IP+WI  +S+LS L+L  N  EG+V
Sbjct  911   HLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEV  970

Query  2091  PTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGT-------NEQFR  2213
             P Q+C L +L LLDLSNN L G+IP C     L  +       +EQF+
Sbjct  971   PVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSSPDEQFK  1018


 Score =   127 bits (320),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 193/704 (27%), Positives = 296/704 (42%), Gaps = 106/704 (15%)
 Frame = +3

Query  192   SLKVLDIGFNKF--QSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMD  365
             SLK L + ++     S G +  +     L+EL++ +     S+   L    SL+ILD+  
Sbjct  511   SLKYLSLSYSSAITNSSGILQGLCSLVHLQELHMADNELRGSLPWCLANMTSLRILDVSS  570

Query  366   NDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNN-  542
             N    G +    +  L +++EL LS+N+F        H   S   + N S L++ + +N 
Sbjct  571   NQL-TGSISSSPLFYLTSIEELSLSNNHF--------HIPISLEPLFNHSRLKIFYADNN  621

Query  543   -ISFDMTK------------------LLSSLAAFPS-------IKTLELQRVNVTNIDAI  644
              I+  +TK                         FP        ++ +   R+ +      
Sbjct  622   PINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPN  681

Query  645   HALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQE  824
               L+N + L +L L   +L   F   I     L++L +S     G +P +    L  L  
Sbjct  682   WLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLIS  741

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
               +S N L+G IPS FGN+  L+ ++LS N+L+G I         +LE+L++ NNS +  
Sbjct  742   FNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGH  801

Query  1005  SSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRD  1184
                R+F N   LR +  + N  + +   Q       L+ L L+N     K+PR+L     
Sbjct  802   MFSRNF-NLINLRWLQLEGNHFVGEIP-QSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTW  859

Query  1185  LKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKL  1364
             L  + + +N+LEG  P       + LQ   +++N  +GSL    H     Q+ ++S N L
Sbjct  860   LIHIIMPKNHLEGPIPVEFCHLYS-LQILDISDNNISGSLPSCFHPLSITQV-HLSKNML  917

Query  1365  CGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLIS  1538
              G++ G    +  +++ L+LS NL +G +   I   + L  L L NN+  GE+P + L  
Sbjct  918   HGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQ-LCG  976

Query  1539  CSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN-----------------------  1649
              + L +L LSNN L G I   FD       LH   NN                       
Sbjct  977   LNQLQLLDLSNNNLHGLIPPCFDNTK----LHESYNNSSSPDEQFKILFSIKGHQGHVEK  1032

Query  1650  -----FEGT------IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLE  1796
                  FE T      I        L  LD+  NKL G IP  +G LT +  L LS N+L 
Sbjct  1033  KIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLT  1092

Query  1797  GHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTAL  1976
             G IP  F NLK +  LDLS N L G IP               HQL             L
Sbjct  1093  GLIPSTFSNLKQIESLDLSYNKLNGKIP---------------HQL--------VELKEL  1129

Query  1977  VILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
              +  ++YN+  G IPEW    +  +     GN F   +P  +C+
Sbjct  1130  AVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICR  1173


 Score =   100 bits (250),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 214/768 (28%), Positives = 342/768 (45%), Gaps = 73/768 (10%)
 Frame = +3

Query  48    FDNPLNSHLNNSGNERLTGLINLEELHMRYTQMEEINI-LSV----------LNLKDFIS  194
             FD+P NS  +   +E  T     E +    T    I + LS           LN   F  
Sbjct  42    FDDPFNSLHHWVDDEGATDCCQWERVECSNTTGRVIQLDLSFIGNWDLKERYLNASLFTP  101

Query  195   LKVLDIGFNKFQSFGPINDVGGAKKLEELY------LFECRFNQSIFQSLKGFPSLKILD  356
              + L+  + K+ +     +  G ++L  L       L E  FN SI  S+    SL  L 
Sbjct  102   FQQLESLYLKYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTSLY  161

Query  357   LMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHL  536
             L  N   +G + +++++ LR+L+ELY+  N  + F     + G  +        L+ L L
Sbjct  162   LYSNRL-EGSIDVKELDSLRDLEELYIGWNMIDKFVVPKGYRGLRK--------LKSLGL  212

Query  537   NNISF-DMTKLLSSLAAFPSIKTLELQ--RVNVTNIDAIHALKNLSSLEELHLDGSNLHK  707
             + +   + +KLL S+ +FPS+ TL L       T       L N ++LE L LD S+LH 
Sbjct  213   SGVGITNGSKLLQSMGSFPSLNTLHLSFNEFTETVTTTTQELHNFTNLEYLTLDYSSLHI  272

Query  708   DFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTS  887
               L +I    SLK LS+S  +V G L  +GL  L NL+ L L  N     I S    L+S
Sbjct  273   SLLQSIASFTSLKNLSMSYCEVNGVLSGQGLERLANLKMLDLRGNLFNNSILSSLARLSS  332

Query  888   LRYVNLSLNKLSGNIelsplstltsleylsIMNN---SFEVASSFRSFANNSKLRVI---  1049
             L  ++LS N+L G+I +    +L++LE L +  N   +FEV   ++       L ++   
Sbjct  333   LTSLDLSYNRLEGSINVKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLRKLKTLYLLGVG  392

Query  1050  LADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEF  1229
             + D +K++   Q  G  P      LS +N  D +   + LH   +L+ L +  ++L   F
Sbjct  393   IRDGSKLL---QSMGSFPSLNNLDLSYNNFTDTVTTTQELHNFANLEYLTLHGSSLHISF  449

Query  1230  PSWLLQNNTKLQYFLMNNNAFTGSL--------KLSSHVN-PNLQII-NVSNNKLCGEIS  1379
                +      L+   M +    G +        K   H++  +L+I+ N S  ++ GE  
Sbjct  450   LQSIALMFPSLKNLSMLDCKVNGVVRGQGFPHFKSLEHLDMDDLRIVLNTSFLQIIGE--  507

Query  1380  GNFSSSFPNI--LALNLSSNLF--SGQLHSLIG-THLGFLDLSNNSFTGEIPKEMLISCS  1544
                  S P++  L+L+ SS +   SG L  L    HL  L +++N   G +P   L + +
Sbjct  508   -----SMPSLKYLSLSYSSAITNSSGILQGLCSLVHLQELHMADNELRGSLPW-CLANMT  561

Query  1545  SLVILKLSNNKLEGQIVQE-FDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIR--DN  1715
             SL IL +S+N+L G I      YL+S+E L L  N+F   I                 +N
Sbjct  562   SLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNN  621

Query  1716  KLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNL----KSLSILDLSENNLTGSIPS  1883
              ++ +I +     T   QL            + F         L  +  S   + G  P+
Sbjct  622   PINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPN  681

Query  1884  CL--NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIs-rlss  2054
              L  N + ++ +SL    L+G       ++  L +LD+S N+F G IP  IG I  RL S
Sbjct  682   WLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLIS  741

Query  2055  lllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPR--CLGKISLE  2192
               ++ N  +G +P+    +  L +LDLSNN L+G IP    +G ++LE
Sbjct  742   FNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLE  789



>ref|XP_006471614.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1-like 
isoform X3 [Citrus sinensis]
Length=1279

 Score =   363 bits (932),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 288/712 (40%), Positives = 402/712 (56%), Gaps = 59/712 (8%)
 Frame = +3

Query  171   LNLKDFISL---KVLDIGFNKFQSFGPINDVGGAKKLEELYLFEC--RFNQSIFQSLKGF  335
             +N+K+F SL   + LD+  N+  +F       G +KL+ LYL     R    + QS+  F
Sbjct  374   INVKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLRKLKTLYLLGVGIRDGSKLLQSMGSF  433

Query  336   PSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKS  515
             PSL  LDL  N+F D     Q++++  NL+ L L               GSS H      
Sbjct  434   PSLNNLDLSYNNFTDTVTTTQELHNFANLEYLTLH--------------GSSLH------  473

Query  516   YLEVLHLNNISFDMTKLLSSLA-AFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDG  692
                      ISF     L S+A  FPS+K L +    V  +       +  SLE L +D 
Sbjct  474   ---------ISF-----LQSIALMFPSLKNLSMLDCKVNGVVRGQGFPHFKSLEHLDMDD  519

Query  693   SN--LHKDFLSNIG-PMESLKVLSLSGAQV----GGTLPNKGLCELKNLQELWLSENQLE  851
                 L+  FL  IG  M SLK LSLS +       G L  +GLC L +LQEL +++N+L 
Sbjct  520   LRIVLNTSFLQIIGESMPSLKYLSLSYSSAITNSSGIL--QGLCSLVHLQELHMADNELR  577

Query  852   GKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANN  1031
             G +P    N+TSLR +++S N+L+G+I  SPL  LTS+E LS+ NN F +  S     N+
Sbjct  578   GSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNH  637

Query  1032  SKLRVILADRNKVIADTQLQGFV--PKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRI  1202
             S+L++  AD N + A       +  PKFQL SLSLS+   D +  P+FL+YQ DL+ +  
Sbjct  638   SRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHF  697

Query  1203  SRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISG  1382
             SR  + GEFP+WLL+NNTKL+   + N++  G  +L  H + +L++++VSNN   G I  
Sbjct  698   SRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPV  757

Query  1383  NFSSSFPNILALNLSSNLFSGQLHSLIGTH--LGFLDLSNNSFTGEIPKEMLISCSSLVI  1556
                   P +++ N+S N   G + S  G    L  LDLSNN  TGEIP+ + + C +L  
Sbjct  758   EIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEF  817

Query  1557  LKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGEI  1733
             L LSNN L+G +      L +L +L L+GN+F G I  +      L  L + +N LSG+I
Sbjct  818   LALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKI  877

Query  1734  PRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHV  1913
             PRW+G LT L+ + + KNHLEG IP+EFC+L SL ILD+S+NN++GS+PSC +P SI  V
Sbjct  878   PRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQV  937

Query  1914  SLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKV  2090
              LSK+ L GQL    FFN ++LV LDLSYN   G IP+WI  +S+LS L+L  N  EG+V
Sbjct  938   HLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEV  997

Query  2091  PTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSI  2246
             P Q+C L +L LLDLSNN L G+IP C     L   +E +   + P E + I
Sbjct  998   PVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKL---HESYNNSSSPDEQFKI  1046


 Score =   126 bits (317),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 193/704 (27%), Positives = 296/704 (42%), Gaps = 106/704 (15%)
 Frame = +3

Query  192   SLKVLDIGFNKF--QSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMD  365
             SLK L + ++     S G +  +     L+EL++ +     S+   L    SL+ILD+  
Sbjct  538   SLKYLSLSYSSAITNSSGILQGLCSLVHLQELHMADNELRGSLPWCLANMTSLRILDVSS  597

Query  366   NDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNN-  542
             N    G +    +  L +++EL LS+N+F        H   S   + N S L++ + +N 
Sbjct  598   NQL-TGSISSSPLFYLTSIEELSLSNNHF--------HIPISLEPLFNHSRLKIFYADNN  648

Query  543   -ISFDMTK------------------LLSSLAAFPS-------IKTLELQRVNVTNIDAI  644
              I+  +TK                         FP        ++ +   R+ +      
Sbjct  649   PINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPN  708

Query  645   HALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQE  824
               L+N + L +L L   +L   F   I     L++L +S     G +P +    L  L  
Sbjct  709   WLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLIS  768

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
               +S N L+G IPS FGN+  L+ ++LS N+L+G I         +LE+L++ NNS +  
Sbjct  769   FNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGH  828

Query  1005  SSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRD  1184
                R+F N   LR +  + N  + +   Q       L+ L L+N     K+PR+L     
Sbjct  829   MFSRNF-NLINLRWLQLEGNHFVGEIP-QSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTW  886

Query  1185  LKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKL  1364
             L  + + +N+LEG  P       + LQ   +++N  +GSL    H     Q+ ++S N L
Sbjct  887   LIHIIMPKNHLEGPIPVEFCHLYS-LQILDISDNNISGSLPSCFHPLSITQV-HLSKNML  944

Query  1365  CGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLIS  1538
              G++ G    +  +++ L+LS NL +G +   I   + L  L L NN+  GE+P + L  
Sbjct  945   HGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQ-LCG  1003

Query  1539  CSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN-----------------------  1649
              + L +L LSNN L G I   FD       LH   NN                       
Sbjct  1004  LNQLQLLDLSNNNLHGLIPPCFDNTK----LHESYNNSSSPDEQFKILFSIKGHQGHVEK  1059

Query  1650  -----FEGT------IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLE  1796
                  FE T      I        L  LD+  NKL G IP  +G LT +  L LS N+L 
Sbjct  1060  KIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLT  1119

Query  1797  GHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTAL  1976
             G IP  F NLK +  LDLS N L G IP               HQL             L
Sbjct  1120  GLIPSTFSNLKQIESLDLSYNKLNGKIP---------------HQL--------VELKEL  1156

Query  1977  VILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
              +  ++YN+  G IPEW    +  +     GN F   +P  +C+
Sbjct  1157  AVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICR  1200


 Score =   120 bits (300),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 211/713 (30%), Positives = 332/713 (47%), Gaps = 62/713 (9%)
 Frame = +3

Query  171   LNLKDFISLK---VLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPS  341
             +N+K+F SL+    LDIG NK   F    D+    KL+ L L   + N+SI  SL  F S
Sbjct  127   INVKEFDSLRDLEELDIGRNKIDKFVVSKDL---SKLKSLGLSGVKLNRSILSSLTVFYS  183

Query  342   LKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYL  521
             L+ LD+ +  F  G   ++D +   NL+ L +S N  +       + G  +        L
Sbjct  184   LRELDISETGF-KGTFDVRDFDSFNNLEVLDMSGNEIDNLVVPQGYKGLRK--------L  234

Query  522   EVLHLNNISF-DMTKLLSSLAAFPSIKTLELQRVNVTNI--DAIHALKNLSSLEELHLDG  692
             + L L+ +   D +KLL S+ +FPS+ TL+L   N T+I       L N ++LE L LD 
Sbjct  235   KSLDLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDY  294

Query  693   SNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYF  872
             S+LH   L +I    SLK LS+S  +V G L  +GL  L NL+ L L  N     I S  
Sbjct  295   SSLHISLLQSIASFTSLKNLSMSYCEVNGVLSGQGLERLANLKMLDLRGNLFNNSILSSL  354

Query  873   GNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNN---SFEVASSFRSFANNSKLR  1043
               L+SL  ++LS N+L G+I +    +L++LE L +  N   +FEV   ++       L 
Sbjct  355   ARLSSLTSLDLSYNRLEGSINVKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLRKLKTLY  414

Query  1044  VI---LADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNN  1214
             ++   + D +K++   Q  G  P      LS +N  D +   + LH   +L+ L +  ++
Sbjct  415   LLGVGIRDGSKLL---QSMGSFPSLNNLDLSYNNFTDTVTTTQELHNFANLEYLTLHGSS  471

Query  1215  LEGEFPSWLLQNNTKLQYFLMNNNAFTGSL--------KLSSHVN-PNLQII-NVSNNKL  1364
             L   F   +      L+   M +    G +        K   H++  +L+I+ N S  ++
Sbjct  472   LHISFLQSIALMFPSLKNLSMLDCKVNGVVRGQGFPHFKSLEHLDMDDLRIVLNTSFLQI  531

Query  1365  CGEISGNFSSSFPNI--LALNLSSNLF--SGQLHSLIG-THLGFLDLSNNSFTGEIPKEM  1529
              GE       S P++  L+L+ SS +   SG L  L    HL  L +++N   G +P   
Sbjct  532   IGE-------SMPSLKYLSLSYSSAITNSSGILQGLCSLVHLQELHMADNELRGSLP-WC  583

Query  1530  LISCSSLVILKLSNNKLEGQIVQE-FDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDI  1706
             L + +SL IL +S+N+L G I      YL+S+E L L  N+F   I              
Sbjct  584   LANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIF  643

Query  1707  R--DNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNL----KSLSILDLSENNLT  1868
                +N ++ +I +     T   QL            + F         L  +  S   + 
Sbjct  644   YADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMN  703

Query  1869  GSIPSCL--NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIs  2042
             G  P+ L  N + ++ +SL    L+G       ++  L +LD+S N+F G IP  IG I 
Sbjct  704   GEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDIL  763

Query  2043  -rlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPR--CLGKISLE  2192
              RL S  ++ N  +G +P+    +  L +LDLSNN L+G IP    +G ++LE
Sbjct  764   PRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLE  816


 Score = 67.8 bits (164),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 72/243 (30%), Positives = 112/243 (46%), Gaps = 18/243 (7%)
 Frame = +3

Query  195  LKVLDIGFNKFQSFGPINDVGGAKKLEELYLFEC--RFNQSIFQSLKGFPSLKILDLMDN  368
            L+ LD+  N+  +F       G +KL+ LYL +   R    + QS+  FPSL  L L DN
Sbjct  11   LEELDMSGNEIDNFKVPQGYRGLRKLKSLYLSKAKIRDGSKLLQSMGSFPSLNTLYLKDN  70

Query  369  DFYD-GPLHIQDINDLRNLKELYLSDNYF-EGFETSANHSGSSRHTIRNKSYLEVLHLNN  542
            +F D      Q +  L NLK L LS N F     +S  H  S      +++ LE     +
Sbjct  71   NFTDIATTTTQGLERLNNLKRLDLSYNLFNNSILSSVAHLSSLTSLDLSENRLE----GS  126

Query  543  ISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSN  722
            I         ++  F S++ LE   +    ID     K+LS L+ L L G  L++  LS+
Sbjct  127  I---------NVKEFDSLRDLEELDIGRNKIDKFVVSKDLSKLKSLGLSGVKLNRSILSS  177

Query  723  IGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEG-KIPSYFGNLTSLRYV  899
            +    SL+ L +S     GT   +      NL+ L +S N+++   +P  +  L  L+ +
Sbjct  178  LTVFYSLRELDISETGFKGTFDVRDFDSFNNLEVLDMSGNEIDNLVVPQGYKGLRKLKSL  237

Query  900  NLS  908
            +LS
Sbjct  238  DLS  240



>ref|XP_006471612.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1-like 
isoform X1 [Citrus sinensis]
Length=1322

 Score =   363 bits (931),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 288/712 (40%), Positives = 402/712 (56%), Gaps = 59/712 (8%)
 Frame = +3

Query  171   LNLKDFISL---KVLDIGFNKFQSFGPINDVGGAKKLEELYLFEC--RFNQSIFQSLKGF  335
             +N+K+F SL   + LD+  N+  +F       G +KL+ LYL     R    + QS+  F
Sbjct  417   INVKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLRKLKTLYLLGVGIRDGSKLLQSMGSF  476

Query  336   PSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKS  515
             PSL  LDL  N+F D     Q++++  NL+ L L               GSS H      
Sbjct  477   PSLNNLDLSYNNFTDTVTTTQELHNFANLEYLTLH--------------GSSLH------  516

Query  516   YLEVLHLNNISFDMTKLLSSLA-AFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDG  692
                      ISF     L S+A  FPS+K L +    V  +       +  SLE L +D 
Sbjct  517   ---------ISF-----LQSIALMFPSLKNLSMLDCKVNGVVRGQGFPHFKSLEHLDMDD  562

Query  693   SN--LHKDFLSNIG-PMESLKVLSLSGAQV----GGTLPNKGLCELKNLQELWLSENQLE  851
                 L+  FL  IG  M SLK LSLS +       G L  +GLC L +LQEL +++N+L 
Sbjct  563   LRIVLNTSFLQIIGESMPSLKYLSLSYSSAITNSSGIL--QGLCSLVHLQELHMADNELR  620

Query  852   GKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANN  1031
             G +P    N+TSLR +++S N+L+G+I  SPL  LTS+E LS+ NN F +  S     N+
Sbjct  621   GSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNH  680

Query  1032  SKLRVILADRNKVIADTQLQGFV--PKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRI  1202
             S+L++  AD N + A       +  PKFQL SLSLS+   D +  P+FL+YQ DL+ +  
Sbjct  681   SRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHF  740

Query  1203  SRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISG  1382
             SR  + GEFP+WLL+NNTKL+   + N++  G  +L  H + +L++++VSNN   G I  
Sbjct  741   SRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPV  800

Query  1383  NFSSSFPNILALNLSSNLFSGQLHSLIGTH--LGFLDLSNNSFTGEIPKEMLISCSSLVI  1556
                   P +++ N+S N   G + S  G    L  LDLSNN  TGEIP+ + + C +L  
Sbjct  801   EIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEF  860

Query  1557  LKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGEI  1733
             L LSNN L+G +      L +L +L L+GN+F G I  +      L  L + +N LSG+I
Sbjct  861   LALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKI  920

Query  1734  PRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHV  1913
             PRW+G LT L+ + + KNHLEG IP+EFC+L SL ILD+S+NN++GS+PSC +P SI  V
Sbjct  921   PRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQV  980

Query  1914  SLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKV  2090
              LSK+ L GQL    FFN ++LV LDLSYN   G IP+WI  +S+LS L+L  N  EG+V
Sbjct  981   HLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEV  1040

Query  2091  PTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSI  2246
             P Q+C L +L LLDLSNN L G+IP C     L   +E +   + P E + I
Sbjct  1041  PVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKL---HESYNNSSSPDEQFKI  1089


 Score =   127 bits (319),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 193/704 (27%), Positives = 296/704 (42%), Gaps = 106/704 (15%)
 Frame = +3

Query  192   SLKVLDIGFNKF--QSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMD  365
             SLK L + ++     S G +  +     L+EL++ +     S+   L    SL+ILD+  
Sbjct  581   SLKYLSLSYSSAITNSSGILQGLCSLVHLQELHMADNELRGSLPWCLANMTSLRILDVSS  640

Query  366   NDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNN-  542
             N    G +    +  L +++EL LS+N+F        H   S   + N S L++ + +N 
Sbjct  641   NQL-TGSISSSPLFYLTSIEELSLSNNHF--------HIPISLEPLFNHSRLKIFYADNN  691

Query  543   -ISFDMTK------------------LLSSLAAFPS-------IKTLELQRVNVTNIDAI  644
              I+  +TK                         FP        ++ +   R+ +      
Sbjct  692   PINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPN  751

Query  645   HALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQE  824
               L+N + L +L L   +L   F   I     L++L +S     G +P +    L  L  
Sbjct  752   WLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLIS  811

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
               +S N L+G IPS FGN+  L+ ++LS N+L+G I         +LE+L++ NNS +  
Sbjct  812   FNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGH  871

Query  1005  SSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRD  1184
                R+F N   LR +  + N  + +   Q       L+ L L+N     K+PR+L     
Sbjct  872   MFSRNF-NLINLRWLQLEGNHFVGEIP-QSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTW  929

Query  1185  LKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKL  1364
             L  + + +N+LEG  P       + LQ   +++N  +GSL    H     Q+ ++S N L
Sbjct  930   LIHIIMPKNHLEGPIPVEFCHLYS-LQILDISDNNISGSLPSCFHPLSITQV-HLSKNML  987

Query  1365  CGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLIS  1538
              G++ G    +  +++ L+LS NL +G +   I   + L  L L NN+  GE+P + L  
Sbjct  988   HGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQ-LCG  1046

Query  1539  CSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN-----------------------  1649
              + L +L LSNN L G I   FD       LH   NN                       
Sbjct  1047  LNQLQLLDLSNNNLHGLIPPCFDNTK----LHESYNNSSSPDEQFKILFSIKGHQGHVEK  1102

Query  1650  -----FEGT------IpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLE  1796
                  FE T      I        L  LD+  NKL G IP  +G LT +  L LS N+L 
Sbjct  1103  KIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLT  1162

Query  1797  GHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTAL  1976
             G IP  F NLK +  LDLS N L G IP               HQL             L
Sbjct  1163  GLIPSTFSNLKQIESLDLSYNKLNGKIP---------------HQL--------VELKEL  1199

Query  1977  VILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
              +  ++YN+  G IPEW    +  +     GN F   +P  +C+
Sbjct  1200  AVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICR  1243


 Score =   118 bits (296),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 210/713 (29%), Positives = 332/713 (47%), Gaps = 62/713 (9%)
 Frame = +3

Query  171   LNLKDFISLK---VLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPS  341
             +++K+F SL+    LDIG NK   F    D+    KL+ L L   + N+SI  SL  F S
Sbjct  170   IDVKEFDSLRDLEELDIGRNKIDKFVVSKDL---SKLKSLGLSGVKLNRSILSSLTVFYS  226

Query  342   LKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYL  521
             L+ LD+ +  F  G   ++D +   NL+ L +S N  +       + G  +        L
Sbjct  227   LRELDISETGF-KGTFDVRDFDSFNNLEVLDMSGNEIDNLVVPQGYKGLRK--------L  277

Query  522   EVLHLNNISF-DMTKLLSSLAAFPSIKTLELQRVNVTNI--DAIHALKNLSSLEELHLDG  692
             + L L+ +   D +KLL S+ +FPS+ TL+L   N T+I       L N ++LE L LD 
Sbjct  278   KSLDLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDY  337

Query  693   SNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYF  872
             S+LH   L +I    SLK LS+S  +V G L  +GL  L NL+ L L  N     I S  
Sbjct  338   SSLHISLLQSIASFTSLKNLSMSYCEVNGVLSGQGLERLANLKMLDLRGNLFNNSILSSL  397

Query  873   GNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNN---SFEVASSFRSFANNSKLR  1043
               L+SL  ++LS N+L G+I +    +L++LE L +  N   +FEV   ++       L 
Sbjct  398   ARLSSLTSLDLSYNRLEGSINVKEFDSLSNLEELDMSGNEIDNFEVPQGYKGLRKLKTLY  457

Query  1044  VI---LADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNN  1214
             ++   + D +K++   Q  G  P      LS +N  D +   + LH   +L+ L +  ++
Sbjct  458   LLGVGIRDGSKLL---QSMGSFPSLNNLDLSYNNFTDTVTTTQELHNFANLEYLTLHGSS  514

Query  1215  LEGEFPSWLLQNNTKLQYFLMNNNAFTGSL--------KLSSHVN-PNLQII-NVSNNKL  1364
             L   F   +      L+   M +    G +        K   H++  +L+I+ N S  ++
Sbjct  515   LHISFLQSIALMFPSLKNLSMLDCKVNGVVRGQGFPHFKSLEHLDMDDLRIVLNTSFLQI  574

Query  1365  CGEISGNFSSSFPNI--LALNLSSNLF--SGQLHSLIG-THLGFLDLSNNSFTGEIPKEM  1529
              GE       S P++  L+L+ SS +   SG L  L    HL  L +++N   G +P   
Sbjct  575   IGE-------SMPSLKYLSLSYSSAITNSSGILQGLCSLVHLQELHMADNELRGSLPW-C  626

Query  1530  LISCSSLVILKLSNNKLEGQIVQE-FDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDI  1706
             L + +SL IL +S+N+L G I      YL+S+E L L  N+F   I              
Sbjct  627   LANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIF  686

Query  1707  R--DNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNL----KSLSILDLSENNLT  1868
                +N ++ +I +     T   QL            + F         L  +  S   + 
Sbjct  687   YADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMN  746

Query  1869  GSIPSCL--NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIs  2042
             G  P+ L  N + ++ +SL    L+G       ++  L +LD+S N+F G IP  IG I 
Sbjct  747   GEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDIL  806

Query  2043  -rlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPR--CLGKISLE  2192
              RL S  ++ N  +G +P+    +  L +LDLSNN L+G IP    +G ++LE
Sbjct  807   PRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLE  859



>ref|XP_009615127.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 isoform X1 [Nicotiana tomentosiformis]
Length=1108

 Score =   359 bits (921),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 295/775 (38%), Positives = 433/775 (56%), Gaps = 62/775 (8%)
 Frame = +3

Query  81    SGNERLTGLINLEELHMRYTQMEEINILSVLNL-KDFISLKVLDIGFNKFQSFGPINDVG  257
             SG+ERL+GL  LE L +    +++ N+LS L L     +LK LDI +N F+SF P  ++G
Sbjct  194   SGSERLSGLDKLEILDLSDNNLDDENLLSALELNTSRTALKKLDIRYNTFRSFIPNEELG  253

Query  258   GAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYL  437
               + +E L L     +++  +S     SLK+L +  N   +G L +Q           Y 
Sbjct  254   ALRNIEYLLLDGNTLDENFLRSSGVMSSLKVLSVA-NCMLNGILPLQG-------NSRYK  305

Query  438   SDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQR  617
                       +    G +      +SY   L     +     LL +       +  EL++
Sbjct  306   RAARCTKLCYARAGKGQTTRVCCTQSYPAFLQEAVSTARTHDLLVTWQ-----QLYELRQ  360

Query  618   VNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKG  797
              + +N           S+ ++ L  +NL   F+  +  ++ L+ LSLSG           
Sbjct  361   GSPSNFK--------HSIHQIILYTTNLLVHFIG-LCDLKYLEELSLSG-----------  400

Query  798   LCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleyls  977
                           N   GK+P+  GNLT LR  +L++N+ +GNI  SPLS+L SLEYL 
Sbjct  401   --------------NSFTGKLPTCLGNLTFLRVFDLTINQFTGNIASSPLSSLLSLEYLL  446

Query  978   IMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKL  1157
             + NN+FE+  SF SFAN+SKL+ + AD N VI  T  + ++PKFQL+ LSL+NC    ++
Sbjct  447   LANNNFEIPISFESFANHSKLKFVTADYNSVIVQTSSKSWIPKFQLEVLSLNNCS---QM  503

Query  1158  PRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQ  1337
             P FLHYQR L++LR+S+ N+ G FP+WLL+NN +L   L++ NAFTGSL+L   + P+L+
Sbjct  504   PSFLHYQRRLRLLRLSKCNIGGNFPNWLLENNPRLADVLLDGNAFTGSLELP--LLPDLK  561

Query  1338  IINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTG  1511
               ++SNNK+ G++  N  S FPN++   +S+N+  G L S  G    L  LDLS N   G
Sbjct  562   AFDISNNKIQGQLPPNIGSIFPNLVISTMSNNMLEGMLPSSFGDMKDLAVLDLSYNKLIG  621

Query  1512  EIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlpl  1691
             ++P  +    S L  L+LS N L+G+I      +++LEYL+LD NNF G  P  LS  PL
Sbjct  622   DLPIGLARKGSKLNFLRLSYNMLKGEIFLISANINNLEYLYLDRNNFSGPTPQKLSTAPL  681

Query  1692  hslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTG  1871
              +LD+  N LSG +P W+G + SL  L LS+NHL+GHIP ++C L+ L +LDLS+NNL G
Sbjct  682   ITLDLSYNNLSGNVPAWLGNIPSLTSLALSRNHLKGHIPPDYCRLEGLEVLDLSDNNLVG  741

Query  1872  SIPSCLNPS-SIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrl  2048
              IPSC N S  +K V LSK++L G+     F+NT L +LDL  N+F G IP+W+G+   +
Sbjct  742   VIPSCFNSSLGLKRVYLSKNKLQGEFN--MFSNTDLKVLDLRDNNFSGSIPKWLGSTLEI  799

Query  2049  sslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKI-SLEGTNEQFRGINL  2225
             ++LLL GNR +G +PTQ+C    L +LDLS+N LSG IP CLG +  +EG +E +   + 
Sbjct  800   TTLLLKGNRLQGTIPTQLCHASNLRILDLSHNNLSGPIPHCLGSLMQIEGISEAYP-YSS  858

Query  2226  PFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEV--QFRTKGNLYNYQNSIL  2384
              F Y        D L     S +    +  +D    V  +F TK N Y+Y+ SI+
Sbjct  859   SFGYSGFQTFGGDTLINIESSIESSSTIFFLDNYAWVGAEFTTKYNTYSYEASIV  913


 Score =   113 bits (282),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 188/697 (27%), Positives = 272/697 (39%), Gaps = 147/697 (21%)
 Frame = +3

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
             K LEEL L    F   +   L     L++ DL  N F  G +    ++ L +L+ L L++
Sbjct  391   KYLEELSLSGNSFTGKLPTCLGNLTFLRVFDLTINQF-TGNIASSPLSSLLSLEYLLLAN  449

Query  444   NYFE---GFETSANHSG--------------SSRHTIRNKSYLEVLHLNNISFDMTKLLS  572
             N FE    FE+ ANHS               +S  +   K  LEVL LNN S    ++ S
Sbjct  450   NNFEIPISFESFANHSKLKFVTADYNSVIVQTSSKSWIPKFQLEVLSLNNCS----QMPS  505

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
              L     ++ L L + N+        L+N   L ++ LDG+         + P   LK  
Sbjct  506   FLHYQRRLRLLRLSKCNIGGNFPNWLLENNPRLADVLLDGNAFTGSLELPLLP--DLKAF  563

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S  ++ G LP        NL    +S N LEG +PS FG++  L  ++LS NKL G++
Sbjct  564   DISNNKIQGQLPPNIGSIFPNLVISTMSNNMLEGMLPSSFGDMKDLAVLDLSYNKLIGDL  623

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADT-QLQGFVPKF  1109
              +      + L +L +  N  +    F   AN + L  +  DRN     T Q     P  
Sbjct  624   PIGLARKGSKLNFLRLSYNMLK-GEIFLISANINNLEYLYLDRNNFSGPTPQKLSTAPLI  682

Query  1110  QLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNA  1289
              LD                           +S NNL G  P+WL  N   L    ++ N 
Sbjct  683   TLD---------------------------LSYNNLSGNVPAWL-GNIPSLTSLALSRNH  714

Query  1290  FTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGT  1469
               G +         L+++++S+N L G I   F+SS   +  + LS N   G+ +    T
Sbjct  715   LKGHIPPDYCRLEGLEVLDLSDNNLVGVIPSCFNSSL-GLKRVYLSKNKLQGEFNMFSNT  773

Query  1470  HLGFLDLSNNSFTGEIPKEM-----------------------LISCSSLVILKLSNNKL  1580
              L  LDL +N+F+G IPK +                       L   S+L IL LS+N L
Sbjct  774   DLKVLDLRDNNFSGSIPKWLGSTLEITTLLLKGNRLQGTIPTQLCHASNLRILDLSHNNL  833

Query  1581  EGQI-------------VQEFDYLSSLEY------------------------LHLDGNN  1649
              G I              + + Y SS  Y                          LD   
Sbjct  834   SGPIPHCLGSLMQIEGISEAYPYSSSFGYSGFQTFGGDTLINIESSIESSSTIFFLDNYA  893

Query  1650  FEGTIpnslsnlplhslDIRD---------NKLSGEIPRWMGRLTSLVQLTLSKNHLEGH  1802
             + G    +  N   +   I D         N+LSGEIP+ +  LT +  L LS NH+ G 
Sbjct  894   WVGAEFTTKYNTYSYEASIVDYMSGIDLSCNQLSGEIPKELSNLTEIRALNLSHNHITGT  953

Query  1803  IPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVI  1982
             I  EF  L+++  LDLS NNLTG IPS                   QL       T L I
Sbjct  954   ILSEFSKLQNIESLDLSYNNLTGRIPS-------------------QLVEL----TTLAI  990

Query  1983  LDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
               +++N+  G  P+     +  +     GN F    P
Sbjct  991   FSVAHNNLTGRTPQRTSQFATFTESSYEGNPFLCGPP  1027



>ref|XP_010324744.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g12460 isoform X3 [Solanum lycopersicum]
Length=809

 Score =   352 bits (903),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 218/523 (42%), Positives = 305/523 (58%), Gaps = 35/523 (7%)
 Frame = +3

Query  399   DINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSL  578
             DI  L NLK L L  N  E F T+          I+  SYL  L   +++ + ++++ SL
Sbjct  22    DIIALSNLKHLDLRANNIESFVTTKG--------IKRMSYLRNLQFESLNSNSSRVIQSL  73

Query  579   AAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSL  758
              +F  +K+L  +  ++T    I+AL+NLS++E L+L GS+++ +FL NIG M SLKVLS+
Sbjct  74    KSFSFLKSLSYEDSDLTAPTIIYALRNLSTVEYLYLKGSSVNDNFLPNIGQMTSLKVLSM  133

Query  759   SGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
                +  GTLPN+G CELK+++E+   +N  EG +PS  GNLTSLR++ L++N   GNI  
Sbjct  134   PSGENNGTLPNQGWCELKHIEEVDFLDNNFEGTLPSCLGNLTSLRWLCLAMNYFRGNIVS  193

Query  939   splstltsleyls-IMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQL  1115
               +    +      I +N FEV  SF  F+N +KL  +    + +I DT+ Q ++P FQL
Sbjct  194   HSIWRRLTSLEYLDISHNQFEVPLSFSQFSNYTKLIYLDVGYSTIIPDTEFQNWIPNFQL  253

Query  1116  DSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
             +   +   I L KLP FLHYQ DL++L I  N L+G+F +WLL+NNT+L  F   +NAF 
Sbjct  254   EFFGIYGYIKLQKLPSFLHYQYDLRILVIDENQLQGKFQTWLLENNTRLAGFYSRDNAFD  313

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI-GTH  1472
             G  KL S V+  L+ I+VSNNKL G I  N S +FP +  LN+S N   G + S+  GTH
Sbjct  314   GPFKLPSIVHLYLETIDVSNNKLNGHIPANMSLAFPKLSFLNMSQNYLEGPIPSMFCGTH  373

Query  1473  LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNF  1652
             L FLDLS N  +GE+P ++ I    L+ L+LSNNKL+G +  E      L +L+L+GNNF
Sbjct  374   LEFLDLSVNKLSGEVPVDLTIGSPQLLYLRLSNNKLKGHMFLEVKS-HVLSFLYLNGNNF  432

Query  1653  EGTIpnslsnlplhslDIRDNKLSGEIPRW------------------------MGRLTS  1760
             EG +P ++    L  LD   N  +GEIPRW                        +G LT+
Sbjct  433   EGPLPENIFLRSLIVLDASRNSFTGEIPRWITDNKRLLQLDLSNNHLQGNISHAIGSLTN  492

Query  1761  LVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL  1889
             L  L LS N LEG IP + C L  LSI+DLS N L G +P CL
Sbjct  493   LNYLLLSHNQLEGQIPTQICMLNDLSIIDLSFNMLYGPLPPCL  535


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 120/462 (26%), Positives = 189/462 (41%), Gaps = 76/462 (16%)
 Frame = +3

Query  741   LKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKL  920
             L+ + +S  ++ G +P         L  L +S+N LEG IPS F   T L +++LS+NKL
Sbjct  326   LETIDVSNNKLNGHIPANMSLAFPKLSFLNMSQNYLEGPIPSMFCG-THLEFLDLSVNKL  384

Query  921   SGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFV  1100
             SG + +        L YL + NN               K  + L  ++ V++   L G  
Sbjct  385   SGEVPVDLTIGSPQLLYLRLSNNKL-------------KGHMFLEVKSHVLSFLYLNG--  429

Query  1101  PKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMN  1280
                       +N    L    FL   R L VL  SRN+  GE P W+  N   LQ   ++
Sbjct  430   ----------NNFEGPLPENIFL---RSLIVLDASRNSFTGEIPRWITDNKRLLQ-LDLS  475

Query  1281  NNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSL  1460
             NN   G++  +     NL  + +S+N+L G+I         ++  ++LS N+  G L   
Sbjct  476   NNHLQGNISHAIGSLTNLNYLLLSHNQLEGQIPTQICM-LNDLSIIDLSFNMLYGPLPPC  534

Query  1461  IGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYL---  1631
             +G       L+      EI      + S+   L         +   +   L S  +L   
Sbjct  535   LGY------LTRTKKDAEISWTYYPATSTRSWLSFEIWMRSKRHYHDSHGLPSDLFLMDV  588

Query  1632  --------HLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKN  1787
                       +   ++G+I   +S +     D+  N+L+GEIP  +G ++++  L LS N
Sbjct  589   ETQVQFSTKRNSYTYKGSILKYMSGI-----DLSSNRLTGEIPVELGNMSNIHALNLSHN  643

Query  1788  HLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNN  1967
             HL G IP  F NL+ +  LDLS N L GSIP  L                          
Sbjct  644   HLNGRIPNTFSNLQEIESLDLSCNRLNGSIPVGL-----------------------LEL  680

Query  1968  TALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
              +L +  ++YN+  G +P++ G           GN F    P
Sbjct  681   NSLAVFSVAYNNLSGAVPDFKGQFGTFDKSSYEGNPFLCGYP  722



>ref|XP_010250307.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 isoform X2 [Nelumbo nucifera]
Length=1081

 Score =   358 bits (918),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 289/705 (41%), Positives = 398/705 (56%), Gaps = 34/705 (5%)
 Frame = +3

Query  195   LKVLDIGFNKFQSFGPINDVG-----GAKKLEELYLFECRFNQSIFQSLKGFPS--LKIL  353
             L++LD+ +N   S   + D G       K LE L      F +SI  +L    S  LK L
Sbjct  132   LQILDLSWNGLSSTLGLQDQGFKHLDRLKNLEVLDFSHNSFGRSIIPNLGALKSQSLKSL  191

Query  354   DLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLH  533
             DL  N+  +G    Q+  +L NL+ LYLS+N F G  T     G     I+    LEVL 
Sbjct  192   DLSGNNI-EGTFTGQEFANLYNLQMLYLSENGFNG--TPQIIPG-----IKRLRKLEVLD  243

Query  534   LNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDF  713
             ++N  F  T L       P+IKTL L   +++       L  LS LE L L  + L  DF
Sbjct  244   ISNNKFSTTILQYIGLLLPNIKTLYLGGNDLSGPITDQDLSTLSELELLDLSDTTLSYDF  303

Query  714   LSNIGPMESLKVLSLSGAQV--GGTLPNKGLCELKNLQEL-WLSENQLEGKIPSYFGNLT  884
             L NIG M SLK L +   +   G  L  KGLC+L  L+EL + S N     + S  GNLT
Sbjct  304   LQNIGEMVSLKFLRMGNIKGLNGTQLSFKGLCKLNKLEELNFNSNNGFMSHLDSCLGNLT  363

Query  885   SLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRN  1064
              LR ++LS N+  GNI+   ++ LTSLEY  + NN F+   SF S AN S L V     N
Sbjct  364   RLRLLDLSYNQFEGNIDPCIINGLTSLEYFDLSNNHFQGPFSFNSLANLSNLEVFQLQNN  423

Query  1065  KVIADTQLQGFVPKFQ------LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEG-  1223
             ++  +  L   +P F+      L S +L+N      LP FLHYQ DL+V+ +S NN  G 
Sbjct  424   QLQVEPDLPALIPIFRQLKILHLSSFTLNNPPS--PLPNFLHYQSDLRVVDLSHNNFNGS  481

Query  1224  EFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP  1403
             +FP+ +L+NN +L+   + NN+F G   L SH  PNL I+ +S+N+  G+I  N    FP
Sbjct  482   QFPTQMLENNARLEVLNIMNNSFMGVPVLPSHPCPNLIILVISHNRFHGQIPENIGVIFP  541

Query  1404  NILALNLSSNLFSGQLHSLIGTH--LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNK  1577
             N+  L++S+N F G++ S IG    L  LDLSNNS +G+IP+ ++  CS L  LKLSNN 
Sbjct  542   NLQILSMSTNAFRGKIPSSIGNMRWLEVLDLSNNSLSGQIPEHIVTGCSRLHFLKLSNNN  601

Query  1578  LEGQIVQEFDYLSSLEYLHLDGNNFEGTIp-nslsnlplhslDIRDNKLSGEIPRWMGRL  1754
             L GQ++     L+ L YLHLDGN+F G +P +   +L L  LD  DN ++G +P W+G L
Sbjct  602   LHGQMLPTVFNLTRLMYLHLDGNHFTGNVPFSLSKSLSLKVLDASDNNIAGRLPGWLGNL  661

Query  1755  TSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQL  1934
             + L  L ++ NH +G IP EFC L  L+ +DLS NNL G IPSC  P S+++V L K++L
Sbjct  662   SDLQVLIMANNHFKGPIPAEFCALGKLTFVDLSMNNLNGLIPSCF-PKSLEYVHLQKNEL  720

Query  1935  SGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLM  2114
              G +  AF N+T LV LD+S N   G +P WIG +S L  LLL GNR EG +P Q+C L 
Sbjct  721   EGPIREAFSNSTGLVTLDISDNMLNGSLPRWIGNLSSLGVLLLKGNRLEGNIPIQLCHLD  780

Query  2115  RlslldlsnnllsGVIPRCLGKIS---LEGTNEQFRGINLPFEYY  2240
             +++++DLS+N LSG IP CL  ++   L+GT  +F    L   +Y
Sbjct  781   KINIMDLSHNNLSGPIPSCLKNLTFQRLDGTTHRFNMDELDDPFY  825


 Score =   103 bits (256),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 197/745 (26%), Positives = 294/745 (39%), Gaps = 171/745 (23%)
 Frame = +3

Query  174   NLKDFISLKVLDIGFNKFQSFGPINDVGGAK--KLEEL-YLFECRFNQSIFQSLKGFPSL  344
             N+ + +SLK L +G  K  +   ++  G  K  KLEEL +     F   +   L     L
Sbjct  306   NIGEMVSLKFLRMGNIKGLNGTQLSFKGLCKLNKLEELNFNSNNGFMSHLDSCLGNLTRL  365

Query  345   KILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLE  524
             ++LDL  N F +G +    IN L +L+   LS+N+F+G          S +++ N S LE
Sbjct  366   RLLDLSYNQF-EGNIDPCIINGLTSLEYFDLSNNHFQG--------PFSFNSLANLSNLE  416

Query  525   VLHLNNISFDMTKLLSSLAA-FPSIKTLELQRVNVTNIDA-----IHALKNLSSLEELH-  683
             V  L N    +   L +L   F  +K L L    + N  +     +H   +L  ++  H 
Sbjct  417   VFQLQNNQLQVEPDLPALIPIFRQLKILHLSSFTLNNPPSPLPNFLHYQSDLRVVDLSHN  476

Query  684   -LDGSNLHKDFLSNIG---------------------PMESLKVLSLSGAQVGGTLPNKG  797
               +GS      L N                       P  +L +L +S  +  G +P   
Sbjct  477   NFNGSQFPTQMLENNARLEVLNIMNNSFMGVPVLPSHPCPNLIILVISHNRFHGQIPENI  536

Query  798   LCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleyls  977
                  NLQ L +S N   GKIPS  GN+  L  ++LS N LSG I    ++  + L +L 
Sbjct  537   GVIFPNLQILSMSTNAFRGKIPSSIGNMRWLEVLDLSNNSLSGQIPEHIVTGCSRLHFLK  596

Query  978   IMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKL  1157
             + NN+        +  N ++L  +  D N         G VP       SLS  + L   
Sbjct  597   LSNNNLH-GQMLPTVFNLTRLMYLHLDGN------HFTGNVP------FSLSKSLSL---  640

Query  1158  PRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLK----------  1307
                       KVL  S NN+ G  P WL  N + LQ  +M NN F G +           
Sbjct  641   ----------KVLDASDNNIAGRLPGWL-GNLSDLQVLIMANNHFKGPIPAEFCALGKLT  689

Query  1308  ------------LSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQL  1451
                         + S    +L+ +++  N+L G I   FS+S   ++ L++S N+ +G L
Sbjct  690   FVDLSMNNLNGLIPSCFPKSLEYVHLQKNELEGPIREAFSNS-TGLVTLDISDNMLNGSL  748

Query  1452  HSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNN----------------K  1577
                IG  + LG L L  N   G IP + L     + I+ LS+N                +
Sbjct  749   PRWIGNLSSLGVLLLKGNRLEGNIPIQ-LCHLDKINIMDLSHNNLSGPIPSCLKNLTFQR  807

Query  1578  LEGQI----VQEFD---YLSS-------------------LEYLHLDGNNFEGTIpnsls  1679
             L+G      + E D   Y+S                     E+     + F  TI   + 
Sbjct  808   LDGTTHRFNMDELDDPFYVSGPGITMSYSFYSSYVYKSSLREFTFSQNSGFFKTIMEQVE  867

Query  1680  nlplhslDIRDNKLSGEIPRWMGRLTSLV-QLTLSKNHLEGHIPIEFCNLKSLSILDLSE  1856
                    DI           + G +  L+  L LS N L G+IP E   L  +  L+LS 
Sbjct  868   FTTKSRYDI-----------YKGIVLELIFGLDLSCNQLVGNIPPEIGELHGIHALNLSH  916

Query  1857  NNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGT  2036
             N+L+GSIP+ +  S++K                      L  LDLS+N+ VG IP  I  
Sbjct  917   NHLSGSIPTTI--SNLKQ---------------------LESLDLSFNNLVGTIPPQITE  953

Query  2037  IsrlsslllNGNRFEGKVPTQVCQL  2111
             +  LS   +  N   GK P Q  Q 
Sbjct  954   LHSLSVFTVAYNNLSGKTPEQKEQF  978


 Score = 68.6 bits (166),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 178/682 (26%), Positives = 279/682 (41%), Gaps = 131/682 (19%)
 Frame = +3

Query  519   LEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSN  698
             L++L LN  +F        LA   +++ L+L       ++ +  L  L  LE L    + 
Sbjct  37    LKILSLNENAF-TNPFPEELAGLENLQMLDLSW---NKLEGLKTLARLEKLEVLDFGNNA  92

Query  699   LHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIP-----  863
             L    L ++G ++SLK LSL         P + L  L+NLQ L LS N L   +      
Sbjct  93    LDNSILPSLGSLKSLKKLSLRQNSFTNPFPYEELSGLENLQILDLSWNGLSSTLGLQDQG  152

Query  864   -SYFGNLTSLRYVNLSLNKLSGNIel-splstltsleylsIMNNSFEVASSFRSFANNSK  1037
               +   L +L  ++ S N    +I          SL+ L +  N+ E   + + FAN   
Sbjct  153   FKHLDRLKNLEVLDFSHNSFGRSIIPNLGALKSQSLKSLDLSGNNIEGTFTGQEFANLYN  212

Query  1038  LRVILADRNKVIADTQLQGFVPKF-QLDSLSLSN---CIDLLKLPRFLHYQRDLKVLRIS  1205
             L+++    N      Q+   + +  +L+ L +SN      +L+    L    ++K L + 
Sbjct  213   LQMLYLSENGFNGTPQIIPGIKRLRKLEVLDISNNKFSTTILQYIGLL--LPNIKTLYLG  270

Query  1206  RNNLEGEFPSW----------LLQNNTKLQYFLMNNNAFTGSLKLSSHVN-PNLQIINVS  1352
              N+L G               L  ++T L Y  + N     SLK     N   L    +S
Sbjct  271   GNDLSGPITDQDLSTLSELELLDLSDTTLSYDFLQNIGEMVSLKFLRMGNIKGLNGTQLS  330

Query  1353  NNKLCG-----EISGNFSSSFPNIL-----------ALNLSSNLFSGQLHSLIG---THL  1475
                LC      E++ N ++ F + L            L+LS N F G +   I    T L
Sbjct  331   FKGLCKLNKLEELNFNSNNGFMSHLDSCLGNLTRLRLLDLSYNQFEGNIDPCIINGLTSL  390

Query  1476  GFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQ--------IVQEFD--------  1607
              + DLSNN F G      L + S+L + +L NN+L+ +        I ++          
Sbjct  391   EYFDLSNNHFQGPFSFNSLANLSNLEVFQLQNNQLQVEPDLPALIPIFRQLKILHLSSFT  450

Query  1608  -------------YLSSLEYLHLDGNNFEGT---IpnslsnlplhslDIRDNKLSG----  1727
                          Y S L  + L  NNF G+        +N  L  L+I +N   G    
Sbjct  451   LNNPPSPLPNFLHYQSDLRVVDLSHNNFNGSQFPTQMLENNARLEVLNIMNNSFMGVPVL  510

Query  1728  --------------------EIPRWMGRLTSLVQ-LTLSKNHLEGHIPIEFCNLKSLSIL  1844
                                 +IP  +G +   +Q L++S N   G IP    N++ L +L
Sbjct  511   PSHPCPNLIILVISHNRFHGQIPENIGVIFPNLQILSMSTNAFRGKIPSSIGNMRWLEVL  570

Query  1845  DLSENNLTGSIPSCL--NPSSIKHVSLSKHQLSGQLTRAFFNNTALV-------------  1979
             DLS N+L+G IP  +    S +  + LS + L GQ+    FN T L+             
Sbjct  571   DLSNNSLSGQIPEHIVTGCSRLHFLKLSNNNLHGQMLPTVFNLTRLMYLHLDGNHFTGNV  630

Query  1980  -----------ILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlsl  2126
                        +LD S N+  G +P W+G +S L  L++  N F+G +P + C L +L+ 
Sbjct  631   PFSLSKSLSLKVLDASDNNIAGRLPGWLGNLSDLQVLIMANNHFKGPIPAEFCALGKLTF  690

Query  2127  ldlsnnllsGVIPRCLGKISLE  2192
             +DLS N L+G+IP C  K SLE
Sbjct  691   VDLSMNNLNGLIPSCFPK-SLE  711


 Score = 53.9 bits (128),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 107/259 (41%), Gaps = 46/259 (18%)
 Frame = +3

Query  255  GGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELY  434
            G  +KLE L L     + SI   L    SLKIL L +N F + P   +++  L NL+ L 
Sbjct  8    GRMEKLEVLDLCRNGLDNSILPYLGALKSLKILSLNENAFTN-PFP-EELAGLENLQMLD  65

Query  435  LSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKL----------------  566
            LS N  EG +T A               LEVL   N + D + L                
Sbjct  66   LSWNKLEGLKTLA-----------RLEKLEVLDFGNNALDNSILPSLGSLKSLKKLSLRQ  114

Query  567  --------LSSLAAFPSIKTLELQRVNVTNI-----DAIHALKNLSSLEELHLDGSNLHK  707
                       L+   +++ L+L    +++           L  L +LE L    ++  +
Sbjct  115  NSFTNPFPYEELSGLENLQILDLSWNGLSSTLGLQDQGFKHLDRLKNLEVLDFSHNSFGR  174

Query  708  DFLSNIGPM--ESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEG--KIPSYFG  875
              + N+G +  +SLK L LSG  + GT   +    L NLQ L+LSEN   G  +I     
Sbjct  175  SIIPNLGALKSQSLKSLDLSGNNIEGTFTGQEFANLYNLQMLYLSENGFNGTPQIIPGIK  234

Query  876  NLTSLRYVNLSLNKLSGNI  932
             L  L  +++S NK S  I
Sbjct  235  RLRKLEVLDISNNKFSTTI  253



>ref|XP_006382320.1| hypothetical protein POPTR_0005s01000g, partial [Populus trichocarpa]
 gb|ERP60117.1| hypothetical protein POPTR_0005s01000g, partial [Populus trichocarpa]
Length=871

 Score =   353 bits (905),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 275/723 (38%), Positives = 385/723 (53%), Gaps = 68/723 (9%)
 Frame = +3

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
             + LEELYL   +FN +I  SL GF +LK LDL +N F               L    ++ 
Sbjct  2     RNLEELYLGSNKFNNNILSSLSGFSTLKYLDLSNNSFTGS----------TGLNGKVVNH  51

Query  444   NYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVN  623
             +Y E           +  ++RN   LE L+L N  F  + L+ SL A PS+KTL+    N
Sbjct  52    SYLE----------ITFPSLRN---LETLYLGNTDFKESILIESLGALPSLKTLDASYSN  98

Query  624   VTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLC  803
              T+      L N SSLEE+ LD S+L   FL NIGP+ +LKVLSL+G     TLP +G C
Sbjct  99    FTHFGK--GLCNSSSLEEVFLDDSSLPASFLRNIGPLSTLKVLSLAGVDFNSTLPAQGWC  156

Query  804   ELKNLQELWLSENQLEGKIPSY-FGNLTSLRYVNLSLNKLSGNIelsplstltsleylsI  980
             ELKNL+EL+L  N L+G  PS+   +LT L Y+++S                        
Sbjct  157   ELKNLEELYLLGNNLKGCTPSFHLSHLTQLEYLSVS------------------------  192

Query  981   MNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDL---L  1151
              NN F+V  +  SF N S L+ I  D N++IA    Q   PKFQL   S SNC       
Sbjct  193   -NNYFQVPITSGSFMNLSNLKFIACDNNELIAAPSFQPSAPKFQLLFFSASNCTPKPLEA  251

Query  1152  KLPRFLHYQRDLKVLRISRNNLEGE-FPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNP  1328
                 FLH Q DL  + +S N   GE FPSWL +NN KL    + + + TG L+L  H  P
Sbjct  252   GFTNFLHSQYDLMFVDLSHNKFVGEPFPSWLFENNRKLNRLYLRDTSITGPLQLPQHPTP  311

Query  1329  NLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNS  1502
              LQ +++S N + G+I+ N  S FP +    +++N  +G +    G  + L +LDLSNN 
Sbjct  312   YLQTVDISGNTIHGQIARNICSIFPRLKNFLMANNSLTGCIPRCFGNMSSLEYLDLSNNH  371

Query  1503  FTGEIPKEMLISC-SSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIp-nsl  1676
              + E+ +  L +  SSL  LKLSNN   G++      ++ L YL LDGN F G +P    
Sbjct  372   MSCELLEHNLPTVGSSLWFLKLSNNNFSGRLPPSVFNMTYLLYLLLDGNKFVGEVPGTFS  431

Query  1677  snlplhslDIRDNKLSGEIPRWMG--RLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDL  1850
                 L  LDI +N LSG +PR +G    + L  + LS+NH EG IPIE+ N   L  LDL
Sbjct  432   LESSLLWLDISNNLLSGMLPRGIGNSSKSQLDGIDLSRNHFEGTIPIEYFNSSGLEFLDL  491

Query  1851  SENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWI  2030
             SENNL+GS+P   +   +++V L  ++LSG L   F+N ++LV LDL  N+  G IP WI
Sbjct  492   SENNLSGSLPLGFHALDLRYVHLYGNRLSGPLPYDFYNLSSLVTLDLGDNNLTGPIPNWI  551

Query  2031  GTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQ-  2207
              ++S LS  +L  N+F GK+P Q+C L +LS+LDLS N  SG+ P CL  ++L  ++E+ 
Sbjct  552   DSLSELSIFVLKSNKFNGKLPHQLCLLRKLSILDLSENNFSGLFPSCLSNLNLTASDEKT  611

Query  2208  -FRGINLPFEYYSINDAILDRLHYEWGS--DDEYIPMLAVDVLPEVQFRTKGNLYNYQNS  2378
                      +Y+S  + IL  +     S  D +  P ++V +   V+   K N Y Y+  
Sbjct  612   SVEPDRASRDYWSEGE-ILSSIGGRGFSPHDTKLWPEISVKI--AVELTAKKNFYTYEGG  668

Query  2379  ILK  2387
             IL+
Sbjct  669   ILR  671


 Score =   130 bits (326),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 204/744 (27%), Positives = 331/744 (44%), Gaps = 125/744 (17%)
 Frame = +3

Query  105   LINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELY  284
             L NLE L++  T  +E +IL + +L    SLK LD  ++ F  FG    +  +  LEE++
Sbjct  61    LRNLETLYLGNTDFKE-SIL-IESLGALPSLKTLDASYSNFTHFG--KGLCNSSSLEEVF  116

Query  285   LFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFE  464
             L +     S  +++    +LK+L L   DF +  L  Q   +L+NL+ELYL  N  +G  
Sbjct  117   LDDSSLPASFLRNIGPLSTLKVLSLAGVDF-NSTLPAQGWCELKNLEELYLLGNNLKGCT  175

Query  465   TSANHSGSSR------------HTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLE  608
              S + S  ++              I + S++ + +L  I+ D  +L+++ +  PS    +
Sbjct  176   PSFHLSHLTQLEYLSVSNNYFQVPITSGSFMNLSNLKFIACDNNELIAAPSFQPSAPKFQ  235

Query  609   LQRVNVTN----------------------IDAIH-----------ALKNLSSLEELHLD  689
             L   + +N                      +D  H             +N   L  L+L 
Sbjct  236   LLFFSASNCTPKPLEAGFTNFLHSQYDLMFVDLSHNKFVGEPFPSWLFENNRKLNRLYLR  295

Query  690   GSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPS  866
              +++         P   L+ + +SG  + G +  + +C +   L+   ++ N L G IP 
Sbjct  296   DTSITGPLQLPQHPTPYLQTVDISGNTIHGQIA-RNICSIFPRLKNFLMANNSLTGCIPR  354

Query  867   YFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRV  1046
              FGN++SL Y++LS N +S  +    L T+ S  +   ++N+        S  N + L  
Sbjct  355   CFGNMSSLEYLDLSNNHMSCELLEHNLPTVGSSLWFLKLSNNNFSGRLPPSVFNMTYLLY  414

Query  1047  ILADRNKVIADTQLQGFVP-KFQLDS----LSLSNCIDLLKLPRFL--HYQRDLKVLRIS  1205
             +L D NK + +      VP  F L+S    L +SN +    LPR +    +  L  + +S
Sbjct  415   LLLDGNKFVGE------VPGTFSLESSLLWLDISNNLLSGMLPRGIGNSSKSQLDGIDLS  468

Query  1206  RNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGN  1385
             RN+ EG  P     N++ L++  ++ N  +GSL L  H   +L+ +++  N+L G +  +
Sbjct  469   RNHFEGTIPIEYF-NSSGLEFLDLSENNLSGSLPLGFHA-LDLRYVHLYGNRLSGPLPYD  526

Query  1386  FSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKL  1565
             F          NLSS              L  LDL +N+ TG IP   + S S L I  L
Sbjct  527   F---------YNLSS--------------LVTLDLGDNNLTGPIPN-WIDSLSELSIFVL  562

Query  1566  SNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslD----------IRDN  1715
              +NK  G++  +   L  L  L L  NNF G  P+ LSNL L + D           RD 
Sbjct  563   KSNKFNGKLPHQLCLLRKLSILDLSENNFSGLFPSCLSNLNLTASDEKTSVEPDRASRDY  622

Query  1716  KLSGEIPRWMG---------------RLTSLVQLTLSKNHL--EGHIPIEFCNLKSLSIL  1844
                GEI   +G                +   V+LT  KN    EG I      L+ +S L
Sbjct  623   WSEGEILSSIGGRGFSPHDTKLWPEISVKIAVELTAKKNFYTYEGGI------LRYMSAL  676

Query  1845  DLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIP  2021
             DLS N  TG IP+   N S I  ++LS++ L+G +  +F N   +  LDLS+N+  G IP
Sbjct  677   DLSCNRFTGEIPTEWGNLSGIYSLNLSQNNLTGLIPSSFSNLKHIESLDLSHNNLNGRIP  736

Query  2022  EWIGTIsrlsslllNGNRFEGKVP  2093
               +  ++ L+   ++ N   G+ P
Sbjct  737   AQLVELTFLAVFNVSYNNLSGRTP  760


 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 192/731 (26%), Positives = 300/731 (41%), Gaps = 164/731 (22%)
 Frame = +3

Query  102   GLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEEL  281
             GL N   L   +     +    + N+    +LKVL +    F S  P       K LEEL
Sbjct  105   GLCNSSSLEEVFLDDSSLPASFLRNIGPLSTLKVLSLAGVDFNSTLPAQGWCELKNLEEL  164

Query  282   YLFECRFNQSIFQSLKGF-PSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEG  458
             YL        +  +LKG  PS                    ++ L  L+ L +S+NYF+ 
Sbjct  165   YL--------LGNNLKGCTPSFH------------------LSHLTQLEYLSVSNNYFQ-  197

Query  459   FETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTN--  632
                           I + S++ + +L  I+ D  +L+++ +  PS    +L   + +N  
Sbjct  198   ------------VPITSGSFMNLSNLKFIACDNNELIAAPSFQPSAPKFQLLFFSASNCT  245

Query  633   --------------------IDAIH-----------ALKNLSSLEELHLDGSNLHKDFLS  719
                                 +D  H             +N   L  L+L  +++      
Sbjct  246   PKPLEAGFTNFLHSQYDLMFVDLSHNKFVGEPFPSWLFENNRKLNRLYLRDTSITGPLQL  305

Query  720   NIGPMESLKVLSLSGAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGNLTSLRY  896
                P   L+ + +SG  + G +  + +C +   L+   ++ N L G IP  FGN++SL Y
Sbjct  306   PQHPTPYLQTVDISGNTIHGQIA-RNICSIFPRLKNFLMANNSLTGCIPRCFGNMSSLEY  364

Query  897   VNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIA  1076
             ++LS N +S  +    L T+ S  +   ++N+        S  N + L  +L D NK + 
Sbjct  365   LDLSNNHMSCELLEHNLPTVGSSLWFLKLSNNNFSGRLPPSVFNMTYLLYLLLDGNKFVG  424

Query  1077  DTQLQGFVP-KFQLDS----LSLSNCIDLLKLPRFL--HYQRDLKVLRISRNNLEGEFPS  1235
             +      VP  F L+S    L +SN +    LPR +    +  L  + +SRN+ EG  P 
Sbjct  425   E------VPGTFSLESSLLWLDISNNLLSGMLPRGIGNSSKSQLDGIDLSRNHFEGTIPI  478

Query  1236  WLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILA  1415
                 N++ L++  ++ N  +GSL L  H   +L+ +++  N+L G +  +F         
Sbjct  479   EYF-NSSGLEFLDLSENNLSGSLPLGFHA-LDLRYVHLYGNRLSGPLPYDF---------  527

Query  1416  LNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIV  1595
              NLSS              L  LDL +N+ TG IP   + S S L I  L +NK  G++ 
Sbjct  528   YNLSS--------------LVTLDLGDNNLTGPIPN-WIDSLSELSIFVLKSNKFNGKLP  572

Query  1596  QEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslD----------IRDNKLSGEI----  1733
              +   L  L  L L  NNF G  P+ LSNL L + D           RD    GEI    
Sbjct  573   HQLCLLRKLSILDLSENNFSGLFPSCLSNLNLTASDEKTSVEPDRASRDYWSEGEILSSI  632

Query  1734  ------PR----WM---------------------GRLTSLVQLTLSKNHLEGHIPIEFC  1820
                   P     W                      G L  +  L LS N   G IP E+ 
Sbjct  633   GGRGFSPHDTKLWPEISVKIAVELTAKKNFYTYEGGILRYMSALDLSCNRFTGEIPTEWG  692

Query  1821  NLKSLSILDLSENNLTGSIPSCLNPSSIKHVS---LSKHQLSGQLTRAFFNNTALVILDL  1991
             NL  +  L+LS+NNLTG IPS    S++KH+    LS + L+G++       T L + ++
Sbjct  693   NLSGIYSLNLSQNNLTGLIPSSF--SNLKHIESLDLSHNNLNGRIPAQLVELTFLAVFNV  750

Query  1992  SYNSFVGIIPE  2024
             SYN+  G  PE
Sbjct  751   SYNNLSGRTPE  761



>ref|XP_006493420.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X2 [Citrus sinensis]
Length=1074

 Score =   357 bits (916),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 299/807 (37%), Positives = 419/807 (52%), Gaps = 102/807 (13%)
 Frame = +3

Query  186   FISLKVLDIGFNKF-QSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLM  362
             F  L+ LD+  N   ++ G +  +   K L+ L L       SI   + G  SL  L L 
Sbjct  96    FQELEWLDLSLNFIRENEGDLTGLSRLKNLKFLDLGSNYLKNSILSRIDGLSSLTTLYLH  155

Query  363   DNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNN  542
             DN   +G + I++I+ L NL+EL    N    F    ++        R    L+ LHL  
Sbjct  156   DN-LLNGTIDIKEIDSLSNLEELDFRGNNINKFVAPKDY--------RGLRMLKSLHLGT  206

Query  543   ISF---------DMTKLLSSL-AAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDG  692
              S+         +++ LL SL   FP+++TLEL+  ++        L N ++LE L LDG
Sbjct  207   SSWHYDGEIYSMNVSSLLQSLWTPFPNLETLELRDYHLGKKMTNQELLNFTNLEVLILDG  266

Query  693   SNLHKDFLSNIG------------------------------------------------  728
             S LH  FL +I                                                 
Sbjct  267   SALHIRFLQSIAVLTSVKHLSMRNCYLYGTSDFQDFPKFRRLENLVMEYSEIHISFPQIS  326

Query  729   -PMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNL  905
               M SLK LSL    + GT+ N+GLCEL +LQEL +  N + G +P    N+TSLR +++
Sbjct  327   KSMVSLKFLSLVNCGLNGTILNQGLCELVHLQELHIGYNNIGGTLPWCLVNMTSLRILDI  386

Query  906   SLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQ  1085
             + N+++GNI  SPL  LTSLE L + NN F++  SF  F N+SKL+     +N++  + +
Sbjct  387   ASNQITGNISSSPLRYLTSLEELRVSNNQFQIPISFEPFFNHSKLKKFYGQKNRLFVEIE  446

