BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22722_g1_i1 len=1958 path=[1:0-294 296:295-324 326:325-343
345:344-634 636:635-648 650:649-675 677:676-844 846:845-1319
1321:1320-1957]

Length=1958
                                                                      Score     E

emb|CDP17831.1|  unnamed protein product                                687   0.0      
ref|XP_010662812.1|  PREDICTED: glycerophosphodiester phosphodies...    651   0.0      
ref|XP_010662813.1|  PREDICTED: glycerophosphodiester phosphodies...    647   0.0      
ref|XP_010646613.1|  PREDICTED: glycerophosphodiester phosphodies...    646   0.0      
ref|XP_010662827.1|  PREDICTED: glycerophosphodiester phosphodies...    645   0.0      
ref|XP_010662810.1|  PREDICTED: glycerophosphodiester phosphodies...    644   0.0      
ref|XP_010662809.1|  PREDICTED: glycerophosphodiester phosphodies...    644   0.0      
ref|XP_002322015.2|  hypothetical protein POPTR_0015s02010g             643   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011003876.1|  PREDICTED: glycerophosphodiester phosphodies...    643   0.0      
ref|XP_002267774.2|  PREDICTED: probable receptor-like protein ki...    640   0.0      Vitis vinifera
ref|XP_010662995.1|  PREDICTED: glycerophosphodiester phosphodies...    641   0.0      
ref|XP_010663000.1|  PREDICTED: glycerophosphodiester phosphodies...    640   0.0      
ref|XP_010646611.1|  PREDICTED: glycerophosphodiester phosphodies...    639   0.0      
ref|XP_010662998.1|  PREDICTED: glycerophosphodiester phosphodies...    638   0.0      
ref|XP_003635153.1|  PREDICTED: glycerophosphodiester phosphodies...    637   0.0      
ref|XP_002268153.3|  PREDICTED: glycerophosphodiester phosphodies...    637   0.0      Vitis vinifera
ref|XP_010111692.1|  putative receptor-like protein kinase              636   0.0      
ref|XP_003634911.1|  PREDICTED: glycerophosphodiester phosphodies...    634   0.0      
ref|XP_011003875.1|  PREDICTED: glycerophosphodiester phosphodies...    633   0.0      
ref|XP_007220557.1|  hypothetical protein PRUPE_ppa003241mg             632   0.0      
ref|XP_010646997.1|  PREDICTED: probable receptor-like protein ki...    631   0.0      
ref|XP_002268734.3|  PREDICTED: glycerophosphodiester phosphodies...    628   0.0      Vitis vinifera
ref|XP_008347622.1|  PREDICTED: probable receptor-like protein ki...    627   0.0      
ref|XP_010645761.1|  PREDICTED: glycerophosphodiester phosphodies...    627   0.0      
emb|CDP17835.1|  unnamed protein product                                624   0.0      
ref|XP_008354881.1|  PREDICTED: probable receptor-like protein ki...    622   0.0      
ref|XP_010662835.1|  PREDICTED: glycerophosphodiester phosphodies...    620   0.0      
ref|XP_008232081.1|  PREDICTED: probable receptor-like protein ki...    620   0.0      
ref|XP_010662993.1|  PREDICTED: glycerophosphodiester phosphodies...    620   0.0      
ref|XP_008232099.1|  PREDICTED: probable receptor-like protein ki...    620   0.0      
ref|XP_002513562.1|  receptor serine/threonine kinase, putative         619   0.0      Ricinus communis
ref|XP_006376636.1|  hypothetical protein POPTR_0012s01760g             619   0.0      
ref|XP_002317767.2|  hypothetical protein POPTR_0012s01750g             618   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010091110.1|  putative receptor-like protein kinase              615   0.0      
ref|XP_002264064.1|  PREDICTED: glycerophosphodiester phosphodies...    615   0.0      Vitis vinifera
ref|XP_011001895.1|  PREDICTED: probable receptor-like protein ki...    614   0.0      