Query  1086  LQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQ  1265
                  PKFQL ++SLS C      PRFL+YQ +L+ + +S  NL GEFP+WLL+NN +L+
Sbjct  447   SHSLTPKFQLQNISLSGCRCDFTFPRFLYYQHELRYVDLSHMNLRGEFPNWLLENNKELE  506

Query  1266  YFLMNNNAFTGSLKLSSHVNP--NLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLF  1439
               L+ NN+ +G  ++   VNP   L  I+VS N + G I     S  P +   N+S N+F
Sbjct  507   TLLLANNSLSGFFQMP--VNPLKQLTTIDVSKNFIQGHIPTGIGSFLPRLEHFNISRNVF  564

Query  1440  SGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYL  1613
             SG + S  G  + L  LDLSNN  TGEIP+ M + C SL IL LSNN L+G I      L
Sbjct  565   SGSIPSSFGDISSLRSLDLSNNRLTGEIPEHMTMGCFSLQILALSNNSLQGHIFSRSFNL  624

Query  1614  SSLEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNH  1790
             ++L  L LD N F G I  N L+   L  L + DN +SG+IP+W+G L++LV + +  NH
Sbjct  625   TNLVTLQLDANQFTGGIPENLLNCSLLGGLYLSDNHISGKIPKWLGNLSNLVDIIMPNNH  684

Query  1791  LEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNT  1970
             LEG IP   C L  L++LDL  NN++GS+PSC +   +  V LS++++ GQL   F    
Sbjct  685   LEGPIPANLCKLNFLTVLDLEVNNISGSLPSCFSSWLLTQVHLSRNKIEGQLEDVF--GD  742

Query  1971  ALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnll  2150
              LV LDLSYN F G IP WI  +S LS L+L  N  EG+VP Q+C L +L L+DLS+N L
Sbjct  743   ILVTLDLSYNRFSGRIPNWIDKLSHLSYLILANNNLEGEVPVQLCLLKQLQLIDLSHNNL  802

Query  2151  sGVIPRCLGKISL-EG-------TNEQFRGINLPFEYYSINDAILDRLHYEWGSDDEYIP  2306
             SG IP CL K +L EG       T+E   G + P    +++ +    +  E         
Sbjct  803   SGTIPSCLYKTALGEGNYDSAAPTSEGNYGASSPAAGEAVSPSGSSTMRKE---------  853

Query  2307  MLAVDVLPEVQFRTKGNLYNYQNSILK  2387
                      V+FRTK   Y YQ  ILK
Sbjct  854   -------ESVEFRTKNTSYYYQGRILK  873


 Score =   138 bits (348),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 196/711 (28%), Positives = 313/711 (44%), Gaps = 97/711 (14%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDI---GFNKFQSFGPINDVGGAK--KLEE  278
             LE L M Y+   EI+I      K  +SLK L +   G N     G I + G  +   L+E
Sbjct  308   LENLVMEYS---EIHISFPQISKSMVSLKFLSLVNCGLN-----GTILNQGLCELVHLQE  359

Query  279   LYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE-  455
             L++       ++   L    SL+ILD+  N    G +    +  L +L+EL +S+N F+ 
Sbjct  360   LHIGYNNIGGTLPWCLVNMTSLRILDIASNQI-TGNISSSPLRYLTSLEELRVSNNQFQI  418

Query  456   --GFETSANHSGSSR-HTIRNKSYLEV--------LHLNNISFDMTKLLSSLAAF----P  590
                FE   NHS   + +  +N+ ++E+          L NIS    +   +   F     
Sbjct  419   PISFEPFFNHSKLKKFYGQKNRLFVEIESHSLTPKFQLQNISLSGCRCDFTFPRFLYYQH  478

Query  591   SIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQ  770
              ++ ++L  +N+        L+N   LE L L  ++L   F   + P++ L  + +S   
Sbjct  479   ELRYVDLSHMNLRGEFPNWLLENNKELETLLLANNSLSGFFQMPVNPLKQLTTIDVSKNF  538

Query  771   VGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
             + G +P      L  L+   +S N   G IPS FG+++SLR ++LS N+L+G I      
Sbjct  539   IQGHIPTGIGSFLPRLEHFNISRNVFSGSIPSSFGDISSLRSLDLSNNRLTGEIPEHMTM  598

Query  951   tltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSL  1130
                SL+ L++ NNS +     RSF N + L  +  D N      Q  G +P+      +L
Sbjct  599   GCFSLQILALSNNSLQGHIFSRSF-NLTNLVTLQLDAN------QFTGGIPE------NL  645

Query  1131  SNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKL  1310
              NC               L  L +S N++ G+ P WL  N + L   +M NN   G +  
Sbjct  646   LNC-------------SLLGGLYLSDNHISGKIPKWL-GNLSNLVDIIMPNNHLEGPIPA  691

Query  1311  SSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDL  1490
             +      L ++++  N + G +   FSS    +  ++LS N   GQL  + G  L  LDL
Sbjct  692   NLCKLNFLTVLDLEVNNISGSLPSCFSSWL--LTQVHLSRNKIEGQLEDVFGDILVTLDL  749

Query  1491  SNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpn  1670
             S N F+G IP   +   S L  L L+NN LEG++  +   L  L+ + L  NN  GTIP+
Sbjct  750   SYNRFSGRIPN-WIDKLSHLSYLILANNNLEGEVPVQLCLLKQLQLIDLSHNNLSGTIPS  808

Query  1671  slsnlplhslDI------------RDNKLSGEIPR-----------------------WM  1745
              L    L   +               +  +GE                          + 
Sbjct  809   CLYKTALGEGNYDSAAPTSEGNYGASSPAAGEAVSPSGSSTMRKEESVEFRTKNTSYYYQ  868

Query  1746  GRLTSLV-QLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNP-SSIKHVSL  1919
             GR+  ++  L LS N L G IP +   L  +  L+LS NNL G+IPS  +  S I+ + L
Sbjct  869   GRILKIMFGLDLSCNKLTGEIPFQIGYLNMIRALNLSHNNLMGTIPSTFSHLSQIESLDL  928

Query  1920  SKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGN  2072
             S + L G++        AL I  +++N+  G +P+ +G  +  +    +GN
Sbjct  929   SYNMLQGKIPTQLVELYALAIFSVAHNNLSGKVPDRVGQFATFTENSYDGN  979



>ref|XP_010250257.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Nelumbo nucifera]
Length=1063

 Score =   356 bits (914),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 299/769 (39%), Positives = 424/769 (55%), Gaps = 74/769 (10%)
 Frame = +3

Query  225   FQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDI  404
             F++ G    V G KKL+ L L + + N SI   L    SL+ L L  N+  +G   +Q++
Sbjct  121   FRNEGVRGRVAGLKKLQVLNLSDNQLNNSILPFLGALTSLETLSLRSNEL-EGSFPLQEL  179

Query  405   NDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAA  584
               LRNLK L L++N   G   S    G  R        L+ L L+   FD + +L  L A
Sbjct  180   VQLRNLKILDLNENRLNG---SLPIQGYERLI-----KLKRLDLSRNHFDKS-ILKFLGA  230

Query  585   FPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNL---------------------  701
              PS+ TL L+   +    + H L NLS+L  L+L G+ L                     
Sbjct  231   LPSLNTLSLENNGMEGSLSAHELANLSNLVVLNLSGNQLNGTLPIQGLVALRKLEILDLS  290

Query  702   HKDFLSNIGP----MESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSY  869
             +  F  +I P    + SLK LS +  ++ G+LP +GLC+LK+LQEL L  N  EG IPS 
Sbjct  291   YNSFTWSIPPSIGNLSSLKALSFAYNRLNGSLPIQGLCKLKSLQELVLGGNSFEGVIPSC  350

Query  870   FGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVI  1049
               NLTSLR ++LS N+L G+I  S +++LTSLEY+S+ NN+FE A  F SFAN+S+L V+
Sbjct  351   LSNLTSLRMLDLSENQLRGSIPSSLITSLTSLEYISLENNNFEGAFWFGSFANSSRLEVV  410

Query  1050  L--ADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLK----LPRFLHYQRDLKVLRISRN  1211
                +  NK+   T+   +VP FQL  L L+NC +L K    +P+FL  Q DL+ + +S N
Sbjct  411   KLSSGGNKLEVQTEYPSWVPSFQLKVLVLTNC-NLNKPAGIIPKFLSLQYDLREIDLSHN  469

Query  1212  NLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFS  1391
             +L G  PSWLL N TKL+   + NN+ TG L L+S ++ N+  + +S N   G++  N  
Sbjct  470   SLRGNLPSWLLHNKTKLELLNVQNNSLTGHLNLTSRLSLNISWLFISENHFHGQLPANIG  529

Query  1392  SSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKL  1565
                PN+  L+ S N F G + S IG   +L  LDLSNN+F+GEIP+++ I C SLV LKL
Sbjct  530   EVLPNLEVLHASQNNFEGSIPSSIGEMRNLFTLDLSNNNFSGEIPEQLAIGCQSLVSLKL  589

Query  1566  SNNKLEGQIVQEFDYLSSLEYLHLDGNNFEG-TIpnslsnlplhslDIRDNKLSGEIPRW  1742
             SNNKL+GQI      L++L  L LD N+F G  I     N  L SLDI +N +SG IP W
Sbjct  590   SNNKLQGQIFPNLSNLTNLVRLDLDSNHFSGNAINGVYQNFLLGSLDISNNYISGRIPSW  649

Query  1743  MGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLS  1922
             +G LT L  L +S N  EGHIP E  +LK LS+LDLS N L+G IP   + S ++ + L 
Sbjct  650   IGNLTGLDILVMSDNLFEGHIPTELGSLKLLSVLDLSGNFLSGPIPLSSDLSVLRFIHLG  709

Query  1923  KHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQ  2099
             +++  G L      ++++L+ LD+  N+  G IP WIG  S L  LLL GN  +G +P Q
Sbjct  710   RNRFKGSLPIGLLNSSSSLLTLDIGNNNLSGQIPNWIGEFSELRILLLKGNNLQGPIPRQ  769

Query  2100  VCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSINDAILDRLH--  2273
             +CQL +  ++DLSNN  SG IP+C                N+PF    +++ + D +   
Sbjct  770   LCQLKQTRIMDLSNNTFSGSIPKCFS--------------NIPFGRSELSEFMFDPIATG  815

Query  2274  -------YEWGS-----DDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
                    Y++GS      D     ++     EV+F TK    +Y++SIL
Sbjct  816   TAYFLQPYKYGSFVEGTRDGNGVEISYKTQEEVEFMTKRRSNSYEDSIL  864


 Score =   123 bits (308),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 200/727 (28%), Positives = 301/727 (41%), Gaps = 83/727 (11%)
 Frame = +3

Query  90    ERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKK  269
             + L  L  LE L + Y         S+ NL    SLK L   +N+     PI  +   K 
Sbjct  276   QGLVALRKLEILDLSYNSFTWSIPPSIGNLS---SLKALSFAYNRLNGSLPIQGLCKLKS  332

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+EL L    F   I   L    SL++LDL +N    G +    I  L +L+ + L +N 
Sbjct  333   LQELVLGGNSFEGVIPSCLSNLTSLRMLDLSENQL-RGSIPSSLITSLTSLEYISLENNN  391

Query  450   FEG---FETSANHS---------GSSRHTIRNK--SYLEVLHLNNISFDMTKLLSSLAAF  587
             FEG   F + AN S         G ++  ++ +  S++    L  +      L       
Sbjct  392   FEGAFWFGSFANSSRLEVVKLSSGGNKLEVQTEYPSWVPSFQLKVLVLTNCNLNKPAGII  451

Query  588   PSIKTLELQRVNVTNIDAIH----------ALKNLSSLEELHLDGSNLHKDFLSNIGPME  737
             P  K L LQ  ++  ID  H           L N + LE L++  ++L      N+    
Sbjct  452   P--KFLSLQ-YDLREIDLSHNSLRGNLPSWLLHNKTKLELLNVQNNSLTGHL--NLTSRL  506

Query  738   SLKV--LSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSL  911
             SL +  L +S     G LP      L NL+ L  S+N  EG IPS  G + +L  ++LS 
Sbjct  507   SLNISWLFISENHFHGQLPANIGEVLPNLEVLHASQNNFEGSIPSSIGEMRNLFTLDLSN  566

Query  912   NKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQ  1091
             N  SG I         SL  L + NN  +    F + +N + L  +  D N   +   + 
Sbjct  567   NNFSGEIPEQLAIGCQSLVSLKLSNNKLQ-GQIFPNLSNLTNLVRLDLDSNH-FSGNAIN  624

Query  1092  GFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYF  1271
             G    F L SL +SN     ++P ++     L +L +S N  EG  P+ L   + KL   
Sbjct  625   GVYQNFLLGSLDISNNYISGRIPSWIGNLTGLDILVMSDNLFEGHIPTEL--GSLKLLSV  682

Query  1272  L-MNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQ  1448
             L ++ N  +G + LSS ++  L+ I++  N+  G +     +S  ++L L++ +N  SGQ
Sbjct  683   LDLSGNFLSGPIPLSSDLSV-LRFIHLGRNRFKGSLPIGLLNSSSSLLTLDIGNNNLSGQ  741

Query  1449  LHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI----------  1592
             + + IG  + L  L L  N+  G IP++ L       I+ LSNN   G I          
Sbjct  742   IPNWIGEFSELRILLLKGNNLQGPIPRQ-LCQLKQTRIMDLSNNTFSGSIPKCFSNIPFG  800

Query  1593  -------------------VQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDN  1715
                                +Q + Y S +E    DGN  E  I              R N
Sbjct  801   RSELSEFMFDPIATGTAYFLQPYKYGSFVEGTR-DGNGVE--ISYKTQEEVEFMTKRRSN  857

Query  1716  KLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-N  1892
                  I  +M        L LS NHL G +P E  NL  +  L+LS N L+GSIP    N
Sbjct  858   SYEDSILNFMS------GLDLSFNHLTGDVPPEMGNLNEILALNLSHNQLSGSIPKSFSN  911

Query  1893  PSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGN  2072
              + ++ + LS + LSGQ+       + L I  ++YN+  G  P+     +        GN
Sbjct  912   LTKVESLDLSHNNLSGQIPSELTELSFLAIFSVAYNNLSGKTPDMKAQFATFDIGCYEGN  971

Query  2073  RFEGKVP  2093
              F    P
Sbjct  972   LFLCGPP  978


 Score =   117 bits (294),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 214/771 (28%), Positives = 327/771 (42%), Gaps = 119/771 (15%)
 Frame = +3

Query  69    HLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPIN  248
             H + S  + L  L +L  L +    ME    LS   L +  +L VL++  N+     PI 
Sbjct  219   HFDKSILKFLGALPSLNTLSLENNGME--GSLSAHELANLSNLVVLNLSGNQLNGTLPIQ  276

Query  249   DVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKE  428
              +   +KLE L L    F  SI  S+    SLK L    N   +G L IQ +  L++L+E
Sbjct  277   GLVALRKLEILDLSYNSFTWSIPPSIGNLSSLKALSFAYNRL-NGSLPIQGLCKLKSLQE  335

Query  429   LYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLE  608
             L L  N FEG   S          + N + L +L L+      +   S + +  S++ + 
Sbjct  336   LVLGGNSFEGVIPSC---------LSNLTSLRMLDLSENQLRGSIPSSLITSLTSLEYIS  386

Query  609   LQRVNVTNIDAIHALKNLSSLEELHLD-GSN---LHKDFLSNIGPMESLKVLSLSGAQV-  773
             L+  N        +  N S LE + L  G N   +  ++ S + P   LKVL L+   + 
Sbjct  387   LENNNFEGAFWFGSFANSSRLEVVKLSSGGNKLEVQTEYPSWV-PSFQLKVLVLTNCNLN  445

Query  774   --GGTLPNKGLCELKNLQELWLSENQLEGKIPSYF-GNLTSLRYVNLSLNKLSGNIelsp  944
                G +P K L    +L+E+ LS N L G +PS+   N T L  +N+  N L+G++ L+ 
Sbjct  446   KPAGIIP-KFLSLQYDLREIDLSHNSLRGNLPSWLLHNKTKLELLNVQNNSLTGHLNLTS  504

Query  945   lstltsleylsIMNNSF--EVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKF---  1109
               +L       I  N F  ++ ++      N  L V+ A +N        +G +P     
Sbjct  505   RLSLNISWLF-ISENHFHGQLPANIGEVLPN--LEVLHASQNN------FEGSIPSSIGE  555

Query  1110  --QLDSLSLSNCIDLLKLPRFLHYQ-RDLKVLRISRNNLEGE-FPSWLLQNNTKLQYFLM  1277
                L +L LSN     ++P  L    + L  L++S N L+G+ FP+  L N T L    +
Sbjct  556   MRNLFTLDLSNNNFSGEIPEQLAIGCQSLVSLKLSNNKLQGQIFPN--LSNLTNLVRLDL  613

Query  1278  NNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALN---LSSNLFSGQ  1448
             ++N F+G+     + N  L  +++SNN     ISG   S   N+  L+   +S NLF G 
Sbjct  614   DSNHFSGNAINGVYQNFLLGSLDISNNY----ISGRIPSWIGNLTGLDILVMSDNLFEGH  669

Query  1449  LHSLIGTH--LGFLDLSNNSFTGEIPKEMLISCSSLVIL---------------------  1559
             + + +G+   L  LDLS N  +G IP    +S    + L                     
Sbjct  670   IPTELGSLKLLSVLDLSGNFLSGPIPLSSDLSVLRFIHLGRNRFKGSLPIGLLNSSSSLL  729

Query  1560  --KLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGE  1730
                + NN L GQI       S L  L L GNN +G I            +D+ +N  SG 
Sbjct  730   TLDIGNNNLSGQIPNWIGEFSELRILLLKGNNLQGPIPRQLCQLKQTRIMDLSNNTFSGS  789

Query  1731  IPRWMG----------------------------RLTSLVQLTLSKNHLE----GHIPIE  1814
             IP+                               +  S V+ T   N +E        +E
Sbjct  790   IPKCFSNIPFGRSELSEFMFDPIATGTAYFLQPYKYGSFVEGTRDGNGVEISYKTQEEVE  849

Query  1815  FCN-----------LKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQLTRAF  1958
             F             L  +S LDLS N+LTG +P  + N + I  ++LS +QLSG + ++F
Sbjct  850   FMTKRRSNSYEDSILNFMSGLDLSFNHLTGDVPPEMGNLNEILALNLSHNQLSGSIPKSF  909

Query  1959  FNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQL  2111
              N T +  LDLS+N+  G IP  +  +S L+   +  N   GK P    Q 
Sbjct  910   SNLTKVESLDLSHNNLSGQIPSELTELSFLAIFSVAYNNLSGKTPDMKAQF  960



>ref|XP_009800701.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana sylvestris]
Length=922

 Score =   353 bits (905),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 253/591 (43%), Positives = 345/591 (58%), Gaps = 59/591 (10%)
 Frame = +3

Query  651   LKNLSSLEELHLDGSNL--HKDFLS--NIGPMESLKVLSLSGAQVG--GTLPNKGLCELK  812
             L NLS+LE L L G  L  H D  S  N+     LK L +SG  +   G+  +   C  K
Sbjct  173   LTNLSNLEVLDL-GYTLRNHNDLQSILNLNDFTRLKYLDISGNHLHTFGSF-DYDWCHFK  230

Query  813   NLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNS  992
             NLQEL +  N  +G +PS   NLT L+ V++S N+ +GNI  SPLS LTSL  L+++NN+
Sbjct  231   NLQELRVGSNNFDGMLPSCLANLTFLQSVDISNNRFTGNIASSPLSKLTSLVSLNVLNNN  290

Query  993   FEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLH  1172
              EV  SF +FAN+S L  +  D N  + +T+ + +VP FQL   S+SNC  L  LPRFLH
Sbjct  291   LEVPVSFEAFANHSSLIEVYTDGNIGVPETESRAWVPTFQLKIFSMSNCTHLQTLPRFLH  350

Query  1173  YQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVS  1352
             YQ  L  L  S N+L G FP+WL QNNT+L    +  NAF GS  L  H +P+++ I +S
Sbjct  351   YQNQLTFLDFSLNHLRGSFPNWLFQNNTQLTGLSLGGNAFIGSFNLPLHAHPSVKYIGIS  410

Query  1353  NNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKE  1526
              N+L G++  N SS  PN++ L +S N   GQ+ + +     L  LDL+NN F+GE+P E
Sbjct  411   ENRLSGQLQANISSVIPNLVLLKMSGNYLEGQIPASVWQMKRLEALDLANNHFSGELPTE  470

Query  1527  MLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDI  1706
             ++I                           S++YLHL+GNNF G IP SLS+  L  L++
Sbjct  471   VVIP-------------------------QSMQYLHLNGNNFTGEIPKSLSSTNLAVLEL  505

Query  1707  RDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSC  1886
              +N LSG IP+WMG+++ LV L +S NHL G IPIE CNL  L  LDLSEN  +G +PSC
Sbjct  506   SNNSLSGMIPQWMGQMSGLVLLAMSHNHLRGPIPIELCNLDRLRFLDLSENQFSGLVPSC  565

Query  1887  LNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllN  2066
                S ++H+ L+K+ LSG LT    NN+AL+ LDLS N+ VG IP+WIG +  L+ LLL 
Sbjct  566   F--SHLEHLFLNKNHLSGNLTHGSTNNSALLTLDLSDNNIVGTIPQWIGNLPALNILLLK  623

Query  2067  GNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQ-FRGINLP----F  2231
              N+FEG++P  +C L RL +LDLS+N L+  IP CL  IS E T++Q FR   LP    F
Sbjct  624   NNKFEGEIPNHLCHLQRLRMLDLSHNHLTESIPSCLSNISQEVTSQQMFR---LPALKSF  680

Query  2232  EYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
              + S+                 Y    AV +  +V+F TK + +NY+   L
Sbjct  681   AFQSV------------AFTSVYTMFDAVRM--KVEFTTKSSSFNYEGGPL  717


 Score =   134 bits (338),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 189/722 (26%), Positives = 298/722 (41%), Gaps = 85/722 (12%)
 Frame = +3

Query  54    NPLNSHLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQS  233
             NPL+S       ++LT L NLE L + YT     ++ S+LNL DF  LK LDI  N   +
Sbjct  159   NPLDSVPTKPSFDKLTNLSNLEVLDLGYTLRNHNDLQSILNLNDFTRLKYLDISGNHLHT  218

Query  234   FGPIN-DVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDIND  410
             FG  + D    K L+EL +    F+  +   L     L+ +D+ +N F  G +    ++ 
Sbjct  219   FGSFDYDWCHFKNLQELRVGSNNFDGMLPSCLANLTFLQSVDISNNRF-TGNIASSPLSK  277

Query  411   LRNLKELYLSDNYFE---GFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLA  581
             L +L  L + +N  E    FE  ANHS          S +EV    NI    T+   S A
Sbjct  278   LTSLVSLNVLNNNLEVPVSFEAFANHS----------SLIEVYTDGNIGVPETE---SRA  324

Query  582   AFPSIKTLELQRVNVTNIDAI--------------------------HALKNLSSLEELH  683
               P+ +       N T++  +                             +N + L  L 
Sbjct  325   WVPTFQLKIFSMSNCTHLQTLPRFLHYQNQLTFLDFSLNHLRGSFPNWLFQNNTQLTGLS  384

Query  684   LDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIP  863
             L G+     F   +    S+K + +S  ++ G L       + NL  L +S N LEG+IP
Sbjct  385   LGGNAFIGSFNLPLHAHPSVKYIGISENRLSGQLQANISSVIPNLVLLKMSGNYLEGQIP  444

Query  864   SYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNN-SFEVASSFRSFANNSKL  1040
             +    +  L  ++L+ N  SG +    +   +        NN + E+  S  S    + L
Sbjct  445   ASVWQMKRLEALDLANNHFSGELPTEVVIPQSMQYLHLNGNNFTGEIPKSLSS----TNL  500

Query  1041  RVILADRNKVIADTQLQGFVPKFQ-----LDSLSLSNCIDLLKLPRFLHYQRDLKVLRIS  1205
              V+       +++  L G +P++      L  L++S+      +P  L     L+ L +S
Sbjct  501   AVL------ELSNNSLSGMIPQWMGQMSGLVLLAMSHNHLRGPIPIELCNLDRLRFLDLS  554

Query  1206  RNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGN  1385
              N   G  PS      + L++  +N N  +G+L   S  N  L  +++S+N + G I   
Sbjct  555   ENQFSGLVPSCF----SHLEHLFLNKNHLSGNLTHGSTNNSALLTLDLSDNNIVGTIP-Q  609

Query  1386  FSSSFPNILALNLSSNLFSGQL--HSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVIL  1559
             +  + P +  L L +N F G++  H      L  LDLS+N  T  IP     SC      
Sbjct  610   WIGNLPALNILLLKNNKFEGEIPNHLCHLQRLRMLDLSHNHLTESIP-----SC------  658

Query  1560  KLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPR  1739
              LSN   E    Q F  L +L+        F        +         + +  + E   
Sbjct  659   -LSNISQEVTSQQMFR-LPALKSFAFQSVAFTSVYTMFDAVRMKVEFTTKSSSFNYE---  713

Query  1740  WMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVS  1916
               G L  +  + LS NHL G +PIE  NL  + +L+ S NNL GSIP    N   I  + 
Sbjct  714   -GGPLLYMSGIDLSSNHLSGEVPIELGNLSEIQVLNFSHNNLIGSIPKTFSNLHEIGCID  772

Query  1917  LSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPT  2096
             LS ++LSG++        +L +  +++N+  G +PE  G  S        GN F    P 
Sbjct  773   LSYNKLSGRIPDELLELHSLAVFSVAHNNLSGAVPELKGQFSTFDESSYEGNPFLCGPPL  832

Query  2097  QV  2102
              +
Sbjct  833   HI  834


 Score =   131 bits (329),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 182/638 (29%), Positives = 275/638 (43%), Gaps = 120/638 (19%)
 Frame = +3

Query  177   LKDFISLKVLDIGFNKFQ------------------SFGPINDVGGAKK---------LE  275
             L +  +LKVLD+  NKF                   S  P++ V              LE
Sbjct  121   LSELRNLKVLDLSGNKFNLGVLSSLSQLTSLKSLILSGNPLDSVPTKPSFDKLTNLSNLE  180

Query  276   ELYLFECRFNQSIFQS---LKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDN  446
              L L     N +  QS   L  F  LK LD+  N  +       D    +NL+EL +  N
Sbjct  181   VLDLGYTLRNHNDLQSILNLNDFTRLKYLDISGNHLHTFGSFDYDWCHFKNLQELRVGSN  240

Query  447   YFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNV  626
              F+G   S          + N ++L+ + ++N  F      S L+   S+ +L +   N+
Sbjct  241   NFDGMLPSC---------LANLTFLQSVDISNNRFTGNIASSPLSKLTSLVSLNVLNNNL  291

Query  627   TNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIG----------PMESLKVLSLSGAQVG  776
                 +  A  N SSL E++ DG         NIG          P   LK+ S+S     
Sbjct  292   EVPVSFEAFANHSSLIEVYTDG---------NIGVPETESRAWVPTFQLKIFSMSNCTHL  342

Query  777   GTLPNKGLCELKNLQELWLSENQLEGKIPSY-FGNLTSLRYVNLSLNKLSGNIelsplst  953
              TLP + L     L  L  S N L G  P++ F N T L  ++L  N   G+        
Sbjct  343   QTLP-RFLHYQNQLTFLDFSLNHLRGSFPNWLFQNNTQLTGLSLGGNAFIGSF-------  394

Query  954   ltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLS  1133
                                      N  L    + +   I++ +L G     QL + ++S
Sbjct  395   -------------------------NLPLHAHPSVKYIGISENRLSG-----QLQA-NIS  423

Query  1134  NCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLS  1313
             + I             +L +L++S N LEG+ P+ + Q   +L+   + NN F+G L   
Sbjct  424   SVIP------------NLVLLKMSGNYLEGQIPASVWQMK-RLEALDLANNHFSGELPTE  470

Query  1314  SHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLG--FLD  1487
               +  ++Q ++++ N   GEI  + SS+  N+  L LS+N  SG +   +G   G   L 
Sbjct  471   VVIPQSMQYLHLNGNNFTGEIPKSLSST--NLAVLELSNNSLSGMIPQWMGQMSGLVLLA  528

Query  1488  LSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIp  1667
             +S+N   G IP E L +   L  L LS N+  G +   F   S LE+L L+ N+  G + 
Sbjct  529   MSHNHLRGPIPIE-LCNLDRLRFLDLSENQFSGLVPSCF---SHLEHLFLNKNHLSGNLT  584

Query  1668  n-slsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSIL  1844
             + S +N  L +LD+ DN + G IP+W+G L +L  L L  N  EG IP   C+L+ L +L
Sbjct  585   HGSTNNSALLTLDLSDNNIVGTIPQWIGNLPALNILLLKNNKFEGEIPNHLCHLQRLRML  644

Query  1845  DLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAF  1958
             DLS N+LT SIPSCL+  S +  S    +L    + AF
Sbjct  645   DLSHNHLTESIPSCLSNISQEVTSQQMFRLPALKSFAF  682



>ref|XP_010250306.1| PREDICTED: receptor-like protein 12 isoform X1 [Nelumbo nucifera]
Length=1254

 Score =   357 bits (917),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 289/705 (41%), Positives = 398/705 (56%), Gaps = 34/705 (5%)
 Frame = +3

Query  195   LKVLDIGFNKFQSFGPINDVGGA-----KKLEELYLFECRFNQSIFQSLKGFPS--LKIL  353
             L++LD+ +N   S   + D G       K LE L      F +SI  +L    S  LK L
Sbjct  305   LQILDLSWNGLSSTLGLQDQGFKHLDRLKNLEVLDFSHNSFGRSIIPNLGALKSQSLKSL  364

Query  354   DLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLH  533
             DL  N+  +G    Q+  +L NL+ LYLS+N F G  T     G     I+    LEVL 
Sbjct  365   DLSGNNI-EGTFTGQEFANLYNLQMLYLSENGFNG--TPQIIPG-----IKRLRKLEVLD  416

Query  534   LNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDF  713
             ++N  F  T L       P+IKTL L   +++       L  LS LE L L  + L  DF
Sbjct  417   ISNNKFSTTILQYIGLLLPNIKTLYLGGNDLSGPITDQDLSTLSELELLDLSDTTLSYDF  476

Query  714   LSNIGPMESLKVLSLSGAQV--GGTLPNKGLCELKNLQEL-WLSENQLEGKIPSYFGNLT  884
             L NIG M SLK L +   +   G  L  KGLC+L  L+EL + S N     + S  GNLT
Sbjct  477   LQNIGEMVSLKFLRMGNIKGLNGTQLSFKGLCKLNKLEELNFNSNNGFMSHLDSCLGNLT  536

Query  885   SLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRN  1064
              LR ++LS N+  GNI+   ++ LTSLEY  + NN F+   SF S AN S L V     N
Sbjct  537   RLRLLDLSYNQFEGNIDPCIINGLTSLEYFDLSNNHFQGPFSFNSLANLSNLEVFQLQNN  596

Query  1065  KVIADTQLQGFVPKFQ------LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEG-  1223
             ++  +  L   +P F+      L S +L+N      LP FLHYQ DL+V+ +S NN  G 
Sbjct  597   QLQVEPDLPALIPIFRQLKILHLSSFTLNNPPS--PLPNFLHYQSDLRVVDLSHNNFNGS  654

Query  1224  EFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP  1403
             +FP+ +L+NN +L+   + NN+F G   L SH  PNL I+ +S+N+  G+I  N    FP
Sbjct  655   QFPTQMLENNARLEVLNIMNNSFMGVPVLPSHPCPNLIILVISHNRFHGQIPENIGVIFP  714

Query  1404  NILALNLSSNLFSGQLHSLIGTH--LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNK  1577
             N+  L++S+N F G++ S IG    L  LDLSNNS +G+IP+ ++  CS L  LKLSNN 
Sbjct  715   NLQILSMSTNAFRGKIPSSIGNMRWLEVLDLSNNSLSGQIPEHIVTGCSRLHFLKLSNNN  774

Query  1578  LEGQIVQEFDYLSSLEYLHLDGNNFEGTIp-nslsnlplhslDIRDNKLSGEIPRWMGRL  1754
             L GQ++     L+ L YLHLDGN+F G +P +   +L L  LD  DN ++G +P W+G L
Sbjct  775   LHGQMLPTVFNLTRLMYLHLDGNHFTGNVPFSLSKSLSLKVLDASDNNIAGRLPGWLGNL  834

Query  1755  TSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQL  1934
             + L  L ++ NH +G IP EFC L  L+ +DLS NNL G IPSC  P S+++V L K++L
Sbjct  835   SDLQVLIMANNHFKGPIPAEFCALGKLTFVDLSMNNLNGLIPSCF-PKSLEYVHLQKNEL  893

Query  1935  SGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLM  2114
              G +  AF N+T LV LD+S N   G +P WIG +S L  LLL GNR EG +P Q+C L 
Sbjct  894   EGPIREAFSNSTGLVTLDISDNMLNGSLPRWIGNLSSLGVLLLKGNRLEGNIPIQLCHLD  953

Query  2115  RlslldlsnnllsGVIPRCLGKIS---LEGTNEQFRGINLPFEYY  2240
             +++++DLS+N LSG IP CL  ++   L+GT  +F    L   +Y
Sbjct  954   KINIMDLSHNNLSGPIPSCLKNLTFQRLDGTTHRFNMDELDDPFY  998


 Score =   102 bits (255),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 197/745 (26%), Positives = 294/745 (39%), Gaps = 171/745 (23%)
 Frame = +3

Query  174   NLKDFISLKVLDIGFNKFQSFGPINDVGGAK--KLEEL-YLFECRFNQSIFQSLKGFPSL  344
             N+ + +SLK L +G  K  +   ++  G  K  KLEEL +     F   +   L     L
Sbjct  479   NIGEMVSLKFLRMGNIKGLNGTQLSFKGLCKLNKLEELNFNSNNGFMSHLDSCLGNLTRL  538

Query  345   KILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLE  524
             ++LDL  N F +G +    IN L +L+   LS+N+F+G          S +++ N S LE
Sbjct  539   RLLDLSYNQF-EGNIDPCIINGLTSLEYFDLSNNHFQG--------PFSFNSLANLSNLE  589

Query  525   VLHLNNISFDMTKLLSSLAA-FPSIKTLELQRVNVTNIDA-----IHALKNLSSLEELH-  683
             V  L N    +   L +L   F  +K L L    + N  +     +H   +L  ++  H 
Sbjct  590   VFQLQNNQLQVEPDLPALIPIFRQLKILHLSSFTLNNPPSPLPNFLHYQSDLRVVDLSHN  649

Query  684   -LDGSNLHKDFLSNIG---------------------PMESLKVLSLSGAQVGGTLPNKG  797
               +GS      L N                       P  +L +L +S  +  G +P   
Sbjct  650   NFNGSQFPTQMLENNARLEVLNIMNNSFMGVPVLPSHPCPNLIILVISHNRFHGQIPENI  709

Query  798   LCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleyls  977
                  NLQ L +S N   GKIPS  GN+  L  ++LS N LSG I    ++  + L +L 
Sbjct  710   GVIFPNLQILSMSTNAFRGKIPSSIGNMRWLEVLDLSNNSLSGQIPEHIVTGCSRLHFLK  769

Query  978   IMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKL  1157
             + NN+        +  N ++L  +  D N         G VP       SLS  + L   
Sbjct  770   LSNNNLH-GQMLPTVFNLTRLMYLHLDGN------HFTGNVP------FSLSKSLSL---  813

Query  1158  PRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLK----------  1307
                       KVL  S NN+ G  P WL  N + LQ  +M NN F G +           
Sbjct  814   ----------KVLDASDNNIAGRLPGWL-GNLSDLQVLIMANNHFKGPIPAEFCALGKLT  862

Query  1308  ------------LSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQL  1451
                         + S    +L+ +++  N+L G I   FS+S   ++ L++S N+ +G L
Sbjct  863   FVDLSMNNLNGLIPSCFPKSLEYVHLQKNELEGPIREAFSNS-TGLVTLDISDNMLNGSL  921

Query  1452  HSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNN----------------K  1577
                IG  + LG L L  N   G IP + L     + I+ LS+N                +
Sbjct  922   PRWIGNLSSLGVLLLKGNRLEGNIPIQ-LCHLDKINIMDLSHNNLSGPIPSCLKNLTFQR  980

Query  1578  LEGQI----VQEFD---YLSS-------------------LEYLHLDGNNFEGTIpnsls  1679
             L+G      + E D   Y+S                     E+     + F  TI   + 
Sbjct  981   LDGTTHRFNMDELDDPFYVSGPGITMSYSFYSSYVYKSSLREFTFSQNSGFFKTIMEQVE  1040

Query  1680  nlplhslDIRDNKLSGEIPRWMGRLTSLV-QLTLSKNHLEGHIPIEFCNLKSLSILDLSE  1856
                    DI           + G +  L+  L LS N L G+IP E   L  +  L+LS 
Sbjct  1041  FTTKSRYDI-----------YKGIVLELIFGLDLSCNQLVGNIPPEIGELHGIHALNLSH  1089

Query  1857  NNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGT  2036
             N+L+GSIP+ +  S++K                      L  LDLS+N+ VG IP  I  
Sbjct  1090  NHLSGSIPTTI--SNLKQ---------------------LESLDLSFNNLVGTIPPQITE  1126

Query  2037  IsrlsslllNGNRFEGKVPTQVCQL  2111
             +  LS   +  N   GK P Q  Q 
Sbjct  1127  LHSLSVFTVAYNNLSGKTPEQKEQF  1151


 Score = 84.7 bits (208),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 203/770 (26%), Positives = 320/770 (42%), Gaps = 136/770 (18%)
 Frame = +3

Query  252   VGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKEL  431
             +G  KKLE L L    FN SIF SL    SLK L L +N F + P   + +     +++L
Sbjct  128   LGRLKKLEVLDLSSNFFNNSIFPSLGALKSLKNLFLCENAFSN-PFSFEGLEPWGRMEKL  186

Query  432   YLSDNYFEGFETSA-NHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLE  608
              + D    G + S   + G+ +        L++L LN  +F        LA   +++ L+
Sbjct  187   EVLDLCRNGLDNSILPYLGALKS-------LKILSLNENAF-TNPFPEELAGLENLQMLD  238

Query  609   LQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLP  788
             L       ++ +  L  L  LE L    + L    L ++G ++SLK LSL         P
Sbjct  239   LSW---NKLEGLKTLARLEKLEVLDFGNNALDNSILPSLGSLKSLKKLSLRQNSFTNPFP  295

Query  789   NKGLCELKNLQELWLSENQLEGKIP------SYFGNLTSLRYVNLSLNKLSGNIelsp-l  947
              + L  L+NLQ L LS N L   +        +   L +L  ++ S N    +I  +   
Sbjct  296   YEELSGLENLQILDLSWNGLSSTLGLQDQGFKHLDRLKNLEVLDFSHNSFGRSIIPNLGA  355

Query  948   stltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKF-QLDSL  1124
                 SL+ L +  N+ E   + + FAN   L+++    N      Q+   + +  +L+ L
Sbjct  356   LKSQSLKSLDLSGNNIEGTFTGQEFANLYNLQMLYLSENGFNGTPQIIPGIKRLRKLEVL  415

Query  1125  SLSNCIDLLKLPRFLH-YQRDLKVLRISRNNLEGEFPSW----------LLQNNTKLQYF  1271
              +SN      + +++     ++K L +  N+L G               L  ++T L Y 
Sbjct  416   DISNNKFSTTILQYIGLLLPNIKTLYLGGNDLSGPITDQDLSTLSELELLDLSDTTLSYD  475

Query  1272  LMNNNAFTGSLKLSSHVN-PNLQIINVSNNKLCG-----EISGNFSSSFPNIL-------  1412
              + N     SLK     N   L    +S   LC      E++ N ++ F + L       
Sbjct  476   FLQNIGEMVSLKFLRMGNIKGLNGTQLSFKGLCKLNKLEELNFNSNNGFMSHLDSCLGNL  535

Query  1413  ----ALNLSSNLFSGQLHSLIG---THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSN  1571
                  L+LS N F G +   I    T L + DLSNN F G      L + S+L + +L N
Sbjct  536   TRLRLLDLSYNQFEGNIDPCIINGLTSLEYFDLSNNHFQGPFSFNSLANLSNLEVFQLQN  595

Query  1572  NKLEGQ--------IVQEFD---------------------YLSSLEYLHLDGNNFEGT-  1661
             N+L+ +        I ++                       Y S L  + L  NNF G+ 
Sbjct  596   NQLQVEPDLPALIPIFRQLKILHLSSFTLNNPPSPLPNFLHYQSDLRVVDLSHNNFNGSQ  655

Query  1662  --IpnslsnlplhslDIRDNKLSG------------------------EIPRWMGRLTSL  1763
                    +N  L  L+I +N   G                        +IP  +G +   
Sbjct  656   FPTQMLENNARLEVLNIMNNSFMGVPVLPSHPCPNLIILVISHNRFHGQIPENIGVIFPN  715

Query  1764  VQ-LTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL--NPSSIKHVSLSKHQL  1934
             +Q L++S N   G IP    N++ L +LDLS N+L+G IP  +    S +  + LS + L
Sbjct  716   LQILSMSTNAFRGKIPSSIGNMRWLEVLDLSNNSLSGQIPEHIVTGCSRLHFLKLSNNNL  775

Query  1935  SGQLTRAFFNNTALV------------------------ILDLSYNSFVGIIPEWIGTIs  2042
              GQ+    FN T L+                        +LD S N+  G +P W+G +S
Sbjct  776   HGQMLPTVFNLTRLMYLHLDGNHFTGNVPFSLSKSLSLKVLDASDNNIAGRLPGWLGNLS  835

Query  2043  rlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLE  2192
              L  L++  N F+G +P + C L +L+ +DLS N L+G+IP C  K SLE
Sbjct  836   DLQVLIMANNHFKGPIPAEFCALGKLTFVDLSMNNLNGLIPSCFPK-SLE  884


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 90/326 (28%), Positives = 133/326 (41%), Gaps = 46/326 (14%)
 Frame = +3

Query  54   NPLNSHLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQS  233
            N + S + N G E L  L  LE L +           S+  LK   +L + +  F+   S
Sbjct  114  NSIMSFVENQGLELLGRLKKLEVLDLSSNFFNNSIFPSLGALKSLKNLFLCENAFSNPFS  173

Query  234  FGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDL  413
            F  +   G  +KLE L L     + SI   L    SLKIL L +N F + P   +++  L
Sbjct  174  FEGLEPWGRMEKLEVLDLCRNGLDNSILPYLGALKSLKILSLNENAFTN-PFP-EELAGL  231

Query  414  RNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKL---------  566
             NL+ L LS N  EG +T A               LEVL   N + D + L         
Sbjct  232  ENLQMLDLSWNKLEGLKTLA-----------RLEKLEVLDFGNNALDNSILPSLGSLKSL  280

Query  567  ---------------LSSLAAFPSIKTLELQRVNVTNI-----DAIHALKNLSSLEELHL  686
                              L+   +++ L+L    +++           L  L +LE L  
Sbjct  281  KKLSLRQNSFTNPFPYEELSGLENLQILDLSWNGLSSTLGLQDQGFKHLDRLKNLEVLDF  340

Query  687  DGSNLHKDFLSNIGPM--ESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEG--  854
              ++  +  + N+G +  +SLK L LSG  + GT   +    L NLQ L+LSEN   G  
Sbjct  341  SHNSFGRSIIPNLGALKSQSLKSLDLSGNNIEGTFTGQEFANLYNLQMLYLSENGFNGTP  400

Query  855  KIPSYFGNLTSLRYVNLSLNKLSGNI  932
            +I      L  L  +++S NK S  I
Sbjct  401  QIIPGIKRLRKLEVLDISNNKFSTTI  426



>ref|XP_006471620.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Citrus sinensis]
Length=993

 Score =   353 bits (905),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 263/672 (39%), Positives = 386/672 (57%), Gaps = 20/672 (3%)
 Frame = +3

Query  219   NKFQSFGPINDVGGAKKLEELYLFECRFNQSIF-QSLKGFPSLKILDLMDNDFYDGPLHI  395
             N+ +    + ++   + LEELY+     ++ +  +  +G   LK L L      +G   +
Sbjct  161   NRLEGSIDVKELDSLRDLEELYIGWNMIDKFVVPKGYRGLRKLKSLGLSGVGITNGSKLL  220

Query  396   QDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSS  575
             Q +    +L  L+LS N F    T+          + N + LE L L++ S  ++ L S 
Sbjct  221   QSMGSFPSLNTLHLSFNEFTETVTTTTQE------LHNFTNLEYLTLDSSSIHISLLQSI  274

Query  576   LAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSN--LHKDFLSNIG-PMESLK  746
              + FPS+K L +    V  +       +  SLE L ++ +   L+  FL  I   M SLK
Sbjct  275   ASLFPSLKNLSMSSYEVNGVLRGQGFPHFKSLELLDMECTRIALNTSFLQIISESMPSLK  334

Query  747   VLSLSGAQVG---GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNK  917
              LSLS + +G     + ++GLC L +LQEL++  N L G +P    N+TSLR + +S N+
Sbjct  335   YLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQ  394

Query  918   LSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQG  1094
             L+G+I  SPL  LTS+E L + NN F++  S     N+S+L+V  A  N++ A+ TQ   
Sbjct  395   LTGSISSSPLVHLTSIEELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEITQSPS  454

Query  1095  F-VPKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQY  1268
                P FQL  LSLS+   D +  P+FL++Q DL+ + +S   + GEFP+WLL+NNT L+ 
Sbjct  455   LTAPNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLES  514

Query  1269  FLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQ  1448
               + N++  G  +L  H +  L+++++SNN   G I        P + +LN+S N   G 
Sbjct  515   LFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGS  574

Query  1449  LHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSL  1622
             + S  G    L  LD++NN  TGEIP+ + + C +L  L LSNN LEG +      L++L
Sbjct  575   IPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNL  634

Query  1623  EYLHLDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEG  1799
             ++L L+GN+F G IP SLS   +   L + +N LSG IPRW+G LT L  + + KNHLEG
Sbjct  635   KWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEG  694

Query  1800  HIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNTAL  1976
              IP+EFC L  L ILD+S+NN++GS+PSC +P SI+HV LSK+ L GQL R  FFN  +L
Sbjct  695   PIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSL  754

Query  1977  VILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsG  2156
             V LDLSYN   G I +W+  +S+LS L+L  N  EG+VP Q+C+L +L LLDLSNN L G
Sbjct  755   VTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHG  814

Query  2157  VIPRCLGKISLE  2192
              IP C    +L 
Sbjct  815   PIPPCFDNTTLH  826


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 145/521 (28%), Positives = 240/521 (46%), Gaps = 42/521 (8%)
 Frame = +3

Query  729   PMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLS  908
             P + L+ L L G  + G + N+GL  L NL+ L LSEN     I S    L+SL  + L 
Sbjct  100   PFQQLESLDLHGKNIAGFVENEGLERLSNLKMLDLSENLFNNSILSSLARLSSLTSLYLY  159

Query  909   LNKLSGNIelsplstltsleylsI---MNNSFEVASSFRSFANNSKL---RVILADRNKV  1070
              N+L G+I++  L +L  LE L I   M + F V   +R       L    V + + +K+
Sbjct  160   SNRLEGSIDVKELDSLRDLEELYIGWNMIDKFVVPKGYRGLRKLKSLGLSGVGITNGSKL  219

Query  1071  IADTQLQGFVPKFQLDSLSLSN-CIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQ  1247
             +   Q  G  P      LS +     +    + LH   +L+ L +  +++       +  
Sbjct  220   L---QSMGSFPSLNTLHLSFNEFTETVTTTTQELHNFTNLEYLTLDSSSIHISLLQSIAS  276

Query  1248  NNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFS------SSFPNI  1409
                 L+   M++    G L+      P+ + + + + + C  I+ N S       S P++
Sbjct  277   LFPSLKNLSMSSYEVNGVLRGQGF--PHFKSLELLDME-CTRIALNTSFLQIISESMPSL  333

Query  1410  LALNLS--------SNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKL  1565
               L+LS        S +    L SL+  HL  L + NN   G +P  M  + +SL IL +
Sbjct  334   KYLSLSDSTLGTNSSKILDRGLCSLV--HLQELYIYNNDLRGSLPWCM-ANMTSLRILYV  390

Query  1566  SNNKLEGQIVQE-FDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDI--RDNKLSGEI-  1733
             S+N+L G I      +L+S+E LHL  N+F+  I                ++N+++ EI 
Sbjct  391   SSNQLTGSISSSPLVHLTSIEELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEIT  450

Query  1734  --PRWMGRLTSLVQLTLSKNHLEGHI-PIEFCNLKSLSILDLSENNLTGSIPSCL--NPS  1898
               P        L +L+LS  + +G I P    +   L  +DLS   + G  P+ L  N +
Sbjct  451   QSPSLTAPNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNT  510

Query  1899  SIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsr-lsslllNGNR  2075
             +++ + L    L+G       ++  L +LD+S N+F G IP  IG +   L SL ++ N 
Sbjct  511   NLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNA  570

Query  2076  FEGKVPTQVCQLMRlslldlsnnllsGVIPR--CLGKISLE  2192
              +G +P+    +  L LLD++NN L+G IP    +G ++LE
Sbjct  571   LDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLE  611



>ref|XP_006493419.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X1 [Citrus sinensis]
Length=1081

 Score =   354 bits (909),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 302/814 (37%), Positives = 424/814 (52%), Gaps = 109/814 (13%)
 Frame = +3

Query  186   FISLKVLDIGFNKF-QSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLM  362
             F  L+ LD+  N   ++ G +  +   K L+ L L       SI   + G  SL  L L 
Sbjct  96    FQELEWLDLSLNFIRENEGDLTGLSRLKNLKFLDLGSNYLKNSILSRIDGLSSLTTLYLH  155

Query  363   DNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNN  542
             DN   +G + I++I+ L NL+EL    N    F    ++        R    L+ LHL  
Sbjct  156   DN-LLNGTIDIKEIDSLSNLEELDFRGNNINKFVAPKDY--------RGLRMLKSLHLGT  206

Query  543   ISF---------DMTKLLSSL-AAFPSIKTLELQRVN----VTN-IDAIHALK--NLSSL  671
              S+         +++ LL SL   FP+++TLEL+  +    +TN +D    L+  N ++L
Sbjct  207   SSWHYDGEIYSMNVSSLLQSLWTPFPNLETLELRDYHLGKKMTNQVDVTFRLELLNFTNL  266

Query  672   EELHLDGSNLHKDFLSNIG-----------------------------------------  728
             E L LDGS LH  FL +I                                          
Sbjct  267   EVLILDGSALHIRFLQSIAVLTSVKHLSMRNCYLYGTSDFQDFPKFRRLENLVMEYSEIH  326

Query  729   --------PMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLT  884
                      M SLK LSL    + GT+ N+GLCEL +LQEL +  N + G +P    N+T
Sbjct  327   ISFPQISKSMVSLKFLSLVNCGLNGTILNQGLCELVHLQELHIGYNNIGGTLPWCLVNMT  386

Query  885   SLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRN  1064
             SLR ++++ N+++GNI  SPL  LTSLE L + NN F++  SF  F N+SKL+     +N
Sbjct  387   SLRILDIASNQITGNISSSPLRYLTSLEELRVSNNQFQIPISFEPFFNHSKLKKFYGQKN  446

Query  1065  KVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLL  1244
             ++  + +     PKFQL ++SLS C      PRFL+YQ +L+ + +S  NL GEFP+WLL
Sbjct  447   RLFVEIESHSLTPKFQLQNISLSGCRCDFTFPRFLYYQHELRYVDLSHMNLRGEFPNWLL  506

Query  1245  QNNTKLQYFLMNNNAFTGSLKLSSHVNP--NLQIINVSNNKLCGEISGNFSSSFPNILAL  1418
             +NN +L+  L+ NN+ +G  ++   VNP   L  I+VS N + G I     S  P +   
Sbjct  507   ENNKELETLLLANNSLSGFFQMP--VNPLKQLTTIDVSKNFIQGHIPTGIGSFLPRLEHF  564

Query  1419  NLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI  1592
             N+S N+FSG + S  G  + L  LDLSNN  TGEIP+ M + C SL IL LSNN L+G I
Sbjct  565   NISRNVFSGSIPSSFGDISSLRSLDLSNNRLTGEIPEHMTMGCFSLQILALSNNSLQGHI  624

Query  1593  VQEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQ  1769
                   L++L  L LD N F G I  N L+   L  L + DN +SG+IP+W+G L++LV 
Sbjct  625   FSRSFNLTNLVTLQLDANQFTGGIPENLLNCSLLGGLYLSDNHISGKIPKWLGNLSNLVD  684

Query  1770  LTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLT  1949
             + +  NHLEG IP   C L  L++LDL  NN++GS+PSC +   +  V LS++++ GQL 
Sbjct  685   IIMPNNHLEGPIPANLCKLNFLTVLDLEVNNISGSLPSCFSSWLLTQVHLSRNKIEGQLE  744

Query  1950  RAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlsll  2129
               F     LV LDLSYN F G IP WI  +S LS L+L  N  EG+VP Q+C L +L L+
Sbjct  745   DVF--GDILVTLDLSYNRFSGRIPNWIDKLSHLSYLILANNNLEGEVPVQLCLLKQLQLI  802

Query  2130  dlsnnllsGVIPRCLGKISL-EG-------TNEQFRGINLPFEYYSINDAILDRLHYEWG  2285
             DLS+N LSG IP CL K +L EG       T+E   G + P    +++ +    +  E  
Sbjct  803   DLSHNNLSGTIPSCLYKTALGEGNYDSAAPTSEGNYGASSPAAGEAVSPSGSSTMRKE--  860

Query  2286  SDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSILK  2387
                             V+FRTK   Y YQ  ILK
Sbjct  861   --------------ESVEFRTKNTSYYYQGRILK  880


 Score =   139 bits (349),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 196/711 (28%), Positives = 313/711 (44%), Gaps = 97/711 (14%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDI---GFNKFQSFGPINDVGGAK--KLEE  278
             LE L M Y+   EI+I      K  +SLK L +   G N     G I + G  +   L+E
Sbjct  315   LENLVMEYS---EIHISFPQISKSMVSLKFLSLVNCGLN-----GTILNQGLCELVHLQE  366

Query  279   LYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE-  455
             L++       ++   L    SL+ILD+  N    G +    +  L +L+EL +S+N F+ 
Sbjct  367   LHIGYNNIGGTLPWCLVNMTSLRILDIASNQI-TGNISSSPLRYLTSLEELRVSNNQFQI  425

Query  456   --GFETSANHSGSSR-HTIRNKSYLEV--------LHLNNISFDMTKLLSSLAAF----P  590
                FE   NHS   + +  +N+ ++E+          L NIS    +   +   F     
Sbjct  426   PISFEPFFNHSKLKKFYGQKNRLFVEIESHSLTPKFQLQNISLSGCRCDFTFPRFLYYQH  485

Query  591   SIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQ  770
              ++ ++L  +N+        L+N   LE L L  ++L   F   + P++ L  + +S   
Sbjct  486   ELRYVDLSHMNLRGEFPNWLLENNKELETLLLANNSLSGFFQMPVNPLKQLTTIDVSKNF  545

Query  771   VGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
             + G +P      L  L+   +S N   G IPS FG+++SLR ++LS N+L+G I      
Sbjct  546   IQGHIPTGIGSFLPRLEHFNISRNVFSGSIPSSFGDISSLRSLDLSNNRLTGEIPEHMTM  605

Query  951   tltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSL  1130
                SL+ L++ NNS +     RSF N + L  +  D N      Q  G +P+      +L
Sbjct  606   GCFSLQILALSNNSLQGHIFSRSF-NLTNLVTLQLDAN------QFTGGIPE------NL  652

Query  1131  SNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKL  1310
              NC               L  L +S N++ G+ P WL  N + L   +M NN   G +  
Sbjct  653   LNC-------------SLLGGLYLSDNHISGKIPKWL-GNLSNLVDIIMPNNHLEGPIPA  698

Query  1311  SSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDL  1490
             +      L ++++  N + G +   FSS    +  ++LS N   GQL  + G  L  LDL
Sbjct  699   NLCKLNFLTVLDLEVNNISGSLPSCFSSWL--LTQVHLSRNKIEGQLEDVFGDILVTLDL  756

Query  1491  SNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpn  1670
             S N F+G IP   +   S L  L L+NN LEG++  +   L  L+ + L  NN  GTIP+
Sbjct  757   SYNRFSGRIPN-WIDKLSHLSYLILANNNLEGEVPVQLCLLKQLQLIDLSHNNLSGTIPS  815

Query  1671  slsnlplhslDI------------RDNKLSGEIPR-----------------------WM  1745
              L    L   +               +  +GE                          + 
Sbjct  816   CLYKTALGEGNYDSAAPTSEGNYGASSPAAGEAVSPSGSSTMRKEESVEFRTKNTSYYYQ  875

Query  1746  GRLTSLV-QLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNP-SSIKHVSL  1919
             GR+  ++  L LS N L G IP +   L  +  L+LS NNL G+IPS  +  S I+ + L
Sbjct  876   GRILKIMFGLDLSCNKLTGEIPFQIGYLNMIRALNLSHNNLMGTIPSTFSHLSQIESLDL  935

Query  1920  SKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGN  2072
             S + L G++        AL I  +++N+  G +P+ +G  +  +    +GN
Sbjct  936   SYNMLQGKIPTQLVELYALAIFSVAHNNLSGKVPDRVGQFATFTENSYDGN  986



>gb|KDO41255.1| hypothetical protein CISIN_1g0449241mg, partial [Citrus sinensis]
Length=682

 Score =   342 bits (878),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 253/634 (40%), Positives = 370/634 (58%), Gaps = 24/634 (4%)
 Frame = +3

Query  378   DGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISF-D  554
             +G +++++ + L NL+EL +S N  + F+    + G  +        L+ LHL+ +   D
Sbjct  45    EGSINVKEFDSLSNLEELDMSGNEIDNFQVPQGYGGLRK--------LKSLHLSRVGIRD  96

Query  555   MTKLLSSLAAFPSIKTLELQRVNVTNIDAI--HALKNLSSLEELHLDGSN--LHKDFLSN  722
              +KLL S+ +FPS+ TL L   N T           +  SLE L +D +   L+  FL  
Sbjct  97    GSKLLRSMGSFPSLNTLYLWGNNFTETMTTTTQGFPHFKSLEHLEMDDARIALNTSFLQI  156

Query  723   IGP-MESLKVLSLSGAQVGGT---LPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSL  890
             IG  M SLK LSLS +  G     + ++GLC L ++QEL ++ N L G +P    N+TSL
Sbjct  157   IGELMPSLKYLSLSYSTPGTNSIEILDQGLCSLMHMQELHIAHNDLRGSLPWCLANMTSL  216

Query  891   RYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKV  1070
             R +++S N+L+G+I  SPL  LTS+E L + +N F +  S     N+S+L++  A  N++
Sbjct  217   RILDVSSNQLTGSISSSPLIHLTSIEELRLSDNHFRIPISLEPLFNHSRLQIFDAYNNEI  276

Query  1071  IAD-TQLQGFVPKFQLDSLSLS-NCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLL  1244
              A+ TQ     P FQL  LSLS    D +  P+FL++Q DL  + +S   + G FP+WLL
Sbjct  277   NAEITQSPSLTPNFQLSHLSLSFGYGDGVTFPKFLYHQHDLVNVDLSHIKMNGGFPNWLL  336

Query  1245  QNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNL  1424
             +NNT+L+   + N++  G  +L  H +  L++++VSNN   G I        P++++ N+
Sbjct  337   ENNTRLETLSLVNDSLAGPFRLPIHSHKQLRLLDVSNNNFQGHIPVEIGDILPSLISFNI  396

Query  1425  SSNLFSGQLHSLIGT--HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ  1598
             S N  +G + S  G    L  LDLSNN   GEIP+ + + C +L  L LSNN LEG +  
Sbjct  397   SMNALNGSIPSSFGNINSLQILDLSNNQLIGEIPEHLAVGCVNLEYLTLSNNNLEGHMFT  456

Query  1599  EFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGRLTSLVQLT  1775
                 L++L +L L+ N+F G IP SLS       L + +N LSG+IPRW+G L  L  + 
Sbjct  457   RNFNLTNLRWLQLESNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLKGLKHII  516

Query  1776  LSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA  1955
             + +NHLEG IP+EFC L SL +LD+S+NN++GS+PSC +  SI+ V LSK+ L GQL R 
Sbjct  517   MPENHLEGPIPMEFCQLYSLQLLDISDNNISGSLPSCFHLLSIEQVHLSKNMLRGQLKRG  576

Query  1956  -FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslld  2132
              FFN ++LV LDLSYN   G IP W+  +S+L  L+L  N  EG+VP Q+C L +L LLD
Sbjct  577   TFFNCSSLVTLDLSYNRLNGSIPNWVDGLSQLRHLILGHNNLEGEVPVQLCGLNQLQLLD  636

Query  2133  lsnnllsGVIPRCLGKISLEGTNEQFRGINLPFE  2234
             LSNN L G IP C    +L  +      +  PFE
Sbjct  637   LSNNNLHGHIPPCFDNTTLHESYSNSSSLK-PFE  669



>ref|XP_010324751.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Solanum lycopersicum]
Length=1050

 Score =   350 bits (899),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 249/631 (39%), Positives = 354/631 (56%), Gaps = 63/631 (10%)
 Frame = +3

Query  78    NSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVG  257
             N  +++  GL NL EL     ++ +INILS L                           G
Sbjct  176   NMMSKKCGGLSNLRELWFEGYEINDINILSAL---------------------------G  208

Query  258   GAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYL  437
               + LE+L L +  FN +IF SLK FPSLK L+L  N+  +G + + DI DL NL+ L L
Sbjct  209   ELRNLEKLILDDNNFNSTIFSSLKIFPSLKHLNLAANEI-NGNVEMNDIIDLSNLEYLDL  267

Query  438   SDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQR  617
             SDN    F T+    G+ + T      L          + ++++ SL +F S+K+L  + 
Sbjct  268   SDNNIHSFATT---KGNKKMTSLRSLLLGS-----SYSNSSRVIRSLKSFSSLKSLSYKN  319

Query  618   VNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKG  797
              N+T+   I+AL+NLS++E L+  GS+L+ +FL NIG M SLKVL++      GTLPN+G
Sbjct  320   SNLTSPSIIYALRNLSTVEYLYFKGSSLNDNFLPNIGQMTSLKVLNMPSGGNNGTLPNQG  379

Query  798   LCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleyl-  974
              CELK ++EL    N   G +P   GNLTSLR+++L+ N L GNI    +    +     
Sbjct  380   WCELKYIEELDFLNNNFVGTLPLCLGNLTSLRWLSLAGNNLHGNIASHSIWRRLTSLEYL  439

Query  975   sIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLK  1154
              I +N F+V  SF  F+++ KL  +    N +I DT+ Q ++P FQL+  ++  CI L K
Sbjct  440   DIADNQFDVPLSFSQFSDHKKLIYLNVGYNTIITDTEYQNWIPNFQLEFFAIQRCIALQK  499

Query  1155  LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNL  1334
             LP FLHYQ DL++L I  N L+G+FP+WLL+NNT+L      +NAF+G LKL S V+ +L
Sbjct  500   LPSFLHYQYDLRILAIEGNQLQGKFPTWLLENNTRLAAIYGRDNAFSGPLKLPSSVHLHL  559

Query  1335  QIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI-GTHLGFLDLSNNSFTG  1511
             + ++VSNNKL G I  N S +FP +L+LN+S N   G + S I G +L  LDLS N  +G
Sbjct  560   EAVDVSNNKLNGHIPQNMSLAFPKLLSLNMSHNHLEGPIPSKISGIYLTILDLSVNFLSG  619

Query  1512  EIPKEM-LISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlp  1688
             E+P ++ ++    L  L+LSNNKL+G+I  E      L +L+L+ NNFEG +P+++    
Sbjct  620   EVPGDLAVVDSPQLFYLRLSNNKLKGKIFSEEFRPHVLSFLYLNDNNFEGALPSNVFLSS  679

Query  1689  lhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHL------------------------E  1796
             L +LD   N  SGEIP        L+QL LSKNHL                        E
Sbjct  680   LITLDASRNNFSGEIPGCTRDNRRLLQLDLSKNHLQGNIPYTIGSLSNLNYLLLSNNKLE  739

Query  1797  GHIPIEFCNLKSLSILDLSENNLTGSIPSCL  1889
             G IP + C L +LSI+DLS N L G +P CL
Sbjct  740   GDIPTQICMLNNLSIVDLSFNKLYGPLPPCL  770


 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = +3

Query  1701  DIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP  1880
             D+  N+L+GEIP  +G ++++  L LS NHL G IP  F NL+ +  LDLS N L GSIP
Sbjct  850   DLSSNRLTGEIPVELGNMSNIHALNLSHNHLNGRIPNTFSNLQEIESLDLSCNRLNGSIP  909

Query  1881  -SCLNPSSIKHVSLSKHQLSGQL  1946
                L  +S+   S++ + LSG +
Sbjct  910   VGLLELNSLAVFSVAYNNLSGAV  932



>ref|XP_009586773.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana tomentosiformis]
Length=922

 Score =   347 bits (891),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 243/539 (45%), Positives = 324/539 (60%), Gaps = 38/539 (7%)
 Frame = +3

Query  624   VTNIDAIHALKNLSSLEELHLDGSNL--HKDFLS--NIGPMESLKVLSLSGAQVG--GTL  785
             V    +   L NLS+LE L L GS L  H D  S  N+     LK L +SG  +   G+ 
Sbjct  164   VPTKPSFEKLTNLSNLEVLDL-GSTLTNHSDLQSILNLNDFTRLKYLDISGNHLHTFGSF  222

Query  786   PNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsl  965
              +   C  KNLQEL +  N  +G +PS   NLT L  +++S N+ +GNI  SPLS LTSL
Sbjct  223   -DYDWCHFKNLQELRVGSNNFDGMLPSCLANLTFLLSLDISNNRFTGNIASSPLSKLTSL  281

Query  966   eylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCID  1145
               L+I+NN+ EV  SF +FAN+S L  +  D N  + +T+ + +VP FQL+  S+SNC  
Sbjct  282   VSLNILNNNLEVPVSFEAFANHSSLIEVYTDGNIGVPETESRAWVPMFQLEIFSMSNCTH  341

Query  1146  LLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVN  1325
             L  LPRFLHYQ  L  L  S N+L G FP+WL QNNT+L    +  NAF GS  L     
Sbjct  342   LQTLPRFLHYQNRLTFLDFSLNHLRGSFPNWLFQNNTQLIGLSLGGNAFIGSFSLPLLAQ  401

Query  1326  PNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNN  1499
             P+++ I +S N+L G++  N SS FPN++ L +S N   GQ+ + +     L  LDL+NN
Sbjct  402   PSVKYIGISENRLSGQLQANISSVFPNLVLLKMSGNCLEGQIPASVWQMKRLEALDLANN  461

Query  1500  SFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnsls  1679
              F+GE+P E++I                           SL+YLHL+GNNF G IP SLS
Sbjct  462   HFSGELPTEVVIP-------------------------PSLQYLHLNGNNFTGEIPKSLS  496

Query  1680  nlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSEN  1859
             +  L  L+I +N LSG IP WMG+++ LV L +S NHL G IP+E CNL  L  LDLSEN
Sbjct  497   STNLAVLEISNNSLSGMIPEWMGQMSGLVLLAMSHNHLRGPIPVELCNLDRLRFLDLSEN  556

Query  1860  NLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTI  2039
               +G IPSC   S ++H+ L+K+ LSG LT    NN+AL+ LDLS N+ VG IP+WIG +
Sbjct  557   QFSGLIPSCF--SHLEHLFLNKNHLSGNLTHGSTNNSALLTLDLSDNNIVGSIPQWIGNL  614

Query  2040  srlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQ-FR  2213
             S L+ LLL  N+FEG++P  +C L RL +LDLS+N L+  IP CL  IS E  ++Q FR
Sbjct  615   SALNILLLKNNKFEGEIPNHLCHLQRLRMLDLSHNQLTESIPSCLSNISQEVNSQQTFR  673


 Score =   132 bits (332),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 181/615 (29%), Positives = 264/615 (43%), Gaps = 120/615 (20%)
 Frame = +3

Query  177   LKDFISLKVLDIGFNKFQSF------------------GPINDVGGAKKLEELY------  284
             L +  +LKVLD+  NKF                      P++ V      E+L       
Sbjct  121   LSELRNLKVLDLSGNKFNLSVLSSLSQLSSLKSLILSGNPLDSVPTKPSFEKLTNLSNLE  180

Query  285   ---LFECRFNQSIFQS---LKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDN  446
                L     N S  QS   L  F  LK LD+  N  +       D    +NL+EL +  N
Sbjct  181   VLDLGSTLTNHSDLQSILNLNDFTRLKYLDISGNHLHTFGSFDYDWCHFKNLQELRVGSN  240

Query  447   YFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNV  626
              F+G   S          + N ++L  L ++N  F      S L+   S+ +L +   N+
Sbjct  241   NFDGMLPSC---------LANLTFLLSLDISNNRFTGNIASSPLSKLTSLVSLNILNNNL  291

Query  627   TNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIG----------PMESLKVLSLSGAQVG  776
                 +  A  N SSL E++ DG         NIG          PM  L++ S+S     
Sbjct  292   EVPVSFEAFANHSSLIEVYTDG---------NIGVPETESRAWVPMFQLEIFSMSNCTHL  342

Query  777   GTLPNKGLCELKNLQELWLSENQLEGKIPSY-FGNLTSLRYVNLSLNKLSGNIelsplst  953
              TLP + L     L  L  S N L G  P++ F N T L  + LSL              
Sbjct  343   QTLP-RFLHYQNRLTFLDFSLNHLRGSFPNWLFQNNTQL--IGLSLG-------------  386

Query  954   ltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLS  1133
                        N+F  + S    A  S   +        I++ +L G   + Q +  S+ 
Sbjct  387   ----------GNAFIGSFSLPLLAQPSVKYI-------GISENRLSG---QLQANISSVF  426

Query  1134  NCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLS  1313
               + LLK+               S N LEG+ P+ + Q   +L+   + NN F+G L   
Sbjct  427   PNLVLLKM---------------SGNCLEGQIPASVWQMK-RLEALDLANNHFSGELPTE  470

Query  1314  SHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLG--FLD  1487
               + P+LQ ++++ N   GEI  + SS+  N+  L +S+N  SG +   +G   G   L 
Sbjct  471   VVIPPSLQYLHLNGNNFTGEIPKSLSST--NLAVLEISNNSLSGMIPEWMGQMSGLVLLA  528

Query  1488  LSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIp  1667
             +S+N   G IP E L +   L  L LS N+  G I   F   S LE+L L+ N+  G + 
Sbjct  529   MSHNHLRGPIPVE-LCNLDRLRFLDLSENQFSGLIPSCF---SHLEHLFLNKNHLSGNLT  584

Query  1668  n-slsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSIL  1844
             + S +N  L +LD+ DN + G IP+W+G L++L  L L  N  EG IP   C+L+ L +L
Sbjct  585   HGSTNNSALLTLDLSDNNIVGSIPQWIGNLSALNILLLKNNKFEGEIPNHLCHLQRLRML  644

Query  1845  DLSENNLTGSIPSCL  1889
             DLS N LT SIPSCL
Sbjct  645   DLSHNQLTESIPSCL  659


 Score =   130 bits (326),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 201/728 (28%), Positives = 309/728 (42%), Gaps = 97/728 (13%)
 Frame = +3

Query  54    NPLNSHLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQS  233
             NPL+S       E+LT L NLE L +  T     ++ S+LNL DF  LK LDI  N   +
Sbjct  159   NPLDSVPTKPSFEKLTNLSNLEVLDLGSTLTNHSDLQSILNLNDFTRLKYLDISGNHLHT  218

Query  234   FGPIN-DVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDIND  410
             FG  + D    K L+EL +    F+  +   L     L  LD+ +N F  G +    ++ 
Sbjct  219   FGSFDYDWCHFKNLQELRVGSNNFDGMLPSCLANLTFLLSLDISNNRF-TGNIASSPLSK  277

Query  411   LRNLKELYLSDNYFE---GFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLA  581
             L +L  L + +N  E    FE  ANHS          S +EV    NI    T+   S A
Sbjct  278   LTSLVSLNILNNNLEVPVSFEAFANHS----------SLIEVYTDGNIGVPETE---SRA  324

Query  582   AFPSIKTLELQRVNVTNIDA----IHALKNLSSLEEL--HLDGSNLHKDFLSNIGPMESL  743
               P  +       N T++      +H    L+ L+    HL GS  +  F +N      L
Sbjct  325   WVPMFQLEIFSMSNCTHLQTLPRFLHYQNRLTFLDFSLNHLRGSFPNWLFQNNT----QL  380

Query  744   KVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLS  923
               LSL G    G+     L +  +++ + +SEN+L G++ +   N++S+ + NL L K+S
Sbjct  381   IGLSLGGNAFIGSFSLPLLAQ-PSVKYIGISENRLSGQLQA---NISSV-FPNLVLLKMS  435

Query  924   GNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVP  1103
             GN                      ++ +S        +L  +    N    +   +  +P
Sbjct  436   GNCLEG------------------QIPASVWQMK---RLEALDLANNHFSGELPTEVVIP  474

Query  1104  KFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNN  1283
                L  L L+      ++P+ L    +L VL IS N+L G  P W+ Q  + L    M++
Sbjct  475   P-SLQYLHLNGNNFTGEIPKSLS-STNLAVLEISNNSLSGMIPEWMGQ-MSGLVLLAMSH  531

Query  1284  NAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLH--S  1457
             N   G + +       L+ +++S N+  G I     S F ++  L L+ N  SG L   S
Sbjct  532   NHLRGPIPVELCNLDRLRFLDLSENQFSGLI----PSCFSHLEHLFLNKNHLSGNLTHGS  587

Query  1458  LIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHL  1637
                + L  LDLS+N+  G IP + + + S+L IL L NNK EG+I     +L  L  L L
Sbjct  588   TNNSALLTLDLSDNNIVGSIP-QWIGNLSALNILLLKNNKFEGEIPNHLCHLQRLRMLDL  646

Query  1638  DGNNFEGTIpnslsnlplhslDIRDNKL--------------------------------  1721
               N    +IP+ LSN+       +  +L                                
Sbjct  647   SHNQLTESIPSCLSNISQEVNSQQTFRLPALKSFAFQSVAFTSVYTMFDAVRMKVEFTTK  706

Query  1722  SGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPS  1898
             S  +    G L  +  + LS N L G +PIE  NL  + +L+ S NNL GSIP    N  
Sbjct  707   SSSLNYEGGPLLYMSGIDLSSNRLSGEVPIELGNLSEIQVLNFSHNNLVGSIPKTFSNLH  766

Query  1899  SIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRF  2078
              I  + LS ++LSG++        +L +  +++N+  G +PE  G  S        GN F
Sbjct  767   EIGCIDLSYNKLSGRIPHELLELHSLAVFSVAHNNLSGSVPELKGQFSTFDETSYEGNPF  826

Query  2079  EGKVPTQV  2102
                 P  +
Sbjct  827   LCGPPLHI  834



>gb|KCW75502.1| hypothetical protein EUGRSUZ_E04263 [Eucalyptus grandis]
Length=1033

 Score =   349 bits (895),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 268/650 (41%), Positives = 393/650 (60%), Gaps = 23/650 (4%)
 Frame = +3

Query  267   KLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDN  446
             KLEEL L     + SI   L   PSL+ L L DN+   G LH+    +L NLKEL +S N
Sbjct  128   KLEELDLSGNSLDNSILSILSTIPSLRHLFLGDNNL-TGTLHVN--GNLSNLKELDISYN  184

Query  447   YFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFD-MTKLLSSLAAFPSIKTLELQRVN  623
               +   T           I+N S LE LHLN      +  ++ +L A  S++ L LQ   
Sbjct  185   SIDAVATVEG--------IKNLSRLENLHLNGAHLKHVGTVVRALGALSSLRILSLQHNT  236

Query  624   VTNIDAIHALKNLSSLEELHLDGSNLHKDF--LSNIGPMESLKVLSLSGAQVGGTLPNKG  797
             V          N S LE+L LDGS+L+     LS++GP+ SL++LSLS   + G L +  
Sbjct  237   VEGTITTQDFHNFSKLEQLILDGSSLNTSIGILSSLGPLTSLRLLSLSITHLSGNLSDDS  296

Query  798   LCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleyls  977
             LC L  L+EL LS N + G +P+ + N++S+R +NL  N+ + ++  SPL++LTSLE+LS
Sbjct  297   LCNLVKLEELDLSFNGITGGLPTCWRNMSSIRILNLEDNEFTDSVVSSPLTSLTSLEFLS  356

Query  978   IMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDL-LK  1154
             I+ N F+++SS    AN+S+L+V++ D  K+  DT++   +P+FQL  LS+SN      K
Sbjct  357   ILGNHFDISSSLGPLANHSRLKVLILDDTKLTIDTKVASLIPRFQLKVLSMSNSPSRGFK  416

Query  1155  LPR--FLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNP  1328
             L    FL +Q DL++L +S N++ G FP+WLL+NNTKL+   M NN FT +L++ S  + 
Sbjct  417   LTSLGFLKHQYDLRILDLSSNDIPGPFPAWLLENNTKLEQLSMVNNLFT-TLEVPSMTHF  475

Query  1329  NLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGT--HLGFLDLSNNS  1502
             NL  +++SNN + GE++  F ++ PN+  LNLS+N   G +   +G+   LG LDLS+N+
Sbjct  476   NLWSMDISNNNMRGELTTEFCANVPNLSYLNLSTNRLEGNIPFELGSIKSLGILDLSSNN  535

Query  1503  FTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLS-SLEYLHLDGNNFEGTIpnsls  1679
             F+G +P ++L S   L IL ++ NKL+G+IV     ++  L YL LD N F G++    S
Sbjct  536   FSGGLPIQLLDS--KLDILSVAYNKLQGEIVLPNHTMNPGLSYLRLDHNLFNGSLSFLSS  593

Query  1680  nlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSEN  1859
              + L  LD+ +N  +G++PR +  ++SLV L LSKN L+G IP E  N   L  LDLS N
Sbjct  594   LVDLQGLDVSNNIFTGKLPRLIANMSSLVVLDLSKNQLDGLIPQELWNFGELQYLDLSNN  653

Query  1860  NLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTI  2039
             NL+G +PS      ++H+ LS+++L+G L  A  N + LV LDLS N F G IP W+G +
Sbjct  654   NLSGPLPSFFISKWVRHIHLSRNKLNGTLVHALPNGSCLVTLDLSENEFSGSIPYWLGNL  713

Query  2040  srlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISL  2189
             S+L  L L GN F G  P Q+C+L  LS++DLS N L G +P CLG ++L
Sbjct  714   SQLKILSLKGNSFYGTFPKQLCKLKSLSMIDLSENNLFGPLPSCLGPMNL  763


 Score = 93.6 bits (231),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 167/650 (26%), Positives = 267/650 (41%), Gaps = 112/650 (17%)
 Frame = +3

Query  267   KLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDN  446
             KLEEL L        +    +   S++IL+L DN+F D  +    +  L +L+ L +  N
Sbjct  302   KLEELDLSFNGITGGLPTCWRNMSSIRILNLEDNEFTDSVVS-SPLTSLTSLEFLSILGN  360

Query  447   YFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNV  626
             +F+          SS   + N S L+VL L++    +   ++SL     +K L +     
Sbjct  361   HFD--------ISSSLGPLANHSRLKVLILDDTKLTIDTKVASLIPRFQLKVLSMSNSPS  412

Query  627   TN--IDAIHALKNLSSLEELHLDGSNLHKDF----LSNIGPMESLKV-------------  749
                 + ++  LK+   L  L L  +++   F    L N   +E L +             
Sbjct  413   RGFKLTSLGFLKHQYDLRILDLSSNDIPGPFPAWLLENNTKLEQLSMVNNLFTTLEVPSM  472

Query  750   -------LSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLS  908
                    + +S   + G L  +    + NL  L LS N+LEG IP   G++ SL  ++LS
Sbjct  473   THFNLWSMDISNNNMRGELTTEFCANVPNLSYLNLSTNRLEGNIPFELGSIKSLGILDLS  532

Query  909   LNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQL  1088
              N  SG + +  L +   +    +  N  +      +   N  L  +  D N  + +  L
Sbjct  533   SNNFSGGLPIQLLDSKLDILS--VAYNKLQGEIVLPNHTMNPGLSYLRLDHN--LFNGSL  588

Query  1089  QGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQY  1268
                     L  L +SN I   KLPR +     L VL +S+N L+G  P   L N  +LQY
Sbjct  589   SFLSSLVDLQGLDVSNNIFTGKLPRLIANMSSLVVLDLSKNQLDGLIPQ-ELWNFGELQY  647

Query  1269  FLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPN---ILALNLSSNLF  1439
               ++NN  +G L  S  ++  ++ I++S NKL    +G    + PN   ++ L+LS N F
Sbjct  648   LDLSNNNLSGPLP-SFFISKWVRHIHLSRNKL----NGTLVHALPNGSCLVTLDLSENEF  702

Query  1440  SGQL-----------------HSLIGT---------HLGFLDLSNNSFTGEIPKEMLISC  1541
             SG +                 +S  GT          L  +DLS N+  G +P       
Sbjct  703   SGSIPYWLGNLSQLKILSLKGNSFYGTFPKQLCKLKSLSMIDLSENNLFGPLP-------  755

Query  1542  SSLVILKLSNN-------KLEGQIVQEFDYLSSLEYL---------------------HL  1637
             S L  + LS +        LE  I       S   Y+                     H 
Sbjct  756   SCLGPMNLSKDDTDKVTSSLERGIGSVLAVWSPWSYVRTNKGCDSNFVFHKEEEFQAPHT  815

Query  1638  DGNNFEGTIpnslsnlplhsl--DIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPI  1811
              G   +G   +      L ++  D   N+ +GEIP  +  L  ++ L LS N L G IP+
Sbjct  816   VGFTTKGRFDSYKGYALLKTVGLDFSCNQFNGEIPPELAILQEMLVLNLSHNKLTGRIPM  875

Query  1812  EFCNLKSLSILDLSENNLTGSIPSCLNP-SSIKHVSLSKHQLSGQLTRAF  1958
                +L  +  +DLS NNL GSIP  L   +S++  ++S + LSG +   +
Sbjct  876   SLSSLTEIESIDLSYNNLIGSIPEELTQLNSLEVFNVSYNDLSGAIPNKY  925


 Score = 80.9 bits (198),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 149/580 (26%), Positives = 239/580 (41%), Gaps = 101/580 (17%)
 Frame = +3

Query  495   HTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLE  674
             H  R K  + +L LN  +FD    + +  ++ +  + E    N T     H    L S  
Sbjct  22    HGFREKERVALLALN-ATFDFIYRVDAGGSYFNCCSWEGVECNPTTGRVTHL--RLFSWR  78

Query  675   ELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTL----PNKGLCELKNLQELWLSEN  842
               H      + +  S + P E LK L +SG  +GG +    PN     L  L+EL LS N
Sbjct  79    NYHFSFKTWYLN-TSLLLPFEELKSLDMSGKYLGGWIAPEEPNLLSSRLSKLEELDLSGN  137

Query  843   QLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSF  1022
              L+  I S    + SLR++ L  N L+G + ++                           
Sbjct  138   SLDNSILSILSTIPSLRHLFLGDNNLTGTLHVN---------------------------  170

Query  1023  ANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSL--SNCIDLLKLPRFLHYQRDLKVL  1196
              N S L+ +    N + A   ++G     +L++L L  ++   +  + R L     L++L
Sbjct  171   GNLSNLKELDISYNSIDAVATVEGIKNLSRLENLHLNGAHLKHVGTVVRALGALSSLRIL  230

Query  1197  RISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEI  1376
              +  N +EG   +    N +KL+  +++ ++   S+ + S + P   +  +S +      
Sbjct  231   SLQHNTVEGTITTQDFHNFSKLEQLILDGSSLNTSIGILSSLGPLTSLRLLSLS------  284

Query  1377  SGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVI  1556
                           +LS NL    L +L+   L  LDLS N  TG +P     + SS+ I
Sbjct  285   ------------ITHLSGNLSDDSLCNLV--KLEELDLSFNGITGGLPT-CWRNMSSIRI  329

Query  1557  LKLSNNKLEGQIVQE-FDYLSSLEYLHLDGNNFE-----GTIpnslsnlplhslDIR---  1709
             L L +N+    +V      L+SLE+L + GN+F+     G + N      L   D +   
Sbjct  330   LNLEDNEFTDSVVSSPLTSLTSLEFLSILGNHFDISSSLGPLANHSRLKVLILDDTKLTI  389

Query  1710  DNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLK---SLSILDLSENNLTGSIP  1880
             D K++  IPR+      L  L++S +   G        LK    L ILDLS N++ G  P
Sbjct  390   DTKVASLIPRFQ-----LKVLSMSNSPSRGFKLTSLGFLKHQYDLRILDLSSNDIPGPFP  444

Query  1881  S--------------------CLNPSSIKHVSL-----SKHQLSGQLTRAFFNNTA-LVI  1982
             +                     L   S+ H +L     S + + G+LT  F  N   L  
Sbjct  445   AWLLENNTKLEQLSMVNNLFTTLEVPSMTHFNLWSMDISNNNMRGELTTEFCANVPNLSY  504

Query  1983  LDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQV  2102
             L+LS N   G IP  +G+I  L  L L+ N F G +P Q+
Sbjct  505   LNLSTNRLEGNIPFELGSIKSLGILDLSSNNFSGGLPIQL  544



>gb|KHN28790.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=1030

 Score =   348 bits (892),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 276/682 (40%), Positives = 388/682 (57%), Gaps = 45/682 (7%)
 Frame = +3

Query  261   AKKLEELYLFECRFN---QSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDI-NDLRNLKE  428
             + KL  L + +  FN     I  SL GF SLK L L   D  D  LHIQ + + LRNL+ 
Sbjct  105   SSKLRNLEVLDISFNPLTNDILPSLGGFTSLKELYLSYIDL-DSDLHIQGLCSSLRNLEI  163

Query  429   LYLSDNYFEGFETSANHSG--------------------SSRHTIRNKSYLEVLHLNNIS  548
             L LS N F   + ++  SG                    S+ +T   +++ ++  L NI 
Sbjct  164   LDLSSNNFNNSDITSALSGLSSLKFLDLSICQLTSRSIFSTSNTFHIRNFYDLFWLKNIF  223

Query  549   FDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHAL-----KNLSSLEELHLDGSNLHKDF  713
                  +   ++ F S+K L+L   N  +    H L      +LS+LE L LD +NL  +F
Sbjct  224   NCYNYVYLDISRFTSLKILDLS-YNKLDKTLYHFLFYADFHDLSNLEHLILDYNNLENEF  282

Query  714   LSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLR  893
             L NIG + SLKVLSL    + GTLP     +LK L+EL+LS N+ EG +PS F N+TSLR
Sbjct  283   LKNIGELTSLKVLSLQQCDINGTLPPTDWFKLKKLEELYLSRNEFEGPLPSSFVNMTSLR  342

Query  894   YVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVI  1073
              + +S N   GN + +  S  +   +  I  N FEV  SF  FAN SK++ I  + N+V+
Sbjct  343   NLEISGNHFIGNFDSNLASLTSLEYFGFI-GNQFEVPVSFTPFANLSKIKFIYGEGNRVV  401

Query  1074  ADTQ--LQGFVPKFQLDSLSLSNCIDL--LKLPRFLHYQRDLKVLRISRNNLEGEFPSWL  1241
              D+Q  LQ ++PKF+L  L +S+  +   L LP FL YQ +L  + +S   LEG+FP WL
Sbjct  402   LDSQHSLQTWIPKFKLQKLIVSSTTETKSLPLPNFLLYQNNLTYIDLSGWKLEGDFPHWL  461

Query  1242  LQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEI-SGNFSSSFPNILAL  1418
             L+NNTK+   L  N +FTG+ +L     PN+Q I+VS+N + G+I S N SS +PN+  L
Sbjct  462   LENNTKMTDALFRNCSFTGTFQLPMSPLPNIQTIDVSDNTVYGQIPSNNISSIYPNLQYL  521

Query  1419  NLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI  1592
             NLS N   G + S +G  + L  LDLS N  +G+IP+ +L     L  LKLSNN LEG I
Sbjct  522   NLSGNNIQGSIPSELGQMSLLYLLDLSENQLSGKIPENILADGHPLQFLKLSNNMLEGPI  581

Query  1593  VQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQL  1772
             +   +  + LE L L  N F G +P+++ N  +  LD+ +N L G++P ++ + + L  L
Sbjct  582   L---NIPNGLETLILSHNRFTGRLPSNIFNSSVVLLDVSNNHLVGKLPSYVEKFSRLQGL  638

Query  1773  TLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTR  1952
              +S NH EG IPIE    ++LS LDLS+NNLTG +PS  N S+++ + L+ + LSG   R
Sbjct  639   YMSNNHFEGSIPIELAEPENLSHLDLSQNNLTGHVPSFAN-SNLQFIHLNNNHLSGLSKR  697

Query  1953  AFFNNTALVILDLSYNSFVGIIPEWIGTIsrlss--lllNGNRFEGKVPTQVCQLMRlsl  2126
              F  N++LV+LDLSYN     I + I  +S      LLL GN F G +P Q+CQL  LS+
Sbjct  698   MFNENSSLVMLDLSYNEISSKIQDMIQDLSYTRLNFLLLKGNHFIGDIPKQLCQLTDLSI  757

Query  2127  ldlsnnllsGVIPRCLGKISLE  2192
             LDLS+N  SG IP CLGK+  E
Sbjct  758   LDLSHNNFSGAIPNCLGKMPFE  779


 Score =   122 bits (306),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 185/714 (26%), Positives = 303/714 (42%), Gaps = 116/714 (16%)
 Frame = +3

Query  171   LNLKDFISLKVLDIGFNKFQS----FGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFP  338
             L++  F SLK+LD+ +NK       F    D      LE L L          +++    
Sbjct  231   LDISRFTSLKILDLSYNKLDKTLYHFLFYADFHDLSNLEHLILDYNNLENEFLKNIGELT  290

Query  339   SLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEG--------------FETSAN  476
             SLK+L L   D  +G L   D   L+ L+ELYLS N FEG               E S N
Sbjct  291   SLKVLSLQQCDI-NGTLPPTDWFKLKKLEELYLSRNEFEGPLPSSFVNMTSLRNLEISGN  349

Query  477   H-SGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHAL  653
             H  G+    + + + LE        F++    +  A    IK +  +   V  +D+ H+L
Sbjct  350   HFIGNFDSNLASLTSLEYFGFIGNQFEVPVSFTPFANLSKIKFIYGEGNRVV-LDSQHSL  408

Query  654   KN-----------LSSLEE------------------LHLDGSNLHKDF----LSN----  722
             +            +SS  E                  + L G  L  DF    L N    
Sbjct  409   QTWIPKFKLQKLIVSSTTETKSLPLPNFLLYQNNLTYIDLSGWKLEGDFPHWLLENNTKM  468

Query  723   -----------------IGPMESLKVLSLSGAQVGGTLPNKGLCEL-KNLQELWLSENQL  848
                              + P+ +++ + +S   V G +P+  +  +  NLQ L LS N +
Sbjct  469   TDALFRNCSFTGTFQLPMSPLPNIQTIDVSDNTVYGQIPSNNISSIYPNLQYLNLSGNNI  528

Query  849   EGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFAN  1028
             +G IPS  G ++ L  ++LS N+LSG I  + L+    L++L + NN  E          
Sbjct  529   QGSIPSELGQMSLLYLLDLSENQLSGKIPENILADGHPLQFLKLSNNMLE----------  578

Query  1029  NSKLRVILADRNKVIADTQLQGFVPKFQLDS----LSLSNCIDLLKLPRFLHYQRDLKVL  1196
                L +       +++  +  G +P    +S    L +SN   + KLP ++     L+ L
Sbjct  579   GPILNIPNGLETLILSHNRFTGRLPSNIFNSSVVLLDVSNNHLVGKLPSYVEKFSRLQGL  638

Query  1197  RISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEI  1376
              +S N+ EG  P  L +    L +  ++ N  TG   + S  N NLQ I+++NN L G +
Sbjct  639   YMSNNHFEGSIPIELAEPE-NLSHLDLSQNNLTG--HVPSFANSNLQFIHLNNNHLSG-L  694

Query  1377  SGNFSSSFPNILALNLSSNLFSGQLHSLIG----THLGFLDLSNNSFTGEIPKEMLISCS  1544
             S    +   +++ L+LS N  S ++  +I     T L FL L  N F G+IPK+ L   +
Sbjct  695   SKRMFNENSSLVMLDLSYNEISSKIQDMIQDLSYTRLNFLLLKGNHFIGDIPKQ-LCQLT  753

Query  1545  SLVILKLSNNKLEG-----------QIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlpl  1691
              L IL LS+N   G           ++    + L    +L  + +N +GT          
Sbjct  754   DLSILDLSHNNFSGAIPNCLGKMPFEVKDPAELLQDFYHLIPEPDNRDGT----ERYELP  809

Query  1692  hslDIRDNKLSGEIPRWMGR-LTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLT  1868
             +  +  +         +MG  L  +  + LS N L+G+IP E  NL  +  L+LS N+LT
Sbjct  810   NVQEKSNFTAKKRTDTYMGSILVYMSGIDLSHNKLKGNIPSELGNLTKIRTLNLSHNDLT  869

Query  1869  GSIPSCLNP-SSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEW  2027
             G IP+  +     + + LS + L+G++       T+L +  +++N+     PE+
Sbjct  870   GQIPATFSHLVQTESLDLSFNMLNGRIPPQLTTLTSLEVFSVAHNNLSCPTPEF  923



>ref|XP_006382351.1| hypothetical protein POPTR_0005s01310g [Populus trichocarpa]
 gb|ERP60148.1| hypothetical protein POPTR_0005s01310g [Populus trichocarpa]
Length=864

 Score =   343 bits (880),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 258/659 (39%), Positives = 368/659 (56%), Gaps = 49/659 (7%)
 Frame = +3

Query  519   LEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVT-----NIDAIHALK---------  656
             LE+L+L +  F  + L+ SL A P +  + L   ++      NI  +  LK         
Sbjct  14    LEILYLESTDFKESILIESLGALPCLGEVWLDGSSLPASFLRNIGPLSTLKVLSLAGVDF  73

Query  657   -----------NLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLC  803
                        N S+LEEL+LD ++L  +FL NIG + +LKVL      +  TLP +G C
Sbjct  74    NSTLPAQGIFFNSSTLEELNLDYTSLPLNFLQNIGALPALKVLYADYCDLNDTLPTQGWC  133

Query  804   ELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIM  983
             +LKNL++L+LS N L+G +P  FGNL+ L+ ++LS N+L GNI  S LS LT LEYLS+ 
Sbjct  134   DLKNLEQLYLSGNNLKGVLPPCFGNLSFLQSLDLSDNQLEGNIAFSHLSHLTQLEYLSVS  193

Query  984   NNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCI-DLLK--  1154
             NN F+V  SF SF N S L+VI  D N++ A    Q   PKFQL   S SNC    LK  
Sbjct  194   NNYFQVPISFGSFMNLSNLKVIACDNNELKAAPSFQPSAPKFQLLFFSASNCTPKPLKAG  253

Query  1155  LPRFLHYQRDLKVLRISRNNLEGE-FPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPN  1331
              P FLH Q DL ++ +S N   GE FPSWL +NNTKL    + + +F G L+L  H  PN
Sbjct  254   FPNFLHSQYDLVLVDLSHNKFVGEPFPSWLFENNTKLNRLYLRDTSFIGPLQLPQHPTPN  313

Query  1332  LQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSF  1505
             L  +++S N + G+++ N  S FP +    +++N  +G +    G  + L +LDLSNN  
Sbjct  314   LHTVDMSGNNIHGQVARNICSIFPRLKNFMMANNNLTGCIPPCFGNMSSLEYLDLSNNHM  373

Query  1506  TGEIPKEMLISC-SSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIp-nsls  1679
             + E+ +  L +  SSL  LKLSNN   G++      +++L YL LDGN F G +      
Sbjct  374   SCELLEHNLPTVGSSLWSLKLSNNNFNGRLPLSVFNMTNLAYLFLDGNKFAGQLSGTFSL  433

Query  1680  nlplhslDIRDNKLSGEIPRWM--GRLTSLVQ-LTLSKNHLEGHIPIEFCNLKSLSILDL  1850
                    DI +N LSG +PR +    L    Q + LS+N  EG IPIE+ N   L  LDL
Sbjct  434   ASSFWWFDISNNLLSGMLPRGIENSSLNHFAQAIDLSRNQFEGTIPIEYFNSHGLEFLDL  493

Query  1851  SENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWI  2030
             SENNL+GS+P   + S +++V L ++QLSG L  AF N ++LVI DL  N+  G IP WI
Sbjct  494   SENNLSGSLPLGFHASDLRYVHLYRNQLSGPLPYAFCNLSSLVIFDLGDNNLTGPIPNWI  553

Query  2031  GTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQF  2210
              ++S LS  +L  N+F GK+P Q+C L +LS+LDLS N  SG++P CL  ++   ++E+ 
Sbjct  554   DSLSELSIFVLKSNQFNGKLPHQLCLLRKLSILDLSENNFSGLLPSCLSNLNFTASDEK-  612

Query  2211  RGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSILK  2387
                       S+      R+  + GS +E    + +D    V+   K N Y+Y+  IL+
Sbjct  613   ---------TSVEPG---RMTGDDGSQEEIFASIVIDAKIAVELTAKKNFYSYEGGILR  659


 Score =   122 bits (305),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 196/738 (27%), Positives = 310/738 (42%), Gaps = 128/738 (17%)
 Frame = +3

Query  114   LEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFE  293
             LEEL++ YT +  +N L   N+    +LKVL   +       P       K LE+LYL  
Sbjct  89    LEELNLDYTSLP-LNFLQ--NIGALPALKVLYADYCDLNDTLPTQGWCDLKNLEQLYLSG  145

Query  294   CRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSA  473
                   +         L+ LDL DN   +G +    ++ L  L+ L +S+NYF+      
Sbjct  146   NNLKGVLPPCFGNLSFLQSLDLSDNQL-EGNIAFSHLSHLTQLEYLSVSNNYFQ------  198

Query  474   NHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDA----  641
                      I   S++ + +L  I+ D  +L ++ +  PS    +L   + +N       
Sbjct  199   -------VPISFGSFMNLSNLKVIACDNNELKAAPSFQPSAPKFQLLFFSASNCTPKPLK  251

Query  642   ------IHALKNLSSLEELH-------------LDGSNLHKDFL---SNIGPME------  737
                   +H+  +L  ++  H              + + L++ +L   S IGP++      
Sbjct  252   AGFPNFLHSQYDLVLVDLSHNKFVGEPFPSWLFENNTKLNRLYLRDTSFIGPLQLPQHPT  311

Query  738   -SLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLN  914
              +L  + +SG  + G +          L+   ++ N L G IP  FGN++SL Y++LS N
Sbjct  312   PNLHTVDMSGNNIHGQVARNICSIFPRLKNFMMANNNLTGCIPPCFGNMSSLEYLDLSNN  371

Query  915   KLSGNIelsplstl-tsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQ  1091
              +S  +    L T+ +SL  L + NN+F        F N + L  +  D NK     QL 
Sbjct  372   HMSCELLEHNLPTVGSSLWSLKLSNNNFNGRLPLSVF-NMTNLAYLFLDGNKFAG--QLS  428

Query  1092  GFVPKFQLDS----LSLSNCIDLLKLPRFL------HYQRDLKVLRISRNNLEGEFPSWL  1241
             G    F L S      +SN +    LPR +      H+    + + +SRN  EG  P   
Sbjct  429   G---TFSLASSFWWFDISNNLLSGMLPRGIENSSLNHFA---QAIDLSRNQFEGTIPIEY  482

Query  1242  LQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALN  1421
               N+  L++  ++ N  +GSL L  H + +L+ +++  N+L G +   F          N
Sbjct  483   F-NSHGLEFLDLSENNLSGSLPLGFHAS-DLRYVHLYRNQLSGPLPYAFC---------N  531

Query  1422  LSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQE  1601
             LSS              L   DL +N+ TG IP   + S S L I  L +N+  G++  +
Sbjct  532   LSS--------------LVIFDLGDNNLTGPIPN-WIDSLSELSIFVLKSNQFNGKLPHQ  576

Query  1602  FDYLSSLEYLHLDGNNFEGTIpnslsnlplhslD------------------------IR  1709
                L  L  L L  NNF G +P+ LSNL   + D                        + 
Sbjct  577   LCLLRKLSILDLSENNFSGLLPSCLSNLNFTASDEKTSVEPGRMTGDDGSQEEIFASIVI  636

Query  1710  DNKLSGEIPRWM-------GRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLT  1868
             D K++ E+           G L  +  L LS N   G IP E+ NL  +  L+LS+NNLT
Sbjct  637   DAKIAVELTAKKNFYSYEGGILRYMSALDLSCNRFTGEIPTEWGNLSGIYSLNLSQNNLT  696

Query  1869  GSIPSC-LNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsr  2045
             G IPS   N   I+ + LS + L+G++       T L + ++SYN+F G  PE     + 
Sbjct  697   GLIPSSFFNLKQIESLDLSHNNLNGRIPAQLVELTFLAVFNVSYNNFSGRTPEMKNQFAT  756

Query  2046  lsslllNGNRFEGKVPTQ  2099
                    GN      P Q
Sbjct  757   FDESSYKGNPLLCGPPLQ  774



>gb|KDO40862.1| hypothetical protein CISIN_1g001653mg [Citrus sinensis]
Length=1037

 Score =   346 bits (888),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 296/792 (37%), Positives = 419/792 (53%), Gaps = 42/792 (5%)
 Frame = +3

Query  51    DNPLNSHLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDI------  212
             DN LN  ++  G   L  L NLEEL M    +E + +      KDF  L+ L+       
Sbjct  71    DNRLNGSIDIKG---LNSLSNLEELDMTGNAIENLVVP-----KDFRGLRKLNTLYLGGS  122

Query  213   GFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIF-QSLKGFPSLKILDLMDNDFYDGPL  389
             G  +      +  +G    L+ LYL   +F  ++  Q L  F +L+ L L ++D +   L
Sbjct  123   GIPRIDGSKVLQSIGSLPSLKTLYLSHTKFKGTVVNQKLHNFTNLEELILDESDLHVSQL  182

Query  390   HIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDM-TKL  566
              +Q I    +LK L + D   +G    A H G      +N   LE L +  +  D+ T  
Sbjct  183   -LQSIASFTSLKHLSMQDCVLKG----ALH-GQDFLKFKN---LEYLDMGWVQVDVNTNF  233

Query  567   LSSLA-AFPSIKTLELQRVNVTNIDAI-HALKNLSSLEELHLDGSNLHKDFLSNIGPMES  740
             L  +  + PS+  L L   ++     +   L  L  L+ L++  ++L       +  M S
Sbjct  234   LQIVGESMPSLNFLSLTNSSLNKHTILDQGLCQLVHLQGLYIRDNDLRDGLPWCLANMTS  293

Query  741   LKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKL  920
             L+VL  S  Q+ G + + GLCEL  L++L++  N L G +P    NLTSLR +++S N+L
Sbjct  294   LQVLYASSNQLTGNI-SPGLCELVLLRKLYIDNNDLRGSLPLCLANLTSLRVLDVSYNQL  352

Query  921   SGNIelsplstltsleylsIMNNSF-EVASSFRSFANNSKLRVILADRNKVIADTQLQGF  1097
             + NI  S L  LTS+E L + NN F ++  S     N SKL+    + N    ++     
Sbjct  353   TENISSSSLMHLTSIEELILSNNHFFQIPISLEPLFNLSKLQTFNGEINAQ-TESHYDSL  411

Query  1098  VPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLM  1277
              PKFQL S+SLS  +D    P FL++Q DL  + +S  NL GEFP+WLL+NNT L+  L+
Sbjct  412   TPKFQLTSISLSGYVDGGTFPEFLYHQHDLNSVNLSHLNLSGEFPNWLLENNTNLETLLL  471

Query  1278  NNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHS  1457
              NN+  GS ++  H +  L  ++V NN   G I     +  P ++ LNLS N F+G + S
Sbjct  472   ANNSLFGSFRMPIHSHQKLATLDVFNNFFQGHIPVEIGTYLPGLMELNLSRNAFNGSIPS  531

Query  1458  LIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYL  1631
                    L  LD+SNN  TGEIP+ M   C SL IL LSNN+L+G I  E   L++L  L
Sbjct  532   SFADMKMLERLDISNNQLTGEIPERMATGCFSLEILALSNNRLQGHIFSEKFNLTNLMTL  591

Query  1632  HLDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIP  1808
              LDGNNF G IP SLS   +   L + DN L G+IPRW+G L +L  + +  N+LEG IP
Sbjct  592   QLDGNNFIGEIPESLSKCYMLRGLYLSDNHLFGKIPRWLGNLPTLQYIIMPNNNLEGPIP  651

Query  1809  IEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILD  1988
             IEFC   SL ILDLS N++ G++PSC +P+SI+ V LSK+++ G+L     +N  LV LD
Sbjct  652   IEFCQRDSLKILDLSNNSIFGTLPSCFSPASIEQVHLSKNKIEGRLESIIHDNPHLVTLD  711

Query  1989  LSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPR  2168
             LSYNS  G IP  I  + +L+ LLL  N  +G++P Q+CQL  + L+DLS+N LSG IP 
Sbjct  712   LSYNSLHGSIPNRIDRLPQLNYLLLAHNYIKGEIPVQLCQLKEVRLIDLSHNNLSGRIPP  771

Query  2169  CLGKISLEGTNEQFRGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRT  2348
             CL   SL   NE + G   P   +    ++         S     PM   +    VQF T
Sbjct  772   CLVNTSL---NEGYHGEVAPTSIWCRRASVYRSACLPGQSSP---PMGKEET---VQFTT  822

Query  2349  KGNLYNYQNSIL  2384
             K   Y YQ  IL
Sbjct  823   KNMSYYYQGRIL  834


 Score =   119 bits (299),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 173/642 (27%), Positives = 274/642 (43%), Gaps = 91/642 (14%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L +LY+       S+   L    SL++LD+  N   +  +    +  L +++EL LS+N+
Sbjct  318   LRKLYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTEN-ISSSSLMHLTSIEELILSNNH  376

Query  450   F--------EGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKL-LSSL---AAFPS  593
             F          F  S   + +     + +S+ + L      F +T + LS       FP 
Sbjct  377   FFQIPISLEPLFNLSKLQTFNGEINAQTESHYDSL---TPKFQLTSISLSGYVDGGTFPE  433

Query  594   -------IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
                    + ++ L  +N++       L+N ++LE L L  ++L   F   I   + L  L
Sbjct  434   FLYHQHDLNSVNLSHLNLSGEFPNWLLENNTNLETLLLANNSLFGSFRMPIHSHQKLATL  493

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +      G +P +    L  L EL LS N   G IPS F ++  L  +++S N+L+G I
Sbjct  494   DVFNNFFQGHIPVEIGTYLPGLMELNLSRNAFNGSIPSSFADMKMLERLDISNNQLTGEI  553

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                  +   SLE L++ NN  +    F    N + L  +  D N  I      G +P+  
Sbjct  554   PERMATGCFSLEILALSNNRLQ-GHIFSEKFNLTNLMTLQLDGNNFI------GEIPE--  604

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C  L             + L +S N+L G+ P WL  N   LQY +M NN  
Sbjct  605   ----SLSKCYML-------------RGLYLSDNHLFGKIPRWL-GNLPTLQYIIMPNNNL  646

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI--G  1466
              G + +      +L+I+++SNN + G +   FS +  +I  ++LS N   G+L S+I   
Sbjct  647   EGPIPIEFCQRDSLKILDLSNNSIFGTLPSCFSPA--SIEQVHLSKNKIEGRLESIIHDN  704

Query  1467  THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGN  1646
              HL  LDLS NS  G IP   +     L  L L++N ++G+I  +   L  +  + L  N
Sbjct  705   PHLVTLDLSYNSLHGSIPNR-IDRLPQLNYLLLAHNYIKGEIPVQLCQLKEVRLIDLSHN  763

Query  1647  NFEGTI----------------pnslsnlplhslDIRDNKLSGEIPRWMGR---------  1751
             N  G I                    S     +   R   L G+    MG+         
Sbjct  764   NLSGRIPPCLVNTSLNEGYHGEVAPTSIWCRRASVYRSACLPGQSSPPMGKEETVQFTTK  823

Query  1752  ----------LTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPS  1898
                       LTS+  + LS N L G IP +   L  +  L+LS NNLTG+IP+   N  
Sbjct  824   NMSYYYQGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIHALNLSHNNLTGTIPTTFSNLK  883

Query  1899  SIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPE  2024
              I+ + LS + L G++         L +  ++YN+  G IP+
Sbjct  884   QIESLDLSYNLLHGKIPPQLIVLNTLEVFKVAYNNLSGKIPD  925


 Score = 86.3 bits (212),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 173/735 (24%), Positives = 293/735 (40%), Gaps = 149/735 (20%)
 Frame = +3

Query  570   SSLAAFPSIKTLELQRVNVTNI---DAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMES  740
             S    F  +++L+L   N+      +++  L  L++L+ L+L+ ++ +    S++G + S
Sbjct  4     SLFTPFQQLESLDLSWNNIAGCVQNESLERLSRLTNLKFLYLNDNHFNNSIFSSLGGLSS  63

Query  741   LKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEG-KIPSYFGNLTSLRYVNL---S  908
             L+ LSL+  ++ G++  KGL  L NL+EL ++ N +E   +P  F  L  L  + L    
Sbjct  64    LRHLSLADNRLNGSIDIKGLNSLSNLEELDMTGNAIENLVVPKDFRGLRKLNTLYLGGSG  123

Query  909   LNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQL  1088
             + ++ G+  L  + +L SL+ L + +  F+     +   N + L  ++ D + +     L
Sbjct  124   IPRIDGSKVLQSIGSLPSLKTLYLSHTKFKGTVVNQKLHNFTNLEELILDESDLHVSQLL  183

Query  1089  QGFVPKFQLDSLSLSNCI--------DLLKLPRFLHYQRDLKVLRISRNNLE--GE-FPS  1235
             Q       L  LS+ +C+        D LK     +       + ++ N L+  GE  PS
Sbjct  184   QSIASFTSLKHLSMQDCVLKGALHGQDFLKFKNLEYLDMGWVQVDVNTNFLQIVGESMPS  243

Query  1236  --WLLQNNTK----------------LQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNK  1361
               +L   N+                 LQ   + +N     L        +LQ++  S+N+
Sbjct  244   LNFLSLTNSSLNKHTILDQGLCQLVHLQGLYIRDNDLRDGLPWCLANMTSLQVLYASSNQ  303

Query  1362  LCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLI  1535
             L G IS         +  L + +N   G L   +   T L  LD+S N  T  I    L+
Sbjct  304   LTGNISPGL-CELVLLRKLYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSSLM  362

Query  1536  SCSSLVILKLSNN-----------------------KLEGQIVQEFDYLSSLEYL-----  1631
               +S+  L LSNN                       ++  Q    +D L+    L     
Sbjct  363   HLTSIEELILSNNHFFQIPISLEPLFNLSKLQTFNGEINAQTESHYDSLTPKFQLTSISL  422

Query  1632  --HLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWM------------------GR  1751
               ++DG  F   + +      ++   +    LSGE P W+                  G 
Sbjct  423   SGYVDGGTFPEFLYHQHDLNSVNLSHL---NLSGEFPNWLLENNTNLETLLLANNSLFGS  479

Query  1752  L-------TSLVQLTLSKNHLEGHIPIE-------------------------FCNLKSL  1835
                       L  L +  N  +GHIP+E                         F ++K L
Sbjct  480   FRMPIHSHQKLATLDVFNNFFQGHIPVEIGTYLPGLMELNLSRNAFNGSIPSSFADMKML  539

Query  1836  SILDLSENNLTGSIPSCLNPS--SIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFV  2009
               LD+S N LTG IP  +     S++ ++LS ++L G +    FN T L+ L L  N+F+
Sbjct  540   ERLDISNNQLTGEIPERMATGCFSLEILALSNNRLQGHIFSEKFNLTNLMTLQLDGNNFI  599

Query  2010  GIIPE------------------------WIGTIsrlsslllNGNRFEGKVPTQVCQLMR  2117
             G IPE                        W+G +  L  +++  N  EG +P + CQ   
Sbjct  600   GEIPESLSKCYMLRGLYLSDNHLFGKIPRWLGNLPTLQYIIMPNNNLEGPIPIEFCQRDS  659

Query  2118  lslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSINDAILDRLHYEWGSDDE  2297
             L +LDLSNN + G +P C    S+E  +     I    E    ++  L  L   + S   
Sbjct  660   LKILDLSNNSIFGTLPSCFSPASIEQVHLSKNKIEGRLESIIHDNPHLVTLDLSYNSLHG  719

Query  2298  YIPMLAVDVLPEVQF  2342
              IP   +D LP++ +
Sbjct  720   SIPN-RIDRLPQLNY  733



>ref|XP_010655050.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
isoform X2 [Vitis vinifera]
Length=1054

 Score =   346 bits (888),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 290/770 (38%), Positives = 424/770 (55%), Gaps = 31/770 (4%)
 Frame = +3

Query  111   NLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSF---GPINDVGGAKKLEEL  281
             N+ E++  Y +  +  +L+V     F  L  L++  N F  F        +   KKLE L
Sbjct  99    NMLEVNWYYYENVKFWLLNVSLFLPFEELHHLNLSANSFDGFIENEGFKGLSSLKKLEIL  158

Query  282   YLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGF  461
              +    F++S  +SL    SLK L +      DG   IQ++   RNL+ L LS N  E F
Sbjct  159   DISGNEFDKSALKSLGAITSLKTLAIRSMGL-DGSFPIQELASSRNLEVLDLSYNDLESF  217

Query  462   ETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDA  641
             +   + +  S   I + SY  +  +         + SS+     +K+L L   ++     
Sbjct  218   QLVQDFASLSNLEILDLSYNSLTGI---------IPSSIRLMSHLKSLSLAANHLNGSLQ  268

Query  642   IHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQ  821
                  +LS+LE L L  ++      S+I  M SLK LSL+G Q+ G+LPN+G C+L  LQ
Sbjct  269   NQDFASLSNLEILDLSYNSFSGILPSSIRLMSSLKSLSLAGNQLNGSLPNQGFCQLNKLQ  328

Query  822   ELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEV  1001
             EL L+ N  +G +P    NLTSLR ++LS N  SGN+  S L +LTSLEY+ +  N FE 
Sbjct  329   ELDLNSNFFQGILPPCLNNLTSLRLLDLSHNLFSGNVSSSLLPSLTSLEYIDLSYNLFEG  388

Query  1002  ASSFRSFANNSKLRVIL--ADRNKVIADTQLQ-GFVPKFQLDSLSLSNCIDLLKLPRFLH  1172
               SF SFAN+S L+V++  +D NK   +T+   G+VP FQL  L LSN   +   P FL 
Sbjct  389   PFSFNSFANHSNLQVVIHGSDNNKFEIETEYPVGWVPLFQLKVLVLSNYKLIGDFPGFLR  448

Query  1173  YQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVS  1352
             YQ  L V+ +S NNL G FP+WLL+NNT+L+Y ++ NN+  G L L    N  +  +++S
Sbjct  449   YQFRLTVVDLSHNNLTGSFPNWLLENNTRLEYLVLRNNSLMGQL-LPLRPNSRITSLDIS  507

Query  1353  NNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKE  1526
             +N+L GE+  N ++  PNI  LNLS+N F G L S I   + L  LDLS NSF+GE+PK+
Sbjct  508   DNRLVGELQQNVANMIPNIEHLNLSNNGFEGILPSSIAEMSSLWSLDLSANSFSGEVPKQ  567

Query  1527  MLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIp-nslsnlplhslD  1703
             +L++   L  LKLSNNK  G+I      L+SLE+LHLD N F+GT+      +  L  LD
Sbjct  568   LLVA-KDLEFLKLSNNKFHGEIFSRDFNLTSLEFLHLDNNQFKGTLSNVISRSSWLRVLD  626

Query  1704  IRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPS  1883
             + +N +SGEIP W+G +T L  L L  N  +G +P E   L+ L  LD+S+N L+GS+PS
Sbjct  627   VSNNNMSGEIPSWIGNMTDLTTLVLGNNSFKGKLPPEISQLQRLEFLDVSQNTLSGSLPS  686

Query  1884  CLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslll  2063
               +   +KH+ L  +  +G + R F N++ L+ LD+  N   G IP  I  +  L   LL
Sbjct  687   LKSIEYLKHLHLQGNMFTGLIPRDFLNSSNLLTLDIRDNRLFGSIPNSISRLLELRIFLL  746

Query  2064  NGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKIS---LEGTNEQFRGINLPFE  2234
              GN   G +P Q+C L ++SL+DLSNN  SG IP+C G I     +  +  ++ +  P+ 
Sbjct  747   RGNLLSGFIPNQLCHLTKISLMDLSNNNFSGSIPKCFGHIQFGDFKTEHNVYKPMFNPYS  806

Query  2235  YYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
             ++SI    L  + Y + S + +      D + EV+F TK    +Y   IL
Sbjct  807   FFSIYTGYL--VKYLFFSTEAH-----RDEVDEVEFVTKNRSNSYGGGIL  849


 Score =   113 bits (282),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 204/737 (28%), Positives = 303/737 (41%), Gaps = 121/737 (16%)
 Frame = +3

Query  69    HLNNS-GNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPI  245
             HLN S  N+    L NLE L + Y     I   S+   +   SLK L +  N+     P 
Sbjct  262   HLNGSLQNQDFASLSNLEILDLSYNSFSGILPSSI---RLMSSLKSLSLAGNQLNGSLPN  318

Query  246   NDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLK  425
                    KL+EL L    F   +   L    SL++LDL  N  + G +    +  L +L+
Sbjct  319   QGFCQLNKLQELDLNSNFFQGILPPCLNNLTSLRLLDLSHN-LFSGNVSSSLLPSLTSLE  377

Query  426   ELYLSDNYFEG---FETSANHS-------GSSRHTIRNKS-----YLEVLHLNNISFDMT  560
              + LS N FEG   F + ANHS       GS  +    ++     ++ +  L  +     
Sbjct  378   YIDLSYNLFEGPFSFNSFANHSNLQVVIHGSDNNKFEIETEYPVGWVPLFQLKVLVLSNY  437

Query  561   KLLSSLAAFPS----IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIG  728
             KL+     F      +  ++L   N+T       L+N + LE L L  ++L    L  + 
Sbjct  438   KLIGDFPGFLRYQFRLTVVDLSHNNLTGSFPNWLLENNTRLEYLVLRNNSLMGQLLP-LR  496

Query  729   PMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLS  908
             P   +  L +S  ++ G L       + N++ L LS N  EG +PS    ++SL  ++LS
Sbjct  497   PNSRITSLDISDNRLVGELQQNVANMIPNIEHLNLSNNGFEGILPSSIAEMSSLWSLDLS  556

Query  909   LNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQL  1088
              N  SG +    L          + NN F      R F N + L  +  D N      Q 
Sbjct  557   ANSFSGEVPKQLLVAKDLEFLK-LSNNKFHGEIFSRDF-NLTSLEFLHLDNN------QF  608

Query  1089  QGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQY  1268
             +G          +LSN I              L+VL +S NN+ GE PSW+  N T L  
Sbjct  609   KG----------TLSNVIS---------RSSWLRVLDVSNNNMSGEIPSWI-GNMTDLTT  648

Query  1269  FLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQ  1448
              ++ NN+F G L         L+ ++VS N L G        S P++ ++          
Sbjct  649   LVLGNNSFKGKLPPEISQLQRLEFLDVSQNTLSG--------SLPSLKSI----------  690

Query  1449  LHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEY  1628
                    +L  L L  N FTG IP++ L S S+L+ L + +N+L G I      L  L  
Sbjct  691   ------EYLKHLHLQGNMFTGLIPRDFLNS-SNLLTLDIRDNRLFGSIPNSISRLLELRI  743

Query  1629  LHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGEIPRWMGRLT----------------  1757
               L GN   G I         +  +D+ +N  SG IP+  G +                 
Sbjct  744   FLLRGNLLSGFIPNQLCHLTKISLMDLSNNNFSGSIPKCFGHIQFGDFKTEHNVYKPMFN  803

Query  1758  ----------SLVQLTL--SKNHLEGHIPIEFCN-----------LKSLSILDLSENNLT  1868
                        LV+     ++ H +    +EF             L  +S LDLS NNLT
Sbjct  804   PYSFFSIYTGYLVKYLFFSTEAHRDEVDEVEFVTKNRSNSYGGGILDFMSGLDLSCNNLT  863

Query  1869  GSIPSCLNP-SSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVG-IIPEWIGTIs  2042
             G IP  L   SSI  ++LS +QL G + ++F   + +  LDLSYN   G I PE+IG ++
Sbjct  864   GEIPRELGMLSSILALNLSHNQLKGSVPKSFSKLSQIESLDLSYNKLSGEIPPEFIG-LN  922

Query  2043  rlsslllNGNRFEGKVP  2093
              L    +  N   G+VP
Sbjct  923   FLEVFNVAHNNISGRVP  939



>ref|XP_010655049.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
isoform X1 [Vitis vinifera]
Length=1103

 Score =   347 bits (890),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 295/814 (36%), Positives = 438/814 (54%), Gaps = 70/814 (9%)
 Frame = +3

Query  111   NLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSF---GPINDVGGAKKLEEL  281
             N+ E++  Y +  +  +L+V     F  L  L++  N F  F        +   KKLE L
Sbjct  99    NMLEVNWYYYENVKFWLLNVSLFLPFEELHHLNLSANSFDGFIENEGFKGLSSLKKLEIL  158

Query  282   YLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGF  461
              +    F++S  +SL    SLK L +      DG   IQ++   RNL+ L LS N  E F
Sbjct  159   DISGNEFDKSALKSLGAITSLKTLAIRSMGL-DGSFPIQELASSRNLEVLDLSYNDLESF  217

Query  462   ETSANHSGSSRHTIRNKSY----------LEVL-HLNNISFDMTKLLSSLA--AFPSIKT  602
             +   + +  S   I + SY          + ++ HL ++S     L  SL    F S+  
Sbjct  218   QLVQDFANLSNLEILDLSYNSLNGIIPSSIRLMSHLKSLSLARNHLNGSLQNQDFASLSN  277

Query  603   LELQRVNVTNIDAI--HALKNLSSLEEL-----HLDGSNLHKDFLSNIGPMESLKVLSLS  761
             LE+  ++  ++  I   +++ +S L+ L     HL+GS  ++DF S    + +L++L LS
Sbjct  278   LEILDLSYNSLTGIIPSSIRLMSHLKSLSLAANHLNGSLQNQDFAS----LSNLEILDLS  333

Query  762   ------------------------GAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSY  869
                                     G Q+ G+LPN+G C+L  LQEL L+ N  +G +P  
Sbjct  334   YNSFSGILPSSIRLMSSLKSLSLAGNQLNGSLPNQGFCQLNKLQELDLNSNFFQGILPPC  393

Query  870   FGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVI  1049
               NLTSLR ++LS N  SGN+  S L +LTSLEY+ +  N FE   SF SFAN+S L+V+
Sbjct  394   LNNLTSLRLLDLSHNLFSGNVSSSLLPSLTSLEYIDLSYNLFEGPFSFNSFANHSNLQVV  453

Query  1050  L--ADRNKVIADTQLQ-GFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLE  1220
             +  +D NK   +T+   G+VP FQL  L LSN   +   P FL YQ  L V+ +S NNL 
Sbjct  454   IHGSDNNKFEIETEYPVGWVPLFQLKVLVLSNYKLIGDFPGFLRYQFRLTVVDLSHNNLT  513

Query  1221  GEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSF  1400
             G FP+WLL+NNT+L+Y ++ NN+  G L L    N  +  +++S+N+L GE+  N ++  
Sbjct  514   GSFPNWLLENNTRLEYLVLRNNSLMGQL-LPLRPNSRITSLDISDNRLVGELQQNVANMI  572

Query  1401  PNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNN  1574
             PNI  LNLS+N F G L S I   + L  LDLS NSF+GE+PK++L++   L  LKLSNN
Sbjct  573   PNIEHLNLSNNGFEGILPSSIAEMSSLWSLDLSANSFSGEVPKQLLVA-KDLEFLKLSNN  631

Query  1575  KLEGQIVQEFDYLSSLEYLHLDGNNFEGTIp-nslsnlplhslDIRDNKLSGEIPRWMGR  1751
             K  G+I      L+SLE+LHLD N F+GT+      +  L  LD+ +N +SGEIP W+G 
Sbjct  632   KFHGEIFSRDFNLTSLEFLHLDNNQFKGTLSNVISRSSWLRVLDVSNNNMSGEIPSWIGN  691

Query  1752  LTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQ  1931
             +T L  L L  N  +G +P E   L+ L  LD+S+N L+GS+PS  +   +KH+ L  + 
Sbjct  692   MTDLTTLVLGNNSFKGKLPPEISQLQRLEFLDVSQNTLSGSLPSLKSIEYLKHLHLQGNM  751

Query  1932  LSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQL  2111
              +G + R F N++ L+ LD+  N   G IP  I  +  L   LL GN   G +P Q+C L
Sbjct  752   FTGLIPRDFLNSSNLLTLDIRDNRLFGSIPNSISRLLELRIFLLRGNLLSGFIPNQLCHL  811

Query  2112  MRlslldlsnnllsGVIPRCLGKIS---LEGTNEQFRGINLPFEYYSINDAILDRLHYEW  2282
              ++SL+DLSNN  SG IP+C G I     +  +  ++ +  P+ ++SI    L  + Y +
Sbjct  812   TKISLMDLSNNNFSGSIPKCFGHIQFGDFKTEHNVYKPMFNPYSFFSIYTGYL--VKYLF  869

Query  2283  GSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
              S + +      D + EV+F TK    +Y   IL
Sbjct  870   FSTEAH-----RDEVDEVEFVTKNRSNSYGGGIL  898


 Score =   114 bits (285),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 210/783 (27%), Positives = 314/783 (40%), Gaps = 164/783 (21%)
 Frame = +3

Query  69    HLNNS-GNERLTGLINLEELHMRYTQMEEINILSV-------------------LNLKDF  188
             HLN S  N+    L NLE L + Y  +  I   S+                   L  +DF
Sbjct  262   HLNGSLQNQDFASLSNLEILDLSYNSLTGIIPSSIRLMSHLKSLSLAANHLNGSLQNQDF  321

Query  189   ISL---KVLDIGFNKFQSFGPI---------------NDVGGA---------KKLEELYL  287
              SL   ++LD+ +N F    P                N + G+          KL+EL L
Sbjct  322   ASLSNLEILDLSYNSFSGILPSSIRLMSSLKSLSLAGNQLNGSLPNQGFCQLNKLQELDL  381

Query  288   FECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEG---  458
                 F   +   L    SL++LDL  N  + G +    +  L +L+ + LS N FEG   
Sbjct  382   NSNFFQGILPPCLNNLTSLRLLDLSHN-LFSGNVSSSLLPSLTSLEYIDLSYNLFEGPFS  440

Query  459   FETSANHS-------GSSRHTIRNKS-----YLEVLHLNNISFDMTKLLSSLAAFPS---  593
             F + ANHS       GS  +    ++     ++ +  L  +     KL+     F     
Sbjct  441   FNSFANHSNLQVVIHGSDNNKFEIETEYPVGWVPLFQLKVLVLSNYKLIGDFPGFLRYQF  500

Query  594   -IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQ  770
              +  ++L   N+T       L+N + LE L L  ++L    L  + P   +  L +S  +
Sbjct  501   RLTVVDLSHNNLTGSFPNWLLENNTRLEYLVLRNNSLMGQLLP-LRPNSRITSLDISDNR  559

Query  771   VGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
             + G L       + N++ L LS N  EG +PS    ++SL  ++LS N  SG +    L 
Sbjct  560   LVGELQQNVANMIPNIEHLNLSNNGFEGILPSSIAEMSSLWSLDLSANSFSGEVPKQLLV  619

Query  951   tltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSL  1130
                      + NN F      R F N + L  +  D N      Q +G          +L
Sbjct  620   AKDLEFLK-LSNNKFHGEIFSRDF-NLTSLEFLHLDNN------QFKG----------TL  661

Query  1131  SNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKL  1310
             SN I              L+VL +S NN+ GE PSW+  N T L   ++ NN+F G L  
Sbjct  662   SNVIS---------RSSWLRVLDVSNNNMSGEIPSWI-GNMTDLTTLVLGNNSFKGKLPP  711

Query  1311  SSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDL  1490
                    L+ ++VS N L G        S P++ ++                 +L  L L
Sbjct  712   EISQLQRLEFLDVSQNTLSG--------SLPSLKSI----------------EYLKHLHL  747

Query  1491  SNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-p  1667
               N FTG IP++ L S S+L+ L + +N+L G I      L  L    L GN   G I  
Sbjct  748   QGNMFTGLIPRDFLNS-SNLLTLDIRDNRLFGSIPNSISRLLELRIFLLRGNLLSGFIPN  806

Query  1668  nslsnlplhslDIRDNKLSGEIPRWMGRLT--------------------------SLVQ  1769
                    +  +D+ +N  SG IP+  G +                            LV+
Sbjct  807   QLCHLTKISLMDLSNNNFSGSIPKCFGHIQFGDFKTEHNVYKPMFNPYSFFSIYTGYLVK  866

Query  1770  LTL--SKNHLEGHIPIEFCN-----------LKSLSILDLSENNLTGSIPSCLNP-SSIK  1907
                  ++ H +    +EF             L  +S LDLS NNLTG IP  L   SSI 
Sbjct  867   YLFFSTEAHRDEVDEVEFVTKNRSNSYGGGILDFMSGLDLSCNNLTGEIPRELGMLSSIL  926

Query  1908  HVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVG-IIPEWIGTIsrlsslllNGNRFEG  2084
              ++LS +QL G + ++F   + +  LDLSYN   G I PE+IG ++ L    +  N   G
Sbjct  927   ALNLSHNQLKGSVPKSFSKLSQIESLDLSYNKLSGEIPPEFIG-LNFLEVFNVAHNNISG  985

Query  2085  KVP  2093
             +VP
Sbjct  986   RVP  988



>ref|XP_006487933.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Citrus sinensis]
Length=1046

 Score =   346 bits (887),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 296/792 (37%), Positives = 419/792 (53%), Gaps = 42/792 (5%)
 Frame = +3

Query  51    DNPLNSHLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDI------  212
             DN LN  ++  G   L  L NLEEL M    +E + +      KDF  L+ L+       
Sbjct  80    DNRLNGSIDIKG---LNSLSNLEELDMTGNAIENLVVP-----KDFRGLRKLNTLYLGGS  131

Query  213   GFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIF-QSLKGFPSLKILDLMDNDFYDGPL  389
             G  +      +  +G    L+ LYL   +F  ++  Q L  F +L+ L L ++D +   L
Sbjct  132   GIPRIDGSKVLQSIGSLPSLKTLYLSHTKFKGTVVNQKLHNFTNLEELILDESDLHVSQL  191

Query  390   HIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDM-TKL  566
              +Q I    +LK L + D   +G    A H G      +N   LE L +  +  D+ T  
Sbjct  192   -LQSIASFTSLKHLSMQDCVLKG----ALH-GQDFLKFKN---LEYLDMGWVQVDVNTNF  242

Query  567   LSSLA-AFPSIKTLELQRVNVTNIDAI-HALKNLSSLEELHLDGSNLHKDFLSNIGPMES  740
             L  +  + PS+  L L   ++     +   L  L  L+ L++  ++L       +  M S
Sbjct  243   LQIVGESMPSLNFLSLTNSSLNKHTILDQGLCQLVHLQGLYIRDNDLRDGLPWCLANMTS  302

Query  741   LKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKL  920
             L+VL  S  Q+ G + + GLCEL  L++L++  N L G +P    NLTSLR +++S N+L
Sbjct  303   LQVLYASSNQLTGNI-SPGLCELVLLRKLYIDNNDLRGSLPLCLANLTSLRVLDVSYNQL  361

Query  921   SGNIelsplstltsleylsIMNNSF-EVASSFRSFANNSKLRVILADRNKVIADTQLQGF  1097
             + NI  S L  LTS+E L + NN F ++  S     N SKL+    + N    ++     
Sbjct  362   TENISSSSLMHLTSIEELILSNNHFFQIPISLEPLFNLSKLQTFNGEINAQ-TESHYDSL  420

Query  1098  VPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLM  1277
              PKFQL S+SLS  +D    P FL++Q DL  + +S  NL GEFP+WLL+NNT L+  L+
Sbjct  421   TPKFQLTSISLSGYVDGGTFPEFLYHQHDLNSVNLSHLNLSGEFPNWLLENNTNLETLLL  480

Query  1278  NNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHS  1457
              NN+  GS ++  H +  L  ++V NN   G I     +  P ++ LNLS N F+G + S
Sbjct  481   ANNSLFGSFRMPIHSHQKLATLDVFNNFFQGHIPVEIGTYLPGLMELNLSRNAFNGSIPS  540

Query  1458  LIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYL  1631
                    L  LD+SNN  TGEIP+ M   C SL IL LSNN+L+G I  E   L++L  L
Sbjct  541   SFADMKMLERLDISNNQLTGEIPERMATGCFSLEILALSNNRLQGHIFSEKFNLTNLMTL  600

Query  1632  HLDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIP  1808
              LDGNNF G IP SLS   +   L + DN L G+IPRW+G L +L  + +  N+LEG IP
Sbjct  601   QLDGNNFIGEIPESLSKCYMLRGLYLSDNHLFGKIPRWLGNLPTLQYIIMPNNNLEGPIP  660

Query  1809  IEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILD  1988
             IEFC   SL ILDLS N++ G++PSC +P+SI+ V LSK+++ G+L     +N  LV LD
Sbjct  661   IEFCQRDSLKILDLSNNSIFGTLPSCFSPASIEQVHLSKNKIEGRLESIIHDNPHLVTLD  720

Query  1989  LSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPR  2168
             LSYNS  G IP  I  + +L+ LLL  N  +G++P Q+CQL  + L+DLS+N LSG IP 
Sbjct  721   LSYNSLHGSIPNRIDRLPQLNYLLLAHNYIKGEIPVQLCQLKEVRLIDLSHNNLSGRIPP  780

Query  2169  CLGKISLEGTNEQFRGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRT  2348
             CL   SL   NE + G   P   +    ++         S     PM   +    VQF T
Sbjct  781   CLVNTSL---NEGYHGEVAPTSIWCRRASVYRSACLPGQSSP---PMGKEET---VQFTT  831

Query  2349  KGNLYNYQNSIL  2384
             K   Y YQ  IL
Sbjct  832   KNMSYYYQGRIL  843


 Score =   119 bits (299),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 174/642 (27%), Positives = 275/642 (43%), Gaps = 91/642 (14%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L +LY+       S+   L    SL++LD+  N   +  +    +  L +++EL LS+N+
Sbjct  327   LRKLYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTEN-ISSSSLMHLTSIEELILSNNH  385

Query  450   F--------EGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKL-LSSL---AAFPS  593
             F          F  S   + +     + +S+ + L      F +T + LS       FP 
Sbjct  386   FFQIPISLEPLFNLSKLQTFNGEINAQTESHYDSL---TPKFQLTSISLSGYVDGGTFPE  442

Query  594   -------IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
                    + ++ L  +N++       L+N ++LE L L  ++L   F   I   + L  L
Sbjct  443   FLYHQHDLNSVNLSHLNLSGEFPNWLLENNTNLETLLLANNSLFGSFRMPIHSHQKLATL  502

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +      G +P +    L  L EL LS N   G IPS F ++  L  +++S N+L+G I
Sbjct  503   DVFNNFFQGHIPVEIGTYLPGLMELNLSRNAFNGSIPSSFADMKMLERLDISNNQLTGEI  562

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                  +   SLE L++ NN  +    F    N + L  +  D N  I      G +P+  
Sbjct  563   PERMATGCFSLEILALSNNRLQ-GHIFSEKFNLTNLMTLQLDGNNFI------GEIPE--  613

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C           Y   L+ L +S N+L G+ P WL  N   LQY +M NN  
Sbjct  614   ----SLSKC-----------YM--LRGLYLSDNHLFGKIPRWL-GNLPTLQYIIMPNNNL  655

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLI--G  1466
              G + +      +L+I+++SNN + G +   FS +  +I  ++LS N   G+L S+I   
Sbjct  656   EGPIPIEFCQRDSLKILDLSNNSIFGTLPSCFSPA--SIEQVHLSKNKIEGRLESIIHDN  713

Query  1467  THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGN  1646
              HL  LDLS NS  G IP   +     L  L L++N ++G+I  +   L  +  + L  N
Sbjct  714   PHLVTLDLSYNSLHGSIPNR-IDRLPQLNYLLLAHNYIKGEIPVQLCQLKEVRLIDLSHN  772

Query  1647  NFEGTI----------------pnslsnlplhslDIRDNKLSGEIPRWMGR---------  1751
             N  G I                    S     +   R   L G+    MG+         
Sbjct  773   NLSGRIPPCLVNTSLNEGYHGEVAPTSIWCRRASVYRSACLPGQSSPPMGKEETVQFTTK  832

Query  1752  ----------LTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPS  1898
                       LTS+  + LS N L G IP +   L  +  L+LS NNLTG+IP+   N  
Sbjct  833   NMSYYYQGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIHALNLSHNNLTGTIPTTFSNLK  892

Query  1899  SIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPE  2024
              I+ + LS + L G++         L +  ++YN+  G IP+
Sbjct  893   QIESLDLSYNLLHGKIPPQLIVLNTLEVFKVAYNNLSGKIPD  934



>ref|XP_007013630.1| Receptor like protein 1, putative isoform 2 [Theobroma cacao]
 gb|EOY31249.1| Receptor like protein 1, putative isoform 2 [Theobroma cacao]
Length=1026

 Score =   345 bits (884),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 283/810 (35%), Positives = 423/810 (52%), Gaps = 107/810 (13%)
 Frame = +3

Query  180   KDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSI---------------  314
             ++  SL+ L +G++   S   I D+G    L+ L+L+ C  N ++               
Sbjct  53    QNLTSLEDLTVGYSSLPS-NFIQDIGTLTSLKNLFLYYCEVNGNLSMHGPLHLKNLESLR  111

Query  315   ----------FQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYF----  452
                        Q++   PSLK L L +    +G L  Q   +L +L+EL +  + F    
Sbjct  112   IYLTPLENNFLQTIGAMPSLKSLSLWNCGL-NGTLATQVWQNLTSLEELSVEFSSFPSNF  170

Query  453   ---------------EGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAF  587
                             G+E + N S    H  +  + LE L +  +S   +  +  + A 
Sbjct  171   IQVIGILTSLKRLEVSGWEVNGNLS---MHAWQTLTSLEELSVEFLSLP-SNFIQDIGAM  226

Query  588   PSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGA  767
              S+K L +    V    +I+   ++ +LE L +D + L  +FL  IG + SLK LSLS  
Sbjct  227   TSLKNLYVFDCEVNGNLSINGPLHVKNLESLSIDSTPLESNFLQIIGAVPSLKSLSLSNC  286

Query  768   QVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspl  947
              + GTLP +G CEL +L+++ +S N L+G +   F N TSL  ++LS N+ SGNI     
Sbjct  287   GLNGTLPTQGFCELTHLRDVDISYNNLKGNLSECFSNFTSLENLDLSSNQFSGNIFFLKS  346

Query  948   stltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLS  1127
              T  S   LS    +F++ SS   F N SKL+ + AD N + A+T++    P+FQL+S+S
Sbjct  347   LTSLSTLTLSNN--NFQIPSSLGPFFNLSKLKYVYADNNSIYAETEMHHLSPRFQLNSIS  404

Query  1128  LSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGE-FPSWLLQNNTKLQYFLMNNNAFTGSL  1304
             LS C D+   P+FL++Q DL+ + +S    +GE FP WLL NN KLQ  ++ NN+ +G  
Sbjct  405   LSCCGDVGSFPQFLYHQHDLQFVDLSNIYFKGEQFPGWLLGNNKKLQSLILINNSLSGPF  464

Query  1305  KLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLG  1478
             +L    + +L  ++VS N   G I     +  P++  LN+S N F G + + IG    L 
Sbjct  465   RLPFASHLDLSGLDVSINFFNGSIPTEIGAKLPSLTFLNMSKNSFGGSIPASIGGINSLQ  524

Query  1479  FLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEG  1658
              LDLSNN  +G +P+ + + CS L +L LSNN+L+GQI      L++L  L +DGN+F G
Sbjct  525   SLDLSNNQLSGGLPEHLAMGCSLLSVLILSNNRLQGQIFPANFSLTNLGELQVDGNHFSG  584

Query  1659  TIpnsls-------------------------nlplhslDIRDNKLSGEIPRWMGRLTSL  1763
             +IP+ LS                            L  LD+ +N + G IP+WMG ++SL
Sbjct  585   SIPDCLSNCSFLSILDVSNNQLFDEIPRWMENLSRLSRLDLSNNAIFGGIPKWMGNMSSL  644

Query  1764  VQLTLSKNHLEGHIPIEFCNLKSLSILDL-SENNLTGSIPSCLNPSSIKHVSLSKHQLSG  1940
              ++ ++ NHL G IP+EFC L     L   S N+++GS+PSC +P  I  V LSK++L G
Sbjct  645   EEIIMANNHLGGSIPVEFCQLNLKLKLLDLSANDISGSLPSCFSPLLISQVHLSKNKLQG  704

Query  1941  QLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRl  2120
             QLT AF N+  LV LDLS N   G IP WIG +S+LS LLLN N FEG++P Q+C+L  L
Sbjct  705   QLTNAFRNSNLLVTLDLSNNHLTGNIPNWIGKLSQLSYLLLNNNHFEGEIPIQLCKLGHL  764

Query  2121  slldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSINDAILDRLHYEWGSDDEY  2300
             SL+DLS+N LSG+IP CL KI+                  ++ND   D +HY        
Sbjct  765   SLIDLSHNNLSGIIPSCL-KIT------------------TLNDVSQDYVHYV-----TT  800

Query  2301  IPMLAVDVLPE--VQFRTKGNLYNYQNSIL  2384
             +  +      E  ++F TK   Y+Y+  IL
Sbjct  801   VARVNTSFSTEEPIEFTTKNISYSYKGKIL  830


 Score =   122 bits (307),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 201/757 (27%), Positives = 327/757 (43%), Gaps = 155/757 (20%)
 Frame = +3

Query  162   LSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPS  341
             LS+   +   SL+ L + F    S   I D+G    L+ LY+F+C  N ++  S+ G   
Sbjct  194   LSMHAWQTLTSLEELSVEFLSLPS-NFIQDIGAMTSLKNLYVFDCEVNGNL--SINGPLH  250

Query  342   LKILDLMDNDFYDGPLH---IQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNK  512
             +K L+ +  D    PL    +Q I  + +LK L LS+    G             T+  +
Sbjct  251   VKNLESLSID--STPLESNFLQIIGAVPSLKSLSLSNCGLNG-------------TLPTQ  295

Query  513   SYLEVLHLNNISFDMTKLLSSLAA----FPSIKTLELQRVNVT-NI--------------  635
              + E+ HL ++      L  +L+     F S++ L+L     + NI              
Sbjct  296   GFCELTHLRDVDISYNNLKGNLSECFSNFTSLENLDLSSNQFSGNIFFLKSLTSLSTLTL  355

Query  636   --------DAIHALKNLSSLEELHLDGSNLHKDF-LSNIGPMESLKVLSLSGAQVGGTLP  788
                      ++    NLS L+ ++ D ++++ +  + ++ P   L  +SLS     G+ P
Sbjct  356   SNNNFQIPSSLGPFFNLSKLKYVYADNNSIYAETEMHHLSPRFQLNSISLSCCGDVGSFP  415

Query  789   N------------------KG-------LCELKNLQELWLSENQLEGKIPSYFGNLTSLR  893
                                KG       L   K LQ L L  N L G     F +   L 
Sbjct  416   QFLYHQHDLQFVDLSNIYFKGEQFPGWLLGNNKKLQSLILINNSLSGPFRLPFASHLDLS  475

Query  894   YVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVI  1073
              +++S+N  +G+I     + L SL +L++  NSF   S   S    + L+ +       +
Sbjct  476   GLDVSINFFNGSIPTEIGAKLPSLTFLNMSKNSFG-GSIPASIGGINSLQSL------DL  528

Query  1074  ADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGE-FPS-WLLQ  1247
             ++ QL G +P+      SL                  L VL +S N L+G+ FP+ + L 
Sbjct  529   SNNQLSGGLPEHLAMGCSL------------------LSVLILSNNRLQGQIFPANFSLT  570

Query  1248  NNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLS  1427
             N  +LQ   ++ N F+GS+         L I++VSNN+L  EI   +  +   +  L+LS
Sbjct  571   NLGELQ---VDGNHFSGSIPDCLSNCSFLSILDVSNNQLFDEIP-RWMENLSRLSRLDLS  626

Query  1428  SNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQE  1601
             +N   G +   +G  + L  + ++NN   G IP E       L +L LS N + G +   
Sbjct  627   NNAIFGGIPKWMGNMSSLEEIIMANNHLGGSIPVEFCQLNLKLKLLDLSANDISGSLPSC  686

Query  1602  FDYLSSLEYLHLDGNNFEGTIpnslsnl-plhslDIRDNKLSGEIPRWMGRLTSLVQLTL  1778
             F  L  +  +HL  N  +G + N+  N   L +LD+ +N L+G IP W+G+L+ L  L L
Sbjct  687   FSPLL-ISQVHLSKNKLQGQLTNAFRNSNLLVTLDLSNNHLTGNIPNWIGKLSQLSYLLL  745

Query  1779  SKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVS--------------  1916
             + NH EG IPI+ C L  LS++DLS NNL+G IPSCL  +++  VS              
Sbjct  746   NNNHFEGEIPIQLCKLGHLSLIDLSHNNLSGIIPSCLKITTLNDVSQDYVHYVTTVARVN  805

Query  1917  --------------------------------LSKHQLSGQLTRAFFNNTALVILDLSYN  2000
                                              S ++L+G++     N   +  L+LS+N
Sbjct  806   TSFSTEEPIEFTTKNISYSYKGKILTILSGIDFSCNKLTGEIPHKVENFLKIFALNLSHN  865

Query  2001  SFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQL  2111
             S  G IP  +  + ++ SL L+ N   GK+P Q+  L
Sbjct  866   SLTGPIPAALSKLRQIESLDLSYNNLSGKIPPQLVGL  902


 Score = 97.1 bits (240),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 139/512 (27%), Positives = 217/512 (42%), Gaps = 99/512 (19%)
 Frame = +3

Query  750   LSLSGAQVG-----GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLN  914
             L LSG  V      G++P +   +L +L  L +S+N   G IP+  G + SL+ ++LS N
Sbjct  472   LDLSGLDVSINFFNGSIPTEIGAKLPSLTFLNMSKNSFGGSIPASIGGINSLQSLDLSNN  531

Query  915   KLSGNIelsplstltsleylsIMNNSFE--VASSFRSFANNSKLRVILADRNKVIADTQL  1088
             +LSG +        + L  L + NN  +  +  +  S  N  +L+V   D N        
Sbjct  532   QLSGGLPEHLAMGCSLLSVLILSNNRLQGQIFPANFSLTNLGELQV---DGN------HF  582

Query  1089  QGFVPKFQ-----LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNN  1253
              G +P        L  L +SN     ++PR++     L  L +S N + G  P W+  N 
Sbjct  583   SGSIPDCLSNCSFLSILDVSNNQLFDEIPRWMENLSRLSRLDLSNNAIFGGIPKWM-GNM  641

Query  1254  TKLQYFLMNNNAFTGSL-----------------------KLSSHVNPNL-QIINVSNNK  1361
             + L+  +M NN   GS+                        L S  +P L   +++S NK
Sbjct  642   SSLEEIIMANNHLGGSIPVEFCQLNLKLKLLDLSANDISGSLPSCFSPLLISQVHLSKNK  701

Query  1362  LCGEISGNFSSSFPNILA-LNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEML  1532
             L G+++  F +S  N+L  L+LS+N  +G + + IG  + L +L L+NN F GEIP + L
Sbjct  702   LQGQLTNAFRNS--NLLVTLDLSNNHLTGNIPNWIGKLSQLSYLLLNNNHFEGEIPIQ-L  758

Query  1533  ISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlpl-------  1691
                  L ++ LS+N L G I+     +++L  +  D  ++  T+    ++          
Sbjct  759   CKLGHLSLIDLSHNNLSG-IIPSCLKITTLNDVSQDYVHYVTTVARVNTSFSTEEPIEFT  817

Query  1692  ----------------hslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCN  1823
                               +D   NKL+GEIP  +     +  L LS N L G IP     
Sbjct  818   TKNISYSYKGKILTILSGIDFSCNKLTGEIPHKVENFLKIFALNLSHNSLTGPIPAALSK  877

Query  1824  LKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNS  2003
             L+ +  LDLS NNL+G IP                QL G    +FF+        ++YN+
Sbjct  878   LRQIESLDLSYNNLSGKIPP---------------QLVGLSFLSFFS--------VAYNN  914

Query  2004  FVGIIPEWIGTIsrlsslllNGNRFEGKVPTQ  2099
               G  PE     +        GN F    P Q
Sbjct  915   LSGSTPERTAQFATFEESSYLGNLFLCGPPLQ  946


 Score = 70.9 bits (172),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 150/573 (26%), Positives = 239/573 (42%), Gaps = 89/573 (16%)
 Frame = +3

Query  591   SIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQ  770
             S+KTL L   +          +NL+SLE+L +  S+L  +F+ +IG + SLK L L   +
Sbjct  32    SLKTLRLLGFSFNGRITTEIWQNLTSLEDLTVGYSSLPSNFIQDIGTLTSLKNLFLYYCE  91

Query  771   VGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
             V G L   G   LKNL+ L +    LE       G + SL+ ++L    L+G +      
Sbjct  92    VNGNLSMHGPLHLKNLESLRIYLTPLENNFLQTIGAMPSLKSLSLWNCGLNGTLATQVWQ  151

Query  951   tltsleylsIMNNSFEVASSFRSFANN--------SKLRVILADRNKVIADTQLQGFVPK  1106
              LTSLE         E++  F SF +N        + L+ +     +V  +  +  +   
Sbjct  152   NLTSLE---------ELSVEFSSFPSNFIQVIGILTSLKRLEVSGWEVNGNLSMHAWQTL  202

Query  1107  FQLDSLSLSNCIDLLKLPR-FLH----------------------------YQRDLKVLR  1199
               L+ LS    ++ L LP  F+                             + ++L+ L 
Sbjct  203   TSLEELS----VEFLSLPSNFIQDIGAMTSLKNLYVFDCEVNGNLSINGPLHVKNLESLS  258

Query  1200  ISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVN-PNLQIINVSNNKLCGEI  1376
             I    LE  F   ++     L+   ++N    G+L         +L+ +++S N L G +
Sbjct  259   IDSTPLESNFLQ-IIGAVPSLKSLSLSNCGLNGTLPTQGFCELTHLRDVDISYNNLKGNL  317

Query  1377  SGNFSSSFPNILALNLSSNLFSGQLHSL-----------------IGTHLG-FLDLS---  1493
             S  F S+F ++  L+LSSN FSG +  L                 I + LG F +LS   
Sbjct  318   SECF-SNFTSLENLDLSSNQFSGNIFFLKSLTSLSTLTLSNNNFQIPSSLGPFFNLSKLK  376

Query  1494  -----NNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEY-----LHLDG  1643
                  NNS   E     L     L  + LS     G   Q   +   L++     ++  G
Sbjct  377   YVYADNNSIYAETEMHHLSPRFQLNSISLSCCGDVGSFPQFLYHQHDLQFVDLSNIYFKG  436

Query  1644  NNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEF-C  1820
               F G +  +   L      + +N LSG           L  L +S N   G IP E   
Sbjct  437   EQFPGWLLGNNKKLQSLI--LINNSLSGPFRLPFASHLDLSGLDVSINFFNGSIPTEIGA  494

Query  1821  NLKSLSILDLSENNLTGSIPSCLNP-SSIKHVSLSKHQLSGQLTRAFFNNTALV-ILDLS  1994
              L SL+ L++S+N+  GSIP+ +   +S++ + LS +QLSG L        +L+ +L LS
Sbjct  495   KLPSLTFLNMSKNSFGGSIPASIGGINSLQSLDLSNNQLSGGLPEHLAMGCSLLSVLILS  554

Query  1995  YNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
              N   G I     +++ L  L ++GN F G +P
Sbjct  555   NNRLQGQIFPANFSLTNLGELQVDGNHFSGSIP  587


 Score = 69.7 bits (169),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 134/516 (26%), Positives = 211/516 (41%), Gaps = 92/516 (18%)
 Frame = +3

Query  300   FNQSIFQSLKG-FPSLKILDLMDNDFYDG-PLHIQDINDLRNLKELYLSDNYFEGFETSA  473
             FN SI   +    PSL  L++  N F    P  I  IN L++L    LS+N   G     
Sbjct  484   FNGSIPTEIGAKLPSLTFLNMSKNSFGGSIPASIGGINSLQSLD---LSNNQLSG-----  535

Query  474   NHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHAL  653
                G   H     S L VL L+N                        R+      A  +L
Sbjct  536   ---GLPEHLAMGCSLLSVLILSN-----------------------NRLQGQIFPANFSL  569

Query  654   KNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWL  833
              NL    EL +DG++        +     L +L +S  Q+   +P + +  L  L  L L
Sbjct  570   TNLG---ELQVDGNHFSGSIPDCLSNCSFLSILDVSNNQLFDEIP-RWMENLSRLSRLDL  625

Query  834   SENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSF  1013
             S N + G IP + GN++SL  + ++ N L G+I +        L+ L +  N  +++ S 
Sbjct  626   SNNAIFGGIPKWMGNMSSLEEIIMANNHLGGSIPVEFCQLNLKLKLLDLSAN--DISGSL  683

Query  1014  RSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKV  1193
              S  +   +  +   +NK      LQG                   +L         L  
Sbjct  684   PSCFSPLLISQVHLSKNK------LQG-------------------QLTNAFRNSNLLVT  718

Query  1194  LRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGE  1373
             L +S N+L G  P+W+    ++L Y L+NNN F G + +      +L +I++S+N L G 
Sbjct  719   LDLSNNHLTGNIPNWI-GKLSQLSYLLLNNNHFEGEIPIQLCKLGHLSLIDLSHNNLSGI  777

Query  1374  ISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEML---ISCS  1544
             I        P+ L +   +++    +H     ++  +   N SF+ E P E     IS S
Sbjct  778   I--------PSCLKITTLNDVSQDYVH-----YVTTVARVNTSFSTEEPIEFTTKNISYS  824

Query  1545  S----LVILK---LSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhsl  1700
                  L IL     S NKL G+I  + +    +  L+L  N+  G I         + SL
Sbjct  825   YKGKILTILSGIDFSCNKLTGEIPHKVENFLKIFALNLSHNSLTGPIPAALSKLRQIESL  884

Query  1701  DIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIP  1808
             D+  N LSG+IP  +  L+ L   +++ N+L G  P
Sbjct  885   DLSYNNLSGKIPPQLVGLSFLSFFSVAYNNLSGSTP  920



>ref|XP_006489919.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Citrus sinensis]
Length=1593

 Score =   350 bits (898),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 239/588 (41%), Positives = 335/588 (57%), Gaps = 19/588 (3%)
 Frame = +3

Query  303   NQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHS  482
             N  + +  +G   LK LDL      DG   +Q +    +L  L+L  N F    T+    
Sbjct  308   NVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTT---  364

Query  483   GSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNL  662
                   + N + LE L L++ S  ++ L S  + FPS+K L +    V  + +     + 
Sbjct  365   ----QELHNFTNLEYLTLDDSSLHISLLQSIASLFPSLKNLSMSGCEVNGVLSGQGFPHF  420

Query  663   SSLEELHLDGSN--LHKDFLSNIG-PMESLKVLSLSGAQVG---GTLPNKGLCELKNLQE  824
              SLE L +  +   L+  FL  IG  M SLK LSLSG+ +G     + ++GLC L +LQE
Sbjct  421   KSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQE  480

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
             L++  N L G +P    N TSLR +++S N+L+G+I  SPL  LTS+E L + NN F + 
Sbjct  481   LYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIP  540

Query  1005  SSFRSFANNSKLRVILADRNKVIADT-QLQGFVPKFQLDSLSLS-NCIDLLKLPRFLHYQ  1178
              S     N+SKL++  A  N++  +  +     PKFQL SLSLS N  D +  P+FL++Q
Sbjct  541   VSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQ  600

Query  1179  RDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNN  1358
              +LK   +S   + GEFP+WLL+NNTKL++  + N++  G  +L  H +  L+ ++VSNN
Sbjct  601   HELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNN  660

Query  1359  KLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGT--HLGFLDLSNNSFTGEIPKEML  1532
                G I        P+++  N+S N   G + S  G    L FLDLSNN  TGEIP  + 
Sbjct  661   NFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLA  720

Query  1533  ISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDIR  1709
             + C +L  L LSNN L+G I      L +L +L L+GN+F G IP SLS       L + 
Sbjct  721   MCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLN  780

Query  1710  DNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL  1889
             +N LSG+IPRW+G L  L  + + KNHLEG IP+EFC L SL ILD+S+NN++GS+PSC 
Sbjct  781   NNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCF  840

Query  1890  NPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWI  2030
              P SIK V LSK+ L GQL    FFN ++LV LDLSYN   G IP+WI
Sbjct  841   YPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWI  888


 Score =   320 bits (820),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 284/776 (37%), Positives = 406/776 (52%), Gaps = 80/776 (10%)
 Frame = +3

Query  195   LKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQ---SIFQSLKGFPSLKILDLMD  365
             L+ LD+  N FQ   P+ ++G    L  L  F    N    SI  S      L+ LDL +
Sbjct  652   LRFLDVSNNNFQGHIPV-EIGDI--LPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSN  708

Query  366   NDFY-DGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNN  542
             N    + P H+       NL+ L LS+N  +G      H  S   ++RN  +L +L  N+
Sbjct  709   NKLTGEIPDHLAMC--CVNLEFLSLSNNSLKG------HIFSRIFSLRNLRWL-LLEGNH  759

Query  543   ISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSN  722
                ++ +   SL+   S+K L L   N++       L NL  L+ + +  ++L       
Sbjct  760   FVGEIPQ---SLSKCSSLKGLYLNNNNLSG-KIPRWLGNLKGLQHIVMPKNHLEGPIPVE  815

Query  723   IGPMESLKVLSLSGAQVGGTLPN-------KGLCELKN----------------LQELWL  833
                ++SL++L +S   + G+LP+       K +   KN                L  L L
Sbjct  816   FCRLDSLQILDISDNNISGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDL  875

Query  834   SENQLEGKIPSYFGNL-----------TSLRYVNLSLNKLSGNIelsplstltsleylsI  980
             S N L G IP +   L           TSLR +++S N+L+G+I  SPL  LTS+E L +
Sbjct  876   SYNYLNGSIPDWIDGLSQLSHLNLAHTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRL  935

Query  981   MNNSFEVASSFRSFANNSKLRVILADRNKVIADT-QLQGFVPKFQLDSLSLS-NCIDLLK  1154
              NN F +  S     N+SKL++  A  N++  +  +     PKFQL SLSLS N  D + 
Sbjct  936   SNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVT  995

Query  1155  LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNL  1334
              P+FL++Q +LK   +S   + GEFP+WLL+NNTKL++  + N++  G  +L  H +  L
Sbjct  996   FPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRL  1055

Query  1335  QIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGT--HLGFLDLSNNSFT  1508
             + ++VSNN   G I        P+++  N+S N   G + S  G    L FLDLSNN  T
Sbjct  1056  RFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLT  1115

Query  1509  GEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlp  1688
             GEIP  + + C +L  L LSNN L+G I      L +L +L L+GN+F G IP SLS   
Sbjct  1116  GEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCS  1175

Query  1689  lhs-lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNL  1865
                 L + +N LSG+IPRW+G L  L  + + KNHLEG IP+EFC L SL ILD+S+NN+
Sbjct  1176  SLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNI  1235

Query  1866  TGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIs  2042
             +GS+PSC  P SIK V LSK+ L GQL    FFN ++LV LDLSYN   G IP+WI  +S
Sbjct  1236  SGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLS  1295

Query  2043  rlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGIN  2222
             +LS L L  N  EG+VP Q+C+L +L LLDLS+N L G+IP C    +L  +       +
Sbjct  1296  QLSHLNLAHNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPD  1355

Query  2223  LPFEY-YSINDAILDRLHYEWGSDDEYIPMLAVD--VLPEVQFRTKGNLYNYQNSI  2381
              PF+  +SI+                  P  +V+  +L   +F TK   Y YQ  +
Sbjct  1356  KPFKTSFSISG-----------------PQGSVEKKILEIFEFTTKNIAYAYQGRV  1394


 Score =   145 bits (365),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 196/708 (28%), Positives = 292/708 (41%), Gaps = 146/708 (21%)
 Frame = +3

Query  162   LSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSI-FQSLKGFP  338
             LS LNL    SL++LD+ FN+       + +     +EEL L    F   +  + L    
Sbjct  894   LSHLNLAHTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHS  953

Query  339   SLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSY  518
              LKI D  +N+          +     LK L LS NY +              ++    +
Sbjct  954   KLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGD--------------SVTFPKF  999

Query  519   LEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSN  698
             L   H                    +K  EL  + +        L+N + LE L+L   +
Sbjct  1000  LYHQH-------------------ELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDS  1040

Query  699   LHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGN  878
             L   F   I   + L+ L +S     G +P +    L +L    +S N L+G IPS FGN
Sbjct  1041  LAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGN  1100

Query  879   LTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILAD  1058
             +  L++++LS NKL+G I         +LE+LS+ NNS +     R F+  + LR +L +
Sbjct  1101  VIFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRN-LRWLLLE  1159

Query  1059  RNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSW  1238
              N  +      G +P+      SLS C               LK L ++ NNL G+ P W
Sbjct  1160  GNHFV------GEIPQ------SLSKC-------------SSLKGLYLNNNNLSGKIPRW  1194

Query  1239  LLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFP-NILA  1415
              L N   LQ+ +M  N   G + +      +LQI+++S+N + G +   F   +P +I  
Sbjct  1195  -LGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCF---YPLSIKQ  1250

Query  1416  LNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIV  1595
             ++LS N+  GQL    GT                      +CSSLV L LS N L G I 
Sbjct  1251  VHLSKNMLHGQLKE--GT--------------------FFNCSSLVTLDLSYNYLNGSIP  1288

Query  1596  QEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGEIPRWMGRLT-----  1757
                D LS L +L+L  NN EG +         L  LD+ DN L G IP      T     
Sbjct  1289  DWIDGLSQLSHLNLAHNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESY  1348

Query  1758  ----------------SLVQLTLSKNHLE-------------------------------  1796
                             S  Q ++ K  LE                               
Sbjct  1349  NNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLSGLDLSCNKL  1408

Query  1797  -GHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHV---SLSKHQLSGQLTRAFFN  1964
              GHIP +  NL  +  L+LS NNLTG+IP  L  S+++H+    LS ++LSG++ R   +
Sbjct  1409  VGHIPPQIGNLTRIQTLNLSHNNLTGTIP--LTFSNLRHIESLDLSYNKLSGKIPRQLVD  1466

Query  1965  NTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
                L I  ++YN+  G IPEW    +  +    +GN F   +P  +C+
Sbjct  1467  LNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCGLPLPICR  1514


 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 161/637 (25%), Positives = 265/637 (42%), Gaps = 127/637 (20%)
 Frame = +3

Query  642   IHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQ  821
             +  L +L  LEEL + G+ + K F+ + G +  LK L LSG    GT   +      NL+
Sbjct  163   VKELDSLRDLEELDIGGNKIDK-FMVSKG-LSKLKSLGLSGTGFKGTFDVREFDSFNNLE  220

Query  822   ELWLSENQLEG-KIPS---YFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNN  989
              L +S N+++   +P        L+ L+ ++L  N L  N  LS ++ L+SL  L + +N
Sbjct  221   VLDMSGNEIDNLVVPQGLERLSRLSKLKKLDLRGN-LCNNSILSSVARLSSLTSLHLSHN  279

Query  990   SFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNC--IDLLKLPR  1163
               + +   + F + S L  +  + N++      +G+    +L SL LS     D  KL +
Sbjct  280   ILQGSIDAKEFDSLSNLEELDINDNEIDNVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQ  339

Query  1164  FLHYQRDLKVLRISRNNLEGEFPSWL-LQNNTKLQYFLMNNNAFTGSLKLS-SHVNPNLQ  1337
              +     L  L +  NN      +   L N T L+Y  +++++   SL  S + + P+L+
Sbjct  340   SMGSFPSLNTLHLESNNFTATLTTTQELHNFTNLEYLTLDDSSLHISLLQSIASLFPSLK  399

Query  1338  IINVSNNKLCGEISGN-------------------FSSSFPNILALNLSSNLFSGQLHSL  1460
              +++S  ++ G +SG                     ++SF  I+  ++ S  +     S 
Sbjct  400   NLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGST  459

Query  1461  IGT--------------HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ  1598
             +GT              HL  L + NN   G +P   L + +SL IL +S N+L G I  
Sbjct  460   LGTNSSRILDQGLCPLAHLQELYIDNNDLRGSLP-WCLANTTSLRILDVSFNQLTGSISS  518

Query  1599  E-FDYLSSLEYLHLDGNNFE--GTIpnslsnlplhslDIRDNKLSGEI------------  1733
                 +L+S+E L L  N+F    ++    ++  L   D ++N+++GEI            
Sbjct  519   SPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQL  578

Query  1734  ---------------PRWMGRLTSLVQLTLSKNHLEGHIP---------IEFCNL-----  1826
                            P+++     L +  LS   + G  P         +EF  L     
Sbjct  579   KSLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSL  638

Query  1827  -----------KSLSILDLSENNLTGSIPSCLNP--SSIKHVSLSKHQLSGQLTRAFFNN  1967
                        K L  LD+S NN  G IP  +     S+ + ++S + L G +  +F N 
Sbjct  639   AGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNV  698

Query  1968  TALVILDLSYNSFVGIIPEWI------------------GTIsrlsslllN-------GN  2072
               L  LDLS N   G IP+ +                  G I      L N       GN
Sbjct  699   IFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGN  758

Query  2073  RFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKI  2183
              F G++P  + +   L  L L+NN LSG IPR LG +
Sbjct  759   HFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNL  795



>ref|XP_007013629.1| Receptor like protein 1, putative isoform 1 [Theobroma cacao]
 gb|EOY31248.1| Receptor like protein 1, putative isoform 1 [Theobroma cacao]
Length=854

 Score =   340 bits (872),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 272/738 (37%), Positives = 405/738 (55%), Gaps = 69/738 (9%)
 Frame = +3

Query  267   KLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLH-IQDINDLRNLKELYLSD  443
              L+ L L+ C  N ++  + + + +L  L+ +  +F   P + IQ I  L +LK L +S 
Sbjct  3     SLKSLSLWNCGLNGTL--ATQVWQNLTSLEELSVEFSSFPSNFIQVIGILTSLKRLEVS-  59

Query  444   NYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVN  623
                 G+E + N S    H  +  + LE L +  +S   +  +  + A  S+K L +    
Sbjct  60    ----GWEVNGNLS---MHAWQTLTSLEELSVEFLSLP-SNFIQDIGAMTSLKNLYVFDCE  111

Query  624   VTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLC  803
             V    +I+   ++ +LE L +D + L  +FL  IG + SLK LSLS   + GTLP +G C
Sbjct  112   VNGNLSINGPLHVKNLESLSIDSTPLESNFLQIIGAVPSLKSLSLSNCGLNGTLPTQGFC  171

Query  804   ELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIM  983
             EL +L+++ +S N L+G +   F N TSL  ++LS N+ SGNI      T  S   LS  
Sbjct  172   ELTHLRDVDISYNNLKGNLSECFSNFTSLENLDLSSNQFSGNIFFLKSLTSLSTLTLSNN  231

Query  984   NNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPR  1163
               +F++ SS   F N SKL+ + AD N + A+T++    P+FQL+S+SLS C D+   P+
Sbjct  232   --NFQIPSSLGPFFNLSKLKYVYADNNSIYAETEMHHLSPRFQLNSISLSCCGDVGSFPQ  289

Query  1164  FLHYQRDLKVLRISRNNLEGE-FPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQI  1340
             FL++Q DL+ + +S    +GE FP WLL NN KLQ  ++ NN+ +G  +L    + +L  
Sbjct  290   FLYHQHDLQFVDLSNIYFKGEQFPGWLLGNNKKLQSLILINNSLSGPFRLPFASHLDLSG  349

Query  1341  INVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGE  1514
             ++VS N   G I     +  P++  LN+S N F G + + IG    L  LDLSNN  +G 
Sbjct  350   LDVSINFFNGSIPTEIGAKLPSLTFLNMSKNSFGGSIPASIGGINSLQSLDLSNNQLSGG  409

Query  1515  IPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnsls-----  1679
             +P+ + + CS L +L LSNN+L+GQI      L++L  L +DGN+F G+IP+ LS     
Sbjct  410   LPEHLAMGCSLLSVLILSNNRLQGQIFPANFSLTNLGELQVDGNHFSGSIPDCLSNCSFL  469

Query  1680  --------------------nlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEG  1799
                                    L  LD+ +N + G IP+WMG ++SL ++ ++ NHL G
Sbjct  470   SILDVSNNQLFDEIPRWMENLSRLSRLDLSNNAIFGGIPKWMGNMSSLEEIIMANNHLGG  529

Query  1800  HIPIEFCNLKSLSILDL-SENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTAL  1976
              IP+EFC L     L   S N+++GS+PSC +P  I  V LSK++L GQLT AF N+  L
Sbjct  530   SIPVEFCQLNLKLKLLDLSANDISGSLPSCFSPLLISQVHLSKNKLQGQLTNAFRNSNLL  589

Query  1977  VILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsG  2156
             V LDLS N   G IP WIG +S+LS LLLN N FEG++P Q+C+L  LSL+DLS+N LSG
Sbjct  590   VTLDLSNNHLTGNIPNWIGKLSQLSYLLLNNNHFEGEIPIQLCKLGHLSLIDLSHNNLSG  649

Query  2157  VIPRCLGKISLEGTNEQFRGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPE-  2333
             +IP CL KI+                  ++ND   D +HY        +  +      E 
Sbjct  650   IIPSCL-KIT------------------TLNDVSQDYVHYV-----TTVARVNTSFSTEE  685

Query  2334  -VQFRTKGNLYNYQNSIL  2384
              ++F TK   Y+Y+  IL
Sbjct  686   PIEFTTKNISYSYKGKIL  703


 Score =   123 bits (308),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 193/730 (26%), Positives = 317/730 (43%), Gaps = 154/730 (21%)
 Frame = +3

Query  243   INDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLH---IQDINDL  413
             I D+G    L+ LY+F+C  N ++  S+ G   +K L+ +  D    PL    +Q I  +
Sbjct  93    IQDIGAMTSLKNLYVFDCEVNGNL--SINGPLHVKNLESLSID--STPLESNFLQIIGAV  148

Query  414   RNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAA---  584
              +LK L LS+    G             T+  + + E+ HL ++      L  +L+    
Sbjct  149   PSLKSLSLSNCGLNG-------------TLPTQGFCELTHLRDVDISYNNLKGNLSECFS  195

Query  585   -FPSIKTLELQRVNVT-NI----------------------DAIHALKNLSSLEELHLDG  692
              F S++ L+L     + NI                       ++    NLS L+ ++ D 
Sbjct  196   NFTSLENLDLSSNQFSGNIFFLKSLTSLSTLTLSNNNFQIPSSLGPFFNLSKLKYVYADN  255

Query  693   SNLHKDF-LSNIGPMESLKVLSLSGAQVGGTLPN------------------KG------  797
             ++++ +  + ++ P   L  +SLS     G+ P                   KG      
Sbjct  256   NSIYAETEMHHLSPRFQLNSISLSCCGDVGSFPQFLYHQHDLQFVDLSNIYFKGEQFPGW  315

Query  798   -LCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleyl  974
              L   K LQ L L  N L G     F +   L  +++S+N  +G+I     + L SL +L
Sbjct  316   LLGNNKKLQSLILINNSLSGPFRLPFASHLDLSGLDVSINFFNGSIPTEIGAKLPSLTFL  375

Query  975   sIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLK  1154
             ++  NSF   S   S    + L+ +       +++ QL G +P+      SL        
Sbjct  376   NMSKNSFG-GSIPASIGGINSLQSL------DLSNNQLSGGLPEHLAMGCSL--------  420

Query  1155  LPRFLHYQRDLKVLRISRNNLEGE-FPS-WLLQNNTKLQYFLMNNNAFTGSLKLSSHVNP  1328
                       L VL +S N L+G+ FP+ + L N  +LQ   ++ N F+GS+        
Sbjct  421   ----------LSVLILSNNRLQGQIFPANFSLTNLGELQ---VDGNHFSGSIPDCLSNCS  467

Query  1329  NLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNS  1502
              L I++VSNN+L  EI   +  +   +  L+LS+N   G +   +G  + L  + ++NN 
Sbjct  468   FLSILDVSNNQLFDEIP-RWMENLSRLSRLDLSNNAIFGGIPKWMGNMSSLEEIIMANNH  526

Query  1503  FTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpns-ls  1679
               G IP E       L +L LS N + G +   F  L  +  +HL  N  +G + N+  +
Sbjct  527   LGGSIPVEFCQLNLKLKLLDLSANDISGSLPSCFSPLL-ISQVHLSKNKLQGQLTNAFRN  585

Query  1680  nlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSEN  1859
             +  L +LD+ +N L+G IP W+G+L+ L  L L+ NH EG IPI+ C L  LS++DLS N
Sbjct  586   SNLLVTLDLSNNHLTGNIPNWIGKLSQLSYLLLNNNHFEGEIPIQLCKLGHLSLIDLSHN  645

Query  1860  NLTGSIPSCLNPSSIKHVS-----------------------------------------  1916
             NL+G IPSCL  +++  VS                                         
Sbjct  646   NLSGIIPSCLKITTLNDVSQDYVHYVTTVARVNTSFSTEEPIEFTTKNISYSYKGKILTI  705

Query  1917  -----LSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFE  2081
                   S ++L+G++     N   +  L+LS+NS  G IP  +  + ++ SL L+ N   
Sbjct  706   LSGIDFSCNKLTGEIPHKVENFLKIFALNLSHNSLTGPIPAALSKLRQIESLDLSYNNLS  765

Query  2082  GKVPTQVCQL  2111
             GK+P Q+  L
Sbjct  766   GKIPPQLVGL  775


 Score = 97.4 bits (241),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 139/512 (27%), Positives = 217/512 (42%), Gaps = 99/512 (19%)
 Frame = +3

Query  750   LSLSGAQVG-----GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLN  914
             L LSG  V      G++P +   +L +L  L +S+N   G IP+  G + SL+ ++LS N
Sbjct  345   LDLSGLDVSINFFNGSIPTEIGAKLPSLTFLNMSKNSFGGSIPASIGGINSLQSLDLSNN  404

Query  915   KLSGNIelsplstltsleylsIMNNSFE--VASSFRSFANNSKLRVILADRNKVIADTQL  1088
             +LSG +        + L  L + NN  +  +  +  S  N  +L+V   D N        
Sbjct  405   QLSGGLPEHLAMGCSLLSVLILSNNRLQGQIFPANFSLTNLGELQV---DGN------HF  455

Query  1089  QGFVPKFQ-----LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNN  1253
              G +P        L  L +SN     ++PR++     L  L +S N + G  P W+  N 
Sbjct  456   SGSIPDCLSNCSFLSILDVSNNQLFDEIPRWMENLSRLSRLDLSNNAIFGGIPKWM-GNM  514

Query  1254  TKLQYFLMNNNAFTGSL-----------------------KLSSHVNPNL-QIINVSNNK  1361
             + L+  +M NN   GS+                        L S  +P L   +++S NK
Sbjct  515   SSLEEIIMANNHLGGSIPVEFCQLNLKLKLLDLSANDISGSLPSCFSPLLISQVHLSKNK  574

Query  1362  LCGEISGNFSSSFPNIL-ALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEML  1532
             L G+++  F +S  N+L  L+LS+N  +G + + IG  + L +L L+NN F GEIP + L
Sbjct  575   LQGQLTNAFRNS--NLLVTLDLSNNHLTGNIPNWIGKLSQLSYLLLNNNHFEGEIPIQ-L  631

Query  1533  ISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlpl-------  1691
                  L ++ LS+N L G I+     +++L  +  D  ++  T+    ++          
Sbjct  632   CKLGHLSLIDLSHNNLSG-IIPSCLKITTLNDVSQDYVHYVTTVARVNTSFSTEEPIEFT  690

Query  1692  ----------------hslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCN  1823
                               +D   NKL+GEIP  +     +  L LS N L G IP     
Sbjct  691   TKNISYSYKGKILTILSGIDFSCNKLTGEIPHKVENFLKIFALNLSHNSLTGPIPAALSK  750

Query  1824  LKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNS  2003
             L+ +  LDLS NNL+G IP                QL G    +FF+        ++YN+
Sbjct  751   LRQIESLDLSYNNLSGKIPP---------------QLVGLSFLSFFS--------VAYNN  787

Query  2004  FVGIIPEWIGTIsrlsslllNGNRFEGKVPTQ  2099
               G  PE     +        GN F    P Q
Sbjct  788   LSGSTPERTAQFATFEESSYLGNLFLCGPPLQ  819


 Score = 89.4 bits (220),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 161/544 (30%), Positives = 243/544 (45%), Gaps = 92/544 (17%)
 Frame = +3

Query  732   MESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSL  911
             M SLK LSL    + GTL  +    L +L+EL +  +          G LTSL+ + +S 
Sbjct  1     MPSLKSLSLWNCGLNGTLATQVWQNLTSLEELSVEFSSFPSNFIQVIGILTSLKRLEVSG  60

Query  912   NKLSGNIelsplstltsleylsI-----MNNSFEVASSFRSFAN--------------NS  1034
              +++GN+ +    TLTSLE LS+      +N  +   +  S  N              N 
Sbjct  61    WEVNGNLSMHAWQTLTSLEELSVEFLSLPSNFIQDIGAMTSLKNLYVFDCEVNGNLSING  120

Query  1035  KLRV-----ILADRNKVIAD-TQLQGFVPKFQLDSLSLSNCIDLLKLPRF----LHYQRD  1184
              L V     +  D   + ++  Q+ G VP   L SLSLSNC     LP      L + RD
Sbjct  121   PLHVKNLESLSIDSTPLESNFLQIIGAVPS--LKSLSLSNCGLNGTLPTQGFCELTHLRD  178

Query  1185  LKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSL-------------------K  1307
             +    IS NNL+G   S    N T L+   +++N F+G++                   +
Sbjct  179   VD---ISYNNLKGNL-SECFSNFTSLENLDLSSNQFSGNIFFLKSLTSLSTLTLSNNNFQ  234

Query  1308  LSSHVNP-----NLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTH  1472
             + S + P      L+ +   NN +  E   +  S    + +++LS     G     +   
Sbjct  235   IPSSLGPFFNLSKLKYVYADNNSIYAETEMHHLSPRFQLNSISLSCCGDVGSFPQFLYHQ  294

Query  1473  --LGFLDLSNNSFTGE-IPKEMLISCSSLVILKLSNNKLEGQIVQEF-------------  1604
               L F+DLSN  F GE  P  +L +   L  L L NN L G     F             
Sbjct  295   HDLQFVDLSNIYFKGEQFPGWLLGNNKKLQSLILINNSLSGPFRLPFASHLDLSGLDVSI  354

Query  1605  ------------DYLSSLEYLHLDGNNFEGTIpnsl-snlplhslDIRDNKLSGEIPRWM  1745
                           L SL +L++  N+F G+IP S+     L SLD+ +N+LSG +P  +
Sbjct  355   NFFNGSIPTEIGAKLPSLTFLNMSKNSFGGSIPASIGGINSLQSLDLSNNQLSGGLPEHL  414

Query  1746  GRLTSLVQ-LTLSKNHLEGHI-PIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVS  1916
                 SL+  L LS N L+G I P  F +L +L  L +  N+ +GSIP CL N S +  + 
Sbjct  415   AMGCSLLSVLILSNNRLQGQIFPANF-SLTNLGELQVDGNHFSGSIPDCLSNCSFLSILD  473

Query  1917  LSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPT  2096
             +S +QL  ++ R   N + L  LDLS N+  G IP+W+G +S L  +++  N   G +P 
Sbjct  474   VSNNQLFDEIPRWMENLSRLSRLDLSNNAIFGGIPKWMGNMSSLEEIIMANNHLGGSIPV  533

Query  2097  QVCQ  2108
             + CQ
Sbjct  534   EFCQ  537


 Score = 70.1 bits (170),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 133/532 (25%), Positives = 223/532 (42%), Gaps = 68/532 (13%)
 Frame = +3

Query  252   VGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKEL  431
             +G  KKL+ L L     +            L  LD+  N F++G +  +    L +L  L
Sbjct  317   LGNNKKLQSLILINNSLSGPFRLPFASHLDLSGLDVSIN-FFNGSIPTEIGAKLPSLTFL  375

Query  432   YLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNN--ISFDMTKLLSSLAAFPSIKTL  605
              +S N F          GS   +I   + L+ L L+N  +S  + + L+   +  S+  L
Sbjct  376   NMSKNSF---------GGSIPASIGGINSLQSLDLSNNQLSGGLPEHLAMGCSLLSVLIL  426

Query  606   ELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTL  785
                R+      A  +L NL    EL +DG++        +     L +L +S  Q+   +
Sbjct  427   SNNRLQGQIFPANFSLTNLG---ELQVDGNHFSGSIPDCLSNCSFLSILDVSNNQLFDEI  483

Query  786   PNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsl  965
             P + +  L  L  L LS N + G IP + GN++SL  + ++ N L G+I +        L
Sbjct  484   P-RWMENLSRLSRLDLSNNAIFGGIPKWMGNMSSLEEIIMANNHLGGSIPVEFCQLNLKL  542

Query  966   eylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCID  1145
             + L +  N  +++ S  S  +   +  +   +NK      LQG                 
Sbjct  543   KLLDLSAN--DISGSLPSCFSPLLISQVHLSKNK------LQG-----------------  577

Query  1146  LLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVN  1325
               +L         L  L +S N+L G  P+W+    ++L Y L+NNN F G + +     
Sbjct  578   --QLTNAFRNSNLLVTLDLSNNHLTGNIPNWI-GKLSQLSYLLLNNNHFEGEIPIQLCKL  634

Query  1326  PNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSF  1505
              +L +I++S+N L G I        P+ L +   +++    +H     ++  +   N SF
Sbjct  635   GHLSLIDLSHNNLSGII--------PSCLKITTLNDVSQDYVH-----YVTTVARVNTSF  681

Query  1506  TGEIPKEMLISCSS-------LVILK---LSNNKLEGQIVQEFDYLSSLEYLHLDGNNFE  1655
             + E P E      S       L IL     S NKL G+I  + +    +  L+L  N+  
Sbjct  682   STEEPIEFTTKNISYSYKGKILTILSGIDFSCNKLTGEIPHKVENFLKIFALNLSHNSLT  741

Query  1656  GTI-pnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIP  1808
             G I         + SLD+  N LSG+IP  +  L+ L   +++ N+L G  P
Sbjct  742   GPIPAALSKLRQIESLDLSYNNLSGKIPPQLVGLSFLSFFSVAYNNLSGSTP  793



>ref|XP_006477903.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=928

 Score =   341 bits (875),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 294/776 (38%), Positives = 405/776 (52%), Gaps = 63/776 (8%)
 Frame = +3

Query  84    GNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGA  263
             G ERL+ L  L+ L + +      NI   L+L    SL++L +  N       I ++   
Sbjct  2     GLERLSRLNTLKILFLDHNYFNN-NIF--LSLGGLSSLRILSLAGNGLNGSIDIKELHNF  58

Query  264   KKLEELYLFECRFNQS-IFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLS  440
               LEEL L E   + S + QS+  F SLK L  M      G LH QD ++ +NL+     
Sbjct  59    TNLEELILVESDLHVSQLLQSIASFSSLKYLS-MRGCVLKGALHGQDFHEFKNLE-----  112

Query  441   DNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRV  620
                               H + ++  +EV    + SF   +++S   A   I +L   R+
Sbjct  113   ------------------HLVMDRMLVEV----DTSF--LQIVSESMASLRILSLSYSRL  148

Query  621   NVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGL  800
             N   I     L  L  L+EL++  ++L    L  +  M SL+VL+++  Q+ G  P  G 
Sbjct  149   NKNTI-LDQGLCELVHLQELYIRDNDLRDSLLWCLANMTSLQVLNVASNQLTGNFP-PGF  206

Query  801   CELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsI  980
             CEL  L+EL++  N L G +P    NLTSLR +++S N+L+ NI  SPL  LTS+E L +
Sbjct  207   CELVLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELIL  266

Query  981   MNNSFEVASSFRSFANNSKLRVILADRNKVIADTQ--LQGFVPKFQLDSLSLSNCIDLLK  1154
              NN F++  S     N SKL+       ++ A+T+       PKFQL S+SLS   D   
Sbjct  267   SNNHFQIPISLEPLFNLSKLKTF---NGEIYAETESHYNSLTPKFQLTSISLSGYGDGGT  323

Query  1155  LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNL  1334
              P+FL++Q DL    +S  NL GEFP+WL +NNT L+  L+ NN+  GS ++  H    L
Sbjct  324   FPKFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKL  383

Query  1335  QIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFT  1508
               ++VSNN   G I     +  P ++ LNLS N F+G + S       L  LD+S N  T
Sbjct  384   ATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFSDMKMLKSLDISYNQLT  443

Query  1509  GEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlp  1688
             G IP  M + C SL IL LSNN L+G I  E   L++L+ L LDGN F G IP SLS   
Sbjct  444   GAIPDRMAMGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCY  503

Query  1689  lhs-lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNL  1865
             L   L + DN LSG+IPRW+G L +L  + +  N+LEG IP EFC L  L +LDLS N++
Sbjct  504   LLGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSI  563

Query  1866  TGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsr  2045
              G++PSCL+  SI+ V LSK+++ GQL         LV LDLSYN   G IP WI  + +
Sbjct  564   FGTLPSCLSLGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDRLPQ  623

Query  2046  lsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISL-EGTNEQFRGIN  2222
             LS LLL  N  EG++P Q+CQL  + L+DLS+N LSG IP CL   +L EG         
Sbjct  624   LSYLLLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIPPCLVNTALSEG---------  674

Query  2223  LPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPE--VQFRTKGNLYNYQNSIL  2384
                 YY   DA+     +       Y P     +  E  VQF TK   Y Y+  IL
Sbjct  675   ----YY---DAVAPTWDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRIL  723


 Score =   128 bits (321),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 188/718 (26%), Positives = 316/718 (44%), Gaps = 84/718 (12%)
 Frame = +3

Query  87    NERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQS-FGPINDVGGA  263
             ++ L  L++L+EL++R   + +  +  + N+    SL+VL++  N+    F P       
Sbjct  155   DQGLCELVHLQELYIRDNDLRDSLLWCLANMT---SLQVLNVASNQLTGNFPP--GFCEL  209

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
               L ELY+       S+   L    SL++LD+  N   +  +    +  L +++EL LS+
Sbjct  210   VLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTEN-ISSSPLMHLTSIEELILSN  268

Query  444   NYFE-GFETSANHSGSSRHTIRNKSYLEV-LHLNNIS--FDMTKL-LSSLAAFPSIKTLE  608
             N+F+         + S   T   + Y E   H N+++  F +T + LS      +     
Sbjct  269   NHFQIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFL  328

Query  609   LQRVNVTNIDAIHA----------LKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSL  758
               + ++ N D  H            +N + L+ L L  ++L   F   I  ++ L  L +
Sbjct  329   YHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDV  388

Query  759   SGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
             S     G +P +    L  L  L LS N   G IPS F ++  L+ +++S N+L+G I  
Sbjct  389   SNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFSDMKMLKSLDISYNQLTGAIPD  448

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLD  1118
                    SLE L++ NN+ +    F    N + L+ +  D NK I +   +     + L 
Sbjct  449   RMAMGCFSLEILALSNNTLQ-GHIFSEKFNLTNLKRLQLDGNKFIGEIP-ESLSKCYLLG  506

Query  1119  SLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTG  1298
              L LS+     K+PR+L     L+ + +  NNLEG  P+   Q +  L+   ++NN+  G
Sbjct  507   GLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDC-LKVLDLSNNSIFG  565

Query  1299  SLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--TH  1472
             +L     +  +++ +++S NK+ G++  +    +P ++ L+LS N   G + + I     
Sbjct  566   TLPSCLSLG-SIEQVHLSKNKIEGQLE-SIIHYYPYLVTLDLSYNRLHGSIPNWIDRLPQ  623

Query  1473  LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI-----------------VQE  1601
             L +L L+NN   GEIP + L     + ++ LS+N L G I                    
Sbjct  624   LSYLLLANNYIEGEIPVQ-LCQLKEVRLIDLSHNNLSGHIPPCLVNTALSEGYYDAVAPT  682

Query  1602  FDYLSS--LEYLHLDGNNF--EGTIpnsls----------nlplhslDIRDNKLSGEIPR  1739
             +D+ S+  L Y   +G+    E T+  +               +  +D+  NKL+GEIP 
Sbjct  683   WDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPT  742

Query  1740  WMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSL  1919
              +G LT +  L LS N+L G IP  F NLK +  LDLS N L G IP  L          
Sbjct  743   QIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLRGKIPPQL----------  792

Query  1920  SKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
                            NT L +  ++YN+  G IP+ +   S        GN F   +P
Sbjct  793   ------------IVLNT-LAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCGLP  837



>gb|KDO38137.1| hypothetical protein CISIN_1g0077622mg, partial [Citrus sinensis]
Length=566

 Score =   331 bits (848),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 236/564 (42%), Positives = 331/564 (59%), Gaps = 31/564 (5%)
 Frame = +3

Query  582   AFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIG-PMESLKVLSL  758
              FP  K+LEL  +  T I                     L+  FL  I   M SLK LSL
Sbjct  14    GFPHFKSLELLDMECTRIA--------------------LNTSFLQIISESMPSLKYLSL  53

Query  759   SGAQVG---GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGN  929
             S + +G     + ++GLC L +LQEL++  N L G +P    N+TSLR + +S N+L+G+
Sbjct  54    SDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQLTGS  113

Query  930   IelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQGF-VP  1103
             I  SPL  LTS+E L + NN F++  S     N+S+L+V  A  N++ A+ TQ      P
Sbjct  114   ISSSPLVHLTSIEELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEITQSPSLTAP  173

Query  1104  KFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMN  1280
              FQL  LSLS+   D +  P+FL++Q DL+ + +S   + GEFP+WLL+NNT L+   + 
Sbjct  174   NFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFLV  233

Query  1281  NNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSL  1460
             N++  G  +L  H +  L+++++SNN   G I        P + +LN+S N   G + S 
Sbjct  234   NDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSS  293

Query  1461  IG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLH  1634
              G    L  LD++NN  TGEIP+ + + C +L  L LSNN LEG +      L++L++L 
Sbjct  294   FGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQ  353

Query  1635  LDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPI  1811
             L+GN+F G IP SLS   +   L + +N LSG IPRW+G LT L  + + KNHLEG IP+
Sbjct  354   LEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEGPIPV  413

Query  1812  EFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILD  1988
             EFC L  L ILD+S+NN++GS+PSC +P SI+HV LSK+ L GQL R  FFN  +LV LD
Sbjct  414   EFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLD  473

Query  1989  LSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPR  2168
             LSYN   G I +W+  +S+LS L+L  N  EG+VP Q+C+L +L LLDLSNN L G IP 
Sbjct  474   LSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHGPIPP  533

Query  2169  CLGKISLEGTNEQFRGINLPFEYY  2240
             C    +L  +       N  FE +
Sbjct  534   CFDNTTLHESYSNSSSPNKQFEIF  557


 Score =   101 bits (252),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 149/537 (28%), Positives = 235/537 (44%), Gaps = 94/537 (18%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY++      S+   +    SL+IL +  N    G +    +  L +++EL+LS+N+
Sbjct  76    LQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQL-TGSISSSPLVHLTSIEELHLSNNH  134

Query  450   FE---GFETSANHSG----SSRHTIRNKSYLEVLHLNNISFDMTKL-LSSL----AAFPS  593
             F+     E   NHS      +++   N    +   L   +F +++L LSS       FP 
Sbjct  135   FQIPISLEPLFNHSRLKVFWAKNNEINAEITQSPSLTAPNFQLSRLSLSSGYGDGVIFPK  194

Query  594   -------IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
                    ++ ++L  + +        L+N ++LE L L   +L   F   I   + L++L
Sbjct  195   FLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFLVNDSLAGPFRLPIHSHKRLRLL  254

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S     G +P +    L  L  L +S N L+G IPS FGN+  L+ ++++ N+L+G I
Sbjct  255   DISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEI  314

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQ  1112
                      +LEYL++ NNS E     R+F N + L+ +  + N  +      G +P+  
Sbjct  315   PEHLAVGCVNLEYLALSNNSLEGHMFSRNF-NLTNLKWLQLEGNHFV------GEIPQ--  365

Query  1113  LDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAF  1292
                 SLS C               L+ L ++ N+L G  P W L N T+LQ+ +M  N  
Sbjct  366   ----SLSKCF-------------VLEGLFLNNNSLSGMIPRW-LGNLTRLQHIMMPKNHL  407

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTH  1472
              G + +       LQI+++S+N     ISG+  S F                 H L   H
Sbjct  408   EGPIPVEFCQLDWLQILDISDNN----ISGSLPSCF-----------------HPLSIEH  446

Query  1473  LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNF  1652
                + LS N   G++ +    +  SLV L LS N+L G I    D LS L +L L  NN 
Sbjct  447   ---VHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNL  503

Query  1653  EGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCN  1823
             E                       GE+P  + +L  L  L LS N+L G IP  F N
Sbjct  504   E-----------------------GEVPVQLCKLNQLQLLDLSNNNLHGPIPPCFDN  537



>ref|XP_010059729.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1 
[Eucalyptus grandis]
Length=1023

 Score =   342 bits (876),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 259/629 (41%), Positives = 383/629 (61%), Gaps = 24/629 (4%)
 Frame = +3

Query  330   GFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRN  509
             GF +L  LD+ DN   D    I+   DL NLKEL +S N        A  +G+    I+N
Sbjct  172   GFSNLMELDISDNAI-DAVATIE--GDLSNLKELDISYN--------AVDAGAIVEGIKN  220

Query  510   KSYLEVLHLNNISFD-MTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHL  686
              S+LE LHL+++    +  ++ +L A  S++ L LQ   V  I      +N S LE+L L
Sbjct  221   LSHLENLHLDDVHLKHVGTVVRALGALSSLRILSLQYNTVEGIITTQDFRNFSKLEQLIL  280

Query  687   DGS--NLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKI  860
             DGS  N  +  LS++GP  SL++LS S   + G L + GLC L  LQEL LS N + G++
Sbjct  281   DGSPLNTSRGILSSLGPSTSLRLLSSSNTGLSGNLSDHGLCNLVKLQELDLSFNGITGRL  340

Query  861   PSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKL  1040
             P+ + N++S+R +NL  N+ + ++  SPLS+LTSLE+LS  +N F++ SS R  AN+S+L
Sbjct  341   PTCWRNMSSIRILNLEDNEFTDSVMSSPLSSLTSLEFLSTSSNHFDIPSSLRPLANHSRL  400

Query  1041  RVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDL-LKLPR--FLHYQRDLKVLRISRN  1211
             +V++ D  K+  DT +   +P+ QL  LS+SN      KL    FL+ Q DL++L +S N
Sbjct  401   KVLILDDTKLTIDTTVASLIPRLQLKVLSMSNSPSRGFKLTSLGFLNNQHDLRILDLSSN  460

Query  1212  NLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFS  1391
             +++G FP+WLLQNNTKL+   M NN FT + K+ S    NL  +++SNN + G++S  F 
Sbjct  461   DIQGPFPAWLLQNNTKLEKLFMENNLFT-TFKVPSMTLFNLSFMDISNNNIRGKLSTEFW  519

Query  1392  SSFPNILALNLSSNLFSGQLHSLIGT--HLGFLDLSNNSFTGEIPKEMLISCSSLVILKL  1565
             ++ PN+  LNLS+N   G + S +G+   L  LDLS+N+F+  +P ++L+    L  L +
Sbjct  520   ANVPNLSYLNLSANRLEGNIPSELGSMKSLYILDLSSNNFSAGLPIQILLD---LCHLNV  576

Query  1566  SNNKLEGQIV-QEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRW  1742
             + NKL+G+IV  +      L +L LD N F G++    S + L  LD+ +N  +GE+PR 
Sbjct  577   AYNKLQGEIVLSDHTMNPCLSHLRLDHNLFTGSLSFLSSFVHLGILDVSNNNFTGELPRL  636

Query  1743  MGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLS  1922
                ++SL+ L LSKN L+G IP E  NL  L  LDLS+NNL+G +PS      + H+ LS
Sbjct  637   TANMSSLMALDLSKNQLDGLIPQELYNLGWLEYLDLSDNNLSGPLPSLFISQRMLHIHLS  696

Query  1923  KHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQV  2102
             +++L+G L  A  N++ LV LDLS N F G IP W+G +S+L+ L L GN F G  P Q+
Sbjct  697   RNKLNGTLVHALSNSSYLVTLDLSENEFFGSIPYWLGNLSQLTILSLKGNSFYGTFPEQL  756

Query  2103  CQLMRlslldlsnnllsGVIPRCLGKISL  2189
             C+L  LS++DLS N L G +P CLG ++L
Sbjct  757   CRLKSLSMIDLSENNLFGPLPSCLGPLNL  785


 Score =   107 bits (266),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 174/640 (27%), Positives = 270/640 (42%), Gaps = 77/640 (12%)
 Frame = +3

Query  267   KLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDN  446
             KL+EL L        +    +   S++IL+L DN+F D  +                S  
Sbjct  325   KLQELDLSFNGITGRLPTCWRNMSSIRILNLEDNEFTDSVMSSPLS-----------SLT  373

Query  447   YFEGFETSANHSG--SSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTL-----  605
               E   TS+NH    SS   + N S L+VL L++    +   ++SL     +K L     
Sbjct  374   SLEFLSTSSNHFDIPSSLRPLANHSRLKVLILDDTKLTIDTTVASLIPRLQLKVLSMSNS  433

Query  606   -----------------ELQRVNVTNID-----AIHALKNLSSLEELHLDGSNLHKDFLS  719
                              +L+ +++++ D         L+N + LE+L ++ +NL   F  
Sbjct  434   PSRGFKLTSLGFLNNQHDLRILDLSSNDIQGPFPAWLLQNNTKLEKLFME-NNLFTTFKV  492

Query  720   NIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYV  899
                 + +L  + +S   + G L  +    + NL  L LS N+LEG IPS  G++ SL  +
Sbjct  493   PSMTLFNLSFMDISNNNIRGKLSTEFWANVPNLSYLNLSANRLEGNIPSELGSMKSLYIL  552

Query  900   NLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD  1079
             +LS N  S  + +  L  L  L    +  N  +          N  L  +  D N     
Sbjct  553   DLSSNNFSAGLPIQILLDLCHLN---VAYNKLQGEIVLSDHTMNPCLSHLRLDHNLFTGS  609

Query  1080  TQ-LQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNT  1256
                L  FV    L  L +SN     +LPR       L  L +S+N L+G  P  L  N  
Sbjct  610   LSFLSSFV---HLGILDVSNNNFTGELPRLTANMSSLMALDLSKNQLDGLIPQEL-YNLG  665

Query  1257  KLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNL  1436
              L+Y  +++N  +G L  S  ++  +  I++S NKL G +    S+S   ++ L+LS N 
Sbjct  666   WLEYLDLSDNNLSGPLP-SLFISQRMLHIHLSRNKLNGTLVHALSNS-SYLVTLDLSENE  723

Query  1437  FSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDY  1610
             F G +   +G  + L  L L  NSF G  P E L    SL ++ LS N L G +      
Sbjct  724   FFGSIPYWLGNLSQLTILSLKGNSFYGTFP-EQLCRLKSLSMIDLSENNLFGPLPSCLGP  782

Query  1611  LS-SLEYLHLDGNNFEGTIpnslsnlplhslDIRDN------KLSGEI--PRWMG-----  1748
             L+ S +Y     +     I         +   I++N      K+ GE   P  +G     
Sbjct  783   LNLSKDYTDKVTSTMNNEIHMIGWPSRPYVRSIKNNREIYHMKMKGEFQAPHIVGFTTKR  842

Query  1749  --------RLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNP-SS  1901
                      L  +V L LS N   G IP+E   L+ + +L+LS N LTG IP  L+  + 
Sbjct  843   RFDSYKGYALLKMVGLLLSCNQFSGEIPLEIAILQEMLVLNLSHNKLTGHIPMSLSSLTK  902

Query  1902  IKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIP  2021
             I+ + LS + L G +        +L I ++SYN   G IP
Sbjct  903   IESIDLSYNNLIGSIPEELTQLNSLEIFNVSYNDLSGAIP  942


 Score = 76.6 bits (187),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 151/558 (27%), Positives = 230/558 (41%), Gaps = 81/558 (15%)
 Frame = +3

Query  195   LKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDF  374
             L++LD+  N  Q   P   +    KLE+L++    F      S+  F +L  +D+ +N+ 
Sbjct  452   LRILDLSSNDIQGPFPAWLLQNNTKLEKLFMENNLFTTFKVPSMTLF-NLSFMDISNNNI  510

Query  375   YDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFD  554
               G L  +   ++ NL  L LS N  EG   S   S  S        Y+  L  NN S  
Sbjct  511   -RGKLSTEFWANVPNLSYLNLSANRLEGNIPSELGSMKSL-------YILDLSSNNFS--  560

Query  555   MTKLLSSLAAFPSIKTLELQRVNVTN-------IDAIHALKNLSSLEELHLDGSNLHKDF  713
                     A  P    L+L  +NV         + + H +     L  L LD  NL    
Sbjct  561   --------AGLPIQILLDLCHLNVAYNKLQGEIVLSDHTMN--PCLSHLRLD-HNLFTGS  609

Query  714   LSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLR  893
             LS +     L +L +S     G LP +    + +L  L LS+NQL+G IP    NL  L 
Sbjct  610   LSFLSSFVHLGILDVSNNNFTGELP-RLTANMSSLMALDLSKNQLDGLIPQELYNLGWLE  668

Query  894   YVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVI  1073
             Y++LS N LSG +     S   S   L I  +  ++  +     +NS   V L      +
Sbjct  669   YLDLSDNNLSGPL----PSLFISQRMLHIHLSRNKLNGTLVHALSNSSYLVTLD-----L  719

Query  1074  ADTQLQGFVPKF-----QLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSW  1238
             ++ +  G +P +     QL  LSL         P  L   + L ++ +S NNL G  PS 
Sbjct  720   SENEFFGSIPYWLGNLSQLTILSLKGNSFYGTFPEQLCRLKSLSMIDLSENNLFGPLPSC  779

Query  1239  LLQNNTKLQYFLMNNNAFTGSLKLSSHV-----NPNLQIINVSNNKLCGEISGNFSSSFP  1403
             L   N    Y     +  T ++    H+      P ++ I  +      ++ G F +  P
Sbjct  780   LGPLNLSKDY----TDKVTSTMNNEIHMIGWPSRPYVRSIKNNREIYHMKMKGEFQA--P  833

Query  1404  NILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLE  1583
             +I+         S + ++L+   +G L LS N F+GEIP E+ I    +++L LS+NKL 
Sbjct  834   HIVGFTTKRRFDSYKGYALLKM-VGLL-LSCNQFSGEIPLEIAI-LQEMLVLNLSHNKLT  890

Query  1584  GQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSL  1763
             G I      L+ +E + L  NN                       L G IP  + +L SL
Sbjct  891   GHIPMSLSSLTKIESIDLSYNN-----------------------LIGSIPEELTQLNSL  927

Query  1764  VQLTLSKNHLEGHIPIEF  1817
                 +S N L G IP ++
Sbjct  928   EIFNVSYNDLSGAIPNKY  945


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 128/461 (28%), Positives = 192/461 (42%), Gaps = 61/461 (13%)
 Frame = +3

Query  66    SHLNNSGNERLTGLINLEELHMRYTQMEEI---NILSVLNLKDFISLKVLDIGFNKFQSF  236
             S+LN S N RL G I  E   M+   + ++   N  + L ++  + L  L++ +NK Q  
Sbjct  526   SYLNLSAN-RLEGNIPSELGSMKSLYILDLSSNNFSAGLPIQILLDLCHLNVAYNKLQGE  584

Query  237   GPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLR  416
               ++D      L  L L    F  S+   L  F  L ILD+ +N+F  G L     N + 
Sbjct  585   IVLSDHTMNPCLSHLRLDHNLFTGSL-SFLSSFVHLGILDVSNNNF-TGELPRLTAN-MS  641

Query  417   NLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHL--NNISFDMTKLLSSLAAFP  590
             +L  L LS N  +G              + N  +LE L L  NN+S  +  L      F 
Sbjct  642   SLMALDLSKNQLDGLIP---------QELYNLGWLEYLDLSDNNLSGPLPSL------FI  686

Query  591   SIKTLELQ-RVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGA  767
             S + L +    N  N   +HAL N S L  L L  +         +G +  L +LSL G 
Sbjct  687   SQRMLHIHLSRNKLNGTLVHALSNSSYLVTLDLSENEFFGSIPYWLGNLSQLTILSLKGN  746

Query  768   QVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspl  947
                GT P + LC LK+L  + LSEN L G +PS  G L               N+     
Sbjct  747   SFYGTFPEQ-LCRLKSLSMIDLSENNLFGPLPSCLGPL---------------NLSKDYT  790

Query  948   stltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQ---LQGFVPKFQLD  1118
               +TS     I    +      RS  NN ++  +     K+  + Q   + GF  K + D
Sbjct  791   DKVTSTMNNEIHMIGWPSRPYVRSIKNNREIYHM-----KMKGEFQAPHIVGFTTKRRFD  845

Query  1119  SL---SLSNCIDLL--------KLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQ  1265
             S    +L   + LL        ++P  +   +++ VL +S N L G  P   L + TK++
Sbjct  846   SYKGYALLKMVGLLLSCNQFSGEIPLEIAILQEMLVLNLSHNKLTGHIP-MSLSSLTKIE  904

Query  1266  YFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNF  1388
                ++ N   GS+        +L+I NVS N L G I   +
Sbjct  905   SIDLSYNNLIGSIPEELTQLNSLEIFNVSYNDLSGAIPNKY  945



>ref|XP_006494118.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Citrus sinensis]
Length=705

 Score =   333 bits (855),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 272/707 (38%), Positives = 387/707 (55%), Gaps = 37/707 (5%)
 Frame = +3

Query  303   NQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHS  482
             N  + Q   G   LK LDL      DG   +Q I    +L  LYLS N F    T     
Sbjct  8     NLVVPQGYNGLRKLKSLDLSGVGVRDGSKLLQSIGSFSSLNSLYLSSNNFTETVTI----  63

Query  483   GSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNL  662
               +   + N + LE L L++    ++ L S  + FPS+K L +    V  +       + 
Sbjct  64    --TTQELHNFTNLEYLKLDDSPLHISLLQSIASIFPSLKNLSMIGCEVNGVIRGQDFPHF  121

Query  663   SSLEELHLD--GSNLHKDFLSNIG-PMESLKVLSLSGAQVG---GTLPNKGLCELKNLQE  824
              SLE L ++     L+  FL      M SLK LSLS   +G       N+GLC L +LQE
Sbjct  122   KSLEHLDMEFMCIALNTSFLQITSESMSSLKYLSLSYYTLGINSSETLNQGLCSLVHLQE  181

Query  825   LWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
             L+++ N L G +P    N+TSLR +++S NKL+G+I  SPL  LTS+E L + NN F++ 
Sbjct  182   LYIASNDLRGSLPWCMANMTSLRILDVSSNKLTGSISSSPLIHLTSIEELYLSNNHFQIP  241

Query  1005  SSFRSFANNSKLRVILADRNKVIAD-TQLQGF-VPKFQLDSLSLSNCI-DLLKLPRFLHY  1175
              S     N+S+L+ + A  N++ A+ T+      P FQL SL LS+   D +  P+FL++
Sbjct  242   ISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFQLQSLLLSSGYGDGVTFPKFLYH  301

Query  1176  QRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSN  1355
             Q DL+ + +S   + G+FP+WLL+NN KL+   + N++  G  +L  H +  L+ ++VSN
Sbjct  302   QHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSN  361

Query  1356  NKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGT--HLGFLDLSNNSFTGEIPKEM  1529
             N   G I        P++ + N+S+N   G + S  G    L  LDLS+N  TGEIP+ +
Sbjct  362   NNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPERL  421

Query  1530  LISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDI  1706
              + C +L  L LSNN L+G +      L++L  L L+ N F G IP SLS       L +
Sbjct  422   AVGCVNLEFLALSNNNLKGHLFCRNFNLANLRRLQLEDNRFIGEIPQSLSKCSSLEGLYL  481

Query  1707  RDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSC  1886
              +N LSG+IPRW+G LTSL  +T+ KNHLEG IP+EFC L SL ILD+S+NN++GS+PSC
Sbjct  482   NNNSLSGKIPRWLGNLTSLQDITMPKNHLEGPIPVEFCQLYSLHILDISDNNISGSLPSC  541

Query  1887  LNPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslll  2063
              +P  IK V LSK+ L GQL R  FFN ++LV LDLSYN   G IP+W   +S+L+ L+L
Sbjct  542   FHPLYIKKVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNHLNGSIPDWFDGLSQLNHLIL  601

Query  2064  NGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYS  2243
               N  EG+VP Q+C L +L LLDLSNN L G +P C    +L  +      +  PFE   
Sbjct  602   GHNNLEGEVPVQLCGLNQLQLLDLSNNNLHGPVPHCFDNTTLRESYNNSSSLK-PFETS-  659

Query  2244  INDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
                       Y W + ++        +L   +F TK   + YQ  +L
Sbjct  660   ---------FYGWLTKEQ-------KILESFEFTTKNIAHIYQGKVL  690


 Score =   121 bits (303),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 170/623 (27%), Positives = 263/623 (42%), Gaps = 127/623 (20%)
 Frame = +3

Query  114   LEELHMRY------TQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLE  275
             LE L M +      T   +I   S+ +LK ++SL    +G N  ++      +     L+
Sbjct  124   LEHLDMEFMCIALNTSFLQITSESMSSLK-YLSLSYYTLGINSSETLN--QGLCSLVHLQ  180

Query  276   ELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE  455
             ELY+       S+   +    SL+ILD+  N    G +    +  L +++ELYLS+N+F+
Sbjct  181   ELYIASNDLRGSLPWCMANMTSLRILDVSSNKL-TGSISSSPLIHLTSIEELYLSNNHFQ  239

Query  456   ---GFETSANHSGSSRHTIRN---KSYLEVLH-LNNISFDMTKLLSSLA-----AFPSI-  596
                  E   NHS   R    N   K+ +   H L   +F +  LL S        FP   
Sbjct  240   IPISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFQLQSLLLSSGYGDGVTFPKFL  299

Query  597   -KTLELQRVNVTNIDAIHA-----LKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSL  758
                 +L+ V++++I          L+N + LE L L   ++   F   I P   L+ L +
Sbjct  300   YHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDV  359

Query  759   SGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
             S     G +P +    L +L    +S N L G IPS FGN+  LR ++LS N+L+G I  
Sbjct  360   SNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPE  419

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLD  1118
                    +LE+L++ NN+ +     R+F N + LR +  + N+ I      G +P+    
Sbjct  420   RLAVGCVNLEFLALSNNNLKGHLFCRNF-NLANLRRLQLEDNRFI------GEIPQ----  468

Query  1119  SLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTG  1298
               SLS C               L+ L ++ N+L G+ P W L N T LQ   M  N   G
Sbjct  469   --SLSKC-------------SSLEGLYLNNNSLSGKIPRW-LGNLTSLQDITMPKNHLEG  512

Query  1299  SLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLG  1478
              + +      +L I+++S+N     ISG+  S F           L+  ++H        
Sbjct  513   PIPVEFCQLYSLHILDISDNN----ISGSLPSCF---------HPLYIKKVH--------  551

Query  1479  FLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEG  1658
                LS N   G++ +    +CSSLV L LS N L G I   FD LS L +L L  NN EG
Sbjct  552   ---LSKNMLHGQLKRGTFFNCSSLVTLDLSYNHLNGSIPDWFDGLSQLNHLILGHNNLEG  608

Query  1659  TIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLS  1838
              +                                               P++ C L  L 
Sbjct  609   EV-----------------------------------------------PVQLCGLNQLQ  621

Query  1839  ILDLSENNLTGSIPSCLNPSSIK  1907
             +LDLS NNL G +P C + ++++
Sbjct  622   LLDLSNNNLHGPVPHCFDNTTLR  644



>ref|XP_004514486.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Cicer arietinum]
Length=1182

 Score =   343 bits (880),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 272/708 (38%), Positives = 387/708 (55%), Gaps = 30/708 (4%)
 Frame = +3

Query  150   EINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGA--KKLEELYLFECRFNQSIFQS  323
             EI + S+ N+     L++L++  N F +  P  + G A    L+ L L     + +I  S
Sbjct  255   EITLRSIYNISKLRYLEILELAGNNF-NLWPRENHGFAWPTNLQVLVLRANSLSNNILSS  313

Query  324   LKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTI  503
             L G P LK LDL  N+   G L I  ++ L NLK L  SDN    F     H GS     
Sbjct  314   LSGLPRLKSLDLSVNNL-KGTLDISGLSTLTNLKMLDFSDNQIVDFVV---HKGS-----  364

Query  504   RNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELH  683
             ++ S L++L L+    + +KL  SL AF SI  L L++              LS LE L 
Sbjct  365   KSLSRLDILDLDQNMINGSKLQESLRAFSSINNLTLRQNEFKGTTLSGGFSGLSKLEYLA  424

Query  684   LD-GSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKI  860
             LD  SNL  +F  +IG + SLKVLS+S   + GTL      +L+ L+EL LS N+  G +
Sbjct  425   LDHSSNLENEFFKSIGDLPSLKVLSMSDCGINGTLSIGDWPKLQKLEELDLSYNEFVGPL  484

Query  861   PSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKL  1040
             PS F N+TSLR + L+ N   GNI     +  +         N FE   SF  F+N+S L
Sbjct  485   PSSFVNMTSLRTLKLTNNHFIGNIGPHLATLTSLEYLN-FEGNQFEFPISFTPFSNHSNL  543

Query  1041  RVILADRNKVIADTQ--LQGFVPKFQLDSLSLSNCIDL--LKLPRFLHYQRDLKVLRISR  1208
             + I  + NKVI D+   L+ +VPKFQL  L LS+  ++  + LP FL YQ +L  +  + 
Sbjct  544   KFIYGNGNKVILDSHSTLKAWVPKFQLQVLQLSSTTEVKSIPLPNFLLYQYNLTNVDFTS  603

Query  1209  NNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGE-ISGN  1385
               L+GEFP+WLL+NNTK++  ++ N +F G   L SH + N+  ++VSNN + G+ +S N
Sbjct  604   CKLKGEFPNWLLENNTKMEMLILQNCSFMGDFHLPSHPHLNMVRVDVSNNAITGQMLSNN  663

Query  1386  FSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVIL  1559
              SS FPN+L LN+S N   G +   I   + L  LDLS+N  +GEIP  +    S L  L
Sbjct  664   ISSIFPNLLHLNMSKNAIHGLIPYEISLLSSLVALDLSDNQLSGEIPHNLSRDGSQLSFL  723

Query  1560  KLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-pnslsnlplhslDIRDNKLSGEIP  1736
             + SNNKL G +       SSL+YL LDGN+  G+I  N  ++  +  LDI +N   G+IP
Sbjct  724   RFSNNKLHGFLPPMMSTYSSLQYLLLDGNSLSGSIPSNFFNSSNIGHLDISNNNFIGKIP  783

Query  1737  RWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVS  1916
               +     L+++++S NHLEG IP E   L+SL+ LDLS+NNL G +PS +N SS   + 
Sbjct  784   SQIQNSFGLIEISMSNNHLEGSIPSELAELESLTYLDLSQNNLVGCVPSFIN-SSATFIH  842

Query  1917  LSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrl--sslllNGNRFEGKV  2090
             LS + L+      F   ++L  LDLS N  +    + I  ++    + LL+ GN F G +
Sbjct  843   LSNNNLTCLSKDMFGERSSLATLDLSNNEIIDGFHDLIHDLNYTGLNILLVKGNHFTGNI  902

Query  2091  PTQVCQLMRlslldlsnnllsGVIPRCLGKISL-----EGTNEQFRGI  2219
             P QVCQL+ L++LDLS N   G IP CLGK+       E + +Q+ GI
Sbjct  903   PKQVCQLVDLNILDLSYNDFVGEIPTCLGKMPFENKDPEASRDQYNGI  950


 Score = 74.3 bits (181),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 137/475 (29%), Positives = 212/475 (45%), Gaps = 56/475 (12%)
 Frame = +3

Query  501   IRNKSYLEVLHLNNISFDMTKLLSSLAAF--PSIKTLELQRVNVTN--IDAIHALKNLSS  668
             + N + +E+L L N SF        +  F  PS   L + RV+V+N  I       N+SS
Sbjct  615   LENNTKMEMLILQNCSF--------MGDFHLPSHPHLNMVRVDVSNNAITGQMLSNNISS  666

Query  669   L--EELHLDGSNLHKDFLSNIGPME-----SLKVLSLSGAQVGGTLPNKGLCELKNLQEL  827
             +    LHL   N+ K+ +  + P E     SL  L LS  Q+ G +P+    +   L  L
Sbjct  667   IFPNLLHL---NMSKNAIHGLIPYEISLLSSLVALDLSDNQLSGEIPHNLSRDGSQLSFL  723

Query  828   WLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSF----  995
               S N+L G +P      +SL+Y+ L  N LSG+I  +  ++        I NN+F    
Sbjct  724   RFSNNKLHGFLPPMMSTYSSLQYLLLDGNSLSGSIPSNFFNSSNIGHLD-ISNNNFIGKI  782

Query  996   --EVASSFR----SFANN-------SKLRVILADRNKVIADTQLQGFVPKFQLDS---LS  1127
               ++ +SF     S +NN       S+L  + +     ++   L G VP F   S   + 
Sbjct  783   PSQIQNSFGLIEISMSNNHLEGSIPSELAELESLTYLDLSQNNLVGCVPSFINSSATFIH  842

Query  1128  LSNCIDLLKLPRFLHYQRD-LKVLRISRNNLEGEFPSWLLQ-NNTKLQYFLMNNNAFTGS  1301
             LSN  +L  L + +  +R  L  L +S N +   F   +   N T L   L+  N FTG+
Sbjct  843   LSNN-NLTCLSKDMFGERSSLATLDLSNNEIIDGFHDLIHDLNYTGLNILLVKGNHFTGN  901

Query  1302  LKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGF  1481
             +        +L I+++S N   GEI                S + ++G +HS  G +   
Sbjct  902   IPKQVCQLVDLNILDLSYNDFVGEIPTCLGKMPFENKDPEASRDQYNGIIHSR-GDYYNR  960

Query  1482  LDLSNNSFTGEIPKE-----MLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGN  1646
                   +FT +   E     +LI  S +    LS+NKL G I  E   L+++  L+L  N
Sbjct  961   FGKEKANFTSKKRSETYTTNILIYMSGI---DLSHNKLNGSIPYELGNLTTIRALNLSNN  1017

Query  1647  NFEGTI-pnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIP  1808
              F G I       + + SLD+  NKLSG+IP  +  LTSL   +++ N+L G  P
Sbjct  1018  FFAGKIPDTFSKLVKVESLDLSFNKLSGQIPPQLSGLTSLEVFSVAHNNLSGATP  1072



>gb|KHN37937.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=1158

 Score =   342 bits (878),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 286/757 (38%), Positives = 397/757 (52%), Gaps = 76/757 (10%)
 Frame = +3

Query  165   SVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECR-FNQ----SIFQSLK  329
             S+ N+    SL++LD+ +N F       D+G A             +NQ    SIF+ L 
Sbjct  259   SIFNISKLSSLEILDLFYNNFND----TDIGFALSGLSSLKSLNLGYNQLTSSSIFRGLS  314

Query  330   GFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRN  509
             G  SL+ILDL  N+  D  +H Q    L  L  LYL  N  +G                 
Sbjct  315   GLISLEILDLRFNNISDFAVH-QGSKGLGRLDALYLDGNMIDG-----------------  356

Query  510   KSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLD  689
                             +KL +SL AF S++ L +               +LS+LE L +D
Sbjct  357   ----------------SKLRNSLRAFSSVRMLSMSENEFKGTIVAGDFHDLSNLEHLTMD  400

Query  690   GSN-LHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPS  866
              SN L  +F  +IG + SLKVLSL    +  TLP     +LK ++EL LS N+ EG +PS
Sbjct  401   YSNNLKNEFFKSIGELTSLKVLSLRYCNINDTLPPADWSKLKKIEELDLSGNEFEGPLPS  460

Query  867   YFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRV  1046
              F N+TSLR + +S N   GN + +  S  +   +     N FEV  SF +FAN+SK+++
Sbjct  461   SFVNMTSLRELEISHNHFIGNFDSNIASLTSLEYFG-FTENQFEVPVSFSTFANHSKIKL  519

Query  1047  ILADRNKVIADTQ--LQGFVPKFQLDSLSLSNCIDL--LKLPRFLHYQRDLKVLRISRNN  1214
             I    N+ I D+Q  L  ++PKFQL  LS+S+  +   L LP FL YQ  L  L  S   
Sbjct  520   IDGGGNRFILDSQHSLPTWIPKFQLQELSVSSTTETKSLPLPNFLLYQNSLISLDFSSWK  579

Query  1215  LEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEI-SGNFS  1391
             LEG+FP WLL+NNTK+   L  N +FTG+ +L     PNL  I+VS+N + G+I S N S
Sbjct  580   LEGDFPYWLLENNTKMTEALFRNCSFTGTFQLPMRSLPNLSKIDVSDNIIVGQIPSNNIS  639

Query  1392  SSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKL  1565
             S +PN+  LNLS N   G +   +G    L  LDLS+N  + EIPK++      L  LKL
Sbjct  640   SIYPNLQFLNLSRNNIQGSIPRELGQMNSLDSLDLSDNHLSREIPKDIFGVGHRLNFLKL  699

Query  1566  SNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWM  1745
             SNNKLEG I+   +  + LE L L+ N   G +P+++ N  + SLD+ +N L G+IP  +
Sbjct  700   SNNKLEGPIL---NIPNGLETLLLNDNRLTGRLPSNIFNASIISLDVSNNHLMGKIPSLV  756

Query  1746  GRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSK  1925
                + L QL L  NH EG IP+E   L+ L+ LDLS+NNL+GS+PS +NP S++ + LS 
Sbjct  757   KNFSGLRQLFLFNNHFEGSIPLELAKLEDLNYLDLSKNNLSGSVPSFVNP-SLRFIHLSN  815

Query  1926  HQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrls--slllNGNRFEGKVPTQ  2099
             + L G   R F   ++LV LDLSYN     + + I  +       LLL GN F G +P Q
Sbjct  816   NHLRGLPKRMFNGTSSLVTLDLSYNEITNSVQDIIQELKYTRLNILLLKGNHFIGDIPKQ  875

Query  2100  VCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSINDAILDRLHYE  2279
             +CQL+ LS+LDLS+N  SG IP CLGK+S E  + +                 L+RL   
Sbjct  876   LCQLIHLSILDLSHNNFSGAIPNCLGKMSFENKDPE---------------RFLERLS-G  919

Query  2280  WGS--DDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
             WGS   ++  P    +V  +V F +K     Y  SIL
Sbjct  920   WGSTGQNKIFPSQLPNVEEKVNFTSKKRTDTYTRSIL  956


 Score =   128 bits (321),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 187/702 (27%), Positives = 298/702 (42%), Gaps = 61/702 (9%)
 Frame = +3

Query  105   LINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELY  284
             L NLE L M Y+   +       ++ +  SLKVL + +       P  D    KK+EEL 
Sbjct  391   LSNLEHLTMDYSNNLKNEFFK--SIGELTSLKVLSLRYCNINDTLPPADWSKLKKIEELD  448

Query  285   LFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---  455
             L    F   +  S     SL+ L++  N F        +I  L +L+    ++N FE   
Sbjct  449   LSGNEFEGPLPSSFVNMTSLRELEISHNHFIGN--FDSNIASLTSLEYFGFTENQFEVPV  506

Query  456   GFETSANHS-------GSSRHTIRNK----SYLEVLHLNNISFDMTKLLSSLAAFP----  590
              F T ANHS       G +R  + ++    +++    L  +S   T    SL   P    
Sbjct  507   SFSTFANHSKIKLIDGGGNRFILDSQHSLPTWIPKFQLQELSVSSTTETKSLP-LPNFLL  565

Query  591   ---SIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLS  761
                S+ +L+     +        L+N + + E      +    F   +  + +L  + +S
Sbjct  566   YQNSLISLDFSSWKLEGDFPYWLLENNTKMTEALFRNCSFTGTFQLPMRSLPNLSKIDVS  625

Query  762   GAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
                + G +P+  +  +  NLQ L LS N ++G IP   G + SL  ++LS N LS  I  
Sbjct  626   DNIIVGQIPSNNISSIYPNLQFLNLSRNNIQGSIPRELGQMNSLDSLDLSDNHLSREIPK  685

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPK----  1106
                     L +L + NN  E             L +       ++ D +L G +P     
Sbjct  686   DIFGVGHRLNFLKLSNNKLE----------GPILNIPNGLETLLLNDNRLTGRLPSNIFN  735

Query  1107  FQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNN  1286
               + SL +SN   + K+P  +     L+ L +  N+ EG  P  L +    L Y  ++ N
Sbjct  736   ASIISLDVSNNHLMGKIPSLVKNFSGLRQLFLFNNHFEGSIPLELAKL-EDLNYLDLSKN  794

Query  1287  AFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG  1466
               +GS+   S VNP+L+ I++SNN L G     F+ +  +++ L+LS N  +  +  +I 
Sbjct  795   NLSGSVP--SFVNPSLRFIHLSNNHLRGLPKRMFNGT-SSLVTLDLSYNEITNSVQDIIQ  851

Query  1467  ----THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSS-----  1619
                 T L  L L  N F G+IPK+ L     L IL LS+N   G I      +S      
Sbjct  852   ELKYTRLNILLLKGNHFIGDIPKQ-LCQLIHLSILDLSHNNFSGAIPNCLGKMSFENKDP  910

Query  1620  ---LEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNH  1790
                LE L   G+  +  I  S        ++    K +    R +  L  +  + LS N 
Sbjct  911   ERFLERLSGWGSTGQNKIFPSQLPNVEEKVNFTSKKRTDTYTRSI--LAYMSGIDLSHNK  968

Query  1791  LEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQLTRAFFNN  1967
             L G+IP +  NL  +  L+LS N+L G IP+   N    + + LS ++LSGQ+       
Sbjct  969   LNGNIPFDLGNLTRIRALNLSHNDLIGQIPATFSNLVQTESLDLSFNKLSGQIPPQLSKL  1028

Query  1968  TALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
             T+L +  +++N+  G  PEW G  S   +    GN F    P
Sbjct  1029  TSLEVFSVAHNNLSGTTPEWKGQFSTFENSSYEGNPFLCGPP  1070



>ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=912

 Score =   338 bits (866),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 229/511 (45%), Positives = 313/511 (61%), Gaps = 4/511 (1%)
 Frame = +3

Query  651   LKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPN-KGLCELKNLQEL  827
             L N  +LEEL+LD   L   FL  +G M SLKVLSLSG  + G LPN +GLCEL +L+ L
Sbjct  173   LPNFENLEELYLDKIELENSFLQTVGVMTSLKVLSLSGCGLTGALPNVQGLCELIHLRVL  232

Query  828   WLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVAS  1007
              +S N+  G +P    NLTSL+ ++LS N+  G+I  SPL  L SL  L + NN F+V  
Sbjct  233   DVSSNEFHGILPWCLSNLTSLQLLDLSSNQFVGDISNSPLKILKSLVDLDVSNNHFQVPF  292

Query  1008  SFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDL  1187
             S   F N+S L+ I    N +  + +L    P+FQL S+  S        P FL++Q +L
Sbjct  293   SLGPFFNHSNLKHIRGQNNAIYLEAELHS-APRFQLISIIFSGYGICGTFPNFLYHQNNL  351

Query  1188  KVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLC  1367
             + + +S  +L+GEFP+WLL NNT+L+   + NN+ +G L+L  H + NL  +++SNN + 
Sbjct  352   QFVDLSHLSLKGEFPNWLLTNNTRLEILDLVNNSLSGHLQLPLHPHVNLLALDISNNHVH  411

Query  1368  GEISGNFSSSFPNILALNLSSNLFSGQLHSLIGT--HLGFLDLSNNSFTGEIPKEMLISC  1541
               I     +  P +  LN+SSN F G + S  G    L  LDLSNN  +G IP+ +   C
Sbjct  412   DHIPLEIGTFLPKLELLNMSSNGFDGSIPSSFGNMNSLRILDLSNNQLSGSIPEHLATGC  471

Query  1542  SSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKL  1721
              SL  L LSNN L+GQ+  +   L++L +L LD N+F G IP SLS   L  +D+ DN L
Sbjct  472   FSLNTLILSNNSLQGQMFSKQFNLTNLWWLELDKNHFSGRIPKSLSKSALSIMDLSDNHL  531

Query  1722  SGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSS  1901
             SG IP W+G L+ L  L LS N L+G IP+EFC L  L +LDL+ N+++G +PSCL+PSS
Sbjct  532   SGMIPGWIGNLSYLQNLILSNNRLKGPIPVEFCQLHYLEVLDLANNSVSGILPSCLSPSS  591

Query  1902  IKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFE  2081
             I HV LS++ + G  T AF  +  LV LDLS N   G IP  IG I+ L  L L  NRF+
Sbjct  592   IIHVHLSQNMIEGPWTNAFSGSHFLVTLDLSSNRITGRIPTLIGGINALRILNLKSNRFD  651

Query  2082  GKVPTQVCQLMRlslldlsnnllsGVIPRCL  2174
             G++P Q+C L +LSL+ L++N LSG IP CL
Sbjct  652   GEIPAQICGLYQLSLIVLADNNLSGSIPSCL  682


 Score =   147 bits (372),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 216/775 (28%), Positives = 342/775 (44%), Gaps = 102/775 (13%)
 Frame = +3

Query  72    LNNSGNERL-TGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPIN  248
             + N G ERL T L +LE L + Y    E  + S+       SLK L++GFN F+      
Sbjct  115   VENEGFERLSTRLSSLEVLDLSYNSFNESILSSLSEFS---SLKSLNLGFNPFEVPIQAQ  171

Query  249   DVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKE  428
             D+   + LEELYL +     S  Q++    SLK+L L          ++Q + +L +L+ 
Sbjct  172   DLPNFENLEELYLDKIELENSFLQTVGVMTSLKVLSLSGCGLTGALPNVQGLCELIHLRV  231

Query  429   LYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLE  608
             L +S N F G              + N + L++L L++  F      S L    S+  L+
Sbjct  232   LDVSSNEFHGILP---------WCLSNLTSLQLLDLSSNQFVGDISNSPLKILKSLVDLD  282

Query  609   LQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLP  788
             +   +     ++    N S+L+ +    + ++ +   +  P   L  +  SG  + GT P
Sbjct  283   VSNNHFQVPFSLGPFFNHSNLKHIRGQNNAIYLEAELHSAPRFQLISIIFSGYGICGTFP  342

Query  789   NKGLCELKNLQELWLSENQLEGKIPSY-FGNLTSLRYVNLSLNKLSGNIelsplstltsl  965
             N  L    NLQ + LS   L+G+ P++   N T L  ++L  N LSG+++L         
Sbjct  343   NF-LYHQNNLQFVDLSHLSLKGEFPNWLLTNNTRLEILDLVNNSLSGHLQL---------  392

Query  966   eylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQ--GFVPKFQLDSLSLSNC  1139
                                  +  L  +    N V     L+   F+PK +L ++S SN 
Sbjct  393   -----------------PLHPHVNLLALDISNNHVHDHIPLEIGTFLPKLELLNMS-SNG  434

Query  1140  IDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSH  1319
              D   +P        L++L +S N L G  P  L      L   +++NN+  G +     
Sbjct  435   FD-GSIPSSFGNMNSLRILDLSNNQLSGSIPEHLATGCFSLNTLILSNNSLQGQMFSKQF  493

Query  1320  VNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLS  1493
                NL  + +  N   G I  + S S  +I  ++LS N  SG +   IG  ++L  L LS
Sbjct  494   NLTNLWWLELDKNHFSGRIPKSLSKSALSI--MDLSDNHLSGMIPGWIGNLSYLQNLILS  551

Query  1494  NNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpns  1673
             NN   G IP E       L +L L+NN + G I+      SS+ ++HL  N  EG   N+
Sbjct  552   NNRLKGPIPVE-FCQLHYLEVLDLANNSVSG-ILPSCLSPSSIIHVHLSQNMIEGPWTNA  609

Query  1674  ls-nlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDL  1850
              S +  L +LD+  N+++G IP  +G + +L  L L  N  +G IP + C L  LS++ L
Sbjct  610   FSGSHFLVTLDLSSNRITGRIPTLIGGINALRILNLKSNRFDGEIPAQICGLYQLSLIVL  669

Query  1851  SENNLTGSIPSCLN--------P-----------------------------------SS  1901
             ++NNL+GSIPSCL         P                                   S 
Sbjct  670   ADNNLSGSIPSCLQLDQSDSLAPDVPPVPNPLNPYYLPVRPMYFTTKRRSYSYQGKILSY  729

Query  1902  IKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFE  2081
             I  +  S ++L+G++     N++A+  L+LSYN F G IP     + ++ SL L+ N   
Sbjct  730   ISGIDFSCNKLTGEIPPEMGNHSAIYSLNLSYNRFTGPIPSTFSNLKQIESLDLSYNNLN  789

Query  2082  GKVPTQVCQLMRlslldlsnnllsGVIPRCLGKI------SLEGTNEQFRGINLP  2228
             G +P+Q+ +L  LS   +++N L G  P+  G+       S EG N    G+ LP
Sbjct  790   GDIPSQLLELKFLSYFSVAHNNLFGKTPKRTGQFATFEVSSYEG-NPNLCGLPLP  843



>ref|XP_011010638.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Populus euphratica]
Length=1555

 Score =   345 bits (885),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 275/732 (38%), Positives = 396/732 (54%), Gaps = 41/732 (6%)
 Frame = +3

Query  243   INDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNL  422
             + ++G    L+EL+   C  N ++    +G   L+IL L  NDF +  + I+ +  L +L
Sbjct  648   LQNIGALPALKELHAGYCDLNGTL--PAQGLRKLEILYLSSNDFKES-IFIESLGALPSL  704

Query  423   KELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKT  602
             K L+  ++ F+      ++S S    + + S L    L NI    T           +K 
Sbjct  705   KTLHARNSKFKHVGKGLSNSSSLEEVVLDGSSLPASFLRNIGHSST-----------LKV  753

Query  603   LELQRVNV-TNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGG  779
             L L  V+  + + A     N S+LEELHLD S+L  +FL NIG + +LK L      + G
Sbjct  754   LSLTTVDFHSTLPAQGTFFNSSTLEELHLDLSSLPLNFLQNIGALPALKELYAGSCDLNG  813

Query  780   TLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstlt  959
             TLP +G CELKNL+E+ LS N L+G +P   GNL+SLR ++LS N+L GNI  S LS LT
Sbjct  814   TLPAQGWCELKNLEEVDLSGNNLKGVLPPCLGNLSSLRSLDLSYNQLEGNIASSHLSHLT  873

Query  960   sleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNC  1139
              L YLS+ NN F+V  SF SF N S L+ I+ D N++IA    Q  VPKFQL     SNC
Sbjct  874   QLGYLSVSNNYFQVPISFGSFMNLSNLKFIVCDSNELIAAPSSQPLVPKFQLLLFRASNC  933

Query  1140  IDL---LKLPRFLHYQRDLKVLRISRNNLEGE-FPSWLLQNNTKLQYFLMNNNAFTGSLK  1307
                      P FLH Q DL V+ +S N   G+ FPSWL +NNTKL    + + + TG L+
Sbjct  934   TPKPLEAGFPNFLHSQHDLVVVDLSHNKFVGQPFPSWLFENNTKLNRLYLRDTSITGPLQ  993

Query  1308  LSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGF  1481
             L  H  P+LQ +++S+N + G+++ N  S FP +    +++N  +G +    G  + L +
Sbjct  994   LPQHPTPSLQTVDMSSNNIHGQVARNICSIFPRLKNFMMANNSLTGCIPPCFGNMSCLQY  1053

Query  1482  LDLSNNSFTGEIPKEMLISC-SSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEG  1658
             LDLSNN  + E+ +  L +  SSL  LKLSNN   G++      ++ L YL LDGN F  
Sbjct  1054  LDLSNNHMSCELLEHNLPTVGSSLWFLKLSNNSFNGRLPPSVFNMTDLHYLLLDGNKFVE  1113

Query  1659  TIpnslsnlplhslDIRDNKLSGEIPRWMG--RLTSLVQLTLSKNHLEGHIPIEFCNLKS  1832
                       L  LDI +N LSG +PR +G    T L  + LS+N  EG IPIE+ N  +
Sbjct  1114  VPGTFSLESSLLWLDISNNLLSGMLPRGIGNSSKTQLHGIDLSRNQFEGTIPIEYFNSSA  1173

Query  1833  LSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVG  2012
             L  LDLSENNL+GS+P   N +S+++V L  ++LSG L   F+N ++LV LDL  N+  G
Sbjct  1174  LQFLDLSENNLSGSLPLGFNATSLRYVHLYGNRLSGPLPYDFYNLSSLVTLDLGDNNLTG  1233

Query  2013  IIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLE  2192
              IP WI         +L  N+F GK+P Q+C L + S+LDLS N  SG++P CL  ++  
Sbjct  1234  PIPNWI---------VLKSNQFNGKLPHQLCLLRKFSILDLSENNFSGLLPSCLSNLNFT  1284

Query  2193  GTNEQ-FRGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPE------VQFRTK  2351
              ++E+ F           I   I   +      ++ + P   V + PE      V+  +K
Sbjct  1285  ASDEKTFDPPRTEMSDGGIQKDIFASIGGRELENEGFYPYEGV-LWPEISVKIAVELTSK  1343

Query  2352  GNLYNYQNSILK  2387
              N Y Y+  IL+
Sbjct  1344  KNFYTYEGDILR  1355


 Score =   103 bits (257),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 186/723 (26%), Positives = 304/723 (42%), Gaps = 139/723 (19%)
 Frame = +3

Query  192   SLKVLDIGFNKFQSFGPINDVG-GAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDN  368
             +LKVL +    F S  P       +  LEEL+L       +  Q++   P+LK L     
Sbjct  750   TLKVLSLTTVDFHSTLPAQGTFFNSSTLEELHLDLSSLPLNFLQNIGALPALKELYAGSC  809

Query  369   DFYDGPLHIQDINDLRNLKELYLSDNYFEGF-------------------ETSANHSGSS  491
             D  +G L  Q   +L+NL+E+ LS N  +G                    +   N + S 
Sbjct  810   DL-NGTLPAQGWCELKNLEEVDLSGNNLKGVLPPCLGNLSSLRSLDLSYNQLEGNIASSH  868

Query  492   RHTIRNKSYLEV--------------LHLNNISF---DMTKLLSSLAAFPSIKTLELQRV  620
                +    YL V              ++L+N+ F   D  +L+++ ++ P +   +L   
Sbjct  869   LSHLTQLGYLSVSNNYFQVPISFGSFMNLSNLKFIVCDSNELIAAPSSQPLVPKFQLLLF  928

Query  621   NVTN----------------------IDAIH-----------ALKNLSSLEELHLDGSNL  701
               +N                      +D  H             +N + L  L+L  +++
Sbjct  929   RASNCTPKPLEAGFPNFLHSQHDLVVVDLSHNKFVGQPFPSWLFENNTKLNRLYLRDTSI  988

Query  702   HKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGN  878
                      P  SL+ + +S   + G +  + +C +   L+   ++ N L G IP  FGN
Sbjct  989   TGPLQLPQHPTPSLQTVDMSSNNIHGQVA-RNICSIFPRLKNFMMANNSLTGCIPPCFGN  1047

Query  879   LTSLRYVNLSLNKLSGNIelsplstltsley-lsIMNNSFEVASSFRSFANNSKLRVILA  1055
             ++ L+Y++LS N +S  +    L T+ S  + L + NNSF        F N + L  +L 
Sbjct  1048  MSCLQYLDLSNNHMSCELLEHNLPTVGSSLWFLKLSNNSFNGRLPPSVF-NMTDLHYLLL  1106

Query  1056  DRNKVIADTQLQGFVP-KFQLDS----LSLSNCIDLLKLPRFL--HYQRDLKVLRISRNN  1214
             D NK +        VP  F L+S    L +SN +    LPR +    +  L  + +SRN 
Sbjct  1107  DGNKFVE-------VPGTFSLESSLLWLDISNNLLSGMLPRGIGNSSKTQLHGIDLSRNQ  1159

Query  1215  LEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNF--  1388
              EG  P     N++ LQ+  ++ N  +GSL L  +   +L+ +++  N+L G +  +F  
Sbjct  1160  FEGTIPIEYF-NSSALQFLDLSENNLSGSLPLGFNAT-SLRYVHLYGNRLSGPLPYDFYN  1217

Query  1389  --------------SSSFPNILALNLSSNLFSGQL-HSL-IGTHLGFLDLSNNSFTGEIP  1520
                           +   PN + L   SN F+G+L H L +      LDLS N+F+G +P
Sbjct  1218  LSSLVTLDLGDNNLTGPIPNWIVLK--SNQFNGKLPHQLCLLRKFSILDLSENNFSGLLP  1275

Query  1521  KEMLISCSSLVILKLSNNKL---------EGQIVQEFDYLSSLEYLHLDGNNF---EGTI  1664
                  SC S +    S+ K          +G I +  D  +S+    L+   F   EG +
Sbjct  1276  -----SCLSNLNFTASDEKTFDPPRTEMSDGGIQK--DIFASIGGRELENEGFYPYEGVL  1328

Query  1665  pnslsnlplhslDIRDN--KLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLS  1838
                +S      L  + N     G+I R+M        + LS N   G IP E+ NL  + 
Sbjct  1329  WPEISVKIAVELTSKKNFYTYEGDILRYMS------VMDLSCNRFTGQIPTEWGNLSGIY  1382

Query  1839  ILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGI  2015
              L+LS+NNLTG IP    N   I+ + LS + L+G++       T L + ++SYN+  G 
Sbjct  1383  SLNLSQNNLTGLIPPSFSNLKQIESLDLSHNNLNGRIPSQLVELTFLAVFNVSYNNLSGR  1442

Query  2016  IPE  2024
              PE
Sbjct  1443  TPE  1445


 Score =   102 bits (254),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 216/753 (29%), Positives = 321/753 (43%), Gaps = 135/753 (18%)
 Frame = +3

Query  213   GFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLH  392
             G N FQ         G + LEELYL + + N S+  SL GF +L                
Sbjct  475   GINSFQVL-----ASGLRNLEELYLSDNKLNDSVLSSLSGFSTL----------------  513

Query  393   IQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLS  572
                       K L LS N F G         +  + +R    LE+L+L +  F  + L+ 
Sbjct  514   ----------KSLDLSSNRFTG--------STGLNGLRK---LEILYLESSDFKESILIE  552

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
             SL A PS+KTL        +      L N SSLEE+ L  S+L   FL NIG   +LKVL
Sbjct  553   SLGALPSLKTLHASSSTFKHFG--KGLSNSSSLEEVFLGSSSLPAGFLRNIGHWSTLKVL  610

Query  753   SLSGAQVGGTLPNKG-LCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGN  929
             SL G  +  TLP +G       L+EL+L    L        G L +L+ ++     L+G 
Sbjct  611   SLPGVDLRSTLPAEGTFFNSSTLEELYLDYISLPLNFLQNIGALPALKELHAGYCDLNGT  670

Query  930   IelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKF  1109
             +   P   L  LE L + +N F+ +    S      L+ + A  +K          V K 
Sbjct  671   L---PAQGLRKLEILYLSSNDFKESIFIESLGALPSLKTLHARNSKF-------KHVGKG  720

Query  1110  QLDSLSLSNCI-DLLKLP----RFLHYQRDLKVLRISRNNLEGEFPSW-LLQNNTKLQY-  1268
               +S SL   + D   LP    R + +   LKVL ++  +     P+     N++ L+  
Sbjct  721   LSNSSSLEEVVLDGSSLPASFLRNIGHSSTLKVLSLTTVDFHSTLPAQGTFFNSSTLEEL  780

Query  1269  ----------FLMNNNA-------FTGSLKLSSHVNP-------NLQIINVSNNKLCGEI  1376
                       FL N  A       + GS  L+  +         NL+ +++S N L G +
Sbjct  781   HLDLSSLPLNFLQNIGALPALKELYAGSCDLNGTLPAQGWCELKNLEEVDLSGNNLKGVL  840

Query  1377  S---GNFSSSFPNILALN-LSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCS  1544
                 GN SS     L+ N L  N+ S  L  L  T LG+L +SNN F   I     ++ S
Sbjct  841   PPCLGNLSSLRSLDLSYNQLEGNIASSHLSHL--TQLGYLSVSNNYFQVPISFGSFMNLS  898

Query  1545  SLVILKLSNNKLEGQ-----IVQEFDYL---------SSLE-----YLH---------LD  1640
             +L  +   +N+L        +V +F  L           LE     +LH         L 
Sbjct  899   NLKFIVCDSNELIAAPSSQPLVPKFQLLLFRASNCTPKPLEAGFPNFLHSQHDLVVVDLS  958

Query  1641  GNNFEGTIpnslsnlplhslD---IRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPI  1811
              N F G    S        L+   +RD  ++G +        SL  + +S N++ G +  
Sbjct  959   HNKFVGQPFPSWLFENNTKLNRLYLRDTSITGPLQLPQHPTPSLQTVDMSSNNIHGQVAR  1018

Query  1812  EFCNL-KSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQLTRAFFNN--TALV  1979
               C++   L    ++ N+LTG IP C  N S ++++ LS + +S +L         ++L 
Sbjct  1019  NICSIFPRLKNFMMANNSLTGCIPPCFGNMSCLQYLDLSNNHMSCELLEHNLPTVGSSLW  1078

Query  1980  ILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGV  2159
              L LS NSF G +P  +  ++ L  LLL+GN+F  +VP        L  LD+SNNLLSG+
Sbjct  1079  FLKLSNNSFNGRLPPSVFNMTDLHYLLLDGNKFV-EVPGTFSLESSLLWLDISNNLLSGM  1137

Query  2160  IPRCLG---KISLEG---TNEQFRGINLPFEYY  2240
             +PR +G   K  L G   +  QF G  +P EY+
Sbjct  1138  LPRGIGNSSKTQLHGIDLSRNQFEGT-IPIEYF  1169



>ref|XP_006601721.1| PREDICTED: disease resistance protein isoform X1 [Glycine max]
Length=1234

 Score =   342 bits (878),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 284/724 (39%), Positives = 405/724 (56%), Gaps = 30/724 (4%)
 Frame = +3

Query  60    LNSHLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFG  239
             L+S L+   N   T    L+EL +R  ++    + S+  L+    LK L + +N+ +   
Sbjct  265   LDSDLHFQENGGFTWPTGLQELDLRENRLNNKFLPSLNGLE---CLKYLGLRWNQLEGSL  321

Query  240   PINDVGG---AKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDIND  410
              I+  GG      L+ L L E R N     SL G   LK L L  N   +G L+I  ++ 
Sbjct  322   NISGNGGFTWPTGLQALDLRENRLNNKFLPSLNGLECLKYLGLSSNQL-EGSLNISGLSG  380

Query  411   LRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFP  590
             L +L+ L LS N    F     H G     +++   L+ LHL     D +KL  SL AF 
Sbjct  381   LTSLEILNLSYNNISDFVV---HQG-----LKSLRRLDALHLYGNMIDGSKLRKSLRAFS  432

Query  591   SIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSN-LHKDFLSNIGPMESLKVLSLSGA  767
             S++ L +              ++LS+LEEL +D SN +  +F  +IG + SLKVLSL   
Sbjct  433   SVRMLSMGENEFKGTIVAGDFQDLSNLEELTMDLSNNMENEFFKSIGKLTSLKVLSLYHC  492

Query  768   QVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspl  947
              + GTLP+    +LK L+ L LS N+ EG +PS F N+TSL+ + +S N   GN + +  
Sbjct  493   NINGTLPHADWSKLKKLELLDLSGNKFEGPLPSSFVNMTSLQKLEISYNHFIGNFDSNIA  552

Query  948   stltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQ--LQGFVPKFQLDS  1121
             S  +   +  I  N FEV  SF  FAN+SK++ I  + NKV  D+Q     ++PKFQL  
Sbjct  553   SLTSLEYFGFI-ENQFEVPVSFTPFANHSKIKFIHGEGNKVSLDSQHSFPTWIPKFQLQE  611

Query  1122  LSLSNCID--LLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
             L +S+      L LP FL YQ  L  L  S   LEG+FP WLL+NNTK+ + L  N +FT
Sbjct  612   LIVSSTTKTMFLPLPNFLLYQNSLITLDFSSWKLEGDFPHWLLENNTKMTHVLFRNCSFT  671

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEI-SGNFSSSFPNILALNLSSNLFSGQLHSLIG--  1466
             G+ +L     PN+  I+VS+N + G+I S NFSS +PN+  LNLS N   G +   +G  
Sbjct  672   GTFQLPMRPLPNIWEIDVSDNIIVGQIPSNNFSSIYPNLHFLNLSRNNIQGSIPHELGQM  731

Query  1467  THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGN  1646
               L  LDLS N  +GEIPK++      L  LKLSNNKLEG I+   +  + LE L L+ N
Sbjct  732   NSLYSLDLSGNQLSGEIPKDIFGVGHQLRFLKLSNNKLEGPIL---NIPNGLETLLLNHN  788

Query  1647  NFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNL  1826
              F G +P+++ N  + SLD+++N L G+IP  +  L+ L ++ LS NH EG IP+E   L
Sbjct  789   RFTGRLPSNIFNASIISLDVKNNHLVGKIPSLIKNLSGLYEICLSNNHFEGSIPLELGEL  848

Query  1827  KSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSF  2006
             + L+ +DLS+NN  G +PS  N SS+  + L+ ++LSG   R F   ++LV+LDLSYN  
Sbjct  849   EDLTSVDLSQNNFIGLVPSFAN-SSVAFIHLNNNRLSGLPKRMFHGKSSLVMLDLSYNEI  907

Query  2007  VGIIPEWIGTIsrlss--lllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGK  2180
                + + I  +S      LLL GN F G +P Q+CQL+ L++LDLS+N  SGVIP+CLGK
Sbjct  908   SNNLQDLIHNLSYKRLNFLLLKGNHFMGDIPKQICQLIDLNMLDLSHNNFSGVIPKCLGK  967

Query  2181  ISLE  2192
             +  E
Sbjct  968   MPFE  971


 Score =   115 bits (287),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 222/764 (29%), Positives = 348/764 (46%), Gaps = 127/764 (17%)
 Frame = +3

Query  192   SLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPS-LKILDLMD-  365
             SL+VLDI  N     G ++ + G   L+ LYL +   N S F   +   S L+ L+++D 
Sbjct  124   SLEVLDISRNYLDDAGILSCLDGLSSLKSLYLRDIGLNTSSFHVFETLSSKLRYLEVLDV  183

Query  366   -NDFYDGPLHIQDINDLRNLKELYLSDNY-----FEGFETSANHSGSSRHTIRNKSYLEV  527
               ++ D    +  ++ L +LK LYL+DN      F  FET ++        +RN   LEV
Sbjct  184   SGNYLDDAGILSCLDGLSSLKSLYLADNKLNTSSFHVFETLSSK-------LRN---LEV  233

Query  528   LHLNNISFD--MTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKN-----LSSLEELHL  686
             L   +ISF+     +L SL  F S+K L L  +++ +   +H  +N      + L+EL L
Sbjct  234   L---DISFNYLTNDILPSLGGFTSLKRLYLAGIHLDS--DLHFQENGGFTWPTGLQELDL  288

Query  687   DGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTL---PNKGLCELKNLQELWLSENQLEGK  857
               + L+  FL ++  +E LK L L   Q+ G+L    N G      LQ L L EN+L  K
Sbjct  289   RENRLNNKFLPSLNGLECLKYLGLRWNQLEGSLNISGNGGFTWPTGLQALDLRENRLNNK  348

Query  858   IPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNS---FEVASSFRSFA-  1025
                    L  L+Y+ LS N+L G++ +S LS LTSLE L++  N+   F V    +S   
Sbjct  349   FLPSLNGLECLKYLGLSSNQLEGSLNISGLSGLTSLEILNLSYNNISDFVVHQGLKSLRR  408

Query  1026  -----------NNSKLRVILADRNKV----IADTQLQGFVPKFQLDSLS--------LSN  1136
                        + SKLR  L   + V    + + + +G +       LS        LSN
Sbjct  409   LDALHLYGNMIDGSKLRKSLRAFSSVRMLSMGENEFKGTIVAGDFQDLSNLEELTMDLSN  468

Query  1137  CIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSS  1316
              ++  +  + +     LKVL +   N+ G  P        KL+   ++ N F G L  SS
Sbjct  469   NME-NEFFKSIGKLTSLKVLSLYHCNINGTLPHADWSKLKKLELLDLSGNKFEGPLP-SS  526

Query  1317  HVN-PNLQIINVSNNKLCGEISGNFSS--------SFPNILALNLSSNLFSGQLHSLIGT  1469
              VN  +LQ + +S N   G    N +S           N   + +S   F+   HS I  
Sbjct  527   FVNMTSLQKLEISYNHFIGNFDSNIASLTSLEYFGFIENQFEVPVSFTPFAN--HSKIKF  584

Query  1470  HLG-----FLDLSNNSFTGEIPK----EMLISCS----------------SLVILKLSNN  1574
               G      LD S +SF   IPK    E+++S +                SL+ L  S+ 
Sbjct  585   IHGEGNKVSLD-SQHSFPTWIPKFQLQELIVSSTTKTMFLPLPNFLLYQNSLITLDFSSW  643

Query  1575  KLEGQIVQE-FDYLSSLEYLHLDGNNFEGTIpnslsnlp-lhslDIRDNKLSGEIPR--W  1742
             KLEG       +  + + ++     +F GT    +  LP +  +D+ DN + G+IP   +
Sbjct  644   KLEGDFPHWLLENNTKMTHVLFRNCSFTGTFQLPMRPLPNIWEIDVSDNIIVGQIPSNNF  703

Query  1743  MGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPS-------------  1883
                  +L  L LS+N+++G IP E   + SL  LDLS N L+G IP              
Sbjct  704   SSIYPNLHFLNLSRNNIQGSIPHELGQMNSLYSLDLSGNQLSGEIPKDIFGVGHQLRFLK  763

Query  1884  ---------CLN-PSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIG  2033
                       LN P+ ++ + L+ ++ +G+L    F N +++ LD+  N  VG IP  I 
Sbjct  764   LSNNKLEGPILNIPNGLETLLLNHNRFTGRLPSNIF-NASIISLDVKNNHLVGKIPSLIK  822

Query  2034  TIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIP  2165
              +S L  + L+ N FEG +P ++ +L  L+ +DLS N   G++P
Sbjct  823   NLSGLYEICLSNNHFEGSIPLELGELEDLTSVDLSQNNFIGLVP  866


 Score = 83.2 bits (204),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 192/742 (26%), Positives = 300/742 (40%), Gaps = 146/742 (20%)
 Frame = +3

Query  87    NERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAK  266
             ++ L  L  L+ LH+ Y  M + + L   +L+ F S+++L +G N+F+      D     
Sbjct  400   HQGLKSLRRLDALHL-YGNMIDGSKLRK-SLRAFSSVRMLSMGENEFKGTIVAGDFQDLS  457

Query  267   KLEELYL-FECRFNQSIFQSLKGFPSLKILDLMDNDF-----------------------  374
              LEEL +          F+S+    SLK+L L   +                        
Sbjct  458   NLEELTMDLSNNMENEFFKSIGKLTSLKVLSLYHCNINGTLPHADWSKLKKLELLDLSGN  517

Query  375   -YDGPLHIQDINDLRNLKELYLSDNYFEG-FE------TSANHSG---------SSRHTI  503
              ++GPL    +N + +L++L +S N+F G F+      TS  + G          S    
Sbjct  518   KFEGPLPSSFVN-MTSLQKLEISYNHFIGNFDSNIASLTSLEYFGFIENQFEVPVSFTPF  576

Query  504   RNKSYLEVLHL--NNISFDMTKLLSSLAAFPS-IKTLELQR--VNVTNIDAIHALKNL--  662
              N S ++ +H   N +S D      S  +FP+ I   +LQ   V+ T       L N   
Sbjct  577   ANHSKIKFIHGEGNKVSLD------SQHSFPTWIPKFQLQELIVSSTTKTMFLPLPNFLL  630

Query  663   --SSLEELHLDGSNLHKDF----LSN---------------------IGPMESLKVLSLS  761
               +SL  L      L  DF    L N                     + P+ ++  + +S
Sbjct  631   YQNSLITLDFSSWKLEGDFPHWLLENNTKMTHVLFRNCSFTGTFQLPMRPLPNIWEIDVS  690

Query  762   GAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
                + G +P+     +  NL  L LS N ++G IP   G + SL  ++LS N+LSG I  
Sbjct  691   DNIIVGQIPSNNFSSIYPNLHFLNLSRNNIQGSIPHELGQMNSLYSLDLSGNQLSGEIPK  750

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLD  1118
                     L +L + NN  E      +  N   L  +L + N+     +L   +    + 
Sbjct  751   DIFGVGHQLRFLKLSNNKLE--GPILNIPNG--LETLLLNHNRFTG--RLPSNIFNASII  804

Query  1119  SLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWL--LQNNTKLQYFLMNNNAF  1292
             SL + N   + K+P  +     L  + +S N+ EG  P  L  L++ T +    ++ N F
Sbjct  805   SLDVKNNHLVGKIPSLIKNLSGLYEICLSNNHFEGSIPLELGELEDLTSVD---LSQNNF  861

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--  1466
              G   + S  N ++  I+++NN+L G     F     +++ L+LS N  S  L  LI   
Sbjct  862   IG--LVPSFANSSVAFIHLNNNRLSGLPKRMFHGK-SSLVMLDLSYNEISNNLQDLIHNL  918

Query  1467  --THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ-------EFDYLSS  1619
                 L FL L  N F G+IPK+ +     L +L LS+N   G I +       E  YL S
Sbjct  919   SYKRLNFLLLKGNHFMGDIPKQ-ICQLIDLNMLDLSHNNFSGVIPKCLGKMPFENKYLKS  977

Query  1620  L----EYLHLDGNNFEGTIpnslsnl------------------------------plhs  1697
             L         D NN   +   + S                                 +  
Sbjct  978   LLARFSTFDPDPNNLAQSPDLAQSPTPVSGPTLNLQEKANFTTKERTDTYIGRVLFYMSG  1037

Query  1698  lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSI  1877
             +D+  NKL G IP  +G LT +  L LS N L G IP+ F  L     LDLS N L   I
Sbjct  1038  IDLSHNKLKGNIPFELGYLTKIRALNLSHNDLTGKIPVTFSLLAQTESLDLSFNMLNSQI  1097

Query  1878  PSCLNP-SSIKHVSLSKHQLSG  1940
             P  L+  +S++  S++ + LSG
Sbjct  1098  PPQLSMLTSLEVFSVAHNNLSG  1119


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 113/461 (25%), Positives = 187/461 (41%), Gaps = 70/461 (15%)
 Frame = +3

Query  579   AAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNI-GPMESLKVLS  755
             + +P++  L L R N+      H L  ++SL  L L G+ L  +   +I G    L+ L 
Sbjct  705   SIYPNLHFLNLSRNNIQG-SIPHELGQMNSLYSLDLSGNQLSGEIPKDIFGVGHQLRFLK  763

Query  756   LSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIe  935
             LS  ++ G + N        L+ L L+ N+  G++PS   N  S+  +++  N L G I 
Sbjct  764   LSNNKLEGPILNIP----NGLETLLLNHNRFTGRLPSNIFN-ASIISLDVKNNHLVGKIP  818

Query  936   lsplstltsleylsIMNNSFEVASSFRSFANNSKLRV-ILADRNKV-IADTQLQGFVPKF  1109
                 +          ++  +E+  S   F  +  L +  L D   V ++     G VP F
Sbjct  819   SLIKN----------LSGLYEICLSNNHFEGSIPLELGELEDLTSVDLSQNNFIGLVPSF  868

Query  1110  QLDSLSLS--NCIDLLKLP-RFLHYQRDLKVLRISRNNLEGEFPSWLLQNNT--KLQYFL  1274
                S++    N   L  LP R  H +  L +L +S N +       L+ N +  +L + L
Sbjct  869   ANSSVAFIHLNNNRLSGLPKRMFHGKSSLVMLDLSYNEISNNLQD-LIHNLSYKRLNFLL  927

Query  1275  MNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEIS-----------------GNFSSSFP  1403
             +  N F G +        +L ++++S+N   G I                    FS+  P
Sbjct  928   LKGNHFMGDIPKQICQLIDLNMLDLSHNNFSGVIPKCLGKMPFENKYLKSLLARFSTFDP  987

Query  1404  NILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVI--LKLSNNK  1577
             +   L  S +L +     + G  L   + +N  FT +   +  I      +  + LS+NK
Sbjct  988   DPNNLAQSPDL-AQSPTPVSGPTLNLQEKAN--FTTKERTDTYIGRVLFYMSGIDLSHNK  1044

Query  1578  LEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLT  1757
             L+G I  E  YL+ +  L+L  N+                       L+G+IP     L 
Sbjct  1045  LKGNIPFELGYLTKIRALNLSHND-----------------------LTGKIPVTFSLLA  1081

Query  1758  SLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP  1880
                 L LS N L   IP +   L SL +  ++ NNL+G  P
Sbjct  1082  QTESLDLSFNMLNSQIPPQLSMLTSLEVFSVAHNNLSGPTP  1122



>gb|KDO44366.1| hypothetical protein CISIN_1g042603mg, partial [Citrus sinensis]
Length=874

 Score =   336 bits (862),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 277/714 (39%), Positives = 380/714 (53%), Gaps = 60/714 (8%)
 Frame = +3

Query  270   LEELYLFECRFNQS-IFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDN  446
             LEEL L E   + S + QS+  F SLK L  M      G LH QD ++ +NL+       
Sbjct  7     LEELILVESDLHVSQLLQSIASFSSLKYLS-MRGCVLKGALHGQDFHEFKNLE-------  58

Query  447   YFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNV  626
                             H + ++  +EV    + SF   +++S   A   I +L   R+N 
Sbjct  59    ----------------HLVMDRMLVEV----DTSF--LQIVSESMASLRILSLSYSRLNK  96

Query  627   TNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCE  806
               I     L  L  L+EL++  ++L    L  +  M SL+VL+++  Q+ G  P  G CE
Sbjct  97    NTI-LDQGLCELVHLQELYIRDNDLRDSLLWCLANMTSLQVLNVASNQLTGNFP-PGFCE  154

Query  807   LKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMN  986
             L  L+EL++  N L G +P    NLTSLR +++S N+L+ NI  SPL  LTS+E L + N
Sbjct  155   LVLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELILSN  214

Query  987   NSFEVASSFRSFANNSKLRVILADRNKVIADTQ--LQGFVPKFQLDSLSLSNCIDLLKLP  1160
             N F++  S     N SKL+       ++ A+T+       PKFQL S+SLS   D    P
Sbjct  215   NHFQIPISLEPLFNLSKLKTF---NGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFP  271

Query  1161  RFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQI  1340
             +FL++Q DL    +S  NL GEFP+WL +NNT L+  L+ NN+  GS ++  H    L  
Sbjct  272   KFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLAT  331

Query  1341  INVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGE  1514
             ++VSNN   G I     +  P ++ LNLS N F+G + S       L  LD+S N  TG 
Sbjct  332   LDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGA  391

Query  1515  IPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplh  1694
             IP+ M + C SL IL LSNN L+G I  E   L++L+ L LDGN F G IP SLS   L 
Sbjct  392   IPERMAMGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYLL  451

Query  1695  s-lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTG  1871
               L + DN LSG+IPRW+G L +L  + +  N+LEG IP EFC L  L +LDLS N++ G
Sbjct  452   GGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFG  511

Query  1872  SIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrls  2051
             ++PSCL+  SI+ V LSK+++ GQL         LV LDLSYN   G IP WI  + +LS
Sbjct  512   TLPSCLSLGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQLS  571

Query  2052  slllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISL-EGTNEQFRGINLP  2228
              +LL  N  EG++P Q+CQL  + L+DLS+N LSG IP CL   +L EG           
Sbjct  572   YILLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIPPCLVNTALSEG-----------  620

Query  2229  FEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPE--VQFRTKGNLYNYQNSIL  2384
               YY   DA+     +       Y P     +  E  VQF TK   Y Y+  IL
Sbjct  621   --YY---DAVAPTWDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRIL  669


 Score =   127 bits (319),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 187/718 (26%), Positives = 316/718 (44%), Gaps = 84/718 (12%)
 Frame = +3

Query  87    NERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQS-FGPINDVGGA  263
             ++ L  L++L+EL++R   + +  +  + N+    SL+VL++  N+    F P       
Sbjct  101   DQGLCELVHLQELYIRDNDLRDSLLWCLANMT---SLQVLNVASNQLTGNFPP--GFCEL  155

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
               L ELY+       S+   L    SL++LD+  N   +  +    +  L +++EL LS+
Sbjct  156   VLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTEN-ISSSPLMHLTSIEELILSN  214

Query  444   NYFE-GFETSANHSGSSRHTIRNKSYLEV-LHLNNIS--FDMTKL-LSSLAAFPSIKTLE  608
             N+F+         + S   T   + Y E   H N+++  F +T + LS      +     
Sbjct  215   NHFQIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFL  274

Query  609   LQRVNVTNIDAIHA----------LKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSL  758
               + ++ N D  H            +N + L+ L L  ++L   F   I  ++ L  L +
Sbjct  275   YHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDV  334

Query  759   SGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
             S     G +P +    L  L  L LS N   G IPS F ++  L+ +++S N+L+G I  
Sbjct  335   SNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGAIPE  394

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLD  1118
                    SLE L++ NN+ +    F    N + L+ +  D NK I +   +     + L 
Sbjct  395   RMAMGCFSLEILALSNNTLQ-GHIFSEKFNLTNLKRLQLDGNKFIGEIP-ESLSKCYLLG  452

Query  1119  SLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTG  1298
              L LS+     K+PR+L     L+ + +  NNLEG  P+   Q +  L+   ++NN+  G
Sbjct  453   GLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDC-LKVLDLSNNSIFG  511

Query  1299  SLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--TH  1472
             +L     +  +++ +++S NK+ G++  +    +P ++ L+LS N   G + + I     
Sbjct  512   TLPSCLSLG-SIEQVHLSKNKIEGQLE-SIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQ  569

Query  1473  LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI-----------------VQE  1601
             L ++ L+NN   GEIP + L     + ++ LS+N L G I                    
Sbjct  570   LSYILLANNYIEGEIPVQ-LCQLKEVRLIDLSHNNLSGHIPPCLVNTALSEGYYDAVAPT  628

Query  1602  FDYLSS--LEYLHLDGNNF--EGTIpnsls----------nlplhslDIRDNKLSGEIPR  1739
             +D+ S+  L Y   +G+    E T+  +               +  +D+  NKL+GEIP 
Sbjct  629   WDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPT  688

Query  1740  WMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSL  1919
              +G LT +  L LS N+L G IP  F NLK +  LDLS N L G IP  L          
Sbjct  689   QIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQL----------  738

Query  1920  SKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
                            NT L +  ++YN+  G IP+ +   S        GN F   +P
Sbjct  739   ------------IVLNT-LAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCGLP  783



>ref|XP_006601724.1| PREDICTED: disease resistance protein isoform X4 [Glycine max]
Length=1181

 Score =   342 bits (876),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 284/724 (39%), Positives = 405/724 (56%), Gaps = 30/724 (4%)
 Frame = +3

Query  60    LNSHLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFG  239
             L+S L+   N   T    L+EL +R  ++    + S+  L+    LK L + +N+ +   
Sbjct  212   LDSDLHFQENGGFTWPTGLQELDLRENRLNNKFLPSLNGLE---CLKYLGLRWNQLEGSL  268

Query  240   PINDVGG---AKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDIND  410
              I+  GG      L+ L L E R N     SL G   LK L L  N   +G L+I  ++ 
Sbjct  269   NISGNGGFTWPTGLQALDLRENRLNNKFLPSLNGLECLKYLGLSSNQL-EGSLNISGLSG  327

Query  411   LRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFP  590
             L +L+ L LS N    F     H G     +++   L+ LHL     D +KL  SL AF 
Sbjct  328   LTSLEILNLSYNNISDFVV---HQG-----LKSLRRLDALHLYGNMIDGSKLRKSLRAFS  379

Query  591   SIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSN-LHKDFLSNIGPMESLKVLSLSGA  767
             S++ L +              ++LS+LEEL +D SN +  +F  +IG + SLKVLSL   
Sbjct  380   SVRMLSMGENEFKGTIVAGDFQDLSNLEELTMDLSNNMENEFFKSIGKLTSLKVLSLYHC  439

Query  768   QVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspl  947
              + GTLP+    +LK L+ L LS N+ EG +PS F N+TSL+ + +S N   GN + +  
Sbjct  440   NINGTLPHADWSKLKKLELLDLSGNKFEGPLPSSFVNMTSLQKLEISYNHFIGNFDSNIA  499

Query  948   stltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQ--LQGFVPKFQLDS  1121
             S  +   +  I  N FEV  SF  FAN+SK++ I  + NKV  D+Q     ++PKFQL  
Sbjct  500   SLTSLEYFGFI-ENQFEVPVSFTPFANHSKIKFIHGEGNKVSLDSQHSFPTWIPKFQLQE  558

Query  1122  LSLSNCID--LLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
             L +S+      L LP FL YQ  L  L  S   LEG+FP WLL+NNTK+ + L  N +FT
Sbjct  559   LIVSSTTKTMFLPLPNFLLYQNSLITLDFSSWKLEGDFPHWLLENNTKMTHVLFRNCSFT  618

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEI-SGNFSSSFPNILALNLSSNLFSGQLHSLIG--  1466
             G+ +L     PN+  I+VS+N + G+I S NFSS +PN+  LNLS N   G +   +G  
Sbjct  619   GTFQLPMRPLPNIWEIDVSDNIIVGQIPSNNFSSIYPNLHFLNLSRNNIQGSIPHELGQM  678

Query  1467  THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGN  1646
               L  LDLS N  +GEIPK++      L  LKLSNNKLEG I+   +  + LE L L+ N
Sbjct  679   NSLYSLDLSGNQLSGEIPKDIFGVGHQLRFLKLSNNKLEGPIL---NIPNGLETLLLNHN  735

Query  1647  NFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNL  1826
              F G +P+++ N  + SLD+++N L G+IP  +  L+ L ++ LS NH EG IP+E   L
Sbjct  736   RFTGRLPSNIFNASIISLDVKNNHLVGKIPSLIKNLSGLYEICLSNNHFEGSIPLELGEL  795

Query  1827  KSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSF  2006
             + L+ +DLS+NN  G +PS  N SS+  + L+ ++LSG   R F   ++LV+LDLSYN  
Sbjct  796   EDLTSVDLSQNNFIGLVPSFAN-SSVAFIHLNNNRLSGLPKRMFHGKSSLVMLDLSYNEI  854

Query  2007  VGIIPEWIGTIsrlss--lllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGK  2180
                + + I  +S      LLL GN F G +P Q+CQL+ L++LDLS+N  SGVIP+CLGK
Sbjct  855   SNNLQDLIHNLSYKRLNFLLLKGNHFMGDIPKQICQLIDLNMLDLSHNNFSGVIPKCLGK  914

Query  2181  ISLE  2192
             +  E
Sbjct  915   MPFE  918


 Score = 82.8 bits (203),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 192/742 (26%), Positives = 300/742 (40%), Gaps = 146/742 (20%)
 Frame = +3

Query  87    NERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAK  266
             ++ L  L  L+ LH+ Y  M + + L   +L+ F S+++L +G N+F+      D     
Sbjct  347   HQGLKSLRRLDALHL-YGNMIDGSKLRK-SLRAFSSVRMLSMGENEFKGTIVAGDFQDLS  404

Query  267   KLEELYL-FECRFNQSIFQSLKGFPSLKILDLMDNDF-----------------------  374
              LEEL +          F+S+    SLK+L L   +                        
Sbjct  405   NLEELTMDLSNNMENEFFKSIGKLTSLKVLSLYHCNINGTLPHADWSKLKKLELLDLSGN  464

Query  375   -YDGPLHIQDINDLRNLKELYLSDNYFEG-FE------TSANHSG---------SSRHTI  503
              ++GPL    +N + +L++L +S N+F G F+      TS  + G          S    
Sbjct  465   KFEGPLPSSFVN-MTSLQKLEISYNHFIGNFDSNIASLTSLEYFGFIENQFEVPVSFTPF  523

Query  504   RNKSYLEVLHL--NNISFDMTKLLSSLAAFPS-IKTLELQR--VNVTNIDAIHALKNL--  662
              N S ++ +H   N +S D      S  +FP+ I   +LQ   V+ T       L N   
Sbjct  524   ANHSKIKFIHGEGNKVSLD------SQHSFPTWIPKFQLQELIVSSTTKTMFLPLPNFLL  577

Query  663   --SSLEELHLDGSNLHKDF----LSN---------------------IGPMESLKVLSLS  761
               +SL  L      L  DF    L N                     + P+ ++  + +S
Sbjct  578   YQNSLITLDFSSWKLEGDFPHWLLENNTKMTHVLFRNCSFTGTFQLPMRPLPNIWEIDVS  637

Query  762   GAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
                + G +P+     +  NL  L LS N ++G IP   G + SL  ++LS N+LSG I  
Sbjct  638   DNIIVGQIPSNNFSSIYPNLHFLNLSRNNIQGSIPHELGQMNSLYSLDLSGNQLSGEIPK  697

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLD  1118
                     L +L + NN  E      +  N   L  +L + N+     +L   +    + 
Sbjct  698   DIFGVGHQLRFLKLSNNKLE--GPILNIPNG--LETLLLNHNRFTG--RLPSNIFNASII  751

Query  1119  SLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWL--LQNNTKLQYFLMNNNAF  1292
             SL + N   + K+P  +     L  + +S N+ EG  P  L  L++ T +    ++ N F
Sbjct  752   SLDVKNNHLVGKIPSLIKNLSGLYEICLSNNHFEGSIPLELGELEDLTSVD---LSQNNF  808

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--  1466
              G   + S  N ++  I+++NN+L G     F     +++ L+LS N  S  L  LI   
Sbjct  809   IG--LVPSFANSSVAFIHLNNNRLSGLPKRMFHGK-SSLVMLDLSYNEISNNLQDLIHNL  865

Query  1467  --THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ-------EFDYLSS  1619
                 L FL L  N F G+IPK+ +     L +L LS+N   G I +       E  YL S
Sbjct  866   SYKRLNFLLLKGNHFMGDIPKQ-ICQLIDLNMLDLSHNNFSGVIPKCLGKMPFENKYLKS  924

Query  1620  L----EYLHLDGNNFEGTIpnslsnl------------------------------plhs  1697
             L         D NN   +   + S                                 +  
Sbjct  925   LLARFSTFDPDPNNLAQSPDLAQSPTPVSGPTLNLQEKANFTTKERTDTYIGRVLFYMSG  984

Query  1698  lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSI  1877
             +D+  NKL G IP  +G LT +  L LS N L G IP+ F  L     LDLS N L   I
Sbjct  985   IDLSHNKLKGNIPFELGYLTKIRALNLSHNDLTGKIPVTFSLLAQTESLDLSFNMLNSQI  1044

Query  1878  PSCLNP-SSIKHVSLSKHQLSG  1940
             P  L+  +S++  S++ + LSG
Sbjct  1045  PPQLSMLTSLEVFSVAHNNLSG  1066


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 113/461 (25%), Positives = 187/461 (41%), Gaps = 70/461 (15%)
 Frame = +3

Query  579   AAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNI-GPMESLKVLS  755
             + +P++  L L R N+      H L  ++SL  L L G+ L  +   +I G    L+ L 
Sbjct  652   SIYPNLHFLNLSRNNIQG-SIPHELGQMNSLYSLDLSGNQLSGEIPKDIFGVGHQLRFLK  710

Query  756   LSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIe  935
             LS  ++ G + N        L+ L L+ N+  G++PS   N  S+  +++  N L G I 
Sbjct  711   LSNNKLEGPILNIP----NGLETLLLNHNRFTGRLPSNIFN-ASIISLDVKNNHLVGKIP  765

Query  936   lsplstltsleylsIMNNSFEVASSFRSFANNSKLRV-ILADRNKV-IADTQLQGFVPKF  1109
                 +          ++  +E+  S   F  +  L +  L D   V ++     G VP F
Sbjct  766   SLIKN----------LSGLYEICLSNNHFEGSIPLELGELEDLTSVDLSQNNFIGLVPSF  815

Query  1110  QLDSLSLS--NCIDLLKLP-RFLHYQRDLKVLRISRNNLEGEFPSWLLQNNT--KLQYFL  1274
                S++    N   L  LP R  H +  L +L +S N +       L+ N +  +L + L
Sbjct  816   ANSSVAFIHLNNNRLSGLPKRMFHGKSSLVMLDLSYNEISNNLQD-LIHNLSYKRLNFLL  874

Query  1275  MNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEIS-----------------GNFSSSFP  1403
             +  N F G +        +L ++++S+N   G I                    FS+  P
Sbjct  875   LKGNHFMGDIPKQICQLIDLNMLDLSHNNFSGVIPKCLGKMPFENKYLKSLLARFSTFDP  934

Query  1404  NILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVI--LKLSNNK  1577
             +   L  S +L +     + G  L   + +N  FT +   +  I      +  + LS+NK
Sbjct  935   DPNNLAQSPDL-AQSPTPVSGPTLNLQEKAN--FTTKERTDTYIGRVLFYMSGIDLSHNK  991

Query  1578  LEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLT  1757
             L+G I  E  YL+ +  L+L  N+                       L+G+IP     L 
Sbjct  992   LKGNIPFELGYLTKIRALNLSHND-----------------------LTGKIPVTFSLLA  1028

Query  1758  SLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP  1880
                 L LS N L   IP +   L SL +  ++ NNL+G  P
Sbjct  1029  QTESLDLSFNMLNSQIPPQLSMLTSLEVFSVAHNNLSGPTP  1069



>ref|XP_006382382.1| hypothetical protein POPTR_0005s01610g [Populus trichocarpa]
 gb|ERP60179.1| hypothetical protein POPTR_0005s01610g [Populus trichocarpa]
Length=977

 Score =   338 bits (867),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 278/740 (38%), Positives = 398/740 (54%), Gaps = 75/740 (10%)
 Frame = +3

Query  252   VGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKEL  431
               G + L+ELYL + +FN SI  SL GF +LK                           L
Sbjct  85    ASGLRNLKELYLNDNKFNDSILTSLSGFSTLK--------------------------SL  118

Query  432   YLSDNYF------EGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPS  593
             YLS+N F      +GF+  A  SG     +RN   L+ L  N ++     +LSSL+ F +
Sbjct  119   YLSNNRFTVTIDLKGFQVLA--SG-----LRNLEQLD-LSYNKLN---DSVLSSLSGFST  167

Query  594   IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFL-SNIGPMESLKVLSLSGAQ  770
             +K L+L     T    ++ L+    LE L+LD ++  +  L  ++G + SLK L    ++
Sbjct  168   LKFLDLSNNRFTGSTGLNGLR---KLETLYLDSTDFKESILIESLGALPSLKTLHARYSR  224

Query  771   VGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
                T   KG CELKNL+ L+LS N L+G +P  FGNL+SL+ ++LS N+L GNI  S +S
Sbjct  225   F--THFGKGWCELKNLEHLFLSGNNLKGVLPPCFGNLSSLQILDLSYNQLEGNIAFSHIS  282

Query  951   tltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSL  1130
              LT LEYLS+ NN F+V  SF SF N+S L+    D N++IA    Q  VPKF+L   S 
Sbjct  283   HLTQLEYLSVSNNYFQVPISFGSFMNHSNLKFFECDNNELIAAPSFQPLVPKFRLRVFSA  342

Query  1131  SNCIDL---LKLPRFLHYQRDLKVLRISRNNLEGE-FPSWLLQNNTKLQYFLMNNNAFTG  1298
             SNC         P FL  Q DL  + +S N   GE FPSWL +NNTKL    + + +F G
Sbjct  343   SNCTPKPLEAGFPNFLQSQYDLVFVDLSHNKFVGESFPSWLFENNTKLNRLYLRDTSFIG  402

Query  1299  SLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--TH  1472
              L+L  H  PNLQ +++S N + G+I+ N  S FP +    +++N  +G +    G  + 
Sbjct  403   PLQLPQHPTPNLQTVDMSGNSIHGQIARNICSIFPRLKNFMMANNSLTGCIPPCFGNMSS  462

Query  1473  LGFLDLSNNSFTGEIPKEMLISC-SSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN  1649
             L +LDLSNN  + E+ +  L +  SSL  LKLSNN  +G++      ++SLEYL LDGN 
Sbjct  463   LEYLDLSNNHMSCELLEHNLPTVGSSLWSLKLSNNNFKGRLPLSVFNMTSLEYLFLDGNK  522

Query  1650  FEGTIp-nslsnlplhslDIRDNKLSGEIPRWMG--RLTSLVQLTLSKNHLEGHIPIEFC  1820
             F G +             DI +N LSG +PR +G   +     + LS+NH EG IP E+ 
Sbjct  523   FAGQVSGTFSLASSFSWFDISNNLLSGMLPRGIGNSSIYRFQAIDLSRNHFEGTIPKEYF  582

Query  1821  NLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYN  2000
             N   L  LDLSENNL+GS+P       ++HV L  ++L+G L  AF+N ++LV LDL YN
Sbjct  583   NSYWLEFLDLSENNLSGSLPLGFLAPHLRHVHLYGNRLTGPLPNAFYNISSLVTLDLGYN  642

Query  2001  SFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGK  2180
             +  G IP WI ++S LS LLL  N+F G++P Q+C L +LS+LDLS N  SG++P CL  
Sbjct  643   NLTGPIPNWIASLSELSILLLKSNQFNGELPVQLCLLRKLSILDLSENNFSGLLPSCLSN  702

Query  2181  ISLEGTNEQFRGINLPFEYYSINDAILDRLHY-----EWGSDDEYI------PMLAVDVL  2327
             +      E +    +     S +D     +       E G++  Y+      P ++V + 
Sbjct  703   LDF---TESYEKTLVHTSTESRDDGSRKEIFASIGGRELGNEGFYLFDKILWPEISVKI-  758

Query  2328  PEVQFRTKGNLYNYQNSILK  2387
               V+  +K N Y Y+  IL+
Sbjct  759   -SVELTSKKNFYTYEGDILR  777


 Score =   109 bits (272),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 201/802 (25%), Positives = 314/802 (39%), Gaps = 183/802 (23%)
 Frame = +3

Query  99    TGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEE  278
             +GL NLE+L + Y ++ + ++LS  +L  F +LK LD+  N+F     +N   G +KLE 
Sbjct  139   SGLRNLEQLDLSYNKLND-SVLS--SLSGFSTLKFLDLSNNRFTGSTGLN---GLRKLET  192

Query  279   LYLFECRFNQSIF-QSLKGFPSLK------------------------------------  347
             LYL    F +SI  +SL   PSLK                                    
Sbjct  193   LYLDSTDFKESILIESLGALPSLKTLHARYSRFTHFGKGWCELKNLEHLFLSGNNLKGVL  252

Query  348   -----------ILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---GFETSANHS-  482
                        ILDL  N   +G +    I+ L  L+ L +S+NYF+    F +  NHS 
Sbjct  253   PPCFGNLSSLQILDLSYNQL-EGNIAFSHISHLTQLEYLSVSNNYFQVPISFGSFMNHSN  311

Query  483   -------------GSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVN  623
                            S   +  K  L V   +N +    K L   A FP+       + +
Sbjct  312   LKFFECDNNELIAAPSFQPLVPKFRLRVFSASNCT---PKPLE--AGFPNFLQ---SQYD  363

Query  624   VTNIDAIH-----------ALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQ  770
             +  +D  H             +N + L  L+L  ++          P  +L+ + +SG  
Sbjct  364   LVFVDLSHNKFVGESFPSWLFENNTKLNRLYLRDTSFIGPLQLPQHPTPNLQTVDMSGNS  423

Query  771   VGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
             + G +          L+   ++ N L G IP  FGN++SL Y++LS N +S  +    L 
Sbjct  424   IHGQIARNICSIFPRLKNFMMANNSLTGCIPPCFGNMSSLEYLDLSNNHMSCELLEHNLP  483

Query  951   tl-tsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQG-FVPKFQLDSL  1124
             T+ +SL  L + NN+F+       F N + L  +  D NK     Q+ G F         
Sbjct  484   TVGSSLWSLKLSNNNFKGRLPLSVF-NMTSLEYLFLDGNKFAG--QVSGTFSLASSFSWF  540

Query  1125  SLSNCIDLLKLPRFLHYQR--DLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTG  1298
              +SN +    LPR +        + + +SRN+ EG  P     N+  L++  ++ N  +G
Sbjct  541   DISNNLLSGMLPRGIGNSSIYRFQAIDLSRNHFEGTIPKEYF-NSYWLEFLDLSENNLSG  599

Query  1299  SLKLSSHVNPNLQIINVSNNKLCGEISGNF----------------SSSFPNILALNLSS  1430
             SL L   + P+L+ +++  N+L G +   F                +   PN +A     
Sbjct  600   SLPLG-FLAPHLRHVHLYGNRLTGPLPNAFYNISSLVTLDLGYNNLTGPIPNWIASLSEL  658

Query  1431  -------NLFSGQL--HSLIGTHLGFLDLSNNSFTGEIPK-----EMLISCSSLVILKLS  1568
                    N F+G+L     +   L  LDLS N+F+G +P      +   S    ++   +
Sbjct  659   SILLLKSNQFNGELPVQLCLLRKLSILDLSENNFSGLLPSCLSNLDFTESYEKTLVHTST  718

Query  1569  NNKLEGQIVQEFDYLSSLE------YLH----------------LDGNNF---EGTIpns  1673
              ++ +G   + F  +   E      YL                     NF   EG I   
Sbjct  719   ESRDDGSRKEIFASIGGRELGNEGFYLFDKILWPEISVKISVELTSKKNFYTYEGDILRY  778

Query  1674  lsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLS  1853
             +S +     D+  N+ +GEIP   G L+ +  L LS+N+  G IP  F NLK +  LDLS
Sbjct  779   MSVM-----DLSCNRFTGEIPTEWGNLSGIYALNLSQNNFNGLIPPSFSNLKQIESLDLS  833

Query  1854  ENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIG  2033
              NNL G IP+                   QL    F    L + ++SYN   G  PE   
Sbjct  834   HNNLNGRIPA-------------------QLVELTF----LAVFNVSYNKLSGRTPEMKN  870

Query  2034  TIsrlsslllNGNRFEGKVPTQ  2099
               +        GN      P Q
Sbjct  871   QFATFDESSYKGNPLLCGPPLQ  892



>ref|XP_006601723.1| PREDICTED: disease resistance protein isoform X3 [Glycine max]
Length=1182

 Score =   341 bits (875),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 288/727 (40%), Positives = 405/727 (56%), Gaps = 30/727 (4%)
 Frame = +3

Query  51    DNPLNSHLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQ  230
             DN LN+   +      + L NLE L + +  +   +IL   +L  F SLK L +      
Sbjct  210   DNKLNTSSFHVFETLSSKLRNLEVLDISFNYLTN-DILP--SLGGFTSLKRLYLAGIHLD  266

Query  231   SFGPINDVGG---AKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQD  401
             S     + GG      L+EL L E R N     SL G   LK L L  N   +G L+I +
Sbjct  267   SDLHFQENGGFTWPTGLQELDLRENRLNNKFLPSLNGLECLKYLGLRWNQL-EGSLNISE  325

Query  402   INDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLA  581
             ++ L +LK L LS N    F     H G     +++   L+ LHL     D +KL  SL 
Sbjct  326   LSRLTSLKTLDLSYNNISDFVV---HQG-----LKSLRRLDALHLYGNMIDGSKLRKSLR  377

Query  582   AFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSN-LHKDFLSNIGPMESLKVLSL  758
             AF S++ L +              ++LS+LEEL +D SN +  +F  +IG + SLKVLSL
Sbjct  378   AFSSVRMLSMGENEFKGTIVAGDFQDLSNLEELTMDLSNNMENEFFKSIGKLTSLKVLSL  437

Query  759   SGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
                 + GTLP+    +LK L+ L LS N+ EG +PS F N+TSL+ + +S N   GN + 
Sbjct  438   YHCNINGTLPHADWSKLKKLELLDLSGNKFEGPLPSSFVNMTSLQKLEISYNHFIGNFDS  497

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQ--LQGFVPKFQ  1112
             +  S  +   +  I  N FEV  SF  FAN+SK++ I  + NKV  D+Q     ++PKFQ
Sbjct  498   NIASLTSLEYFGFI-ENQFEVPVSFTPFANHSKIKFIHGEGNKVSLDSQHSFPTWIPKFQ  556

Query  1113  LDSLSLSNCID--LLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNN  1286
             L  L +S+      L LP FL YQ  L  L  S   LEG+FP WLL+NNTK+ + L  N 
Sbjct  557   LQELIVSSTTKTMFLPLPNFLLYQNSLITLDFSSWKLEGDFPHWLLENNTKMTHVLFRNC  616

Query  1287  AFTGSLKLSSHVNPNLQIINVSNNKLCGEI-SGNFSSSFPNILALNLSSNLFSGQLHSLI  1463
             +FTG+ +L     PN+  I+VS+N + G+I S NFSS +PN+  LNLS N   G +   +
Sbjct  617   SFTGTFQLPMRPLPNIWEIDVSDNIIVGQIPSNNFSSIYPNLHFLNLSRNNIQGSIPHEL  676

Query  1464  G--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHL  1637
             G    L  LDLS N  +GEIPK++      L  LKLSNNKLEG I+   +  + LE L L
Sbjct  677   GQMNSLYSLDLSGNQLSGEIPKDIFGVGHQLRFLKLSNNKLEGPIL---NIPNGLETLLL  733

Query  1638  DGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEF  1817
             + N F G +P+++ N  + SLD+++N L G+IP  +  L+ L ++ LS NH EG IP+E 
Sbjct  734   NHNRFTGRLPSNIFNASIISLDVKNNHLVGKIPSLIKNLSGLYEICLSNNHFEGSIPLEL  793

Query  1818  CNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSY  1997
               L+ L+ +DLS+NN  G +PS  N SS+  + L+ ++LSG   R F   ++LV+LDLSY
Sbjct  794   GELEDLTSVDLSQNNFIGLVPSFAN-SSVAFIHLNNNRLSGLPKRMFHGKSSLVMLDLSY  852

Query  1998  NSFVGIIPEWIGTIsrlss--lllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRC  2171
             N     + + I  +S      LLL GN F G +P Q+CQL+ L++LDLS+N  SGVIP+C
Sbjct  853   NEISNNLQDLIHNLSYKRLNFLLLKGNHFMGDIPKQICQLIDLNMLDLSHNNFSGVIPKC  912

Query  2172  LGKISLE  2192
             LGK+  E
Sbjct  913   LGKMPFE  919


 Score = 82.8 bits (203),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 192/742 (26%), Positives = 300/742 (40%), Gaps = 146/742 (20%)
 Frame = +3

Query  87    NERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAK  266
             ++ L  L  L+ LH+ Y  M + + L   +L+ F S+++L +G N+F+      D     
Sbjct  348   HQGLKSLRRLDALHL-YGNMIDGSKLRK-SLRAFSSVRMLSMGENEFKGTIVAGDFQDLS  405

Query  267   KLEELYL-FECRFNQSIFQSLKGFPSLKILDLMDNDF-----------------------  374
              LEEL +          F+S+    SLK+L L   +                        
Sbjct  406   NLEELTMDLSNNMENEFFKSIGKLTSLKVLSLYHCNINGTLPHADWSKLKKLELLDLSGN  465

Query  375   -YDGPLHIQDINDLRNLKELYLSDNYFEG-FE------TSANHSG---------SSRHTI  503
              ++GPL    +N + +L++L +S N+F G F+      TS  + G          S    
Sbjct  466   KFEGPLPSSFVN-MTSLQKLEISYNHFIGNFDSNIASLTSLEYFGFIENQFEVPVSFTPF  524

Query  504   RNKSYLEVLHL--NNISFDMTKLLSSLAAFPS-IKTLELQR--VNVTNIDAIHALKNL--  662
              N S ++ +H   N +S D      S  +FP+ I   +LQ   V+ T       L N   
Sbjct  525   ANHSKIKFIHGEGNKVSLD------SQHSFPTWIPKFQLQELIVSSTTKTMFLPLPNFLL  578

Query  663   --SSLEELHLDGSNLHKDF----LSN---------------------IGPMESLKVLSLS  761
               +SL  L      L  DF    L N                     + P+ ++  + +S
Sbjct  579   YQNSLITLDFSSWKLEGDFPHWLLENNTKMTHVLFRNCSFTGTFQLPMRPLPNIWEIDVS  638

Query  762   GAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
                + G +P+     +  NL  L LS N ++G IP   G + SL  ++LS N+LSG I  
Sbjct  639   DNIIVGQIPSNNFSSIYPNLHFLNLSRNNIQGSIPHELGQMNSLYSLDLSGNQLSGEIPK  698

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLD  1118
                     L +L + NN  E      +  N   L  +L + N+     +L   +    + 
Sbjct  699   DIFGVGHQLRFLKLSNNKLE--GPILNIPNG--LETLLLNHNRFTG--RLPSNIFNASII  752

Query  1119  SLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWL--LQNNTKLQYFLMNNNAF  1292
             SL + N   + K+P  +     L  + +S N+ EG  P  L  L++ T +    ++ N F
Sbjct  753   SLDVKNNHLVGKIPSLIKNLSGLYEICLSNNHFEGSIPLELGELEDLTSVD---LSQNNF  809

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--  1466
              G   + S  N ++  I+++NN+L G     F     +++ L+LS N  S  L  LI   
Sbjct  810   IG--LVPSFANSSVAFIHLNNNRLSGLPKRMFHGK-SSLVMLDLSYNEISNNLQDLIHNL  866

Query  1467  --THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ-------EFDYLSS  1619
                 L FL L  N F G+IPK+ +     L +L LS+N   G I +       E  YL S
Sbjct  867   SYKRLNFLLLKGNHFMGDIPKQ-ICQLIDLNMLDLSHNNFSGVIPKCLGKMPFENKYLKS  925

Query  1620  L----EYLHLDGNNFEGTIpnslsnl------------------------------plhs  1697
             L         D NN   +   + S                                 +  
Sbjct  926   LLARFSTFDPDPNNLAQSPDLAQSPTPVSGPTLNLQEKANFTTKERTDTYIGRVLFYMSG  985

Query  1698  lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSI  1877
             +D+  NKL G IP  +G LT +  L LS N L G IP+ F  L     LDLS N L   I
Sbjct  986   IDLSHNKLKGNIPFELGYLTKIRALNLSHNDLTGKIPVTFSLLAQTESLDLSFNMLNSQI  1045

Query  1878  PSCLNP-SSIKHVSLSKHQLSG  1940
             P  L+  +S++  S++ + LSG
Sbjct  1046  PPQLSMLTSLEVFSVAHNNLSG  1067


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 113/461 (25%), Positives = 187/461 (41%), Gaps = 70/461 (15%)
 Frame = +3

Query  579   AAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNI-GPMESLKVLS  755
             + +P++  L L R N+      H L  ++SL  L L G+ L  +   +I G    L+ L 
Sbjct  653   SIYPNLHFLNLSRNNIQG-SIPHELGQMNSLYSLDLSGNQLSGEIPKDIFGVGHQLRFLK  711

Query  756   LSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIe  935
             LS  ++ G + N        L+ L L+ N+  G++PS   N  S+  +++  N L G I 
Sbjct  712   LSNNKLEGPILNIP----NGLETLLLNHNRFTGRLPSNIFN-ASIISLDVKNNHLVGKIP  766

Query  936   lsplstltsleylsIMNNSFEVASSFRSFANNSKLRV-ILADRNKV-IADTQLQGFVPKF  1109
                 +          ++  +E+  S   F  +  L +  L D   V ++     G VP F
Sbjct  767   SLIKN----------LSGLYEICLSNNHFEGSIPLELGELEDLTSVDLSQNNFIGLVPSF  816

Query  1110  QLDSLSLS--NCIDLLKLP-RFLHYQRDLKVLRISRNNLEGEFPSWLLQNNT--KLQYFL  1274
                S++    N   L  LP R  H +  L +L +S N +       L+ N +  +L + L
Sbjct  817   ANSSVAFIHLNNNRLSGLPKRMFHGKSSLVMLDLSYNEISNNLQD-LIHNLSYKRLNFLL  875

Query  1275  MNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEIS-----------------GNFSSSFP  1403
             +  N F G +        +L ++++S+N   G I                    FS+  P
Sbjct  876   LKGNHFMGDIPKQICQLIDLNMLDLSHNNFSGVIPKCLGKMPFENKYLKSLLARFSTFDP  935

Query  1404  NILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVI--LKLSNNK  1577
             +   L  S +L +     + G  L   + +N  FT +   +  I      +  + LS+NK
Sbjct  936   DPNNLAQSPDL-AQSPTPVSGPTLNLQEKAN--FTTKERTDTYIGRVLFYMSGIDLSHNK  992

Query  1578  LEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLT  1757
             L+G I  E  YL+ +  L+L  N+                       L+G+IP     L 
Sbjct  993   LKGNIPFELGYLTKIRALNLSHND-----------------------LTGKIPVTFSLLA  1029

Query  1758  SLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP  1880
                 L LS N L   IP +   L SL +  ++ NNL+G  P
Sbjct  1030  QTESLDLSFNMLNSQIPPQLSMLTSLEVFSVAHNNLSGPTP  1070



>gb|KHN08312.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=1229

 Score =   341 bits (874),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 284/724 (39%), Positives = 405/724 (56%), Gaps = 30/724 (4%)
 Frame = +3

Query  60    LNSHLNNSGNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFG  239
             L+S L+   N   T    L+EL +R  ++    + S+  L+    LK L + +N+ +   
Sbjct  260   LDSDLHFQENGGFTWPTGLQELDLRENRLNNKFLPSLNGLE---CLKYLGLRWNQLEGSL  316

Query  240   PINDVGG---AKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDIND  410
              I+  GG      L+ L L E R N     SL G   LK L L  N   +G L+I  ++ 
Sbjct  317   NISGNGGFTWPTGLQALDLRENRLNNKFLPSLNGLECLKYLGLSSNQL-EGSLNISGLSG  375

Query  411   LRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFP  590
             L +L+ L LS N    F     H G     +++   L+ LHL     D +KL  SL AF 
Sbjct  376   LTSLEILDLSYNNISDFVV---HQG-----LKSLRRLDALHLYGNMIDGSKLRKSLRAFS  427

Query  591   SIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSN-LHKDFLSNIGPMESLKVLSLSGA  767
             S++ L +              ++LS+LEEL +D SN +  +F  +IG + SLKVLSL   
Sbjct  428   SVRMLSMGENEFKGTIVAGDFQDLSNLEELTMDLSNNMENEFFKSIGKLTSLKVLSLYYC  487

Query  768   QVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspl  947
              + GTLP+    +LK L+ L LS N+ EG +PS F N+TSL+ + +S N   GN + +  
Sbjct  488   NINGTLPHADWSKLKKLELLDLSGNKFEGPLPSSFVNMTSLQKLEISYNHFIGNFDSNIA  547

Query  948   stltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQ--LQGFVPKFQLDS  1121
             S  +   +  I  N FEV  SF  FAN+SK++ I  + NKV  D+Q     ++PKFQL  
Sbjct  548   SLTSLEYFGFI-ENQFEVPVSFTPFANHSKIKFIHGEGNKVSLDSQHSFPTWIPKFQLQE  606

Query  1122  LSLSNCID--LLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFT  1295
             L +S+      L LP FL YQ  L  L  S   LEG+FP WLL+NNTK+ + L  N +FT
Sbjct  607   LIVSSTTKTMFLPLPNFLLYQNSLIRLDFSSWKLEGDFPHWLLENNTKMTHVLFRNCSFT  666

Query  1296  GSLKLSSHVNPNLQIINVSNNKLCGEI-SGNFSSSFPNILALNLSSNLFSGQLHSLIG--  1466
             G+ +L     PN+  I+VS+N + G+I S NFSS +PN+  LNLS N   G +   +G  
Sbjct  667   GTFQLPMRPLPNIWEIDVSDNIIVGQIPSNNFSSIYPNLHFLNLSRNNIQGSIPHELGQM  726

Query  1467  THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGN  1646
               L  LDLS N  +GEIPK++      L  LKLSNNKLEG I+   +  + LE L L+ N
Sbjct  727   NSLYSLDLSGNQLSGEIPKDIFGVGHQLRFLKLSNNKLEGPIL---NIPNGLETLLLNHN  783

Query  1647  NFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNL  1826
              F G +P+++ N  + SLD+++N L G+IP  +  L+ L ++ LS NH EG IP+E   L
Sbjct  784   RFTGRLPSNIFNASIISLDVKNNHLVGKIPSLIKNLSGLYEICLSNNHFEGSIPLELGEL  843

Query  1827  KSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSF  2006
             + L+ +DLS+NN  G +PS  N SS+  + L+ ++LSG   R F   ++LV+LDLSYN  
Sbjct  844   EDLTSVDLSQNNFIGLVPSFAN-SSVAFIHLNNNRLSGLPKRMFHGKSSLVMLDLSYNEI  902

Query  2007  VGIIPEWIGTIsrlss--lllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGK  2180
                + + I  +S      LLL GN F G +P Q+CQL+ L++LDLS+N  SGVIP+CLGK
Sbjct  903   SNNLQDLIHNLSYKRLNFLLLKGNHFMGDIPKQICQLIDLNMLDLSHNNFSGVIPKCLGK  962

Query  2181  ISLE  2192
             +  E
Sbjct  963   MPFE  966


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 222/764 (29%), Positives = 347/764 (45%), Gaps = 127/764 (17%)
 Frame = +3

Query  192   SLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPS-LKILDLMD-  365
             SL+VLDI  N     G ++ + G   L+ LYL +   N S F   +   S L+ L+++D 
Sbjct  119   SLEVLDISRNYLDDAGILSCLDGLSSLKSLYLRDIGLNTSSFHVFETLSSKLRYLEVLDV  178

Query  366   -NDFYDGPLHIQDINDLRNLKELYLSDNY-----FEGFETSANHSGSSRHTIRNKSYLEV  527
               ++ D    +  ++ L +LK LYL+DN      F  FET ++        +RN   LEV
Sbjct  179   SGNYLDDAGILSCLDGLSSLKSLYLADNKLNTSSFHVFETLSSK-------LRN---LEV  228

Query  528   LHLNNISFD--MTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKN-----LSSLEELHL  686
             L   +ISF+     +L SL  F S+K L L  +++ +   +H  +N      + L+EL L
Sbjct  229   L---DISFNYLTNDILPSLGGFTSLKRLYLAGIHLDS--DLHFQENGGFTWPTGLQELDL  283

Query  687   DGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTL---PNKGLCELKNLQELWLSENQLEGK  857
               + L+  FL ++  +E LK L L   Q+ G+L    N G      LQ L L EN+L  K
Sbjct  284   RENRLNNKFLPSLNGLECLKYLGLRWNQLEGSLNISGNGGFTWPTGLQALDLRENRLNNK  343

Query  858   IPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNS---FEVASSFRSFA-  1025
                    L  L+Y+ LS N+L G++ +S LS LTSLE L +  N+   F V    +S   
Sbjct  344   FLPSLNGLECLKYLGLSSNQLEGSLNISGLSGLTSLEILDLSYNNISDFVVHQGLKSLRR  403

Query  1026  -----------NNSKLRVILADRNKV----IADTQLQGFVPKFQLDSLS--------LSN  1136
                        + SKLR  L   + V    + + + +G +       LS        LSN
Sbjct  404   LDALHLYGNMIDGSKLRKSLRAFSSVRMLSMGENEFKGTIVAGDFQDLSNLEELTMDLSN  463

Query  1137  CIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSS  1316
              ++  +  + +     LKVL +   N+ G  P        KL+   ++ N F G L  SS
Sbjct  464   NME-NEFFKSIGKLTSLKVLSLYYCNINGTLPHADWSKLKKLELLDLSGNKFEGPLP-SS  521

Query  1317  HVN-PNLQIINVSNNKLCGEISGNFSS--------SFPNILALNLSSNLFSGQLHSLIGT  1469
              VN  +LQ + +S N   G    N +S           N   + +S   F+   HS I  
Sbjct  522   FVNMTSLQKLEISYNHFIGNFDSNIASLTSLEYFGFIENQFEVPVSFTPFAN--HSKIKF  579

Query  1470  HLG-----FLDLSNNSFTGEIPK----EMLISCS----------------SLVILKLSNN  1574
               G      LD S +SF   IPK    E+++S +                SL+ L  S+ 
Sbjct  580   IHGEGNKVSLD-SQHSFPTWIPKFQLQELIVSSTTKTMFLPLPNFLLYQNSLIRLDFSSW  638

Query  1575  KLEGQIVQE-FDYLSSLEYLHLDGNNFEGTIpnslsnlp-lhslDIRDNKLSGEIPR--W  1742
             KLEG       +  + + ++     +F GT    +  LP +  +D+ DN + G+IP   +
Sbjct  639   KLEGDFPHWLLENNTKMTHVLFRNCSFTGTFQLPMRPLPNIWEIDVSDNIIVGQIPSNNF  698

Query  1743  MGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPS-------------  1883
                  +L  L LS+N+++G IP E   + SL  LDLS N L+G IP              
Sbjct  699   SSIYPNLHFLNLSRNNIQGSIPHELGQMNSLYSLDLSGNQLSGEIPKDIFGVGHQLRFLK  758

Query  1884  ---------CLN-PSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIG  2033
                       LN P+ ++ + L+ ++ +G+L    F N +++ LD+  N  VG IP  I 
Sbjct  759   LSNNKLEGPILNIPNGLETLLLNHNRFTGRLPSNIF-NASIISLDVKNNHLVGKIPSLIK  817

Query  2034  TIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIP  2165
              +S L  + L+ N FEG +P ++ +L  L+ +DLS N   G++P
Sbjct  818   NLSGLYEICLSNNHFEGSIPLELGELEDLTSVDLSQNNFIGLVP  861


 Score = 83.2 bits (204),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 192/742 (26%), Positives = 301/742 (41%), Gaps = 146/742 (20%)
 Frame = +3

Query  87    NERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAK  266
             ++ L  L  L+ LH+ Y  M + + L   +L+ F S+++L +G N+F+      D     
Sbjct  395   HQGLKSLRRLDALHL-YGNMIDGSKLRK-SLRAFSSVRMLSMGENEFKGTIVAGDFQDLS  452

Query  267   KLEELYL-FECRFNQSIFQSLKGFPSLKILDL------------------------MDND  371
              LEEL +          F+S+    SLK+L L                        +  +
Sbjct  453   NLEELTMDLSNNMENEFFKSIGKLTSLKVLSLYYCNINGTLPHADWSKLKKLELLDLSGN  512

Query  372   FYDGPLHIQDINDLRNLKELYLSDNYFEG-FE------TSANHSG---------SSRHTI  503
              ++GPL    +N + +L++L +S N+F G F+      TS  + G          S    
Sbjct  513   KFEGPLPSSFVN-MTSLQKLEISYNHFIGNFDSNIASLTSLEYFGFIENQFEVPVSFTPF  571

Query  504   RNKSYLEVLHL--NNISFDMTKLLSSLAAFPS-IKTLELQR--VNVTNIDAIHALKNL--  662
              N S ++ +H   N +S D      S  +FP+ I   +LQ   V+ T       L N   
Sbjct  572   ANHSKIKFIHGEGNKVSLD------SQHSFPTWIPKFQLQELIVSSTTKTMFLPLPNFLL  625

Query  663   --SSLEELHLDGSNLHKDF----LSN---------------------IGPMESLKVLSLS  761
               +SL  L      L  DF    L N                     + P+ ++  + +S
Sbjct  626   YQNSLIRLDFSSWKLEGDFPHWLLENNTKMTHVLFRNCSFTGTFQLPMRPLPNIWEIDVS  685

Query  762   GAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
                + G +P+     +  NL  L LS N ++G IP   G + SL  ++LS N+LSG I  
Sbjct  686   DNIIVGQIPSNNFSSIYPNLHFLNLSRNNIQGSIPHELGQMNSLYSLDLSGNQLSGEIPK  745

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLD  1118
                     L +L + NN  E      +  N   L  +L + N+     +L   +    + 
Sbjct  746   DIFGVGHQLRFLKLSNNKLE--GPILNIPNG--LETLLLNHNRFTG--RLPSNIFNASII  799

Query  1119  SLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWL--LQNNTKLQYFLMNNNAF  1292
             SL + N   + K+P  +     L  + +S N+ EG  P  L  L++ T +    ++ N F
Sbjct  800   SLDVKNNHLVGKIPSLIKNLSGLYEICLSNNHFEGSIPLELGELEDLTSVD---LSQNNF  856

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--  1466
              G   + S  N ++  I+++NN+L G     F     +++ L+LS N  S  L  LI   
Sbjct  857   IG--LVPSFANSSVAFIHLNNNRLSGLPKRMFHGK-SSLVMLDLSYNEISNNLQDLIHNL  913

Query  1467  --THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ-------EFDYLSS  1619
                 L FL L  N F G+IPK+ +     L +L LS+N   G I +       E  YL S
Sbjct  914   SYKRLNFLLLKGNHFMGDIPKQ-ICQLIDLNMLDLSHNNFSGVIPKCLGKMPFENKYLKS  972

Query  1620  L----EYLHLDGNNFEGTIpnslsnl------------------------------plhs  1697
             L         D NN   +   + S                                 +  
Sbjct  973   LLARFSTFDPDPNNLAQSPDLAQSPTPVSGPTLNLQEKANFTTKERTDTYIGRVLFYMSG  1032

Query  1698  lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSI  1877
             +D+  NKL G IP  +G LT +  L LS N L G IP+ F  L     LDLS N L   I
Sbjct  1033  IDLSHNKLKGNIPFELGYLTKIRALNLSHNDLTGKIPVTFSLLAQTESLDLSFNMLNSQI  1092

Query  1878  PSCLNP-SSIKHVSLSKHQLSG  1940
             P  L+  +S++  S++ + LSG
Sbjct  1093  PPQLSMLTSLEVFSVAHNNLSG  1114


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 113/461 (25%), Positives = 187/461 (41%), Gaps = 70/461 (15%)
 Frame = +3

Query  579   AAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNI-GPMESLKVLS  755
             + +P++  L L R N+      H L  ++SL  L L G+ L  +   +I G    L+ L 
Sbjct  700   SIYPNLHFLNLSRNNIQG-SIPHELGQMNSLYSLDLSGNQLSGEIPKDIFGVGHQLRFLK  758

Query  756   LSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIe  935
             LS  ++ G + N        L+ L L+ N+  G++PS   N  S+  +++  N L G I 
Sbjct  759   LSNNKLEGPILNIP----NGLETLLLNHNRFTGRLPSNIFN-ASIISLDVKNNHLVGKIP  813

Query  936   lsplstltsleylsIMNNSFEVASSFRSFANNSKLRV-ILADRNKV-IADTQLQGFVPKF  1109
                 +          ++  +E+  S   F  +  L +  L D   V ++     G VP F
Sbjct  814   SLIKN----------LSGLYEICLSNNHFEGSIPLELGELEDLTSVDLSQNNFIGLVPSF  863

Query  1110  QLDSLSLS--NCIDLLKLP-RFLHYQRDLKVLRISRNNLEGEFPSWLLQNNT--KLQYFL  1274
                S++    N   L  LP R  H +  L +L +S N +       L+ N +  +L + L
Sbjct  864   ANSSVAFIHLNNNRLSGLPKRMFHGKSSLVMLDLSYNEISNNLQD-LIHNLSYKRLNFLL  922

Query  1275  MNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEIS-----------------GNFSSSFP  1403
             +  N F G +        +L ++++S+N   G I                    FS+  P
Sbjct  923   LKGNHFMGDIPKQICQLIDLNMLDLSHNNFSGVIPKCLGKMPFENKYLKSLLARFSTFDP  982

Query  1404  NILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVI--LKLSNNK  1577
             +   L  S +L +     + G  L   + +N  FT +   +  I      +  + LS+NK
Sbjct  983   DPNNLAQSPDL-AQSPTPVSGPTLNLQEKAN--FTTKERTDTYIGRVLFYMSGIDLSHNK  1039

Query  1578  LEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLT  1757
             L+G I  E  YL+ +  L+L  N+                       L+G+IP     L 
Sbjct  1040  LKGNIPFELGYLTKIRALNLSHND-----------------------LTGKIPVTFSLLA  1076

Query  1758  SLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP  1880
                 L LS N L   IP +   L SL +  ++ NNL+G  P
Sbjct  1077  QTESLDLSFNMLNSQIPPQLSMLTSLEVFSVAHNNLSGPTP  1117



>ref|XP_002269212.3| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
Length=1070

 Score =   338 bits (868),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 300/789 (38%), Positives = 418/789 (53%), Gaps = 42/789 (5%)
 Frame = +3

Query  111   NLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSF---GPINDVGGAKKLEEL  281
             N  E    Y +  +  +L+V     F  L  L++  N F  F        +   KKLE L
Sbjct  99    NFVEFDWSYYENVKFWLLNVSLFLPFEELHHLNLSTNSFDGFIENEGFKRLSSLKKLEIL  158

Query  282   YLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGF  461
              +    FN+S  +SL    SLK L L      +G   IQ++  LRNL  L LS N+ E F
Sbjct  159   DISGNEFNKSALKSLGTITSLKTLVLSSMGL-NGSFPIQELVSLRNLVVLDLSYNHLESF  217

Query  462   ETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDA  641
             +   +   S   +I  K  LE L+LN   F  T L   L  F S+K L L+  ++     
Sbjct  218   QAVQD---SKSLSIFKK--LETLNLNQNMFKNTSL-QQLNIFTSLKNLSLKWNSLEGFFP  271

Query  642   IHALKNLSSLEELHLDGS-----------------NLHKDFLSNIGP-----MESLKVLS  755
             I  L  L +L  L L G+                 +L  +FL+ I P     M SLK LS
Sbjct  272   IEGLCTLENLVLLDLSGNHLIGMQEFASLNNLEILDLSYNFLNGILPSSIRLMSSLKFLS  331

Query  756   LSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIe  935
             L+   +  +L ++GLC+L  LQEL L+ N   G +P    NLTSLR ++LS N  SGN  
Sbjct  332   LARNGLNSSLQDQGLCQLNKLQELDLNSNFFHGILPPCLNNLTSLRLLDLSSNLFSGNAS  391

Query  936   lsplstltsleylsIMNNSFEVASSFRSFANNSKLRVIL--ADRNKVIADTQLQ-GFVPK  1106
              S L+ LTSLEY+ + +N FE + SF SF+N+SKL+V++  +  NK   +T+   G+VP 
Sbjct  392   SSLLANLTSLEYIDLSHNLFEDSFSFSSFSNHSKLQVVILGSGYNKFEVETEYPVGWVPL  451

Query  1107  FQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNN  1286
             FQL +L LS C     LP FL YQ  L V+ +S NNL G FP+WLL+NNT+L+Y  + NN
Sbjct  452   FQLKTLVLSYCKLTGDLPGFLQYQFKLMVVDLSHNNLTGSFPNWLLENNTRLEYLFLRNN  511

Query  1287  AFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG  1466
             +  G L L    N +++++++S+NKL G++  N  +  PNI+ LNLS+N F G L S I 
Sbjct  512   SLMGQL-LPLRPNTHIKLLDISHNKLDGQLQENVPNMIPNIMYLNLSNNGFEGILPSSIA  570

Query  1467  --THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLD  1640
               + L  LDLS NSF+GE+PK++L +   L ILKLSNNK  G+I      L+ L YL+L 
Sbjct  571   EMSSLWALDLSTNSFSGEVPKQLL-ATKDLWILKLSNNKFHGEIFSRDFNLTGLRYLYLG  629

Query  1641  GNNFEGTIp-nslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEF  1817
              N F GT+      +  L  LD+ +N +SGEIP W+G +T L  L L  N  +G +P E 
Sbjct  630   NNQFTGTLSNVISRSSWLWELDVSNNYMSGEIPNWIGNMTYLTTLVLGNNSFKGKLPPEI  689

Query  1818  CNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSY  1997
               L+SL  LD+S+N L+GS+PS  +   ++H+ L  +   G + R F N++ L+ LD+  
Sbjct  690   SQLQSLEFLDVSQNALSGSLPSLKSMKYLEHLHLQGNMFIGLIPRDFLNSSYLLTLDIRD  749

Query  1998  NSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLG  2177
             N   G IP  I  + +L  LLL GN   G +P  +C L  +SL+DLSNN  SG IPRC G
Sbjct  750   NRLFGSIPNSISALLKLKILLLRGNLLSGFIPNHLCHLTEISLMDLSNNSFSGPIPRCFG  809

Query  2178  KISLEGTNEQFRGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGN  2357
              I    T +++      F Y       L      W     Y P  A +   EV+F TK  
Sbjct  810   HIQFGETKKEYYEFG-QFHYSLYAGNFLTVYPGYWVKYWRY-PSFAYEEKDEVEFVTKNR  867

Query  2358  LYNYQNSIL  2384
               +Y   IL
Sbjct  868   RDSYVGDIL  876


 Score =   107 bits (268),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 221/797 (28%), Positives = 323/797 (41%), Gaps = 171/797 (21%)
 Frame = +3

Query  177   LKDFISLK---VLDIGFNKFQSFGPINDVGGA---KKLEELYLFECRFNQSIFQSLKGFP  338
             +++ +SL+   VLD+ +N  +SF  + D       KKLE L L +  F  +  Q L  F 
Sbjct  195   IQELVSLRNLVVLDLSYNHLESFQAVQDSKSLSIFKKLETLNLNQNMFKNTSLQQLNIFT  254

Query  339   SLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSY  518
             SLK L L  N   +G   I+ +  L NL  L LS N+  G +  A        ++ N   
Sbjct  255   SLKNLSLKWNSL-EGFFPIEGLCTLENLVLLDLSGNHLIGMQEFA--------SLNN---  302

Query  519   LEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSN  698
             LE+L L+  +F    L SS+    S+K L L R  + +      L  L+ L+EL L+ + 
Sbjct  303   LEILDLS-YNFLNGILPSSIRLMSSLKFLSLARNGLNSSLQDQGLCQLNKLQELDLNSNF  361

Query  699   LHKDFLSNIGPMESLKVLSL-----SGAQVGGTLPN------------------------  791
              H      +  + SL++L L     SG      L N                        
Sbjct  362   FHGILPPCLNNLTSLRLLDLSSNLFSGNASSSLLANLTSLEYIDLSHNLFEDSFSFSSFS  421

Query  792   ------------------------KGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYV  899
                                      G   L  L+ L LS  +L G +P +      L  V
Sbjct  422   NHSKLQVVILGSGYNKFEVETEYPVGWVPLFQLKTLVLSYCKLTGDLPGFLQYQFKLMVV  481

Query  900   NLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD  1079
             +LS N L+G+     L   T LEYL + NNS  +         N+ ++++    NK+  D
Sbjct  482   DLSHNNLTGSFPNWLLENNTRLEYLFLRNNS--LMGQLLPLRPNTHIKLLDISHNKL--D  537

Query  1080  TQLQGFVPKF--QLDSLSLSN------------------CIDLL------KLPRFLHYQR  1181
              QLQ  VP     +  L+LSN                   +DL       ++P+ L   +
Sbjct  538   GQLQENVPNMIPNIMYLNLSNNGFEGILPSSIAEMSSLWALDLSTNSFSGEVPKQLLATK  597

Query  1182  DLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNK  1361
             DL +L++S N   GE  S    N T L+Y  + NN FTG+L      +  L  ++VSNN 
Sbjct  598   DLWILKLSNNKFHGEIFSRDF-NLTGLRYLYLGNNQFTGTLSNVISRSSWLWELDVSNNY  656

Query  1362  LCGEIS---GNFS--------------------SSFPNILALNLSSNLFSGQLHSLIGT-  1469
             + GEI    GN +                    S   ++  L++S N  SG L SL    
Sbjct  657   MSGEIPNWIGNMTYLTTLVLGNNSFKGKLPPEISQLQSLEFLDVSQNALSGSLPSLKSMK  716

Query  1470  HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN  1649
             +L  L L  N F G IP++ L S S L+ L + +N+L G I      L  L+ L L GN 
Sbjct  717   YLEHLHLQGNMFIGLIPRDFLNS-SYLLTLDIRDNRLFGSIPNSISALLKLKILLLRGNL  775

Query  1650  FEGTI-pnslsnlplhslDIRDNKLSGEIPRWMGRLT----------------SLVQ---  1769
               G I  +      +  +D+ +N  SG IPR  G +                 SL     
Sbjct  776   LSGFIPNHLCHLTEISLMDLSNNSFSGPIPRCFGHIQFGETKKEYYEFGQFHYSLYAGNF  835

Query  1770  LTLSKNHL-----------EGHIPIEFCN-----------LKSLSILDLSENNLTGSIPS  1883
             LT+   +            E    +EF             L  +S LDLS NNLT  IP 
Sbjct  836   LTVYPGYWVKYWRYPSFAYEEKDEVEFVTKNRRDSYVGDILNFMSGLDLSCNNLTSEIPH  895

Query  1884  CLNPSSIKH-VSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlssll  2060
              L   S+ H ++LS +QL G + ++F N + +  LDLSYN   G IP  +  ++ L    
Sbjct  896   ELGMLSLIHTLNLSHNQLKGSIPKSFSNLSQIESLDLSYNKLSGEIPLELIGLNFLEVFS  955

Query  2061  lNGNRFEGKVPTQVCQL  2111
             +  N   G+VP    Q 
Sbjct  956   VAHNNISGRVPDMKAQF  972


 Score = 97.1 bits (240),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 176/663 (27%), Positives = 276/663 (42%), Gaps = 77/663 (12%)
 Frame = +3

Query  84    GNERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGA  263
             G +    L NLE L + Y  +  I   S+   +   SLK L +  N   S   + D G  
Sbjct  293   GMQEFASLNNLEILDLSYNFLNGILPSSI---RLMSSLKFLSLARNGLNS--SLQDQGLC  347

Query  264   K--KLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYL  437
             +  KL+EL L    F+  +   L    SL++LDL  N  + G      + +L +L+ + L
Sbjct  348   QLNKLQELDLNSNFFHGILPPCLNNLTSLRLLDLSSN-LFSGNASSSLLANLTSLEYIDL  406

Query  438   SDNYFEGFETSA---NHS---------GSSRHTIRNK---SYLEVLHLNNISFDMTKLLS  572
             S N FE   + +   NHS         G ++  +  +    ++ +  L  +     KL  
Sbjct  407   SHNLFEDSFSFSSFSNHSKLQVVILGSGYNKFEVETEYPVGWVPLFQLKTLVLSYCKLTG  466

Query  573   SLAAFPSIK----TLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMES  740
              L  F   +     ++L   N+T       L+N + LE L L  ++L    L  + P   
Sbjct  467   DLPGFLQYQFKLMVVDLSHNNLTGSFPNWLLENNTRLEYLFLRNNSLMGQLLP-LRPNTH  525

Query  741   LKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKL  920
             +K+L +S  ++ G L       + N+  L LS N  EG +PS    ++SL  ++LS N  
Sbjct  526   IKLLDISHNKLDGQLQENVPNMIPNIMYLNLSNNGFEGILPSSIAEMSSLWALDLSTNSF  585

Query  921   SGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKV----------  1070
             SG +    L+T        + NN F      R F N + LR +    N+           
Sbjct  586   SGEVPKQLLATKDLWILK-LSNNKFHGEIFSRDF-NLTGLRYLYLGNNQFTGTLSNVISR  643

Query  1071  --------IADTQLQGFVPKF-----QLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRN  1211
                     +++  + G +P +      L +L L N     KLP  +   + L+ L +S+N
Sbjct  644   SSWLWELDVSNNYMSGEIPNWIGNMTYLTTLVLGNNSFKGKLPPEISQLQSLEFLDVSQN  703

Query  1212  NLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFS  1391
              L G  PS  L++   L++  +  N F G +      +  L  +++ +N+L G I  + S
Sbjct  704   ALSGSLPS--LKSMKYLEHLHLQGNMFIGLIPRDFLNSSYLLTLDIRDNRLFGSIPNSIS  761

Query  1392  SSFPNILALNLSSNLFSGQL--HSLIGTHLGFLDLSNNSFTGEIP-----------KEML  1532
             +    +  L L  NL SG +  H    T +  +DLSNNSF+G IP           K+  
Sbjct  762   ALL-KLKILLLRGNLLSGFIPNHLCHLTEISLMDLSNNSFSGPIPRCFGHIQFGETKKEY  820

Query  1533  ISCSSLVILKLSNNKLE---GQIVQEFDYLSSLEYLHLDGNNF----EGTIpnslsnlpl  1691
                        + N L    G  V+ + Y  S  Y   D   F                +
Sbjct  821   YEFGQFHYSLYAGNFLTVYPGYWVKYWRY-PSFAYEEKDEVEFVTKNRRDSYVGDILNFM  879

Query  1692  hslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTG  1871
               LD+  N L+ EIP  +G L+ +  L LS N L+G IP  F NL  +  LDLS N L+G
Sbjct  880   SGLDLSCNNLTSEIPHELGMLSLIHTLNLSHNQLKGSIPKSFSNLSQIESLDLSYNKLSG  939

Query  1872  SIP  1880
              IP
Sbjct  940   EIP  942



>gb|KDO37806.1| hypothetical protein CISIN_1g003888mg [Citrus sinensis]
Length=788

 Score =   332 bits (852),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 225/520 (43%), Positives = 327/520 (63%), Gaps = 11/520 (2%)
 Frame = +3

Query  732   MESLKVLSLSGAQVG---GTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVN  902
             M SLK LS+S + +G     + ++GLC L +LQEL++  N L G +P    N+TSLR ++
Sbjct  45    MPSLKYLSMSDSTLGTNSSRILDQGLCSLMHLQELYIDNNDLRGSLPWCLANMTSLRILD  104

Query  903   LSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-  1079
             +S N+L+G+I  SPL  LTS+E L + NN F++  S     N+S+L++  A  N++ A+ 
Sbjct  105   VSSNQLTGSISSSPLVHLTSIEELMLSNNHFQIPISLEPLFNHSRLKIFDAANNEIKAEI  164

Query  1080  TQLQGF-VPKFQLDSLSLSNCI-DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNN  1253
             T+      P FQL +LSLS+   D +  P+FL++Q DL+ +R+S  N++GEFP+WLL+NN
Sbjct  165   TESHSLTAPNFQLQALSLSSGYGDGVTFPKFLYHQHDLEDVRLSHVNMDGEFPNWLLENN  224

Query  1254  TKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSN  1433
             TKL+   + N++ TG  +L  H +  L+ ++VSNN   G I        P++++ N+S N
Sbjct  225   TKLRQLYLVNDSLTGPFRLPIHSHRWLRFLDVSNNNFQGHIPVEIGDILPSLISFNISMN  284

Query  1434  LFSGQLHSLIGT--HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFD  1607
                  + S  G    L  LDLSNN  TGEIP+ + +SC +L  L LSNN L+G +     
Sbjct  285   ALDSSIPSSFGNMNFLQILDLSNNQLTGEIPEHLAVSCVNLEFLALSNNNLKGHMFSRNF  344

Query  1608  YLSSLEYLHLDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGRLTSLVQLTLSK  1784
              L++L  L L+GN+ EG IP SLS       L + +N LSG+IPRW+G LT L  + + +
Sbjct  345   NLTNLRSLQLEGNHLEGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTGLKHIIMPE  404

Query  1785  NHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FF  1961
             NHLEG IP+ FC L SL ILD+S+NN++GS+PSC +P SI+ V LSK+ L GQL R  FF
Sbjct  405   NHLEGPIPVGFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHGQLKRGTFF  464

Query  1962  NNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsn  2141
             + ++LV LDLSYN   G IP W+  +S+LS L+L  N  EG+VP Q+C+L +L LLDLSN
Sbjct  465   HCSSLVTLDLSYNRLNGSIPNWVDGLSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSN  524

Query  2142  nllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSINDAIL  2261
             N L G IP C    +L  ++     +  PFE   + D+++
Sbjct  525   NNLHGPIPPCFDNTTLHESSNNSYSLK-PFETSLVMDSMM  563


 Score =   133 bits (334),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 189/669 (28%), Positives = 297/669 (44%), Gaps = 91/669 (14%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   L    SL+ILD+  N    G +    +  L +++EL LS+N+
Sbjct  76    LQELYIDNNDLRGSLPWCLANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEELMLSNNH  134

Query  450   FE---GFETSANHSG---------------SSRHTIRNKSY-LEVLHLNNISFDMTKLLS  572
             F+     E   NHS                +  H++   ++ L+ L L++   D      
Sbjct  135   FQIPISLEPLFNHSRLKIFDAANNEIKAEITESHSLTAPNFQLQALSLSSGYGDGVTFPK  194

Query  573   SLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVL  752
              L     ++ + L  VN+        L+N + L +L+L   +L   F   I     L+ L
Sbjct  195   FLYHQHDLEDVRLSHVNMDGEFPNWLLENNTKLRQLYLVNDSLTGPFRLPIHSHRWLRFL  254

Query  753   SLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNI  932
              +S     G +P +    L +L    +S N L+  IPS FGN+  L+ ++LS N+L+G I
Sbjct  255   DVSNNNFQGHIPVEIGDILPSLISFNISMNALDSSIPSSFGNMNFLQILDLSNNQLTGEI  314

Query  933   elsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKF-  1109
                   +  +LE+L++ NN+ +     R+F N + LR +  + N       L+G +P+  
Sbjct  315   PEHLAVSCVNLEFLALSNNNLKGHMFSRNF-NLTNLRSLQLEGN------HLEGEIPQSL  367

Query  1110  ----QLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLM  1277
                  L+ L L+N     K+PR+L     LK + +  N+LEG  P    Q  + LQ   +
Sbjct  368   SKCSSLEGLYLNNNSLSGKIPRWLGNLTGLKHIIMPENHLEGPIPVGFCQLYS-LQILDI  426

Query  1278  NNNAFTGSLKLSSHVNP-NLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLH  1454
             ++N  +GSL    H  P +++ +++S N L G++         +++ L+LS N  +G + 
Sbjct  427   SDNNISGSLPSCFH--PLSIEQVHLSKNMLHGQLKRGTFFHCSSLVTLDLSYNRLNGSIP  484

Query  1455  SLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEY  1628
             + +   + L  L L +N+  GE+P + L   + L +L LSNN L G I   FD  +  E 
Sbjct  485   NWVDGLSQLSHLILGHNNLEGEVPVQ-LCELNQLQLLDLSNNNLHGPIPPCFDNTTLHES  543

Query  1629  -------------LHLDG----------NNFEGT------IpnslsnlplhslDIRDNKL  1721
                          L +D            NFE T      I        L  LD+  NKL
Sbjct  544   SNNSYSLKPFETSLVMDSMMIPAEKQIHENFEFTTKNIAYIYQGKVLSLLSGLDLSCNKL  603

Query  1722  SGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSS  1901
              G IP  +G LT +  L LS N+L G IP  F NLK +  LDLS N L G IP       
Sbjct  604   IGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIP-------  656

Query  1902  IKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFE  2081
                     HQL    T A F+        ++YN+  G IPEW    +  +     GN F 
Sbjct  657   --------HQLVELKTLAVFS--------VAYNNLSGEIPEWTAQFATFNESSYEGNTFL  700

Query  2082  GKVPTQVCQ  2108
               +P  +C+
Sbjct  701   CGLPLPICR  709



>ref|XP_006601722.1| PREDICTED: disease resistance protein isoform X2 [Glycine max]
Length=1182

 Score =   340 bits (872),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 285/732 (39%), Positives = 407/732 (56%), Gaps = 42/732 (6%)
 Frame = +3

Query  96    LTGLINLEELHMRYTQM--EEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKK  269
             L GL +L+ L++   ++     ++   L+ K   +L+VLDI FN + +   +  +GG   
Sbjct  197   LDGLSSLKSLYLADNKLNTSSFHVFETLSSK-LRNLEVLDISFN-YLTNDILPSLGGFTS  254

Query  270   LEELYLFECRFNQSI-FQSLKGFP---SLKILDLMDNDFYDGPLHIQDINDLRNLKELYL  437
             L+ LYL     +  + FQ   GF     L+ LDL +N   +    +  +N L  LK L L
Sbjct  255   LKRLYLAGIHLDSDLHFQGNGGFTWPTGLQALDLRENRLNNK--FLPSLNGLECLKYLGL  312

Query  438   SDNYFEGFETSANHSGSSRHTIRNKSY-----------------LEVLHLNNISFDMTKL  566
             S N  EG    +  SG +   I N SY                 L+ LHL     D +KL
Sbjct  313   SSNQLEGSLNISGLSGLTSLEILNLSYNNISDFVVHQGLKSLRRLDALHLYGNMIDGSKL  372

Query  567   LSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSN-LHKDFLSNIGPMESL  743
               SL AF S++ L +              ++LS+LEEL +D SN +  +F  +IG + SL
Sbjct  373   RKSLRAFSSVRMLSMGENEFKGTIVAGDFQDLSNLEELTMDLSNNMENEFFKSIGKLTSL  432

Query  744   KVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLS  923
             KVLSL    + GTLP+    +LK L+ L LS N+ EG +PS F N+TSL+ + +S N   
Sbjct  433   KVLSLYHCNINGTLPHADWSKLKKLELLDLSGNKFEGPLPSSFVNMTSLQKLEISYNHFI  492

Query  924   GNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQ--LQGF  1097
             GN + +  S  +   +  I  N FEV  SF  FAN+SK++ I  + NKV  D+Q     +
Sbjct  493   GNFDSNIASLTSLEYFGFI-ENQFEVPVSFTPFANHSKIKFIHGEGNKVSLDSQHSFPTW  551

Query  1098  VPKFQLDSLSLSNCID--LLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYF  1271
             +PKFQL  L +S+      L LP FL YQ  L  L  S   LEG+FP WLL+NNTK+ + 
Sbjct  552   IPKFQLQELIVSSTTKTMFLPLPNFLLYQNSLITLDFSSWKLEGDFPHWLLENNTKMTHV  611

Query  1272  LMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEI-SGNFSSSFPNILALNLSSNLFSGQ  1448
             L  N +FTG+ +L     PN+  I+VS+N + G+I S NFSS +PN+  LNLS N   G 
Sbjct  612   LFRNCSFTGTFQLPMRPLPNIWEIDVSDNIIVGQIPSNNFSSIYPNLHFLNLSRNNIQGS  671

Query  1449  LHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSL  1622
             +   +G    L  LDLS N  +GEIPK++      L  LKLSNNKLEG I+   +  + L
Sbjct  672   IPHELGQMNSLYSLDLSGNQLSGEIPKDIFGVGHQLRFLKLSNNKLEGPIL---NIPNGL  728

Query  1623  EYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGH  1802
             E L L+ N F G +P+++ N  + SLD+++N L G+IP  +  L+ L ++ LS NH EG 
Sbjct  729   ETLLLNHNRFTGRLPSNIFNASIISLDVKNNHLVGKIPSLIKNLSGLYEICLSNNHFEGS  788

Query  1803  IPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVI  1982
             IP+E   L+ L+ +DLS+NN  G +PS  N SS+  + L+ ++LSG   R F   ++LV+
Sbjct  789   IPLELGELEDLTSVDLSQNNFIGLVPSFAN-SSVAFIHLNNNRLSGLPKRMFHGKSSLVM  847

Query  1983  LDLSYNSFVGIIPEWIGTIsrlss--lllNGNRFEGKVPTQVCQLMRlslldlsnnllsG  2156
             LDLSYN     + + I  +S      LLL GN F G +P Q+CQL+ L++LDLS+N  SG
Sbjct  848   LDLSYNEISNNLQDLIHNLSYKRLNFLLLKGNHFMGDIPKQICQLIDLNMLDLSHNNFSG  907

Query  2157  VIPRCLGKISLE  2192
             VIP+CLGK+  E
Sbjct  908   VIPKCLGKMPFE  919


 Score = 83.2 bits (204),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 192/742 (26%), Positives = 300/742 (40%), Gaps = 146/742 (20%)
 Frame = +3

Query  87    NERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAK  266
             ++ L  L  L+ LH+ Y  M + + L   +L+ F S+++L +G N+F+      D     
Sbjct  348   HQGLKSLRRLDALHL-YGNMIDGSKLRK-SLRAFSSVRMLSMGENEFKGTIVAGDFQDLS  405

Query  267   KLEELYL-FECRFNQSIFQSLKGFPSLKILDLMDNDF-----------------------  374
              LEEL +          F+S+    SLK+L L   +                        
Sbjct  406   NLEELTMDLSNNMENEFFKSIGKLTSLKVLSLYHCNINGTLPHADWSKLKKLELLDLSGN  465

Query  375   -YDGPLHIQDINDLRNLKELYLSDNYFEG-FE------TSANHSG---------SSRHTI  503
              ++GPL    +N + +L++L +S N+F G F+      TS  + G          S    
Sbjct  466   KFEGPLPSSFVN-MTSLQKLEISYNHFIGNFDSNIASLTSLEYFGFIENQFEVPVSFTPF  524

Query  504   RNKSYLEVLHL--NNISFDMTKLLSSLAAFPS-IKTLELQR--VNVTNIDAIHALKNL--  662
              N S ++ +H   N +S D      S  +FP+ I   +LQ   V+ T       L N   
Sbjct  525   ANHSKIKFIHGEGNKVSLD------SQHSFPTWIPKFQLQELIVSSTTKTMFLPLPNFLL  578

Query  663   --SSLEELHLDGSNLHKDF----LSN---------------------IGPMESLKVLSLS  761
               +SL  L      L  DF    L N                     + P+ ++  + +S
Sbjct  579   YQNSLITLDFSSWKLEGDFPHWLLENNTKMTHVLFRNCSFTGTFQLPMRPLPNIWEIDVS  638

Query  762   GAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
                + G +P+     +  NL  L LS N ++G IP   G + SL  ++LS N+LSG I  
Sbjct  639   DNIIVGQIPSNNFSSIYPNLHFLNLSRNNIQGSIPHELGQMNSLYSLDLSGNQLSGEIPK  698

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLD  1118
                     L +L + NN  E      +  N   L  +L + N+     +L   +    + 
Sbjct  699   DIFGVGHQLRFLKLSNNKLE--GPILNIPNG--LETLLLNHNRFTG--RLPSNIFNASII  752

Query  1119  SLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWL--LQNNTKLQYFLMNNNAF  1292
             SL + N   + K+P  +     L  + +S N+ EG  P  L  L++ T +    ++ N F
Sbjct  753   SLDVKNNHLVGKIPSLIKNLSGLYEICLSNNHFEGSIPLELGELEDLTSVD---LSQNNF  809

Query  1293  TGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--  1466
              G   + S  N ++  I+++NN+L G     F     +++ L+LS N  S  L  LI   
Sbjct  810   IG--LVPSFANSSVAFIHLNNNRLSGLPKRMFHGK-SSLVMLDLSYNEISNNLQDLIHNL  866

Query  1467  --THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ-------EFDYLSS  1619
                 L FL L  N F G+IPK+ +     L +L LS+N   G I +       E  YL S
Sbjct  867   SYKRLNFLLLKGNHFMGDIPKQ-ICQLIDLNMLDLSHNNFSGVIPKCLGKMPFENKYLKS  925

Query  1620  L----EYLHLDGNNFEGTIpnslsnl------------------------------plhs  1697
             L         D NN   +   + S                                 +  
Sbjct  926   LLARFSTFDPDPNNLAQSPDLAQSPTPVSGPTLNLQEKANFTTKERTDTYIGRVLFYMSG  985

Query  1698  lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSI  1877
             +D+  NKL G IP  +G LT +  L LS N L G IP+ F  L     LDLS N L   I
Sbjct  986   IDLSHNKLKGNIPFELGYLTKIRALNLSHNDLTGKIPVTFSLLAQTESLDLSFNMLNSQI  1045

Query  1878  PSCLNP-SSIKHVSLSKHQLSG  1940
             P  L+  +S++  S++ + LSG
Sbjct  1046  PPQLSMLTSLEVFSVAHNNLSG  1067


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 113/461 (25%), Positives = 187/461 (41%), Gaps = 70/461 (15%)
 Frame = +3

Query  579   AAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNI-GPMESLKVLS  755
             + +P++  L L R N+      H L  ++SL  L L G+ L  +   +I G    L+ L 
Sbjct  653   SIYPNLHFLNLSRNNIQG-SIPHELGQMNSLYSLDLSGNQLSGEIPKDIFGVGHQLRFLK  711

Query  756   LSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIe  935
             LS  ++ G + N        L+ L L+ N+  G++PS   N  S+  +++  N L G I 
Sbjct  712   LSNNKLEGPILNIP----NGLETLLLNHNRFTGRLPSNIFN-ASIISLDVKNNHLVGKIP  766

Query  936   lsplstltsleylsIMNNSFEVASSFRSFANNSKLRV-ILADRNKV-IADTQLQGFVPKF  1109
                 +          ++  +E+  S   F  +  L +  L D   V ++     G VP F
Sbjct  767   SLIKN----------LSGLYEICLSNNHFEGSIPLELGELEDLTSVDLSQNNFIGLVPSF  816

Query  1110  QLDSLSLS--NCIDLLKLP-RFLHYQRDLKVLRISRNNLEGEFPSWLLQNNT--KLQYFL  1274
                S++    N   L  LP R  H +  L +L +S N +       L+ N +  +L + L
Sbjct  817   ANSSVAFIHLNNNRLSGLPKRMFHGKSSLVMLDLSYNEISNNLQD-LIHNLSYKRLNFLL  875

Query  1275  MNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEIS-----------------GNFSSSFP  1403
             +  N F G +        +L ++++S+N   G I                    FS+  P
Sbjct  876   LKGNHFMGDIPKQICQLIDLNMLDLSHNNFSGVIPKCLGKMPFENKYLKSLLARFSTFDP  935

Query  1404  NILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVI--LKLSNNK  1577
             +   L  S +L +     + G  L   + +N  FT +   +  I      +  + LS+NK
Sbjct  936   DPNNLAQSPDL-AQSPTPVSGPTLNLQEKAN--FTTKERTDTYIGRVLFYMSGIDLSHNK  992

Query  1578  LEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLT  1757
             L+G I  E  YL+ +  L+L  N+                       L+G+IP     L 
Sbjct  993   LKGNIPFELGYLTKIRALNLSHND-----------------------LTGKIPVTFSLLA  1029

Query  1758  SLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP  1880
                 L LS N L   IP +   L SL +  ++ NNL+G  P
Sbjct  1030  QTESLDLSFNMLNSQIPPQLSMLTSLEVFSVAHNNLSGPTP  1070



>ref|XP_006389033.1| hypothetical protein POPTR_0056s00220g [Populus trichocarpa]
 gb|ERP47947.1| hypothetical protein POPTR_0056s00220g [Populus trichocarpa]
Length=993

 Score =   336 bits (862),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 285/787 (36%), Positives = 404/787 (51%), Gaps = 103/787 (13%)
 Frame = +3

Query  120   ELHMRYTQMEEINILSVLNLK-----DFISLKVLDIGFNKFQSFGPINDVG------GAK  266
             EL +     + +N +  L+L       F  L++LD+  N  Q  G + + G      G +
Sbjct  79    ELQLSLVNYDFVNAVEDLDLNASLFLPFKELEILDLSGN--QLVGGLKNQGFQVLASGLR  136

Query  267   KLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDN  446
              LE+LYL   + N S    L GF +LK LDL +N F         +N LRNL        
Sbjct  137   NLEKLYLRYNKLNDSFLSCLGGFSTLKSLDLSNNRFTGS----TGLNGLRNL--------  184

Query  447   YFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNV  626
                                      E L+L+N  F  + L+ SL A P            
Sbjct  185   -------------------------ETLYLSN-DFKESILIESLGALPC-----------  207

Query  627   TNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCE  806
                           LEE+ LD S+L   FL NIG + +LKVLSLSG     TLP +G CE
Sbjct  208   --------------LEEVFLDYSSLPASFLRNIGHLSTLKVLSLSGVDFNSTLPAEGWCE  253

Query  807   LKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMN  986
             LKNL++L LS N L+G +P  FGNL+ L+ ++LS N+L GNI  S LS L  LEYLS+ N
Sbjct  254   LKNLEQLSLSGNNLKGVLPPCFGNLSFLQSLDLSDNQLEGNIASSHLSHLPQLEYLSVSN  313

Query  987   NSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCI-DLLK--L  1157
             N F+V  SF SF N+S L+    D N++IA    Q  VPKFQL + S SNC    LK   
Sbjct  314   NYFQVPISFGSFMNHSNLKFFECDNNELIAAPSFQPLVPKFQLRAFSASNCTPKPLKAGF  373

Query  1158  PRFLHYQRDLKVLRISRNNLEGE-FPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNL  1334
             P FL  Q DL  + +S N   GE FPSWL +NN  L    + + +FTG L+L  H  PNL
Sbjct  374   PNFLQSQHDLVFVDLSHNKFVGEPFPSWLFENNRLLNRLYLRDISFTGPLQLPQHPTPNL  433

Query  1335  QIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFT  1508
             Q +++S N + G+++    S F  +    +++N  +G +    G  + L +LDLSNN  +
Sbjct  434   QTVDMSGNNIHGQVARTICSIFTRLKNFIMANNTLTGCIPPCFGNMSSLEYLDLSNNHMS  493

Query  1509  GEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIp-nslsnl  1685
              E+ +  L   +SL  LKLSNN  +G++      ++ L YL LDGN F G +        
Sbjct  494   CELLEHNLP--TSLWFLKLSNNNFKGRLPLSVLNMTDLRYLFLDGNKFAGQVSGTFSLAS  551

Query  1686  plhslDIRDNKLSGEIPRWMG--RLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSEN  1859
             P    DI +N LSG +PR +G   L S   + LS+N  EG IP E+ N  SL  LDLS+N
Sbjct  552   PFMWFDISNNLLSGMLPRGIGNSSLNSCQAIDLSRNQFEGTIPKEYFNSYSLEFLDLSKN  611

Query  1860  NLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTI  2039
             NL+GS+P       +++V L  ++LSG L  AF N+++LV LDL  N+    IP WI ++
Sbjct  612   NLSGSLPLGFLAPHLRYVHLYGNRLSGPLPYAFCNHSSLVTLDLGDNNLTESIPNWIDSL  671

Query  2040  srlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGI  2219
             S LS  +L  N+F GK+P Q+C L +LS+LDLS N  SG +P CL  ++   ++E+   +
Sbjct  672   SELSIFVLKSNQFNGKLPDQLCLLRKLSILDLSENNFSGPLPSCLSNLNFTESDEKTWVV  731

Query  2220  NLPFEYYSINDAILDRLHYEWGS----------DDEYI-PMLAVDVLPEVQFRTKGNLYN  2366
                  +  I+D     +    G           DD+ + P ++V +   ++  +K N Y 
Sbjct  732   T---SWEIIDDGSQKEIFASIGGRELGNQRFYLDDKTLQPEISVKI--SIELTSKKNFYT  786

Query  2367  YQNSILK  2387
             Y+  IL+
Sbjct  787   YEGDILR  793


 Score =   110 bits (274),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 196/806 (24%), Positives = 323/806 (40%), Gaps = 188/806 (23%)
 Frame = +3

Query  54    NPLNSHLNNSGNERL-TGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQ  230
             N L   L N G + L +GL NLE+L++RY ++ + + LS L    F +LK LD+  N+F 
Sbjct  117   NQLVGGLKNQGFQVLASGLRNLEKLYLRYNKLND-SFLSCLG--GFSTLKSLDLSNNRFT  173

Query  231   SFGPIN---------------------DVGGAKKLEELYLFECRFNQSIFQSLKGFPSLK  347
                 +N                      +G    LEE++L       S  +++    +LK
Sbjct  174   GSTGLNGLRNLETLYLSNDFKESILIESLGALPCLEEVFLDYSSLPASFLRNIGHLSTLK  233

Query  348   ILDLMDNDFYDGPLHIQDINDLRNLKELY------------------------LSDNYFE  455
             +L L   DF +  L  +   +L+NL++L                         LSDN  E
Sbjct  234   VLSLSGVDF-NSTLPAEGWCELKNLEQLSLSGNNLKGVLPPCFGNLSFLQSLDLSDNQLE  292

Query  456   GFETSAN--HSGSSRHTIRNKSYLEV-------LHLNNISF---DMTKLLSSLAAFPSIK  599
             G   S++  H     +   + +Y +V       ++ +N+ F   D  +L+++ +  P + 
Sbjct  293   GNIASSHLSHLPQLEYLSVSNNYFQVPISFGSFMNHSNLKFFECDNNELIAAPSFQPLVP  352

Query  600   TLELQRVNVTN----------------------IDAIH-----------ALKNLSSLEEL  680
               +L+  + +N                      +D  H             +N   L  L
Sbjct  353   KFQLRAFSASNCTPKPLKAGFPNFLQSQHDLVFVDLSHNKFVGEPFPSWLFENNRLLNRL  412

Query  681   HLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKI  860
             +L   +          P  +L+ + +SG  + G +          L+   ++ N L G I
Sbjct  413   YLRDISFTGPLQLPQHPTPNLQTVDMSGNNIHGQVARTICSIFTRLKNFIMANNTLTGCI  472

Query  861   PSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKL  1040
             P  FGN++SL Y++LS N +S  +    L T        + NN+F+      S  N + L
Sbjct  473   PPCFGNMSSLEYLDLSNNHMSCELLEHNLPTSLWFLK--LSNNNFKGRLPL-SVLNMTDL  529

Query  1041  RVILADRNKV------------------IADTQLQGFVPKFQLDSLSLSNC--IDLLK--  1154
             R +  D NK                   I++  L G +P+  + + SL++C  IDL +  
Sbjct  530   RYLFLDGNKFAGQVSGTFSLASPFMWFDISNNLLSGMLPR-GIGNSSLNSCQAIDLSRNQ  588

Query  1155  ----LPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHV  1322
                 +P+       L+ L +S+NNL G  P   L     L+Y  +  N  +G L  +   
Sbjct  589   FEGTIPKEYFNSYSLEFLDLSKNNLSGSLPLGFLA--PHLRYVHLYGNRLSGPLPYAFCN  646

Query  1323  NPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSN  1496
             + +L  +++ +N L   I  N+  S   +    L SN F+G+L   +     L  LDLS 
Sbjct  647   HSSLVTLDLGDNNLTESIP-NWIDSLSELSIFVLKSNQFNGKLPDQLCLLRKLSILDLSE  705

Query  1497  NSFTGEIPKEMLISCSSLVILKLSNNKL----------EGQIVQEFDYLSSLEY----LH  1634
             N+F+G +P     SC S +    S+ K           +G   + F  +   E      +
Sbjct  706   NNFSGPLP-----SCLSNLNFTESDEKTWVVTSWEIIDDGSQKEIFASIGGRELGNQRFY  760

Query  1635  LDGNNFEGTIpnslsn----------------lplhslDIRDNKLSGEIPRWMGRLTSLV  1766
             LD    +  I   +S                   +  +D+  N+ +GEIP   G L+ ++
Sbjct  761   LDDKTLQPEISVKISIELTSKKNFYTYEGDILRYMSVMDLSCNRFTGEIPTEWGNLSGII  820

Query  1767  QLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQL  1946
              L LS+N+L G IP  F NLK +  LDLS NNL G IP+                   QL
Sbjct  821   ALNLSQNNLTGLIPSSFSNLKQIESLDLSHNNLKGRIPT-------------------QL  861

Query  1947  TRAFFNNTALVILDLSYNSFVGIIPE  2024
                 F    L + ++SYN+  G  PE
Sbjct  862   VELTF----LAVFNVSYNNLSGRTPE  883



>ref|XP_007140409.1| hypothetical protein PHAVU_008G109300g [Phaseolus vulgaris]
 gb|ESW12403.1| hypothetical protein PHAVU_008G109300g [Phaseolus vulgaris]
Length=897

 Score =   334 bits (857),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 259/654 (40%), Positives = 361/654 (55%), Gaps = 24/654 (4%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+E++L     +     SL G P L+ LDL  N    G ++I  ++ L +L  L LS N 
Sbjct  15    LQEIWLTYNSLSNKFVSSLSGLPRLQFLDLSYNQL-KGTINISGLSTLSSLTNLDLSYNS  73

Query  450   FEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFP-SIKTLELQRVNV  626
                F         SR        L+VL LN    D  KL  SL A   SIK L +   N 
Sbjct  74    IHYFVADQGSKSLSR--------LDVLQLNGNMIDGKKLKESLQALSLSIKHLHMSSNNF  125

Query  627   TNIDAIHALKNLSSLEELHLDGSN-LHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLC  803
                       +L +LE L LDGSN +  +F  +IG + SLK LSLS  Q+  TLP     
Sbjct  126   KGTILAKDFHDLKNLEGLRLDGSNNIENEFFKSIGNLTSLKALSLSYCQINDTLPAADWS  185

Query  804   ELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIM  983
             +LK L+EL+L +N  EG +P  F N+TSLR + LS N   G+ + +  +  +   +    
Sbjct  186   KLKKLEELYLIQNGFEGFLPISFINMTSLRILELSHNHFIGHFDSNIATLTSLEHFG-FT  244

Query  984   NNSFEVASSFRSFANNSKLRVILADRNKVIADTQ--LQGFVPKFQLDSLSLSNCI--DLL  1151
              N FE+  SF  FAN+S L+VI    NKV  D+Q  LQ ++PKFQL  L +S+ I     
Sbjct  245   ENQFEIPVSFTPFANHSNLQVIHGKGNKVRLDSQHSLQTWIPKFQLQELRMSSTIMTSSF  304

Query  1152  KLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPN  1331
             +LP+FL YQ +L  L  S   L+G FP WLL+NNTKL   +  N + TG++++       
Sbjct  305   QLPKFLLYQTNLTSLDFSSLKLKGGFPHWLLENNTKLTEVVFENCSLTGTMQIPLRPVRE  364

Query  1332  LQIINVSNNKLCGEI-SGNFSSSFPNILALNLSSNLFSGQLHSLIG-THLGFLDLSNNSF  1505
             L  I+VSNN + GEI S N SS +P +  LN+S N   G +    G   L  LDLSNN  
Sbjct  365   LWSIDVSNNIIIGEIPSKNISSIYPKLRYLNMSKNYMRGSISREFGRMKLHSLDLSNNQL  424

Query  1506  TGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnl  1685
             +GEIP+++  +   L  L+LSNNKLEG I   F   + LE L L+ NNF G + +++ N 
Sbjct  425   SGEIPEDIFEARHQLKFLRLSNNKLEGPI---FTIPTKLEILSLNDNNFSGRLSSNIFNT  481

Query  1686  plhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNL  1865
              + SLD+ +N L G+I   +  L+ L +L +S N+ EG IP+E   L+ L  LDLS+NNL
Sbjct  482   SIVSLDVSNNHLVGKISSLLKNLSGLSELRMSNNNFEGFIPLELTQLEDLKYLDLSQNNL  541

Query  1866  TGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsr  2045
              G +PS  N SS+K++ LS + L+G   + F  N++LV+LDLS+N   G I + I  +S 
Sbjct  542   IGLLPSFRN-SSVKYIHLSNNHLTGFSKKMFIENSSLVMLDLSHNEISGGIQDMIEDLSY  600

Query  2046  lssl--llNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTN  2201
                   LL GN   G +P Q+CQL+ L++LDLS+N  SG IP CLG +  +  N
Sbjct  601   SKLKFLLLKGNHITGDIPKQLCQLIDLTMLDLSDNKFSGEIPHCLGTMPFDNKN  654


 Score =   125 bits (315),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 195/724 (27%), Positives = 304/724 (42%), Gaps = 200/724 (28%)
 Frame = +3

Query  183   DFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLM  362
             +  SLK L + + +     P  D    KKLEELYL +  F   +  S     SL+IL+L 
Sbjct  161   NLTSLKALSLSYCQINDTLPAADWSKLKKLEELYLIQNGFEGFLPISFINMTSLRILELS  220

Query  363   DNDF---YDGPLHIQDINDLRNLKELYLSDNYFE---GFETSANHSG-------------  485
              N F   +D      +I  L +L+    ++N FE    F   ANHS              
Sbjct  221   HNHFIGHFDS-----NIATLTSLEHFGFTENQFEIPVSFTPFANHSNLQVIHGKGNKVRL  275

Query  486   SSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLS  665
              S+H+++  +++    L  +    T + SS      +    L + N+T++D         
Sbjct  276   DSQHSLQ--TWIPKFQLQELRMSSTIMTSSFQ----LPKFLLYQTNLTSLD---------  320

Query  666   SLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELW---LS  836
                 L L G   H    +N      L  +      + GT+       L+ ++ELW   +S
Sbjct  321   -FSSLKLKGGFPHWLLENNT----KLTEVVFENCSLTGTMQ----IPLRPVRELWSIDVS  371

Query  837   ENQLEGKIPSYFGNLTS----LRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVA  1004
              N + G+IPS   N++S    LRY+N+S N + G+I                        
Sbjct  372   NNIIIGEIPS--KNISSIYPKLRYLNMSKNYMRGSIS-----------------------  406

Query  1005  SSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRD  1184
                R F    ++++   D    +++ QL G +P+                       +  
Sbjct  407   ---REFG---RMKLHSLD----LSNNQLSGEIPE------------------DIFEARHQ  438

Query  1185  LKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHV-NPNLQIINVSNNK  1361
             LK LR+S N LEG  P + +   TKL+   +N+N F+G  +LSS++ N ++  ++VSNN 
Sbjct  439   LKFLRLSNNKLEG--PIFTIP--TKLEILSLNDNNFSG--RLSSNIFNTSIVSLDVSNNH  492

Query  1362  LCGEISG----------------NFSSSFP-------NILALNLSSNLFSGQLHSLIGTH  1472
             L G+IS                 NF    P       ++  L+LS N   G L S   + 
Sbjct  493   LVGKISSLLKNLSGLSELRMSNNNFEGFIPLELTQLEDLKYLDLSQNNLIGLLPSFRNSS  552

Query  1473  LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI---VQEFDYLSSLEYLHLDG  1643
             + ++ LSNN  TG   K+M I  SSLV+L LS+N++ G I   +++  Y S L++L L G
Sbjct  553   VKYIHLSNNHLTG-FSKKMFIENSSLVMLDLSHNEISGGIQDMIEDLSY-SKLKFLLLKG  610

Query  1644  NNFEGTIpnsl-snlplhslDIRDNKLSGEIPRWM------------------GR-----  1751
             N+  G IP  L   + L  LD+ DNK SGEIP  +                  GR     
Sbjct  611   NHITGDIPKQLCQLIDLTMLDLSDNKFSGEIPHCLGTMPFDNKNLDPLLKASKGRFFAEE  670

Query  1752  --------------------------------LTSLVQLTLSKNHLEGHIPIEFCNLKSL  1835
                                             L  +  + LS N L+G+IP E   L  +
Sbjct  671   SISQAPLPSSEHKKEKASFTSKRSTYTYIGSILAYMSGIDLSHNKLKGNIPYELGKLTRI  730

Query  1836  SILDLSENNLTGSIP-SCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVG  2012
               L+LS NNL G IP S  N    + + LS ++LSG++       T+L +L +++N+  G
Sbjct  731   RALNLSHNNLIGQIPYSFSNLVQTESLDLSFNKLSGEIPSNLIILTSLEVLSVAHNNLSG  790

Query  2013  IIPE  2024
              +PE
Sbjct  791   PLPE  794


 Score =   119 bits (297),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 203/791 (26%), Positives = 346/791 (44%), Gaps = 119/791 (15%)
 Frame = +3

Query  87    NERLTGLINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAK  266
             N+      NL+E+ + Y  +    + S+  L     L+ LD+ +N+ +  G IN + G  
Sbjct  6     NDSFKWPTNLQEIWLTYNSLSNKFVSSLSGLP---RLQFLDLSYNQLK--GTIN-ISGLS  59

Query  267   KLEELYLFECRFNQ-SIFQSLKGFPSLKILDLM--DNDFYDGPLHIQDINDLR-NLKELY  434
              L  L   +  +N    F + +G  SL  LD++  + +  DG    + +  L  ++K L+
Sbjct  60    TLSSLTNLDLSYNSIHYFVADQGSKSLSRLDVLQLNGNMIDGKKLKESLQALSLSIKHLH  119

Query  435   LSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQ  614
             +S N F+G   + +      H ++N   L +   NNI  +  K   S+    S+K L L 
Sbjct  120   MSSNNFKGTILAKDF-----HDLKNLEGLRLDGSNNIENEFFK---SIGNLTSLKALSLS  171

Query  615   RVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNK  794
                + +         L  LEEL+L  +        +   M SL++L LS     G   + 
Sbjct  172   YCQINDTLPAADWSKLKKLEELYLIQNGFEGFLPISFINMTSLRILELSHNHFIGHF-DS  230

Query  795   GLCELKNLQELWLSENQLEGKIP-SYFGNLTSLRYVNLSLNKL------SGNIelsplst  953
              +  L +L+    +ENQ E  +  + F N ++L+ ++   NK+      S    +     
Sbjct  231   NIATLTSLEHFGFTENQFEIPVSFTPFANHSNLQVIHGKGNKVRLDSQHSLQTWIPKFQL  290

Query  954   ltsleylsIMNNSFEVAS-----------SFRSFA-----------NNSKLRVILADRNK  1067
                    +IM +SF++              F S             NN+KL  ++ +   
Sbjct  291   QELRMSSTIMTSSFQLPKFLLYQTNLTSLDFSSLKLKGGFPHWLLENNTKLTEVVFENCS  350

Query  1068  VIADTQLQGFVPKFQLDSLSLSNCIDLLKLP-----------RFLHYQRD----------  1184
             +    Q+    P  +L S+ +SN I + ++P           R+L+  ++          
Sbjct  351   LTGTMQIP-LRPVRELWSIDVSNNIIIGEIPSKNISSIYPKLRYLNMSKNYMRGSISREF  409

Query  1185  ----LKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVS  1352
                 L  L +S N L GE P  + +   +L++  ++NN   G +     +   L+I++++
Sbjct  410   GRMKLHSLDLSNNQLSGEIPEDIFEARHQLKFLRLSNNKLEGPIFT---IPTKLEILSLN  466

Query  1353  NNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGF--LDLSNNSFTGEIPKE  1526
             +N   G +S N  ++  +I++L++S+N   G++ SL+    G   L +SNN+F G IP E
Sbjct  467   DNNFSGRLSSNIFNT--SIVSLDVSNNHLVGKISSLLKNLSGLSELRMSNNNFEGFIPLE  524

Query  1527  MLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEG-TIpnslsnlplhslD  1703
              L     L  L LS N L G ++  F   SS++Y+HL  N+  G +    + N  L  LD
Sbjct  525   -LTQLEDLKYLDLSQNNLIG-LLPSFRN-SSVKYIHLSNNHLTGFSKKMFIENSSLVMLD  581

Query  1704  IRDNKLSGEIPRWMGRLT--SLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSI  1877
             +  N++SG I   +  L+   L  L L  NH+ G IP + C L  L++LDLS+N  +G I
Sbjct  582   LSHNEISGGIQDMIEDLSYSKLKFLLLKGNHITGDIPKQLCQLIDLTMLDLSDNKFSGEI  641

Query  1878  PSCLNP----------------------SSIKHVSL-----SKHQLSGQLTRAFFNNTAL  1976
             P CL                         SI    L      K + S    R+ +     
Sbjct  642   PHCLGTMPFDNKNLDPLLKASKGRFFAEESISQAPLPSSEHKKEKASFTSKRSTYTYIGS  701

Query  1977  VI-----LDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsn  2141
             ++     +DLS+N   G IP  +G ++R+ +L L+ N   G++P     L++   LDLS 
Sbjct  702   ILAYMSGIDLSHNKLKGNIPYELGKLTRIRALNLSHNNLIGQIPYSFSNLVQTESLDLSF  761

Query  2142  nllsGVIPRCL  2174
             N LSG IP  L
Sbjct  762   NKLSGEIPSNL  772



>ref|XP_006602960.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X2 [Glycine max]
Length=1152

 Score =   339 bits (869),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 287/757 (38%), Positives = 397/757 (52%), Gaps = 77/757 (10%)
 Frame = +3

Query  165   SVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECR-FNQ----SIFQSLK  329
             S+ N+    SL++LD+ +N F       D+G A             +NQ    SIF+ L 
Sbjct  254   SIFNISKLSSLEILDLFYNNFND----TDIGFALSGLSSLKSLNLGYNQLTSSSIFR-LS  308

Query  330   GFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRN  509
             G  SL+ILDL  N+  D  +H Q    L  L  LYL  N  +G                 
Sbjct  309   GLISLEILDLRFNNISDFAVH-QGSKGLGRLDALYLDGNMIDG-----------------  350

Query  510   KSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLD  689
                             +KL +SL AF S++ L +               +LS+LE L +D
Sbjct  351   ----------------SKLRNSLRAFSSVRMLSMSENEFKGTIVAGDFHDLSNLEHLTMD  394

Query  690   GSN-LHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPS  866
              SN L  +F  +IG + SLKVLSL    +  TLP     +LK ++EL LS N+ EG +PS
Sbjct  395   YSNNLKNEFFKSIGELTSLKVLSLRYCNINDTLPPADWSKLKKIEELDLSGNEFEGPLPS  454

Query  867   YFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRV  1046
              F N+TSLR + +S N   GN + +  S  +   +     N FEV  SF +FAN+SK+++
Sbjct  455   SFVNMTSLRELEISHNHFIGNFDSNIASLTSLEYFG-FTENQFEVPVSFSTFANHSKIKL  513

Query  1047  ILADRNKVIADTQ--LQGFVPKFQLDSLSLSNCIDL--LKLPRFLHYQRDLKVLRISRNN  1214
             I    N+ I D+Q  L  ++PKFQL  LS+S+  +   L LP FL YQ  L  L  S   
Sbjct  514   IDGGGNRFILDSQHSLPTWIPKFQLQELSVSSTTETKSLPLPNFLLYQNSLISLDFSSWK  573

Query  1215  LEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEI-SGNFS  1391
             LEG+FP WLL+NNTK+   L  N +FTG+ +L     PNL  I+VS+N + G+I S N S
Sbjct  574   LEGDFPYWLLENNTKMTEALFRNCSFTGTFQLPMRSLPNLSKIDVSDNIIVGQIPSNNIS  633

Query  1392  SSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKL  1565
             S +PN+  LNLS N   G +   +G    L  LDLS+N  + EIPK++      L  LKL
Sbjct  634   SIYPNLQFLNLSRNNIQGSIPRELGQMNSLDSLDLSDNHLSREIPKDIFGVGHRLNFLKL  693

Query  1566  SNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWM  1745
             SNNKLEG I+   +  + LE L L+ N   G +P+++ N  + SLD+ +N L G+IP  +
Sbjct  694   SNNKLEGPIL---NIPNGLETLLLNDNRLTGRLPSNIFNASIISLDVSNNHLMGKIPSLV  750

Query  1746  GRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSK  1925
                + L QL L  NH EG IP+E   L+ L+ LDLS+NNLTGS+PS +NP S++ + LS 
Sbjct  751   KNFSGLRQLFLFNNHFEGSIPLELAKLEDLNYLDLSKNNLTGSVPSFVNP-SLRFIHLSN  809

Query  1926  HQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrls--slllNGNRFEGKVPTQ  2099
             + L G   R F   ++LV LDLSYN     + + I  +       LLL GN F G +P Q
Sbjct  810   NHLRGLPKRMFNGTSSLVTLDLSYNEITNSVQDIIQELKYTRLNILLLKGNHFIGDIPKQ  869

Query  2100  VCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSINDAILDRLHYE  2279
             +CQL+ LS+LDLS+N  SG IP CLGK+S E  + +                 L+RL   
Sbjct  870   LCQLIHLSILDLSHNNFSGAIPNCLGKMSFENKDPE---------------RFLERLS-G  913

Query  2280  WGS--DDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
             WGS   ++  P    +V  +V F +K     Y  SIL
Sbjct  914   WGSTGQNKIFPSQLPNVEEKVNFTSKKRTDTYTRSIL  950


 Score =   129 bits (324),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 188/702 (27%), Positives = 298/702 (42%), Gaps = 61/702 (9%)
 Frame = +3

Query  105   LINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELY  284
             L NLE L M Y+   +       ++ +  SLKVL + +       P  D    KK+EEL 
Sbjct  385   LSNLEHLTMDYSNNLKNEFFK--SIGELTSLKVLSLRYCNINDTLPPADWSKLKKIEELD  442

Query  285   LFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---  455
             L    F   +  S     SL+ L++  N F        +I  L +L+    ++N FE   
Sbjct  443   LSGNEFEGPLPSSFVNMTSLRELEISHNHFIGN--FDSNIASLTSLEYFGFTENQFEVPV  500

Query  456   GFETSANHS-------GSSRHTIRNK----SYLEVLHLNNISFDMTKLLSSLAAFP----  590
              F T ANHS       G +R  + ++    +++    L  +S   T    SL   P    
Sbjct  501   SFSTFANHSKIKLIDGGGNRFILDSQHSLPTWIPKFQLQELSVSSTTETKSLP-LPNFLL  559

Query  591   ---SIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLS  761
                S+ +L+     +        L+N + + E      +    F   +  + +L  + +S
Sbjct  560   YQNSLISLDFSSWKLEGDFPYWLLENNTKMTEALFRNCSFTGTFQLPMRSLPNLSKIDVS  619

Query  762   GAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
                + G +P+  +  +  NLQ L LS N ++G IP   G + SL  ++LS N LS  I  
Sbjct  620   DNIIVGQIPSNNISSIYPNLQFLNLSRNNIQGSIPRELGQMNSLDSLDLSDNHLSREIPK  679

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPK----  1106
                     L +L + NN  E             L +       ++ D +L G +P     
Sbjct  680   DIFGVGHRLNFLKLSNNKLE----------GPILNIPNGLETLLLNDNRLTGRLPSNIFN  729

Query  1107  FQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNN  1286
               + SL +SN   + K+P  +     L+ L +  N+ EG  P  L +    L Y  ++ N
Sbjct  730   ASIISLDVSNNHLMGKIPSLVKNFSGLRQLFLFNNHFEGSIPLELAKLE-DLNYLDLSKN  788

Query  1287  AFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG  1466
               TGS+   S VNP+L+ I++SNN L G     F+ +  +++ L+LS N  +  +  +I 
Sbjct  789   NLTGSVP--SFVNPSLRFIHLSNNHLRGLPKRMFNGT-SSLVTLDLSYNEITNSVQDIIQ  845

Query  1467  ----THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSS-----  1619
                 T L  L L  N F G+IPK+ L     L IL LS+N   G I      +S      
Sbjct  846   ELKYTRLNILLLKGNHFIGDIPKQ-LCQLIHLSILDLSHNNFSGAIPNCLGKMSFENKDP  904

Query  1620  ---LEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNH  1790
                LE L   G+  +  I  S        ++    K +    R +  L  +  + LS N 
Sbjct  905   ERFLERLSGWGSTGQNKIFPSQLPNVEEKVNFTSKKRTDTYTRSI--LAYMSGIDLSHNK  962

Query  1791  LEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQLTRAFFNN  1967
             L G+IP +  NL  +  L+LS N+L G IP+   N    + + LS ++LSGQ+       
Sbjct  963   LNGNIPFDLGNLTRIRALNLSHNDLIGQIPATFSNLVQTESLDLSFNKLSGQIPPQLSKL  1022

Query  1968  TALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
             T+L +  +++N+  G  PEW G  S   +    GN F    P
Sbjct  1023  TSLEVFSVAHNNLSGTTPEWKGQFSTFENSSYEGNPFLCGPP  1064


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 171/644 (27%), Positives = 271/644 (42%), Gaps = 93/644 (14%)
 Frame = +3

Query  408   DLRNLKELYLSDNYFEGFETSANH-------SGSSRHTIRNKSYLEVLHLNNISFDMTKL  566
             D+  L E Y++ ++F  F+   N        SG   + +R ++ L+VL ++    D   +
Sbjct  69    DIAWLPEPYINYSHFVVFKDLNNLDLSWNAISGCVGNQVRLEN-LQVLDMSYNYLDAAGI  127

Query  567   LSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSS----LEELHLDGSNLHKDFLSNIGPM  734
             LS L    S       R N  N  + H  + LSS    LE L++  + L  D L ++G  
Sbjct  128   LSCLDGL-SSLKSLSLRGNRLNTSSFHVFETLSSKLRNLEVLNISNNYLTNDILPSLGGF  186

Query  735   ESLKVLSLSGAQVGGTLPNKGLCE-LKNLQELWLSE------------------------  839
              SLK L+L+G Q+   L  +GLC  L+NL+ L LS                         
Sbjct  187   TSLKELNLAGIQLDSDLHIQGLCSLLRNLEVLDLSNNNYNHIDIGYALSRLSSLKSLNLG  246

Query  840   -NQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFR  1016
              NQL  +       L+SL  ++L  N  +       LS L+SL+ L++  N    +S FR
Sbjct  247   YNQLTSRSIFNISKLSSLEILDLFYNNFNDTDIGFALSGLSSLKSLNLGYNQLTSSSIFR  306

Query  1017  SFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSL-SNCIDLLKLPRFLHYQRDLKV  1193
               +    L ++    N +      QG     +LD+L L  N ID  KL   L     +++
Sbjct  307   -LSGLISLEILDLRFNNISDFAVHQGSKGLGRLDALYLDGNMIDGSKLRNSLRAFSSVRM  365

Query  1194  LRISRNNLEGEFPSWLLQNNTKLQYFLMN------NNAFTGSLKLSSHVNPNLQIINVSN  1355
             L +S N  +G   +    + + L++  M+      N  F    +L+S    +L+  N+++
Sbjct  366   LSMSENEFKGTIVAGDFHDLSNLEHLTMDYSNNLKNEFFKSIGELTSLKVLSLRYCNIND  425

Query  1356  N---------------KLCG-EISGNFSSSFPNILALN---LSSNLFSGQLHSLIG--TH  1472
                              L G E  G   SSF N+ +L    +S N F G   S I   T 
Sbjct  426   TLPPADWSKLKKIEELDLSGNEFEGPLPSSFVNMTSLRELEISHNHFIGNFDSNIASLTS  485

Query  1473  LGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNK--LEGQ----------IVQEFDYLS  1616
             L +   + N F   +      + S + ++    N+  L+ Q           +QE    S
Sbjct  486   LEYFGFTENQFEVPVSFSTFANHSKIKLIDGGGNRFILDSQHSLPTWIPKFQLQELSVSS  545

Query  1617  SLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKN-HL  1793
             + E   L   NF       L    L SLD    KL G+ P W+    + +   L +N   
Sbjct  546   TTETKSLPLPNF------LLYQNSLISLDFSSWKLEGDFPYWLLENNTKMTEALFRNCSF  599

Query  1794  EGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSI----KHVSLSKHQLSGQLTRAFF  1961
              G   +   +L +LS +D+S+N + G IPS  N SSI    + ++LS++ + G + R   
Sbjct  600   TGTFQLPMRSLPNLSKIDVSDNIIVGQIPSN-NISSIYPNLQFLNLSRNNIQGSIPRELG  658

Query  1962  NNTALVILDLSYNSFVGIIPEWI-GTIsrlsslllNGNRFEGKV  2090
                +L  LDLS N     IP+ I G   RL+ L L+ N+ EG +
Sbjct  659   QMNSLDSLDLSDNHLSREIPKDIFGVGHRLNFLKLSNNKLEGPI  702



>ref|XP_006602959.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X1 [Glycine max]
Length=1201

 Score =   339 bits (869),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 293/776 (38%), Positives = 406/776 (52%), Gaps = 66/776 (9%)
 Frame = +3

Query  165   SVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQ----SIFQSLKG  332
             S+ N+    SL++LD+ +N F     IN       L  L      +NQ    SIF ++  
Sbjct  254   SIFNISKLSSLEILDLSYNNFNH---INIGSALSGLSSLKSLNLGYNQLTSRSIF-NISK  309

Query  333   FPSLKILDLMDNDFYD--------------------GPLHIQDINDLRNLKELYLSDNYF  452
               SL+ILDL  N+F D                      L    I  L  L  L + D  F
Sbjct  310   LSSLEILDLFYNNFNDTDIGFALSGLSSLKSLNLGYNQLTSSSIFRLSGLISLEILDLRF  369

Query  453   EGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVTN  632
                   A H GS     +    L+ L+L+    D +KL +SL AF S++ L +       
Sbjct  370   NNISDFAVHQGS-----KGLGRLDALYLDGNMIDGSKLRNSLRAFSSVRMLSMSENEFKG  424

Query  633   IDAIHALKNLSSLEELHLDGSN-LHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCEL  809
                     +LS+LE L +D SN L  +F  +IG + SLKVLSL    +  TLP     +L
Sbjct  425   TIVAGDFHDLSNLEHLTMDYSNNLKNEFFKSIGELTSLKVLSLRYCNINDTLPPADWSKL  484

Query  810   KNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNN  989
             K ++EL LS N+ EG +PS F N+TSLR + +S N   GN + +  S  +   +     N
Sbjct  485   KKIEELDLSGNEFEGPLPSSFVNMTSLRELEISHNHFIGNFDSNIASLTSLEYFG-FTEN  543

Query  990   SFEVASSFRSFANNSKLRVILADRNKVIADTQ--LQGFVPKFQLDSLSLSNCIDL--LKL  1157
              FEV  SF +FAN+SK+++I    N+ I D+Q  L  ++PKFQL  LS+S+  +   L L
Sbjct  544   QFEVPVSFSTFANHSKIKLIDGGGNRFILDSQHSLPTWIPKFQLQELSVSSTTETKSLPL  603

Query  1158  PRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQ  1337
             P FL YQ  L  L  S   LEG+FP WLL+NNTK+   L  N +FTG+ +L     PNL 
Sbjct  604   PNFLLYQNSLISLDFSSWKLEGDFPYWLLENNTKMTEALFRNCSFTGTFQLPMRSLPNLS  663

Query  1338  IINVSNNKLCGEI-SGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFT  1508
              I+VS+N + G+I S N SS +PN+  LNLS N   G +   +G    L  LDLS+N  +
Sbjct  664   KIDVSDNIIVGQIPSNNISSIYPNLQFLNLSRNNIQGSIPRELGQMNSLDSLDLSDNHLS  723

Query  1509  GEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlp  1688
              EIPK++      L  LKLSNNKLEG I+   +  + LE L L+ N   G +P+++ N  
Sbjct  724   REIPKDIFGVGHRLNFLKLSNNKLEGPIL---NIPNGLETLLLNDNRLTGRLPSNIFNAS  780

Query  1689  lhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLT  1868
             + SLD+ +N L G+IP  +   + L QL L  NH EG IP+E   L+ L+ LDLS+NNLT
Sbjct  781   IISLDVSNNHLMGKIPSLVKNFSGLRQLFLFNNHFEGSIPLELAKLEDLNYLDLSKNNLT  840

Query  1869  GSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrl  2048
             GS+PS +NP S++ + LS + L G   R F   ++LV LDLSYN     + + I  +   
Sbjct  841   GSVPSFVNP-SLRFIHLSNNHLRGLPKRMFNGTSSLVTLDLSYNEITNSVQDIIQELKYT  899

Query  2049  s--slllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGIN  2222
                 LLL GN F G +P Q+CQL+ LS+LDLS+N  SG IP CLGK+S E  + +     
Sbjct  900   RLNILLLKGNHFIGDIPKQLCQLIHLSILDLSHNNFSGAIPNCLGKMSFENKDPE-----  954

Query  2223  LPFEYYSINDAILDRLHYEWGS--DDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
                         L+RL   WGS   ++  P    +V  +V F +K     Y  SIL
Sbjct  955   ----------RFLERLS-GWGSTGQNKIFPSQLPNVEEKVNFTSKKRTDTYTRSIL  999


 Score =   129 bits (323),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 188/702 (27%), Positives = 298/702 (42%), Gaps = 61/702 (9%)
 Frame = +3

Query  105   LINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELY  284
             L NLE L M Y+   +       ++ +  SLKVL + +       P  D    KK+EEL 
Sbjct  434   LSNLEHLTMDYSNNLKNEFFK--SIGELTSLKVLSLRYCNINDTLPPADWSKLKKIEELD  491

Query  285   LFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFE---  455
             L    F   +  S     SL+ L++  N F        +I  L +L+    ++N FE   
Sbjct  492   LSGNEFEGPLPSSFVNMTSLRELEISHNHFIGN--FDSNIASLTSLEYFGFTENQFEVPV  549

Query  456   GFETSANHS-------GSSRHTIRNK----SYLEVLHLNNISFDMTKLLSSLAAFP----  590
              F T ANHS       G +R  + ++    +++    L  +S   T    SL   P    
Sbjct  550   SFSTFANHSKIKLIDGGGNRFILDSQHSLPTWIPKFQLQELSVSSTTETKSLP-LPNFLL  608

Query  591   ---SIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLS  761
                S+ +L+     +        L+N + + E      +    F   +  + +L  + +S
Sbjct  609   YQNSLISLDFSSWKLEGDFPYWLLENNTKMTEALFRNCSFTGTFQLPMRSLPNLSKIDVS  668

Query  762   GAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIel  938
                + G +P+  +  +  NLQ L LS N ++G IP   G + SL  ++LS N LS  I  
Sbjct  669   DNIIVGQIPSNNISSIYPNLQFLNLSRNNIQGSIPRELGQMNSLDSLDLSDNHLSREIPK  728

Query  939   splstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPK----  1106
                     L +L + NN  E             L +       ++ D +L G +P     
Sbjct  729   DIFGVGHRLNFLKLSNNKLE----------GPILNIPNGLETLLLNDNRLTGRLPSNIFN  778

Query  1107  FQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNN  1286
               + SL +SN   + K+P  +     L+ L +  N+ EG  P  L +    L Y  ++ N
Sbjct  779   ASIISLDVSNNHLMGKIPSLVKNFSGLRQLFLFNNHFEGSIPLELAKL-EDLNYLDLSKN  837

Query  1287  AFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG  1466
               TGS+   S VNP+L+ I++SNN L G     F+ +  +++ L+LS N  +  +  +I 
Sbjct  838   NLTGSVP--SFVNPSLRFIHLSNNHLRGLPKRMFNGT-SSLVTLDLSYNEITNSVQDIIQ  894

Query  1467  ----THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSS-----  1619
                 T L  L L  N F G+IPK+ L     L IL LS+N   G I      +S      
Sbjct  895   ELKYTRLNILLLKGNHFIGDIPKQ-LCQLIHLSILDLSHNNFSGAIPNCLGKMSFENKDP  953

Query  1620  ---LEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNH  1790
                LE L   G+  +  I  S        ++    K +    R +  L  +  + LS N 
Sbjct  954   ERFLERLSGWGSTGQNKIFPSQLPNVEEKVNFTSKKRTDTYTRSI--LAYMSGIDLSHNK  1011

Query  1791  LEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLSGQLTRAFFNN  1967
             L G+IP +  NL  +  L+LS N+L G IP+   N    + + LS ++LSGQ+       
Sbjct  1012  LNGNIPFDLGNLTRIRALNLSHNDLIGQIPATFSNLVQTESLDLSFNKLSGQIPPQLSKL  1071

Query  1968  TALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
             T+L +  +++N+  G  PEW G  S   +    GN F    P
Sbjct  1072  TSLEVFSVAHNNLSGTTPEWKGQFSTFENSSYEGNPFLCGPP  1113



>gb|KDO38653.1| hypothetical protein CISIN_1g004005mg [Citrus sinensis]
Length=779

 Score =   329 bits (844),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 241/567 (43%), Positives = 338/567 (60%), Gaps = 29/567 (5%)
 Frame = +3

Query  582   AFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIG-PMESLKVLSL  758
              FP  K+LE   ++ T I              L+     L+  FL  I   M SLK LSL
Sbjct  14    GFPHFKSLEHFDMDFTRI-------------ALNTSFIALNTSFLQIISESMPSLKYLSL  60

Query  759   S----GAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSG  926
             S    G    GTL ++GLC L +LQEL+++ N L G +P    N+TSLR +++S N+L+G
Sbjct  61    SYYTLGTNSSGTL-DQGLCSLVHLQELYIASNDLRGSLPWCMANMTSLRILDVSSNQLTG  119

Query  927   NIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQGFV-  1100
             +I  SPL  LTS+E L + NN F++  S     N S+L++  A+ N++ A+ T+    + 
Sbjct  120   SISSSPLVHLTSIEELMLSNNYFQIPISLEPLFNYSRLKIFNAENNEIKAEITESHSLIA  179

Query  1101  PKFQLDSLSLS-NCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLM  1277
             PKFQL++LSLS N  D    P+FL++Q DL+ + +S   + GEFP+WLL+NNTKL+   +
Sbjct  180   PKFQLNTLSLSSNYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPNWLLENNTKLETLFL  239

Query  1278  NNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHS  1457
              N++  G  +L  H +  L+ ++VSNN + G I        P++   N S N   G + S
Sbjct  240   VNDSLAGPFRLPIHSHKRLRQLDVSNNNIRGHIPVKIGDVLPSLYVFNNSMNALDGSIPS  299

Query  1458  LIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYL  1631
               G    L  LDLSNN  TGEIP+ + + C +L  L LSNN L+G +      L++L++L
Sbjct  300   SFGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQFLALSNNNLQGHLFSRNFNLTNLQWL  359

Query  1632  HLDGNNFEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIP  1808
              L+GN F G IP SLS       L + +N L G+IPRW+G LT L  + +  NHLEG IP
Sbjct  360   QLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLLGKIPRWLGNLTRLQYIIMPNNHLEGPIP  419

Query  1809  IEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNTALVIL  1985
             +EFC L SL ILD+S+NN++GS+PSC +P SIK V LSK+ L GQL R  FFN ++LV L
Sbjct  420   VEFCQLDSLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTL  479

Query  1986  DLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIP  2165
             DLSYN   G IP+W+  +S+LS L+L  N  EG+V  Q+C+L +L LLDLSNN L G IP
Sbjct  480   DLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVSVQLCELNQLQLLDLSNNNLHGPIP  539

Query  2166  RCLGKISLEGTNEQFRGINLPFEYYSI  2246
              C    +L   +E +   + P E + I
Sbjct  540   PCFDNTTL---HESYSNSSSPDEQFEI  563


 Score =   132 bits (333),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 189/681 (28%), Positives = 298/681 (44%), Gaps = 114/681 (17%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   +    SL+ILD+  N    G +    +  L +++EL LS+NY
Sbjct  83    LQELYIASNDLRGSLPWCMANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEELMLSNNY  141

Query  450   FEGFETSANHSGSSRHTIRNKSYLEVLHLNN--ISFDMTKLLSSLAAFPSIKTLEL----  611
             F+           S   + N S L++ +  N  I  ++T+  S +A    + TL L    
Sbjct  142   FQ--------IPISLEPLFNYSRLKIFNAENNEIKAEITESHSLIAPKFQLNTLSLSSNY  193

Query  612   -----------QRVNVTNIDAIHA----------LKNLSSLEELHLDGSNLHKDFLSNIG  728
                         + ++  +D  H           L+N + LE L L   +L   F   I 
Sbjct  194   GDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPNWLLENNTKLETLFLVNDSLAGPFRLPIH  253

Query  729   PMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLS  908
               + L+ L +S   + G +P K    L +L     S N L+G IPS FGN+  L+ ++LS
Sbjct  254   SHKRLRQLDVSNNNIRGHIPVKIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLS  313

Query  909   LNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQL  1088
              N L+G I         +L++L++ NN+ +     R+F N + L+ +  + N+ +     
Sbjct  314   NNHLTGEIPEHLAVGCVNLQFLALSNNNLQGHLFSRNF-NLTNLQWLQLEGNRFV-----  367

Query  1089  QGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQY  1268
              G +P+      SLS C               L+ L ++ N+L G+ P WL  N T+LQY
Sbjct  368   -GEIPQ------SLSKC-------------SSLEGLYLNNNSLLGKIPRWL-GNLTRLQY  406

Query  1269  FLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQ  1448
              +M NN   G + +      +LQI+++S+N + G +   F     +I  ++LS N+  GQ
Sbjct  407   IIMPNNHLEGPIPVEFCQLDSLQILDISDNNISGSLPSCFHPL--SIKQVHLSKNMLHGQ  464

Query  1449  LHSLIGT-----HLGFLDLSNNSFTGEIPKEM-----------------------LISCS  1544
             L    GT      L  LDLS N   G IP  +                       L   +
Sbjct  465   LKR--GTFFNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVSVQLCELN  522

Query  1545  SLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN-------FE--GTIpnslsnlplhs  1697
              L +L LSNN L G I   FD  +    LH   +N       FE   +I      L   +
Sbjct  523   QLQLLDLSNNNLHGPIPPCFDNTT----LHESYSNSSSPDEQFEIFFSIEGHQGFLEKQN  578

Query  1698  lDIRDNKLSGEIPRWMGRLTSLVQLTLSK-NHLEGHIPIEFCNLKSLSILDLSENNLTGS  1874
              +I +         + G++ SL+       N L GHIP +  NL  +  L+LS NNLTGS
Sbjct  579   HEIFEFTTKNIAYIYQGKVLSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGS  638

Query  1875  IPSCLNPSSIKHVS---LSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsr  2045
             IPS    S++KHV    LS ++L+G++         L +  ++YN+  G IPEW    + 
Sbjct  639   IPSTF--SNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWKAQFAT  696

Query  2046  lsslllNGNRFEGKVPTQVCQ  2108
              +     GN F   +P  +C+
Sbjct  697   FNESSYEGNTFLCGLPLPICR  717



>ref|XP_006366099.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Solanum tuberosum]
Length=709

 Score =   327 bits (838),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 213/513 (42%), Positives = 301/513 (59%), Gaps = 15/513 (3%)
 Frame = +3

Query  879   LTSLRYVNLSLNKLSGNIelsplstltsleyls-IMNNSFEVASSFRSFANNSKLRVILA  1055
             +TSLR+++ S N   GNI    +    +      I +N F+V  SF  F+N +KL  +  
Sbjct  1     MTSLRWLSFSGNYFMGNIASHSIWRRLTSLEYLDIADNQFDVPLSFSQFSNQTKLISLDV  60

Query  1056  DRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPS  1235
               N +I DT+ Q ++P FQL+   +  CI L K P FLHYQ DL++L I  N L G FP+
Sbjct  61    GYNTIITDTEFQNWIPNFQLEFFGIGECISLHKFPSFLHYQYDLRILVIYANQLAGNFPT  120

Query  1236  WLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILA  1415
             WLL+NNT+L     ++NAF G  KL  + + +L+ I+VSNNKL G I  N S +FP +  
Sbjct  121   WLLENNTRLAAIYGDDNAFNGPFKLPLNRHLHLETIDVSNNKLNGYIPANMSLAFPKLTF  180

Query  1416  LNLSSNLFSGQLHS-LIGTHLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI  1592
             LN+S N   G + S   G HL FLDLS N  +G +P ++ I    L  L+LSNNKL+G+I
Sbjct  181   LNMSKNNLEGPIPSKFCGIHLEFLDLSVNILSGGVPSDLAIGSPQLFYLRLSNNKLKGKI  240

Query  1593  VQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQL  1772
               E      L +L+L+ NNFEG +P+++    L  LD   N  +GEIPRW+   T L+QL
Sbjct  241   FSEEVRPHILSFLYLNDNNFEGPLPSNIFLRSLIVLDASRNNFTGEIPRWIMDNTRLLQL  300

Query  1773  TLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTR  1952
              LSKN LEG IP+E CNLKS+ +L +SEN L+G IPSC++   ++H+ L K+QL G+L  
Sbjct  301   DLSKNLLEGLIPVEICNLKSIYVLAISENKLSGFIPSCVSSLPLEHIHLEKNQLGGELGH  360

Query  1953  AFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslld  2132
               FN + L+ LDL YN+F G IP  IG+++ L+ LLL  N+ EG++PTQ+C L  LS++D
Sbjct  361   VLFNLSFLITLDLGYNNFTGNIPHTIGSLNSLNYLLLRNNQLEGQIPTQICMLNDLSIVD  420

Query  2133  lsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSIND-----AILDRLHYEWGSDDE  2297
             LS N L G +  CL  ++    +   R       YY+        A L  + ++    D 
Sbjct  421   LSFNKLYGPLLPCLSNLTQAKKDAHLR-----MAYYATTSRDSWLAFLGWIRWKRHYYDR  475

Query  2298  Y---IPMLAVDVLPEVQFRTKGNLYNYQNSILK  2387
             +        +DV  +VQF TK N Y Y+ SIL+
Sbjct  476   HGLITTSFLMDVETQVQFSTKRNSYTYKRSILE  508


 Score = 89.4 bits (220),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 143/532 (27%), Positives = 230/532 (43%), Gaps = 84/532 (16%)
 Frame = +3

Query  651   LKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELW  830
             L+N + L  ++ D +  +  F   +     L+ + +S  ++ G +P         L  L 
Sbjct  123   LENNTRLAAIYGDDNAFNGPFKLPLNRHLHLETIDVSNNKLNGYIPANMSLAFPKLTFLN  182

Query  831   LSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASS  1010
             +S+N LEG IPS F  +  L +++LS+N LSG +          L YL + NN  +    
Sbjct  183   MSKNNLEGPIPSKFCGI-HLEFLDLSVNILSGGVPSDLAIGSPQLFYLRLSNNKLKG---  238

Query  1011  FRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLK  1190
              + F+   +  ++       + D   +G +P         SN            + R L 
Sbjct  239   -KIFSEEVRPHIL---SFLYLNDNNFEGPLP---------SNI-----------FLRSLI  274

Query  1191  VLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCG  1370
             VL  SRNN  GE P W++ +NT+L    ++ N   G + +      ++ ++ +S NKL G
Sbjct  275   VLDASRNNFTGEIPRWIM-DNTRLLQLDLSKNLLEGLIPVEICNLKSIYVLAISENKLSG  333

Query  1371  EISGNFSSSFPNILALNLSSNLFSGQL-HSLIG-THLGFLDLSNNSFTGEIPKEMLISCS  1544
              I  +  SS P +  ++L  N   G+L H L   + L  LDL  N+FTG IP   + S +
Sbjct  334   FIP-SCVSSLP-LEHIHLEKNQLGGELGHVLFNLSFLITLDLGYNNFTGNIP-HTIGSLN  390

Query  1545  SLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDI------  1706
             SL  L L NN+LEGQI  +   L+ L  + L  N   G +   LSNL     D       
Sbjct  391   SLNYLLLRNNQLEGQIPTQICMLNDLSIVDLSFNKLYGPLLPCLSNLTQAKKDAHLRMAY  450

Query  1707  -----RDNKLS--GEIPRWM-------GRLTS----------------------------  1760
                  RD+ L+  G I RW        G +T+                            
Sbjct  451   YATTSRDSWLAFLGWI-RWKRHYYDRHGLITTSFLMDVETQVQFSTKRNSYTYKRSILEY  509

Query  1761  LVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL-NPSSIKHVSLSKHQLS  1937
             +  + LS N L G IP+E  N+ ++  L+LS+N+L G IP    N   I+ + LS ++L+
Sbjct  510   MSGIDLSSNRLTGEIPVELGNMSNIHALNLSQNHLIGRIPYTFSNLQEIESLDLSYNRLN  569

Query  1938  GQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
             G +        +L +  ++YN+  G +P++       +     GN F    P
Sbjct  570   GSIPVDLLELNSLAVFSVAYNNLSGAVPDFKAQFGTFNKSSYEGNPFLCGYP  621



>gb|KDO38654.1| hypothetical protein CISIN_1g004005mg [Citrus sinensis]
Length=717

 Score =   327 bits (837),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 220/504 (44%), Positives = 315/504 (63%), Gaps = 10/504 (2%)
 Frame = +3

Query  756   LSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIe  935
             +S  +V G + ++GLC L +LQEL+++ N L G +P    N+TSLR +++S N+L+G+I 
Sbjct  1     MSSCEVNGVVRSQGLCSLVHLQELYIASNDLRGSLPWCMANMTSLRILDVSSNQLTGSIS  60

Query  936   lsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQGFV-PKF  1109
              SPL  LTS+E L + NN F++  S     N S+L++  A+ N++ A+ T+    + PKF
Sbjct  61    SSPLVHLTSIEELMLSNNYFQIPISLEPLFNYSRLKIFNAENNEIKAEITESHSLIAPKF  120

Query  1110  QLDSLSLS-NCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNN  1286
             QL++LSLS N  D    P+FL++Q DL+ + +S   + GEFP+WLL+NNTKL+   + N+
Sbjct  121   QLNTLSLSSNYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPNWLLENNTKLETLFLVND  180

Query  1287  AFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG  1466
             +  G  +L  H +  L+ ++VSNN + G I        P++   N S N   G + S  G
Sbjct  181   SLAGPFRLPIHSHKRLRQLDVSNNNIRGHIPVKIGDVLPSLYVFNNSMNALDGSIPSSFG  240

Query  1467  --THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLD  1640
                 L  LDLSNN  TGEIP+ + + C +L  L LSNN L+G +      L++L++L L+
Sbjct  241   NMKFLQILDLSNNHLTGEIPEHLAVGCVNLQFLALSNNNLQGHLFSRNFNLTNLQWLQLE  300

Query  1641  GNNFEGTIpnslsnlplhs-lDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEF  1817
             GN F G IP SLS       L + +N L G+IPRW+G LT L  + +  NHLEG IP+EF
Sbjct  301   GNRFVGEIPQSLSKCSSLEGLYLNNNSLLGKIPRWLGNLTRLQYIIMPNNHLEGPIPVEF  360

Query  1818  CNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLS  1994
             C L SL ILD+S+NN++GS+PSC +P SIK V LSK+ L GQL R  FFN ++LV LDLS
Sbjct  361   CQLDSLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLS  420

Query  1995  YNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCL  2174
             YN   G IP+W+  +S+LS L+L  N  EG+V  Q+C+L +L LLDLSNN L G IP C 
Sbjct  421   YNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVSVQLCELNQLQLLDLSNNNLHGPIPPCF  480

Query  2175  GKISLEGTNEQFRGINLPFEYYSI  2246
                +L   +E +   + P E + I
Sbjct  481   DNTTL---HESYSNSSSPDEQFEI  501


 Score =   133 bits (334),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 189/681 (28%), Positives = 298/681 (44%), Gaps = 114/681 (17%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             L+ELY+       S+   +    SL+ILD+  N    G +    +  L +++EL LS+NY
Sbjct  21    LQELYIASNDLRGSLPWCMANMTSLRILDVSSNQL-TGSISSSPLVHLTSIEELMLSNNY  79

Query  450   FEGFETSANHSGSSRHTIRNKSYLEVLHLNN--ISFDMTKLLSSLAAFPSIKTLEL----  611
             F+           S   + N S L++ +  N  I  ++T+  S +A    + TL L    
Sbjct  80    FQ--------IPISLEPLFNYSRLKIFNAENNEIKAEITESHSLIAPKFQLNTLSLSSNY  131

Query  612   -----------QRVNVTNIDAIHA----------LKNLSSLEELHLDGSNLHKDFLSNIG  728
                         + ++  +D  H           L+N + LE L L   +L   F   I 
Sbjct  132   GDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPNWLLENNTKLETLFLVNDSLAGPFRLPIH  191

Query  729   PMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLS  908
               + L+ L +S   + G +P K    L +L     S N L+G IPS FGN+  L+ ++LS
Sbjct  192   SHKRLRQLDVSNNNIRGHIPVKIGDVLPSLYVFNNSMNALDGSIPSSFGNMKFLQILDLS  251

Query  909   LNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQL  1088
              N L+G I         +L++L++ NN+ +     R+F N + L+ +  + N+ +     
Sbjct  252   NNHLTGEIPEHLAVGCVNLQFLALSNNNLQGHLFSRNF-NLTNLQWLQLEGNRFV-----  305

Query  1089  QGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQY  1268
              G +P+      SLS C               L+ L ++ N+L G+ P WL  N T+LQY
Sbjct  306   -GEIPQ------SLSKC-------------SSLEGLYLNNNSLLGKIPRWL-GNLTRLQY  344

Query  1269  FLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQ  1448
              +M NN   G + +      +LQI+++S+N + G +   F     +I  ++LS N+  GQ
Sbjct  345   IIMPNNHLEGPIPVEFCQLDSLQILDISDNNISGSLPSCFHPL--SIKQVHLSKNMLHGQ  402

Query  1449  LHSLIGT-----HLGFLDLSNNSFTGEIPKEM-----------------------LISCS  1544
             L    GT      L  LDLS N   G IP  +                       L   +
Sbjct  403   LKR--GTFFNCSSLVTLDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVSVQLCELN  460

Query  1545  SLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN-------FE--GTIpnslsnlplhs  1697
              L +L LSNN L G I   FD  +    LH   +N       FE   +I      L   +
Sbjct  461   QLQLLDLSNNNLHGPIPPCFDNTT----LHESYSNSSSPDEQFEIFFSIEGHQGFLEKQN  516

Query  1698  lDIRDNKLSGEIPRWMGRLTSLVQLTLSK-NHLEGHIPIEFCNLKSLSILDLSENNLTGS  1874
              +I +         + G++ SL+       N L GHIP +  NL  +  L+LS NNLTGS
Sbjct  517   HEIFEFTTKNIAYIYQGKVLSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGS  576

Query  1875  IPSCLNPSSIKHVS---LSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsr  2045
             IPS    S++KHV    LS ++L+G++         L +  ++YN+  G IPEW    + 
Sbjct  577   IPSTF--SNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWKAQFAT  634

Query  2046  lsslllNGNRFEGKVPTQVCQ  2108
              +     GN F   +P  +C+
Sbjct  635   FNESSYEGNTFLCGLPLPICR  655



>ref|XP_006489902.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Citrus sinensis]
Length=1367

 Score =   337 bits (865),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 278/794 (35%), Positives = 419/794 (53%), Gaps = 102/794 (13%)
 Frame = +3

Query  129   MRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQ  308
             +  T  E   +LS   L +F +L+ L + F+   +   +  +     L++L +  C  N 
Sbjct  350   LTMTNCEVNGVLSGQELHNFANLEYLALDFSSLHT-SLLQSIASFTSLKKLSMTNCEVNG  408

Query  309   SI----FQSLKGFPSLKILDLMDNDF-----------------------YDGPLHIQDIN  407
              +     ++L    +LK+LDL  N F                        +G +++++ +
Sbjct  409   VLSGQALETLSRLTNLKMLDLRGNLFNNSILSSLAHLSSLTSLDLSENKLEGSINVKEFD  468

Query  408   DLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISF-DMTKLLSSLAA  584
              L NL+EL +S N  + F+    + G  +        L+ LHL+ +   D +KLL S+ +
Sbjct  469   SLSNLEELDMSGNEIDNFQVPQGYGGLRK--------LKSLHLSRVGIRDGSKLLRSMGS  520

Query  585   FPSIKTLEL--------------QRVNVTNID-------AIH------------ALKNLS  665
             FPS+ TL L              +  N TN++       ++H            +LKNLS
Sbjct  521   FPSLNTLYLWGNNFTETMTTTTQELHNFTNLEYLTLDHSSLHISLLQSIASISPSLKNLS  580

Query  666   -------------------SLEELHLDGSN--LHKDFLSNIGP-MESLKVLSLSGAQVGG  779
                                SLE L +D +   L+  FL  IG  M SLK LSLS +  G 
Sbjct  581   MCGCEINGVVRGQGFPHFKSLEHLEMDDARIALNTSFLQIIGELMPSLKYLSLSYSTPGT  640

Query  780   T---LPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
                 + ++GLC L ++QEL ++ N L G +P    N+TSLR +++S N+L+G+I  SPL 
Sbjct  641   NSIEILDQGLCSLMHMQELHIAHNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLI  700

Query  951   tltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIAD-TQLQGFVPKFQLDSLS  1127
              LTS+E L + +N F +  S     N+S+L++  A  N++ A+ TQ     P FQL  LS
Sbjct  701   HLTSIEELRLSDNHFRIPISLEPLFNHSRLQIFDAYNNEINAEITQSPSLTPNFQLSHLS  760

Query  1128  LS-NCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSL  1304
             LS    D +  P+FL++Q DL  + +S   + G FP+WLL+NNT+L+   + N++  G  
Sbjct  761   LSFGYGDGVTFPKFLYHQHDLVNVDLSHIKMNGGFPNWLLENNTRLETLSLVNDSLAGPF  820

Query  1305  KLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGT--HLG  1478
             +L  H +  L++++VSNN   G I        P++++ N+S N  +G + S  G    L 
Sbjct  821   RLPIHSHKQLRLLDVSNNNFQGHIPVEIGDILPSLISFNISMNALNGSIPSSFGNINSLQ  880

Query  1479  FLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEG  1658
              LDLSNN   GEIP+ + + C +L  L LSNN LEG +      L++L +L L+ N+F G
Sbjct  881   ILDLSNNQLIGEIPEHLAVGCVNLEYLTLSNNNLEGHMFTRNFNLTNLRWLQLESNHFVG  940

Query  1659  TI-pnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSL  1835
              I  +      L  L + +N LSG+IPRW+G L  L  + + +NHLEG IP+EFC L SL
Sbjct  941   EIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLKGLKHIIMPENHLEGPIPMEFCQLYSL  1000

Query  1836  SILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRA-FFNNTALVILDLSYNSFVG  2012
              +LD+S+NN++GS+PSC +  SI+ V LSK+ L GQL R  FFN ++LV LDLSYN   G
Sbjct  1001  QLLDISDNNISGSLPSCFHLLSIEQVHLSKNMLRGQLKRGTFFNCSSLVTLDLSYNRLNG  1060

Query  2013  IIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLE  2192
              IP W+  +S+L  L+L  N  EG+VP Q+C L +L LLDLSNN L G IP C    +L 
Sbjct  1061  SIPNWVDGLSQLRHLILGHNNLEGEVPVQLCGLNQLQLLDLSNNNLHGHIPPCFDNTTLH  1120

Query  2193  GTNEQFRGINLPFE  2234
              +      +  PFE
Sbjct  1121  ESYSNSSSLK-PFE  1133


 Score =   130 bits (326),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 186/665 (28%), Positives = 291/665 (44%), Gaps = 84/665 (13%)
 Frame = +3

Query  270   LEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNY  449
             ++EL++       S+   L    SL+ILD+  N    G +    +  L +++EL LSDN+
Sbjct  656   MQELHIAHNDLRGSLPWCLANMTSLRILDVSSNQL-TGSISSSPLIHLTSIEELRLSDNH  714

Query  450   FE---GFETSANHSG-SSRHTIRNKSYLEVLHLNNIS--FDMTKLLSSLA-----AFPSI  596
             F      E   NHS         N+   E+    +++  F ++ L  S        FP  
Sbjct  715   FRIPISLEPLFNHSRLQIFDAYNNEINAEITQSPSLTPNFQLSHLSLSFGYGDGVTFP--  772

Query  597   KTLELQRVNVTNIDAIHA----------LKNLSSLEELHLDGSNLHKDFLSNIGPMESLK  746
             K L  Q  ++ N+D  H           L+N + LE L L   +L   F   I   + L+
Sbjct  773   KFLYHQH-DLVNVDLSHIKMNGGFPNWLLENNTRLETLSLVNDSLAGPFRLPIHSHKQLR  831

Query  747   VLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSG  926
             +L +S     G +P +    L +L    +S N L G IPS FGN+ SL+ ++LS N+L G
Sbjct  832   LLDVSNNNFQGHIPVEIGDILPSLISFNISMNALNGSIPSSFGNINSLQILDLSNNQLIG  891

Query  927   NIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPK  1106
              I         +LEYL++ NN+ E     R+F N + LR +  + N  + +   Q     
Sbjct  892   EIPEHLAVGCVNLEYLTLSNNNLEGHMFTRNF-NLTNLRWLQLESNHFVGEIP-QSLSKC  949

Query  1107  FQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNN  1286
               L+ L L+N     K+PR+L   + LK + +  N+LEG  P    Q  + LQ   +++N
Sbjct  950   SSLEGLYLNNNSLSGKIPRWLGNLKGLKHIIMPENHLEGPIPMEFCQLYS-LQLLDISDN  1008

Query  1287  AFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG  1466
               +GSL    H+  +++ +++S N L G++      +  +++ L+LS N  +G + + + 
Sbjct  1009  NISGSLPSCFHL-LSIEQVHLSKNMLRGQLKRGTFFNCSSLVTLDLSYNRLNGSIPNWVD  1067

Query  1467  --THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYL---------  1613
               + L  L L +N+  GE+P + L   + L +L LSNN L G I   FD           
Sbjct  1068  GLSQLRHLILGHNNLEGEVPVQ-LCGLNQLQLLDLSNNNLHGHIPPCFDNTTLHESYSNS  1126

Query  1614  SSLEYLHLDGNNFEGTIpnslsnlplhslDIRD--------------------NKLSGEI  1733
             SSL+   +      G I        +     ++                    NKL G I
Sbjct  1127  SSLKPFEISLVMESGMIYAEKQIHEIFEFTTKNIAHIYQGKVLSLLSGLDLSCNKLIGHI  1186

Query  1734  PRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHV  1913
             P  +G LT +  L LS N+L G IP  F NLK +  LDLS N L G IP           
Sbjct  1187  PPQIGNLTRIQTLNLSHNNLIGSIPSTFSNLKQIESLDLSYNKLNGKIP-----------  1235

Query  1914  SLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
                 HQL            AL +  ++YN+  G IPE     +  +     GN F   +P
Sbjct  1236  ----HQL--------MELNALAVFSVAYNNLSGEIPECKAQFATFNERSYEGNTFLCGLP  1283

Query  2094  TQVCQ  2108
               +C+
Sbjct  1284  LPICR  1288


 Score =   124 bits (310),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 233/867 (27%), Positives = 375/867 (43%), Gaps = 174/867 (20%)
 Frame = +3

Query  54    NPLNSHLNNSGNERLTGLINLEELHMR------------------------YTQME-EIN  158
             N +   + N G ERL+ L NL+ L +                         Y ++E  I+
Sbjct  109   NKIAGCVENEGLERLSKLNNLKMLDLSENLFDNSILSFVGRLSSLRSLKLSYNRLEGSID  168

Query  159   ILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFP  338
             +  + +L+D   L+ LDIG+NK   F       G +KL+ L L   + N SI  SL  F 
Sbjct  169   VKELDSLRD---LEELDIGWNKIDKFVV---SKGLRKLKYLGLSGNKLNHSILSSLTIFS  222

Query  339   SLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSY  518
              L+ L L D  F  G   +++ N   NL+ L +S+N  +       + G     +RN   
Sbjct  223   LLRELYLRDTGF-KGTFDVREFNSFNNLEALDMSNNEIDNLVVPQGYRG-----LRN---  273

Query  519   LEVLHLNNISF-DMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGS  695
             L+ L L+ +   D + LL S+ +FPS+ TL L   N   ID    L N ++LE L LD S
Sbjct  274   LKSLDLSEVGIRDGSNLLRSMGSFPSLNTLYLTSNNF--IDTTSELHNFTNLEYLALDSS  331

Query  696   NLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFG  875
             +LH   L +I    SLK+L+++  +V G L  + L    NL+ L L  + L   +     
Sbjct  332   SLHISLLQSIASFTSLKILTMTNCEVNGVLSGQELHNFANLEYLALDFSSLHTSLLQSIA  391

Query  876   NLTSLRYVNLSLNKLSGNIelsplstltsleylsIMN---NSFEVASSFRSFANNSKLRV  1046
             + TSL+ ++++  +++G +    L TL+ L  L +++   N F  +        +S   +
Sbjct  392   SFTSLKKLSMTNCEVNGVLSGQALETLSRLTNLKMLDLRGNLFNNSILSSLAHLSSLTSL  451

Query  1047  ILADRNKVIADTQLQGFVPKFQLDSLSLS-NCIDLLKLPRFLHYQRDLKVLRISRNNLE-  1220
              L++ NK+     ++ F     L+ L +S N ID  ++P+     R LK L +SR  +  
Sbjct  452   DLSE-NKLEGSINVKEFDSLSNLEELDMSGNEIDNFQVPQGYGGLRKLKSLHLSRVGIRD  510

Query  1221  --------GEFPS------W-------------LLQNNTKLQYFLMNNNAFTGSLKLS-S  1316
                     G FPS      W              L N T L+Y  +++++   SL  S +
Sbjct  511   GSKLLRSMGSFPSLNTLYLWGNNFTETMTTTTQELHNFTNLEYLTLDHSSLHISLLQSIA  570

Query  1317  HVNPNLQIINVSNNKLCGEISGNFSSSFPNI---------LALNLSSNLFSGQL------  1451
              ++P+L+ +++   ++ G + G     F ++         +ALN S     G+L      
Sbjct  571   SISPSLKNLSMCGCEINGVVRGQGFPHFKSLEHLEMDDARIALNTSFLQIIGELMPSLKY  630

Query  1452  ----HSLIGT--------------HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNK  1577
                 +S  GT              H+  L +++N   G +P   L + +SL IL +S+N+
Sbjct  631   LSLSYSTPGTNSIEILDQGLCSLMHMQELHIAHNDLRGSLPW-CLANMTSLRILDVSSNQ  689

Query  1578  LEGQIVQE-FDYLSSLEYLHLDGNNFEGTIpnsls--nlplhslDIRDNKLSGEI-----  1733
             L G I      +L+S+E L L  N+F   I       +  L   D  +N+++ EI     
Sbjct  690   LTGSISSSPLIHLTSIEELRLSDNHFRIPISLEPLFNHSRLQIFDAYNNEINAEITQSPS  749

Query  1734  ----------------------PRWMGRLTSLVQLTLSKNHLEGHIP---------IEFC  1820
                                   P+++     LV + LS   + G  P         +E  
Sbjct  750   LTPNFQLSHLSLSFGYGDGVTFPKFLYHQHDLVNVDLSHIKMNGGFPNWLLENNTRLETL  809

Query  1821  NL----------------KSLSILDLSENNLTGSIPSCLN---PSSIKHVSLSKHQLSGQ  1943
             +L                K L +LD+S NN  G IP  +    PS I   ++S + L+G 
Sbjct  810   SLVNDSLAGPFRLPIHSHKQLRLLDVSNNNFQGHIPVEIGDILPSLIS-FNISMNALNGS  868

Query  1944  LTRAFFNNTALVILDLSYNSFVGIIPE--WIGTIsrlsslllNGNRFEGKVPTQVCQLMR  2117
             +  +F N  +L ILDLS N  +G IPE   +G ++     L N N  EG + T+   L  
Sbjct  869   IPSSFGNINSLQILDLSNNQLIGEIPEHLAVGCVNLEYLTLSN-NNLEGHMFTRNFNLTN  927

Query  2118  lslldlsnnllsGVIPRCLGKI-SLEG  2195
             L  L L +N   G IP+ L K  SLEG
Sbjct  928   LRWLQLESNHFVGEIPQSLSKCSSLEG  954


 Score = 60.5 bits (145),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 119/389 (31%), Positives = 180/389 (46%), Gaps = 81/389 (21%)
 Frame = +3

Query  729   PMESLKVLSLSGAQVGGTLPNKGL---CELKNLQELWLSENQLEGKIPSYFGNLTSLRYV  899
             P + L+ L LS  ++ G + N+GL    +L NL+ L LSEN  +  I S+ G L+SLR +
Sbjct  97    PFQQLESLDLSWNKIAGCVENEGLERLSKLNNLKMLDLSENLFDNSILSFVGRLSSLRSL  156

Query  900   NLSLNKLSGNIelsplstltsleylsIMNN---SFEVASSFR-----SFANN-------S  1034
              LS N+L G+I++  L +L  LE L I  N    F V+   R       + N       S
Sbjct  157   KLSYNRLEGSIDVKELDSLRDLEELDIGWNKIDKFVVSKGLRKLKYLGLSGNKLNHSILS  216

Query  1035  KLRVILADRNKVIADTQLQGF--VPKF----QLDSLSLSNC-IDLLKLPRFLHYQRDLKV  1193
              L +    R   + DT  +G   V +F     L++L +SN  ID L +P+     R+LK 
Sbjct  217   SLTIFSLLRELYLRDTGFKGTFDVREFNSFNNLEALDMSNNEIDNLVVPQGYRGLRNLKS  276

Query  1194  LRISRNNLE---------GEFPS----WLLQNN-----------TKLQYFLMNNNAFTGS  1301
             L +S   +          G FPS    +L  NN           T L+Y  +++++   S
Sbjct  277   LDLSEVGIRDGSNLLRSMGSFPSLNTLYLTSNNFIDTTSELHNFTNLEYLALDSSSLHIS  336

Query  1302  LKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNI--LALNLSSNLFSGQLHSLIG-TH  1472
             L  S     +L+I+ ++N ++ G +SG    +F N+  LAL+ SS L +  L S+   T 
Sbjct  337   LLQSIASFTSLKILTMTNCEVNGVLSGQELHNFANLEYLALDFSS-LHTSLLQSIASFTS  395

Query  1473  LGFLDLSNNSFTGEIPKEMLISCSSLVILKL---------------------------SN  1571
             L  L ++N    G +  + L + S L  LK+                           S 
Sbjct  396   LKKLSMTNCEVNGVLSGQALETLSRLTNLKMLDLRGNLFNNSILSSLAHLSSLTSLDLSE  455

Query  1572  NKLEGQI-VQEFDYLSSLEYLHLDGNNFE  1655
             NKLEG I V+EFD LS+LE L + GN  +
Sbjct  456   NKLEGSINVKEFDSLSNLEELDMSGNEID  484



>ref|XP_011009769.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 isoform X8 [Populus euphratica]
Length=1003

 Score =   328 bits (840),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 278/754 (37%), Positives = 407/754 (54%), Gaps = 67/754 (9%)
 Frame = +3

Query  186   FISLKVLDIGFNKFQSFGPINDVGG---AKKLEELYLFECRFNQSIFQSLKG-FPSLKIL  353
             F  L+ LD+G N     G + + G    + KL EL L   RFN+SI     G   +LK L
Sbjct  97    FKELQSLDLGSNGL--VGCLENEGFEVLSSKLRELDLSYNRFNKSILSCFNGNLSTLKSL  154

Query  354   DLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLH  533
             DL DN    G                            S +  G    + R K  LE L 
Sbjct  155   DLSDNGLTAG----------------------------SGSFYGLKVLSSRLKK-LENLD  185

Query  534   LNNISFDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDF  713
             L    ++   +  SL  F S+K+L L    +T          L  LE LHL G+  +   
Sbjct  186   LGWNEYN-DGIFPSLTGFSSLKSLYLSYNELTGSGFKVLSSRLKKLENLHLGGNQYNDSI  244

Query  714   LSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLR  893
              S++    SLK L LS  Q+ G++     CELKNL++L LS N L G +P   GNL+SL+
Sbjct  245   FSSLTEFSSLKSLDLSYNQLTGSI--NSWCELKNLKQLDLSRNNLGGSLPDCLGNLSSLQ  302

Query  894   YVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVI  1073
              +++S N+ +GNI   PL+ LTSLE+LS+ NN FEV  S + F N+S L+    + NK++
Sbjct  303   LLDVSKNQFTGNIAFGPLTNLTSLEFLSLSNNFFEVPISMKPFMNHSSLKFFCNENNKLV  362

Query  1074  ADTQL-QGFVPKFQLDSLSLSNCIDLL--KLPRFLHYQRDLKVLRISRNNLEGEFPSWLL  1244
              +  + +  +PKFQL   S+S   + L  ++P FL+YQ  L+ L +S NN+ G FPSWLL
Sbjct  363   TEPAVFEHLIPKFQLVFFSVSKTTEALNVQIPNFLYYQYHLRFLDLSHNNITGMFPSWLL  422

Query  1245  QNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNL  1424
              NNT+L+   ++ N+F G+L+L  H  P +  +++SNN + G+I  +    FPN+ +L +
Sbjct  423   NNNTRLEQLYLSGNSFVGTLQLQEHPYPKMTELDISNNNMTGQIPKDICLIFPNLESLRM  482

Query  1425  SSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQ  1598
             + N F+G + S +G  + L  LDLSNN  +  +  E+L    +L  LKLSNN L GQI  
Sbjct  483   AKNGFTGCIPSCLGNISSLSLLDLSNNQLS-TVTLELL----TLQYLKLSNNNLGGQIPT  537

Query  1599  EFDYLSSLEYLHLDGNNFEGTIpnsls--nlplhslDIRDNKLSGEIPRWMGRLTSLVQL  1772
                  S  EYL+L  NNF G I             +D+ +N+ SG +PR     T+L  +
Sbjct  538   SVFNSSVSEYLYLGDNNFWGQISYFPLNGWKSWIVVDLSNNQFSGMLPRGFVNSTNLEAI  597

Query  1773  TLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTR  1952
              LSKNH +G IP +FC L  +  L LS+NNL+G IPSC +P SI H+ LSK++LSG LT 
Sbjct  598   DLSKNHFKGPIPRDFCKLDQVQYLILSDNNLSGYIPSCFSPPSIIHMHLSKNRLSGPLTY  657

Query  1953  AFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQLMRlslld  2132
              F+N+++LV +DL  N+F G IP WIG +S LS LL+  N F+G++P Q+C L +LS+LD
Sbjct  658   GFYNSSSLVTMDLRDNNFTGSIPNWIGNLSSLSVLLMKANHFDGELPVQLCLLEQLSILD  717

Query  2133  lsnnllsGVIPRCLGKISLEGTNEQF----------RGINLPFEYYSINDAILDRLHYEW  2282
             +S N LSG +P CLG ++ + ++++           R I   + Y ++   ++  ++   
Sbjct  718   VSQNQLSGPLPSCLGNLTFKESSQKALVNLGVLLLPRSIEKAY-YETMGPPVVASMYTLL  776

Query  2283  GSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
                  Y P    +V   V+F TK   Y Y+  IL
Sbjct  777   KG---YWPNFTEEV---VEFTTKNMYYGYKGKIL  804


 Score =   104 bits (259),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 187/740 (25%), Positives = 309/740 (42%), Gaps = 133/740 (18%)
 Frame = +3

Query  177   LKDFISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILD  356
             L  F SLK L + +N+    G        KKLE L+L   ++N SIF SL  F SLK LD
Sbjct  199   LTGFSSLKSLYLSYNELTGSGFKVLSSRLKKLENLHLGGNQYNDSIFSSLTEFSSLKSLD  258

Query  357   LMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEG--------------FETSANH-SGS-  488
             L  N        I    +L+NLK+L LS N   G               + S N  +G+ 
Sbjct  259   LSYNQLTGS---INSWCELKNLKQLDLSRNNLGGSLPDCLGNLSSLQLLDVSKNQFTGNI  315

Query  489   SRHTIRNKSYLEVLHLNNISFDMT--------------------KLLSSLAAFPSI----  596
             +   + N + LE L L+N  F++                     KL++  A F  +    
Sbjct  316   AFGPLTNLTSLEFLSLSNNFFEVPISMKPFMNHSSLKFFCNENNKLVTEPAVFEHLIPKF  375

Query  597   --------KTLELQRVNVTN----------IDAIH----------ALKNLSSLEELHLDG  692
                     KT E   V + N          +D  H           L N + LE+L+L G
Sbjct  376   QLVFFSVSKTTEALNVQIPNFLYYQYHLRFLDLSHNNITGMFPSWLLNNNTRLEQLYLSG  435

Query  693   SNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYF  872
             ++          P   +  L +S   + G +P        NL+ L +++N   G IPS  
Sbjct  436   NSFVGTLQLQEHPYPKMTELDISNNNMTGQIPKDICLIFPNLESLRMAKNGFTGCIPSCL  495

Query  873   GN--------------------LTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNS  992
             GN                    L +L+Y+ LS N L G I  + +   +  EYL + +N+
Sbjct  496   GNISSLSLLDLSNNQLSTVTLELLTLQYLKLSNNNLGGQI-PTSVFNSSVSEYLYLGDNN  554

Query  993   FEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLH  1172
             F    S+  F  N     I+ D    +++ Q  G +P+  ++S                 
Sbjct  555   FWGQISY--FPLNGWKSWIVVD----LSNNQFSGMLPRGFVNS-----------------  591

Query  1173  YQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVS  1352
                +L+ + +S+N+ +G  P    + + ++QY ++++N  +G +  S    P++  +++S
Sbjct  592   --TNLEAIDLSKNHFKGPIPRDFCKLD-QVQYLILSDNNLSGYIP-SCFSPPSIIHMHLS  647

Query  1353  NNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKE  1526
              N+L G ++  F +S  +++ ++L  N F+G + + IG  + L  L +  N F GE+P +
Sbjct  648   KNRLSGPLTYGFYNS-SSLVTMDLRDNNFTGSIPNWIGNLSSLSVLLMKANHFDGELPVQ  706

Query  1527  MLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDI  1706
             + +    L IL +S N+L G +      L+  E       N  G +    S    +   +
Sbjct  707   LCL-LEQLSILDVSQNQLSGPLPSCLGNLTFKESSQKALVNL-GVLLLPRSIEKAYYETM  764

Query  1707  RDNKLSGEIP----RWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGS  1874
                 ++         W      +V+ T +KN   G+   +   L  +S  DLS NN  G+
Sbjct  765   GPPVVASMYTLLKGYWPNFTEEVVEFT-TKNMYYGY---KGKILSYMSGFDLSNNNFVGA  820

Query  1875  IPSCL-NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrls  2051
             IP    N S I  ++LS + L+G +   F N   +  LDLSYN+  G+IP  +  I+ L 
Sbjct  821   IPPEFGNLSEILSLNLSHNNLTGSIPATFSNLKRIESLDLSYNNLNGVIPPQLTEITTLE  880

Query  2052  slllNGNRFEGKVPTQVCQL  2111
                +  N   GK P +  Q 
Sbjct  881   VFSVAHNNLSGKTPERKYQF  900


 Score = 92.8 bits (229),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 171/713 (24%), Positives = 272/713 (38%), Gaps = 165/713 (23%)
 Frame = +3

Query  69    HLNNSGNERLTG-LINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPI  245
              L  SG + L+  L  LE LH+   Q  + +I S  +L +F SLK LD+ +N+    G I
Sbjct  214   ELTGSGFKVLSSRLKKLENLHLGGNQYND-SIFS--SLTEFSSLKSLDLSYNQLT--GSI  268

Query  246   NDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLK  425
             N     K L++L L       S+   L    SL++LD+  N F  G +    + +L +L+
Sbjct  269   NSWCELKNLKQLDLSRNNLGGSLPDCLGNLSSLQLLDVSKNQF-TGNIAFGPLTNLTSLE  327

Query  426   ELYLSDNYFE---GFETSANHSG------SSRHTIRNKSYLEVL--HLNNISFDMTKLLS  572
              L LS+N+FE     +   NHS        +   +   +  E L      + F ++K   
Sbjct  328   FLSLSNNFFEVPISMKPFMNHSSLKFFCNENNKLVTEPAVFEHLIPKFQLVFFSVSKTTE  387

Query  573   SL-AAFPS-------IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIG  728
             +L    P+       ++ L+L   N+T +     L N + LE+L+L G++          
Sbjct  388   ALNVQIPNFLYYQYHLRFLDLSHNNITGMFPSWLLNNNTRLEQLYLSGNSFVGTLQLQEH  447

Query  729   PMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGN----------  878
             P   +  L +S   + G +P        NL+ L +++N   G IPS  GN          
Sbjct  448   PYPKMTELDISNNNMTGQIPKDICLIFPNLESLRMAKNGFTGCIPSCLGNISSLSLLDLS  507

Query  879   ----------LTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSF-----  1013
                       L +L+Y+ LS N L G I  S  ++  S       NN +   S F     
Sbjct  508   NNQLSTVTLELLTLQYLKLSNNNLGGQIPTSVFNSSVSEYLYLGDNNFWGQISYFPLNGW  567

Query  1014  ------------------RSFANNSKLRVILADRNK------------------VIADTQ  1085
                               R F N++ L  I   +N                   +++D  
Sbjct  568   KSWIVVDLSNNQFSGMLPRGFVNSTNLEAIDLSKNHFKGPIPRDFCKLDQVQYLILSDNN  627

Query  1086  LQGFVPKF----QLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNN  1253
             L G++P       +  + LS       L    +    L  + +  NN  G  P+W+  N 
Sbjct  628   LSGYIPSCFSPPSIIHMHLSKNRLSGPLTYGFYNSSSLVTMDLRDNNFTGSIPNWI-GNL  686

Query  1254  TKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEIS---GN-------------  1385
             + L   LM  N F G L +   +   L I++VS N+L G +    GN             
Sbjct  687   SSLSVLLMKANHFDGELPVQLCLLEQLSILDVSQNQLSGPLPSCLGNLTFKESSQKALVN  746

Query  1386  --------------FSSSFPNILALNLS------------------SNLFSGQLHSLIGT  1469
                           + +  P ++A   +                   N++ G    ++  
Sbjct  747   LGVLLLPRSIEKAYYETMGPPVVASMYTLLKGYWPNFTEEVVEFTTKNMYYGYKGKILSY  806

Query  1470  HLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNN  1649
               GF DLSNN+F G IP E   + S ++ L LS+N L G I   F  L  +E L L  NN
Sbjct  807   MSGF-DLSNNNFVGAIPPE-FGNLSEILSLNLSHNNLTGSIPATFSNLKRIESLDLSYNN  864

Query  1650  FEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIP  1808
                                    L+G IP  +  +T+L   +++ N+L G  P
Sbjct  865   -----------------------LNGVIPPQLTEITTLEVFSVAHNNLSGKTP  894



>ref|XP_006583617.1| PREDICTED: brassinosteroid LRR receptor kinase-like isoform X2 
[Glycine max]
Length=1063

 Score =   328 bits (842),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 287/714 (40%), Positives = 395/714 (55%), Gaps = 38/714 (5%)
 Frame = +3

Query  105   LINLEELHMRYTQMEEINILSVLN-LKDFISLKVLDIGFNK--FQSFGPINDVGGAKKLE  275
             L NLE L +    ++   ILS L+ L    SL + D  FN   F  F  +     + KL 
Sbjct  117   LQNLEVLDLSSNDLDNAAILSCLDGLSSLKSLYLRDSRFNASSFHVFETL-----SSKLR  171

Query  276   ELYLFECRFN---QSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDI-NDLRNLKELYLSD  443
              L + +  FN     I  SL GF SLK L L   D  D  LHIQ + + LRNL+ L LS 
Sbjct  172   NLKVLDISFNPLTNDILSSLGGFTSLKELHLAGIDL-DSDLHIQGLCSSLRNLEILDLSR  230

Query  444   NYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVN  623
             N F   + ++ HSG S     + S  +++         ++ + +++ F S+K L+L    
Sbjct  231   NNFNNTDITSVHSGLSSLKSLDLSNCQLI---------SRSIFNISRFTSLKILDLSHNW  281

Query  624   VTNIDAIHA-LKNLSSLEELHLDGSN-LHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKG  797
             +      H     LS+LE L LD +  L  +FL NIG + SLKVLSL    + GTLP   
Sbjct  282   LDESIQWHQDFHGLSNLEHLILDNNYYLQNEFLKNIGELTSLKVLSLQQCDINGTLPPTD  341

Query  798   LCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleyls  977
               +LK L+EL LSEN+ EG +PS F N+TSLR + +S N   GN + +  S  +   +  
Sbjct  342   WFKLKKLEELDLSENEFEGPLPSSFVNMTSLRKLEISYNHFIGNFDSNLASLTSLEYFGF  401

Query  978   IMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQ--LQGFVPKFQLDSLSLSNCIDL-  1148
             I  N FE+  SF  FAN SK++ I    NK + D+   LQ ++PKFQL  L +S+  +  
Sbjct  402   I-GNQFEIPVSFTPFANLSKIKFIYGHGNKFLLDSHHSLQTWIPKFQLQELFVSSTTETK  460

Query  1149  -LKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVN  1325
              L LP FL YQ  L  + +S   LEGEFP WLL+NNTK+   L  N +FTG+ +L     
Sbjct  461   SLPLPNFLLYQNSLTNIDLSDWKLEGEFPLWLLENNTKMTEALFRNCSFTGTFQLPMSPL  520

Query  1326  PNLQIINVSNNKLCGEI-SGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSN  1496
             PN+Q I+VS+N + G+I S N SS +PN+  L+LS N   G + S +G  + L  LDLS 
Sbjct  521   PNIQAIDVSDNTINGQIPSNNISSVYPNLQYLHLSRNNIQGSIPSELGQMSLLYSLDLSG  580

Query  1497  NSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnsl  1676
             N  +G+IP+ +      L  L LSNN  EG I+      + L+ L L+ N F G +PNS+
Sbjct  581   NQLSGKIPESIFGDGHPLQFLILSNNMFEGPILT---IPNGLKTLLLNDNGFIGRLPNSI  637

Query  1677  snlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSE  1856
              +  + SLD+ +N L G+IP  +  L+ L +L LS NH EG IP+E   L+ L+ LDLS+
Sbjct  638   FHASIISLDVSNNHLVGKIPGLIKNLSGLEELYLSNNHFEGSIPLELGELEHLTYLDLSQ  697

Query  1857  NNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGT  2036
             NNLTG +PS  N S ++ + LS + LSG   R    N++LV+LDLSYN     I   I  
Sbjct  698   NNLTGHVPSFAN-SPVEFMHLSNNHLSGLSKRMLNENSSLVMLDLSYNEISNNIQGLIQN  756

Query  2037  Isrlss--lllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLE  2192
             +S      L L GN F G +P Q+CQL  LS+LDLS+N  SG IP CLGK+  E
Sbjct  757   LSYTRLNFLFLKGNHFIGDIPKQLCQLADLSILDLSHNNFSGAIPNCLGKMPFE  810


 Score =   128 bits (321),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 192/729 (26%), Positives = 310/729 (43%), Gaps = 98/729 (13%)
 Frame = +3

Query  165   SVLNLKDFISLKVLDIGFNKF-QSFGPINDVGGAKKLEELYLFECRFNQSIF-QSLKGFP  338
             S+ N+  F SLK+LD+  N   +S     D  G   LE L L    + Q+ F +++    
Sbjct  262   SIFNISRFTSLKILDLSHNWLDESIQWHQDFHGLSNLEHLILDNNYYLQNEFLKNIGELT  321

Query  339   SLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEG--------------FETSAN  476
             SLK+L L   D  +G L   D   L+ L+EL LS+N FEG               E S N
Sbjct  322   SLKVLSLQQCDI-NGTLPPTDWFKLKKLEELDLSENEFEGPLPSSFVNMTSLRKLEISYN  380

Query  477   HS-GSSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAAFPSIK------------------  599
             H  G+    + + + LE        F++    +  A    IK                  
Sbjct  381   HFIGNFDSNLASLTSLEYFGFIGNQFEIPVSFTPFANLSKIKFIYGHGNKFLLDSHHSLQ  440

Query  600   ----TLELQRVNV---------------------TNID----------AIHALKNLSSLE  674
                   +LQ + V                     TNID           +  L+N + + 
Sbjct  441   TWIPKFQLQELFVSSTTETKSLPLPNFLLYQNSLTNIDLSDWKLEGEFPLWLLENNTKMT  500

Query  675   ELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCEL-KNLQELWLSENQLE  851
             E      +    F   + P+ +++ + +S   + G +P+  +  +  NLQ L LS N ++
Sbjct  501   EALFRNCSFTGTFQLPMSPLPNIQAIDVSDNTINGQIPSNNISSVYPNLQYLHLSRNNIQ  560

Query  852   GKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANN  1031
             G IPS  G ++ L  ++LS N+LSG I  S       L++L + NN FE      +  N 
Sbjct  561   GSIPSELGQMSLLYSLDLSGNQLSGKIPESIFGDGHPLQFLILSNNMFE--GPILTIPNG  618

Query  1032  SKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRN  1211
               L+ +L + N  I   +L   +    + SL +SN   + K+P  +     L+ L +S N
Sbjct  619   --LKTLLLNDNGFIG--RLPNSIFHASIISLDVSNNHLVGKIPGLIKNLSGLEELYLSNN  674

Query  1212  NLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFS  1391
             + EG  P   L     L Y  ++ N  TG   + S  N  ++ +++SNN L G +S    
Sbjct  675   HFEGSIP-LELGELEHLTYLDLSQNNLTG--HVPSFANSPVEFMHLSNNHLSG-LSKRML  730

Query  1392  SSFPNILALNLSSNLFSGQLHSLIG----THLGFLDLSNNSFTGEIPKEMLISCSSLVIL  1559
             +   +++ L+LS N  S  +  LI     T L FL L  N F G+IPK+ L   + L IL
Sbjct  731   NENSSLVMLDLSYNEISNNIQGLIQNLSYTRLNFLFLKGNHFIGDIPKQ-LCQLADLSIL  789

Query  1560  KLSNNKLEGQIVQEFDYL------SSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKL  1721
              LS+N   G I      +      S   + +L G      +  +  +       +++   
Sbjct  790   DLSHNNFSGAIPNCLGKMPFEVEDSPRLWRYLHGWPMGRYLVRNKYSRFQLLPYVQEKAN  849

Query  1722  SGEIPR---WMGRLTSLVQ-LTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCL  1889
                  R   +MG + + +  + LS N L+G+IP E  NL  +  L+LS N+LTG IP+  
Sbjct  850   FTSKKRTYTYMGSILAYMSGIDLSHNKLKGNIPSELGNLTKIHTLNLSHNDLTGKIPATF  909

Query  1890  NP-SSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllN  2066
             +     + + LS + L+GQ+       T+L +  +++N+  G  PE+ G  S        
Sbjct  910   SHLVQTESLDLSFNMLNGQIPPQLTTLTSLAVFSVAHNNLSGPTPEFKGQFSTFDESSYE  969

Query  2067  GNRFEGKVP  2093
             GN F   +P
Sbjct  970   GNPFLCGLP  978



>ref|XP_006389359.1| hypothetical protein POPTR_0027s00350g, partial [Populus trichocarpa]
 gb|ERP48273.1| hypothetical protein POPTR_0027s00350g, partial [Populus trichocarpa]
Length=961

 Score =   327 bits (837),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 250/639 (39%), Positives = 378/639 (59%), Gaps = 31/639 (5%)
 Frame = +3

Query  519   LEVLHLNNISFDMTKLLSSLAAFPSIKTLELQRVNVT-NIDA-IHALKNLSSLEELHLDG  692
             LE LHL    ++   +  SL  F S+K+L+L    +T +I++ I +  +  S  +     
Sbjct  132   LENLHLRRNQYN-DSIFPSLTGFSSLKSLDLSNNQLTGSINSNILSHPSGLSSLKSLNLS  190

Query  693   SNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYF  872
              N+     +++  + SLK LSL    +     ++G CELKNL++L LS N L G +P   
Sbjct  191   GNMLLGSTASLCSLPSLKTLSLKDTNL-----SQGWCELKNLKQLHLSRNNLGGSLPDCL  245

Query  873   GNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVIL  1052
             GN++SL+ +++S N+ +GNI   PL+ L SLE+LS+ NN FEV  S + F N+S L+   
Sbjct  246   GNMSSLQLLDVSENQFTGNIAFGPLTNLISLEFLSLSNNLFEVPISIKPFMNHSSLKFFS  305

Query  1053  ADRNKVIAD-TQLQGFVPKFQLDSLSLSNCID---LLKLPRFLHYQRDLKVLRISRNNLE  1220
             ++ NK++ +       +PKFQL    LS+      L  +P FL+YQ DL+ L +S NN+ 
Sbjct  306   SENNKLVTEPAAFDNLIPKFQLVFFRLSSSPTSEALNVIPDFLYYQLDLRALDLSHNNIT  365

Query  1221  GEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSF  1400
             G FPSWLL+NNT+L+   +++N+F G+L+L  H++PN+  +++SNN + G+I  +    F
Sbjct  366   GMFPSWLLKNNTRLEQLYLSDNSFIGALQLQDHLHPNMTNLDISNNNMNGQIPKDICLIF  425

Query  1401  PNILALNLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNN  1574
             PN+  L ++ N F+G + S +G  + L FLDLSNN  +  +  E L   +++ +LKLSNN
Sbjct  426   PNLHTLRMAKNGFTGCIPSCLGNISSLSFLDLSNNQLS-TVKLEQL---TTIWVLKLSNN  481

Query  1575  KLEGQIVQEFDYLSSLEYLHLDGNNFEGTIp--nslsnlplhslDIRDNKLSGEIPRWMG  1748
              L G+I       S L +L+L+GNNF G I           + LD+ +N+ SG +PR   
Sbjct  482   NLGGKIPTSVFNSSRLNFLYLNGNNFWGQISDFPLYRWNVWNVLDLSNNQFSGMLPRSFV  541

Query  1749  RLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKH  1928
               + L  + LS NH +G IP +FC    L  LDLSENNL+G IPSC +P  I HV LSK+
Sbjct  542   NFSILGVIDLSGNHFKGPIPRDFCKFDQLEYLDLSENNLSGYIPSCFSPPQITHVHLSKN  601

Query  1929  QLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVPTQVCQ  2108
             +LSG LT AFFN++ LV +DL  NSF G IP WIG +S LS LLL  N F+G++P Q+C 
Sbjct  602   RLSGPLTYAFFNSSYLVTMDLRENSFTGSIPNWIGNLSSLSVLLLRANHFDGELPIQLCL  661

Query  2109  LMRlslldlsnnllsGVIPRCLGKISLEGTNEQFRGINLPFEYYSINDAILDRLHYE---  2279
             L +LS+LD+S+N LSG +P CLG ++ + +++  + I L   Y  I+++I ++ +YE   
Sbjct  662   LEQLSILDVSHNQLSGPLPSCLGNLTFKKSDK--KAI-LEVAYGFISESI-EKAYYEIMG  717

Query  2280  ---WGSDDEYIPMLAVDVLPEV-QFRTKGNLYNYQNSIL  2384
                  S D        +   EV +F TK   Y Y+  +L
Sbjct  718   PPLVDSVDNLRNFFLFNFTEEVTEFTTKNMYYGYKGKVL  756


 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 170/672 (25%), Positives = 293/672 (44%), Gaps = 88/672 (13%)
 Frame = +3

Query  264   KKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSD  443
             K L++L+L       S+   L    SL++LD+ +N F  G +    + +L +L+ L LS+
Sbjct  225   KNLKQLHLSRNNLGGSLPDCLGNMSSLQLLDVSENQF-TGNIAFGPLTNLISLEFLSLSN  283

Query  444   NYFE---GFETSANHSGSSRHTIRN-KSYLEVLHLNNISFDMTKLLSSLAAFPS------  593
             N FE     +   NHS     +  N K   E    +N+      +   L++ P+      
Sbjct  284   NLFEVPISIKPFMNHSSLKFFSSENNKLVTEPAAFDNLIPKFQLVFFRLSSSPTSEALNV  343

Query  594   ----------IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPME--  737
                       ++ L+L   N+T +     LKN + LE+L+L  ++        IG ++  
Sbjct  344   IPDFLYYQLDLRALDLSHNNITGMFPSWLLKNNTRLEQLYLSDNSF-------IGALQLQ  396

Query  738   -----SLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVN  902
                  ++  L +S   + G +P        NL  L +++N   G IPS  GN++SL +++
Sbjct  397   DHLHPNMTNLDISNNNMNGQIPKDICLIFPNLHTLRMAKNGFTGCIPSCLGNISSLSFLD  456

Query  903   LSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADT  1082
             LS N+LS       L  LT++  L + NN+         F N+S+L  +  + N      
Sbjct  457   LSNNQLS----TVKLEQLTTIWVLKLSNNNLGGKIPTSVF-NSSRLNFLYLNGNN-----  506

Query  1083  QLQGFVPKFQLDSLSLSNCIDLLK------LPRFLHYQRDLKVLRISRNNLEGEFPSWLL  1244
                G +  F L   ++ N +DL        LPR       L V+ +S N+ +G  P    
Sbjct  507   -FWGQISDFPLYRWNVWNVLDLSNNQFSGMLPRSFVNFSILGVIDLSGNHFKGPIPRDFC  565

Query  1245  QNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEIS-GNFSSSFPNILALN  1421
             + + +L+Y  ++ N  +G +  S    P +  +++S N+L G ++   F+SS+  ++ ++
Sbjct  566   KFD-QLEYLDLSENNLSGYIP-SCFSPPQITHVHLSKNRLSGPLTYAFFNSSY--LVTMD  621

Query  1422  LSSNLFSGQLHSLIGTHLGFLDLSN--NSFTGEIPKEMLISCSSLVILKLSNNKLEGQI-  1592
             L  N F+G + + IG       L    N F GE+P ++ +    L IL +S+N+L G + 
Sbjct  622   LRENSFTGSIPNWIGNLSSLSVLLLRANHFDGELPIQLCL-LEQLSILDVSHNQLSGPLP  680

Query  1593  -------VQEFDYLSSLEYLHLDGNNFEGTIpnslsnlplhslDIRDN-------KLSGE  1730
                     ++ D  + LE  +  G   E         +    +D  DN         + E
Sbjct  681   SCLGNLTFKKSDKKAILEVAY--GFISESIEKAYYEIMGPPLVDSVDNLRNFFLFNFTEE  738

Query  1731  IPRWMGR----------LTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIP  1880
             +  +  +          L  +  + LS N+  G IP EF NL  +  ++LS NNLTGSIP
Sbjct  739   VTEFTTKNMYYGYKGKVLNYMFGIDLSNNNFIGAIPPEFGNLSKILSVNLSHNNLTGSIP  798

Query  1881  SCL-NPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlssl  2057
             +   N   I+ + LS + L+G +   F   T L +  +++N+  G  PE I         
Sbjct  799   ATFSNLMHIESLDLSYNNLNGAIPPQFTEVTTLEVFSVAHNNLSGKTPERIYQFGTFDES  858

Query  2058  llNGNRFEGKVP  2093
                GN F    P
Sbjct  859   CYEGNPFLCGPP  870


 Score = 60.8 bits (146),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 135/553 (24%), Positives = 214/553 (39%), Gaps = 93/553 (17%)
 Frame = +3

Query  189   ISLKVLDIGFNKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDN  368
             + L+ LD+  N      P   +    +LE+LYL +  F  ++       P++  LD+ +N
Sbjct  352   LDLRALDLSHNNITGMFPSWLLKNNTRLEQLYLSDNSFIGALQLQDHLHPNMTNLDISNN  411

Query  369   DFYDGPLHIQDINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNIS  548
             +  +G +         NL  L ++ N F G   S          + N S L  L L+N  
Sbjct  412   NM-NGQIPKDICLIFPNLHTLRMAKNGFTGCIPSC---------LGNISSLSFLDLSNNQ  461

Query  549   FDMTKLLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLH---KDF--  713
                 K    L    +I  L+L   N+       ++ N S L  L+L+G+N      DF  
Sbjct  462   LSTVK----LEQLTTIWVLKLSNNNLGG-KIPTSVFNSSRLNFLYLNGNNFWGQISDFPL  516

Query  714   ---------------LSNIGP-----MESLKVLSLSGAQVGGTLPNKGLCELKNLQELWL  833
                             S + P        L V+ LSG    G +P +  C+   L+ L L
Sbjct  517   YRWNVWNVLDLSNNQFSGMLPRSFVNFSILGVIDLSGNHFKGPIP-RDFCKFDQLEYLDL  575

Query  834   SENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSF  1013
             SEN L G IPS F     + +V+LS N+LSG +              +  N+S+ V    
Sbjct  576   SENNLSGYIPSCFSP-PQITHVHLSKNRLSGPL------------TYAFFNSSYLVTMDL  622

Query  1014  RSFANNSKLRVILADRNKVIADTQLQGFVPKF------QLDSLSLSNCIDLLKLPRFLHY  1175
             R                    +    G +P +          L  +N  D  +LP  L  
Sbjct  623   R--------------------ENSFTGSIPNWIGNLSSLSVLLLRANHFD-GELPIQLCL  661

Query  1176  QRDLKVLRISRNNLEGEFPSWL----LQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQII  1343
                L +L +S N L G  PS L     + + K     +     + S++ + +      ++
Sbjct  662   LEQLSILDVSHNQLSGPLPSCLGNLTFKKSDKKAILEVAYGFISESIEKAYYEIMGPPLV  721

Query  1344  NVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDLSNNSFTGEIPK  1523
             +  +N     +   F  +F   +    + N++ G    ++    G +DLSNN+F G IP 
Sbjct  722   DSVDN-----LRNFFLFNFTEEVTEFTTKNMYYGYKGKVLNYMFG-IDLSNNNFIGAIPP  775

Query  1524  EMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpns-lsnlplhsl  1700
             E   + S ++ + LS+N L G I   F  L  +E L L  NN  G IP        L   
Sbjct  776   E-FGNLSKILSVNLSHNNLTGSIPATFSNLMHIESLDLSYNNLNGAIPPQFTEVTTLEVF  834

Query  1701  DIRDNKLSGEIPR  1739
              +  N LSG+ P 
Sbjct  835   SVAHNNLSGKTPE  847



>ref|XP_010655051.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 isoform X3 [Vitis vinifera]
Length=854

 Score =   324 bits (830),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 256/660 (39%), Positives = 374/660 (57%), Gaps = 55/660 (8%)
 Frame = +3

Query  531   HLNNISFDMTKLLSSLA--AFPSIKTLELQRVNVTNIDAI--HALKNLSSLEEL-----H  683
             HL ++S     L  SL    F S+  LE+  ++  ++  I   +++ +S L+ L     H
Sbjct  3     HLKSLSLAANHLNGSLQNQDFASLSNLEILDLSYNSLTGIIPSSIRLMSHLKSLSLAANH  62

Query  684   LDGSNLHKDFLSNIGPMESLKVLSLS------------------------GAQVGGTLPN  791
             L+GS  ++DF S    + +L++L LS                        G Q+ G+LPN
Sbjct  63    LNGSLQNQDFAS----LSNLEILDLSYNSFSGILPSSIRLMSSLKSLSLAGNQLNGSLPN  118

Query  792   KGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsley  971
             +G C+L  LQEL L+ N  +G +P    NLTSLR ++LS N  SGN+  S L +LTSLEY
Sbjct  119   QGFCQLNKLQELDLNSNFFQGILPPCLNNLTSLRLLDLSHNLFSGNVSSSLLPSLTSLEY  178

Query  972   lsIMNNSFEVASSFRSFANNSKLRVIL--ADRNKVIADTQLQ-GFVPKFQLDSLSLSNCI  1142
             + +  N FE   SF SFAN+S L+V++  +D NK   +T+   G+VP FQL  L LSN  
Sbjct  179   IDLSYNLFEGPFSFNSFANHSNLQVVIHGSDNNKFEIETEYPVGWVPLFQLKVLVLSNYK  238

Query  1143  DLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHV  1322
              +   P FL YQ  L V+ +S NNL G FP+WLL+NNT+L+Y ++ NN+  G L L    
Sbjct  239   LIGDFPGFLRYQFRLTVVDLSHNNLTGSFPNWLLENNTRLEYLVLRNNSLMGQL-LPLRP  297

Query  1323  NPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG--THLGFLDLSN  1496
             N  +  +++S+N+L GE+  N ++  PNI  LNLS+N F G L S I   + L  LDLS 
Sbjct  298   NSRITSLDISDNRLVGELQQNVANMIPNIEHLNLSNNGFEGILPSSIAEMSSLWSLDLSA  357

Query  1497  NSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTIpnsl  1676
             NSF+GE+PK++L++   L  LKLSNNK  G+I      L+SLE+LHLD N F+GT+ N +
Sbjct  358   NSFSGEVPKQLLVA-KDLEFLKLSNNKFHGEIFSRDFNLTSLEFLHLDNNQFKGTLSNVI  416

Query  1677  snlp-lhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLS  1853
             S    L  LD+ +N +SGEIP W+G +T L  L L  N  +G +P E   L+ L  LD+S
Sbjct  417   SRSSWLRVLDVSNNNMSGEIPSWIGNMTDLTTLVLGNNSFKGKLPPEISQLQRLEFLDVS  476

Query  1854  ENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIG  2033
             +N L+GS+PS  +   +KH+ L  +  +G + R F N++ L+ LD+  N   G IP  I 
Sbjct  477   QNTLSGSLPSLKSIEYLKHLHLQGNMFTGLIPRDFLNSSNLLTLDIRDNRLFGSIPNSIS  536

Query  2034  TIsrlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKIS---LEGTNE  2204
              +  L   LL GN   G +P Q+C L ++SL+DLSNN  SG IP+C G I     +  + 
Sbjct  537   RLLELRIFLLRGNLLSGFIPNQLCHLTKISLMDLSNNNFSGSIPKCFGHIQFGDFKTEHN  596

Query  2205  QFRGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQNSIL  2384
              ++ +  P+ ++SI    L  + Y + S + +      D + EV+F TK    +Y   IL
Sbjct  597   VYKPMFNPYSFFSIYTGYL--VKYLFFSTEAH-----RDEVDEVEFVTKNRSNSYGGGIL  649


 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 210/783 (27%), Positives = 314/783 (40%), Gaps = 164/783 (21%)
 Frame = +3

Query  69    HLNNS-GNERLTGLINLEELHMRYTQMEEINILSV-------------------LNLKDF  188
             HLN S  N+    L NLE L + Y  +  I   S+                   L  +DF
Sbjct  13    HLNGSLQNQDFASLSNLEILDLSYNSLTGIIPSSIRLMSHLKSLSLAANHLNGSLQNQDF  72

Query  189   ISL---KVLDIGFNKFQSFGPI---------------NDVGGA---------KKLEELYL  287
              SL   ++LD+ +N F    P                N + G+          KL+EL L
Sbjct  73    ASLSNLEILDLSYNSFSGILPSSIRLMSSLKSLSLAGNQLNGSLPNQGFCQLNKLQELDL  132

Query  288   FECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYFEG---  458
                 F   +   L    SL++LDL  N  + G +    +  L +L+ + LS N FEG   
Sbjct  133   NSNFFQGILPPCLNNLTSLRLLDLSHN-LFSGNVSSSLLPSLTSLEYIDLSYNLFEGPFS  191

Query  459   FETSANHS-------GSSRHTIRNKS-----YLEVLHLNNISFDMTKLLSSLAAFPS---  593
             F + ANHS       GS  +    ++     ++ +  L  +     KL+     F     
Sbjct  192   FNSFANHSNLQVVIHGSDNNKFEIETEYPVGWVPLFQLKVLVLSNYKLIGDFPGFLRYQF  251

Query  594   -IKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQ  770
              +  ++L   N+T       L+N + LE L L  ++L    L  + P   +  L +S  +
Sbjct  252   RLTVVDLSHNNLTGSFPNWLLENNTRLEYLVLRNNSLMGQLLP-LRPNSRITSLDISDNR  310

Query  771   VGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelspls  950
             + G L       + N++ L LS N  EG +PS    ++SL  ++LS N  SG +    L 
Sbjct  311   LVGELQQNVANMIPNIEHLNLSNNGFEGILPSSIAEMSSLWSLDLSANSFSGEVPKQLLV  370

Query  951   tltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSL  1130
                      + NN F      R F N + L  +  D N      Q +G          +L
Sbjct  371   AKDLEFLK-LSNNKFHGEIFSRDF-NLTSLEFLHLDNN------QFKG----------TL  412

Query  1131  SNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKL  1310
             SN I              L+VL +S NN+ GE PSW+  N T L   ++ NN+F G L  
Sbjct  413   SNVIS---------RSSWLRVLDVSNNNMSGEIPSWI-GNMTDLTTLVLGNNSFKGKLPP  462

Query  1311  SSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGTHLGFLDL  1490
                    L+ ++VS N L G        S P++ ++                 +L  L L
Sbjct  463   EISQLQRLEFLDVSQNTLSG--------SLPSLKSI----------------EYLKHLHL  498

Query  1491  SNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLEYLHLDGNNFEGTI-p  1667
               N FTG IP++ L S S+L+ L + +N+L G I      L  L    L GN   G I  
Sbjct  499   QGNMFTGLIPRDFLNS-SNLLTLDIRDNRLFGSIPNSISRLLELRIFLLRGNLLSGFIPN  557

Query  1668  nslsnlplhslDIRDNKLSGEIPRWMGRLT--------------------------SLVQ  1769
                    +  +D+ +N  SG IP+  G +                            LV+
Sbjct  558   QLCHLTKISLMDLSNNNFSGSIPKCFGHIQFGDFKTEHNVYKPMFNPYSFFSIYTGYLVK  617

Query  1770  LTL--SKNHLEGHIPIEFCN-----------LKSLSILDLSENNLTGSIPSCLNP-SSIK  1907
                  ++ H +    +EF             L  +S LDLS NNLTG IP  L   SSI 
Sbjct  618   YLFFSTEAHRDEVDEVEFVTKNRSNSYGGGILDFMSGLDLSCNNLTGEIPRELGMLSSIL  677

Query  1908  HVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVG-IIPEWIGTIsrlsslllNGNRFEG  2084
              ++LS +QL G + ++F   + +  LDLSYN   G I PE+IG ++ L    +  N   G
Sbjct  678   ALNLSHNQLKGSVPKSFSKLSQIESLDLSYNKLSGEIPPEFIG-LNFLEVFNVAHNNISG  736

Query  2085  KVP  2093
             +VP
Sbjct  737   RVP  739



>gb|KCW83038.1| hypothetical protein EUGRSUZ_C04419, partial [Eucalyptus grandis]
Length=819

 Score =   323 bits (828),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 245/594 (41%), Positives = 364/594 (61%), Gaps = 16/594 (3%)
 Frame = +3

Query  630   NIDAIHALKNLSSLEELHLDGSNLHKD---FLSNIGPMESLKVLSLSGAQVGGTLPNKGL  800
             NI +   +KNLS L+ LHL+G +L KD   F+  +G + SL++LSL    V GT+  +GL
Sbjct  44    NIPSKLGIKNLSHLKNLHLNGVHL-KDVGIFMRALGALSSLRILSLQDNTVEGTITTQGL  102

Query  801   CELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsI  980
             C L  L+EL LS N++ G +P+ + N+TS+R +NL+ N+ + ++  SPL++L SLE+LSI
Sbjct  103   CNLIKLEELDLSTNKITGGLPTCWRNMTSIRILNLADNEFTDSVASSPLTSLASLEFLSI  162

Query  981   MNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQGFVPKFQLDSLSLSNCIDL-LKL  1157
             + N F + SS    AN+S+L+V+L D  K+  DT++   +P+FQL   S+SN +    KL
Sbjct  163   LGNHFNIPSSLGPLANHSRLKVLLLDDTKLTLDTKVATSIPRFQLKVFSMSNSLSKGFKL  222

Query  1158  P--RFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPN  1331
             P   +L++Q DL+++ +S N++ G FP+WLL+NNTKL+   M NN+FT +L++ S    N
Sbjct  223   PFLGYLNHQYDLRIIDLSSNDIPGPFPTWLLENNTKLENLFMENNSFT-TLEVPSMTCLN  281

Query  1332  LQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIGT--HLGFLDLSNNSF  1505
             L +++VSNN + GE++  F ++FPN+  LNLS+N   G + S +GT   L  LDLS+N+F
Sbjct  282   LSVMDVSNNDMRGELTTEFCANFPNLRHLNLSANRLEGNIPSELGTIKSLYSLDLSSNNF  341

Query  1506  TGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSSLE--YLHLDGNNFEGTIpnsls  1679
             +G +P ++L S SSL  L ++ NKL+G+IV   D+  +L    L L  N F G +    S
Sbjct  342   SGGLPSQLLDSNSSLDNLNVAYNKLQGKIVFS-DHTMNLNPLCLRLGHNMFTGDLSFLSS  400

Query  1680  nlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIEFCNLKSLSILDLSEN  1859
              + L  LDI +N   G++PR +     L  L LSKNHL+G IP E  NL  L  LDLS+N
Sbjct  401   FVNLELLDISNNSFIGKLPRLIANTLDLAVLDLSKNHLDGLIPRELFNLGQLQYLDLSDN  460

Query  1860  NLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALVILDLSYNSFVGIIPEWIGTI  2039
             NL+GS+ S      + H+ L+ ++L+G L  A  N++ LV LDLS N F G IP W+G +
Sbjct  461   NLSGSLASSFIAPLLSHIHLNGNKLNGTLVHALSNSSYLVTLDLSENEFSGSIPYWLGNL  520

Query  2040  srlsslllNGNRFEGKVPTQVCQLMRlslldlsnnllsGVIPRCLGKISLEGT---NEQF  2210
             S+LS L L GN F G  P Q+C L  LS++DLS N L G +P CLG ++   T   N+  
Sbjct  521   SQLSILSLRGNSFSGTFPEQLCSLKSLSMIDLSKNNLFGRLPSCLGPMNFSSTGYANKVT  580

Query  2211  RGINLPFEYYSINDAILDRLHYEWGSDDEYIPMLAVDVLPEVQFRTKGNLYNYQ  2372
                N+ FE+  ++     R     G  D YI +  + +   V F TKG   +Y+
Sbjct  581   STPNMGFEFIRLSTWSYVRTIKSHGDFDFYIEIETMQLPHIVGFTTKGRFDSYK  634


 Score =   140 bits (353),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 195/706 (28%), Positives = 313/706 (44%), Gaps = 91/706 (13%)
 Frame = +3

Query  69    HLNNSGNERLTG----------LINLEELHMRYTQMEEINILSVLNLKDFISLKVLDIGF  218
             HLN S N RL G          L +L+ LH+    ++++ I  +  L    SL++L +  
Sbjct  33    HLNLSAN-RLEGNIPSKLGIKNLSHLKNLHLNGVHLKDVGIF-MRALGALSSLRILSLQD  90

Query  219   NKFQSFGPINDVGGAKKLEELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQ  398
             N  +       +    KLEEL L   +    +    +   S++IL+L DN+F D  +   
Sbjct  91    NTVEGTITTQGLCNLIKLEELDLSTNKITGGLPTCWRNMTSIRILNLADNEFTDS-VASS  149

Query  399   DINDLRNLKELYLSDNYFEGFETSANHSGSSRHTIRNKSYLEVLHLNNIS----------  548
              +  L +L+ L +  N+F    +    +  SR  +      ++     ++          
Sbjct  150   PLTSLASLEFLSILGNHFNIPSSLGPLANHSRLKVLLLDDTKLTLDTKVATSIPRFQLKV  209

Query  549   FDMTKLLSSLAAFP---------SIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSNL  701
             F M+  LS     P          ++ ++L   ++        L+N + LE L ++ ++ 
Sbjct  210   FSMSNSLSKGFKLPFLGYLNHQYDLRIIDLSSNDIPGPFPTWLLENNTKLENLFMENNSF  269

Query  702   HKDFLSNIGPMESLKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNL  881
                 + ++  + +L V+ +S   + G L  +      NL+ L LS N+LEG IPS  G +
Sbjct  270   TTLEVPSMTCL-NLSVMDVSNNDMRGELTTEFCANFPNLRHLNLSANRLEGNIPSELGTI  328

Query  882   TSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADR  1061
              SL  ++LS N  SG +    L + +SL+ L++  N  +    F     N     +    
Sbjct  329   KSLYSLDLSSNNFSGGLPSQLLDSNSSLDNLNVAYNKLQGKIVFSDHTMNLNPLCLRLGH  388

Query  1062  NKVIADTQ-LQGFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSW  1238
             N    D   L  FV    L+ L +SN   + KLPR +    DL VL +S+N+L+G  P  
Sbjct  389   NMFTGDLSFLSSFV---NLELLDISNNSFIGKLPRLIANTLDLAVLDLSKNHLDGLIPRE  445

Query  1239  LLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILAL  1418
             L  N  +LQY  +++N  +GSL  SS + P L  I+++ NKL G +    S+S   ++ L
Sbjct  446   LF-NLGQLQYLDLSDNNLSGSLA-SSFIAPLLSHIHLNGNKLNGTLVHALSNS-SYLVTL  502

Query  1419  NLSSNLFSGQLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQI  1592
             +LS N FSG +   +G  + L  L L  NSF+G  P E L S  SL ++ LS N L G++
Sbjct  503   DLSENEFSGSIPYWLGNLSQLSILSLRGNSFSGTFP-EQLCSLKSLSMIDLSKNNLFGRL  561

Query  1593  VQ------------------------EFDYLSSLEYL---------------------HL  1637
                                       EF  LS+  Y+                     H+
Sbjct  562   PSCLGPMNFSSTGYANKVTSTPNMGFEFIRLSTWSYVRTIKSHGDFDFYIEIETMQLPHI  621

Query  1638  DGNNFEGTIpnsl--snlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPI  1811
              G   +G   +    + L +  LD   N+ SGEIP  +  L  +  L LS N L GHIP+
Sbjct  622   VGFTTKGRFDSYKGYALLKMVQLDFSCNQFSGEIPPEIAILQDMRVLNLSHNKLNGHIPM  681

Query  1812  EFCNLKSLSILDLSENNLTGSIPSCLNP-SSIKHVSLSKHQLSGQL  1946
                NL  +  +DLS NNL GSIP  L   +S++  ++S + LSG +
Sbjct  682   SLWNLTKIESIDLSYNNLIGSIPEELTQLNSLEVFNVSYNDLSGAI  727


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 109/273 (40%), Gaps = 64/273 (23%)
 Frame = +3

Query  1329  NLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQLHSLIG----THLGFLDLSN  1496
             NL ++N+SNN + GE +  F  + PN+  LNLS+N   G + S +G    +HL  L L+ 
Sbjct  5     NLSVMNISNNNMRGEPTTKFCLNVPNLYHLNLSANRLEGNIPSKLGIKNLSHLKNLHLNG  64

Query  1497  NSFTG-EIPKEMLISCSSLVILKLSNNKLEGQI-VQEFDYLSSLEYLHLDGNNFEGTIpn  1670
                    I    L + SSL IL L +N +EG I  Q    L  LE L             
Sbjct  65    VHLKDVGIFMRALGALSSLRILSLQDNTVEGTITTQGLCNLIKLEEL-------------  111

Query  1671  slsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEGHIPIE-FCNLKSLSILD  1847
                       D+  NK++G +P     +TS+  L L+ N     +      +L SL  L 
Sbjct  112   ----------DLSTNKITGGLPTCWRNMTSIRILNLADNEFTDSVASSPLTSLASLEFLS  161

Query  1848  LSENNLTGSIPSCLNP------------------------SSIKHVSLSKHQLSGQLTRA  1955
             +  N+   +IPS L P                        +SI    L    +S  L++ 
Sbjct  162   ILGNHF--NIPSSLGPLANHSRLKVLLLDDTKLTLDTKVATSIPRFQLKVFSMSNSLSKG  219

Query  1956  FF--------NNTALVILDLSYNSFVGIIPEWI  2030
             F         +   L I+DLS N   G  P W+
Sbjct  220   FKLPFLGYLNHQYDLRIIDLSSNDIPGPFPTWL  252



>gb|KHN28791.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=1025

 Score =   326 bits (835),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 296/733 (40%), Positives = 408/733 (56%), Gaps = 52/733 (7%)
 Frame = +3

Query  105   LINLEELHMRYTQMEEINILSVLN-LKDFISLKVLDIGFNK--FQSFGPINDVGGAKKLE  275
             L NLE L +    ++   ILS L+ L    SL + D  FN   F  F  +     + KL 
Sbjct  55    LQNLEVLDLSSNDLDNAAILSCLDGLSSLKSLYLRDSRFNASSFHVFETL-----SSKLR  109

Query  276   ELYLFECRFN---QSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDI-NDLRNLKELYLSD  443
              L + +  FN     I  SL GF SLK L L   D  D  LHIQ + + LRNL+ L LS 
Sbjct  110   NLKVLDISFNPLTNDILSSLGGFTSLKELHLAGIDL-DSDLHIQGLCSSLRNLEILDLSR  168

Query  444   NYFEGFETSANHSGS--------------SRH------TIRNKSYLEVLHLNNISFDMTK  563
             N F   + ++ HSG               SR       ++RN   LE+L L++ +F+ + 
Sbjct  169   NNFNNTDITSVHSGLSSLKSLDLSNCQLISRSIFSLCSSLRN---LEILDLSDNNFNNSD  225

Query  564   LLSSLAAFPSIKTLELQRVNVTNIDAIHALKNLSSLEELHLDGSN-LHKDFLSNIGPMES  740
             ++S L+   S+K+L+L    +T+  +I     LS+LE L LD +  L  +FL NIG + S
Sbjct  226   IISVLSGLSSLKSLDLSNCQLTS-RSIFNFHGLSNLEHLILDNNYYLQNEFLKNIGELTS  284

Query  741   LKVLSLSGAQVGGTLPNKGLCELKNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSLNKL  920
             LKVLSL    + GTLP     +LK L+EL LSEN+ EG +PS F N+TSLR + +S N  
Sbjct  285   LKVLSLQQCDINGTLPPTDWFKLKKLEELDLSENEFEGPLPSSFVNMTSLRKLEISYNHF  344

Query  921   SGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQ--LQG  1094
              GN + +  S  +   +  I  N FE+  SF  FAN SK++ I    NK + D+   LQ 
Sbjct  345   IGNFDSNLASLTSLEYFGFI-GNQFEIPVSFTPFANLSKIKFIYGHGNKFLLDSHHSLQT  403

Query  1095  FVPKFQLDSLSLSNCIDL--LKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQY  1268
             ++PKFQL  L +S+  +   L LP FL YQ  L  + +S   LEGEFP WLL+NNTK+  
Sbjct  404   WIPKFQLQELFVSSTTETKSLPLPNFLLYQNSLTNIDLSDWKLEGEFPLWLLENNTKMTE  463

Query  1269  FLMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEI-SGNFSSSFPNILALNLSSNLFSG  1445
              L  N +FTG+ +L     PN+Q I+VS+N + G+I S N SS +PN+  L+LS N   G
Sbjct  464   ALFRNCSFTGTFQLPMSPLPNIQAIDVSDNTINGQIPSNNISSVYPNLQYLHLSRNNIQG  523

Query  1446  QLHSLIG--THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYLSS  1619
              + S +G  + L  LDLS N  +G+IP+ +      L  L LSNN  EG I+      + 
Sbjct  524   SIPSELGQMSLLYSLDLSGNQLSGKIPESIFGDGHPLQFLILSNNMFEGPILT---IPNG  580

Query  1620  LEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPRWMGRLTSLVQLTLSKNHLEG  1799
             L+ L L+ N F G +PNS+ +  + SLD+ +N L G+IP  +  L+ L +L LS NH EG
Sbjct  581   LKTLLLNDNGFIGRLPNSIFHASIISLDVSNNHLVGKIPGLIKNLSGLEELYLSNNHFEG  640

Query  1800  HIPIEFCNLKSLSILDLSENNLTGSIPSCLNPSSIKHVSLSKHQLSGQLTRAFFNNTALV  1979
              IP+E   L+ L+ LDLS+NNLTG +PS  N S ++ + LS + LSG   R    N++LV
Sbjct  641   SIPLELGELEHLTYLDLSQNNLTGHVPSFAN-SPVEFMHLSNNHLSGLSKRMLNENSSLV  699

Query  1980  ILDLSYNSFVGIIPEWIGTIsrlss--lllNGNRFEGKVPTQVCQLMRlslldlsnnlls  2153
             +LDLSYN     I   I  +S      L L GN F G +P Q+CQL  LS+LDLS+N  S
Sbjct  700   MLDLSYNEISNNIQGLIQNLSYTRLNFLFLKGNHFIGDIPKQLCQLADLSILDLSHNNFS  759

Query  2154  GVIPRCLGKISLE  2192
             G IP CLGK+  E
Sbjct  760   GAIPNCLGKMPFE  772


 Score =   124 bits (310),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 189/709 (27%), Positives = 307/709 (43%), Gaps = 69/709 (10%)
 Frame = +3

Query  102   GLINLEELHM---RYTQMEEINILSVLNLKDFISLKVLDIGFNKFQSFGPINDVGGAKKL  272
             GL NLE L +    Y Q E +      N+ +  SLKVL +         P  D    KKL
Sbjct  256   GLSNLEHLILDNNYYLQNEFLK-----NIGELTSLKVLSLQQCDINGTLPPTDWFKLKKL  310

Query  273   EELYLFECRFNQSIFQSLKGFPSLKILDLMDNDFYDGPLHIQDINDLRNLKELYLSDNYF  452
             EEL L E  F   +  S     SL+ L++  N F        ++  L +L+      N F
Sbjct  311   EELDLSENEFEGPLPSSFVNMTSLRKLEISYNHFIGN--FDSNLASLTSLEYFGFIGNQF  368

Query  453   E---GFETSANHSG-------------SSRHTIRNKSYLEVLHLNNISFDMTKLLSSLAA  584
             E    F   AN S               S H++  ++++    L  +    T    SL  
Sbjct  369   EIPVSFTPFANLSKIKFIYGHGNKFLLDSHHSL--QTWIPKFQLQELFVSSTTETKSLP-  425

Query  585   FPSIKTLELQRVNVTNID----------AIHALKNLSSLEELHLDGSNLHKDFLSNIGPM  734
                +    L + ++TNID           +  L+N + + E      +    F   + P+
Sbjct  426   ---LPNFLLYQNSLTNIDLSDWKLEGEFPLWLLENNTKMTEALFRNCSFTGTFQLPMSPL  482

Query  735   ESLKVLSLSGAQVGGTLPNKGLCEL-KNLQELWLSENQLEGKIPSYFGNLTSLRYVNLSL  911
              +++ + +S   + G +P+  +  +  NLQ L LS N ++G IPS  G ++ L  ++LS 
Sbjct  483   PNIQAIDVSDNTINGQIPSNNISSVYPNLQYLHLSRNNIQGSIPSELGQMSLLYSLDLSG  542

Query  912   NKLSGNIelsplstltsleylsIMNNSFEVASSFRSFANNSKLRVILADRNKVIADTQLQ  1091
             N+LSG I  S       L++L + NN FE      +  N   L+ +L + N  I   +L 
Sbjct  543   NQLSGKIPESIFGDGHPLQFLILSNNMFE--GPILTIPNG--LKTLLLNDNGFIG--RLP  596

Query  1092  GFVPKFQLDSLSLSNCIDLLKLPRFLHYQRDLKVLRISRNNLEGEFPSWLLQNNTKLQYF  1271
               +    + SL +SN   + K+P  +     L+ L +S N+ EG  P   L     L Y 
Sbjct  597   NSIFHASIISLDVSNNHLVGKIPGLIKNLSGLEELYLSNNHFEGSIP-LELGELEHLTYL  655

Query  1272  LMNNNAFTGSLKLSSHVNPNLQIINVSNNKLCGEISGNFSSSFPNILALNLSSNLFSGQL  1451
              ++ N  TG   + S  N  ++ +++SNN L G +S    +   +++ L+LS N  S  +
Sbjct  656   DLSQNNLTG--HVPSFANSPVEFMHLSNNHLSG-LSKRMLNENSSLVMLDLSYNEISNNI  712

Query  1452  HSLIG----THLGFLDLSNNSFTGEIPKEMLISCSSLVILKLSNNKLEGQIVQEFDYL--  1613
               LI     T L FL L  N F G+IPK+ L   + L IL LS+N   G I      +  
Sbjct  713   QGLIQNLSYTRLNFLFLKGNHFIGDIPKQ-LCQLADLSILDLSHNNFSGAIPNCLGKMPF  771

Query  1614  ----SSLEYLHLDGNNFEGTIpnslsnlplhslDIRDNKLSGEIPR---WMGRLTSLVQ-  1769
                 S   + +L G      +  +  +       +++        R   +MG + + +  
Sbjct  772   EVEDSPRLWRYLHGWPMGRYLVRNKYSRFQLLPYVQEKANFTSKKRTYTYMGSILAYMSG  831

Query  1770  LTLSKNHLEGHIPIEFCNLKSLSILDLSENNLTGSIPSCLNP-SSIKHVSLSKHQLSGQL  1946
             + LS N L+G+IP E  NL  +  L+LS N+LTG IP+  +     + + LS + L+GQ+
Sbjct  832   IDLSHNKLKGNIPSELGNLTKIHTLNLSHNDLTGKIPATFSHLVQTESLDLSFNMLNGQI  891

Query  1947  TRAFFNNTALVILDLSYNSFVGIIPEWIGTIsrlsslllNGNRFEGKVP  2093
                    T+L +  +++N+  G  PE+ G  S        GN F   +P
Sbjct  892   PPQLTTLTSLAVFSVAHNNLSGPTPEFKGQFSTFDESSYEGNPFLCGLP  940



>ref|XP_006382330.1| hypothetical protein POPTR_0005s01090g [Populus trichocarpa]
 gb|ERP60127.1| hypothetical protein POPTR_0005s01090g [Populus trichocarpa]
Length=760

 Score =   319 bits (818),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 224/594 (38%), Positives = 334/594 (56%), Gaps = 49/594 (8%)
 Frame = +3

Query  663   SSLEELHLDGSNLHKDFLSNIGPMESLKVLSLSGAQVGGTLPNKG-LCELKNLQELWLSE  839
             S+LEEL+LD ++L  +FL  I  + +LKVLS+S + + GTLP +G       L+EL+L  
Sbjct  26    STLEELYLDYTSLPLNFLPKIRALPALKVLSVSDSNLNGTLPTRGTFFNSSTLEELYLDY  85

Query  840   NQLEGKIPSYFGNLTSLRYVNLSLNKLSGNIelsplstltsleylsIMNNSFEVASSFRS  1019
               L        G L +L+ +++    ++  +                     +V  S + 
Sbjct  86    TSLPLNFLQDIGALPALKVLSVGECNINDTLPA-------------------QVPISRKH  126

Query  1020  FANNSKLRVILADRNKVIADT-QLQGFVPKFQLDSLSLSNCIDL----LKLPRFLHYQRD  1184
             F N+S L+   ++ N+++ +       +PKFQL    LSN        +++P FL+YQ +
Sbjct  127   FMNHSSLKFFSSENNRLVTEPMSFHDLIPKFQLVFFHLSNSPTSKAVNVEIPNFLYYQYN  186

Query  1185  LKVLRISRNNLEGEFPSWLLQNNTKLQYFLMNNNAFTGSLKLSSHVNPNLQIINVSNNKL  1364
             L+ L +S NN+ G FPSWLL+NNT+L+   M+ N+F G+L+L  H NPN+  +++SNN +
Sbjct  187   LRFLDLSHNNITGMFPSWLLKNNTRLEQLFMSENSFVGTLQLQDHPNPNMTELDISNNNM  24