ref|XP_008246015.1|  PREDICTED: probable receptor-like protein ki...    613   0.0      
ref|XP_010662662.1|  PREDICTED: glycerophosphodiester phosphodies...    614   0.0      
ref|XP_010662387.1|  PREDICTED: probable receptor-like protein ki...    615   0.0      
ref|XP_008232078.1|  PREDICTED: probable receptor-like protein ki...    613   0.0      
ref|XP_010662988.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    610   0.0      
ref|XP_008363237.1|  PREDICTED: probable receptor-like protein ki...    611   0.0      
ref|XP_008376284.1|  PREDICTED: probable receptor-like protein ki...    611   0.0      
gb|KDP22160.1|  hypothetical protein JCGZ_25991                         611   0.0      
ref|XP_002266286.1|  PREDICTED: glycerophosphodiester phosphodies...    610   0.0      Vitis vinifera
ref|XP_002279967.2|  PREDICTED: glycerophosphodiester phosphodies...    610   0.0      Vitis vinifera
ref|XP_002263649.2|  PREDICTED: probable receptor-like protein ki...    608   0.0      Vitis vinifera
ref|XP_002322014.2|  hypothetical protein POPTR_0015s01990g             607   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011003874.1|  PREDICTED: glycerophosphodiester phosphodies...    608   0.0      
ref|XP_009765439.1|  PREDICTED: probable receptor-like protein ki...    608   0.0      
ref|XP_002275176.2|  PREDICTED: glycerophosphodiester phosphodies...    606   0.0      Vitis vinifera
ref|XP_004298576.1|  PREDICTED: probable receptor-like protein ki...    605   0.0      
ref|XP_011001896.1|  PREDICTED: glycerophosphodiester phosphodies...    605   0.0      
ref|XP_002513559.1|  receptor serine/threonine kinase, putative         605   0.0      Ricinus communis
ref|XP_007039002.1|  Kinase superfamily protein, putative               605   0.0      
ref|XP_009335120.1|  PREDICTED: probable receptor-like protein ki...    598   0.0      
gb|KDP22153.1|  hypothetical protein JCGZ_25984                         598   0.0      
ref|XP_010663016.1|  PREDICTED: glycerophosphodiester phosphodies...    598   0.0      
gb|KDP42825.1|  hypothetical protein JCGZ_23767                         597   0.0      
ref|XP_004287327.1|  PREDICTED: probable receptor-like protein ki...    595   0.0      
ref|XP_009596791.1|  PREDICTED: probable receptor-like protein ki...    596   0.0      
ref|XP_007036614.1|  Kinase superfamily protein, putative               595   0.0      
ref|XP_010662776.1|  PREDICTED: probable receptor-like protein ki...    593   0.0      
ref|XP_011037043.1|  PREDICTED: glycerophosphodiester phosphodies...    592   0.0      
ref|XP_011037042.1|  PREDICTED: glycerophosphodiester phosphodies...    591   0.0      
ref|XP_010662808.1|  PREDICTED: probable receptor-like protein ki...    591   0.0      
ref|XP_011037041.1|  PREDICTED: glycerophosphodiester phosphodies...    591   0.0      
ref|XP_010662831.1|  PREDICTED: glycerophosphodiester phosphodies...    590   0.0      
gb|EYU19635.1|  hypothetical protein MIMGU_mgv1a003204mg                588   0.0      
ref|XP_002268653.1|  PREDICTED: glycerophosphodiester phosphodies...    588   0.0      Vitis vinifera
ref|XP_007010199.1|  Kinase superfamily protein, putative               587   0.0      
ref|XP_010646615.1|  PREDICTED: glycerophosphodiester phosphodies...    585   0.0      
ref|XP_010662564.1|  PREDICTED: glycerophosphodiester phosphodies...    582   0.0      
ref|XP_004235104.1|  PREDICTED: probable receptor-like protein ki...    582   0.0      
ref|XP_010247813.1|  PREDICTED: glycerophosphodiester phosphodies...    581   0.0      
ref|XP_007039000.1|  Kinase superfamily protein, putative               576   0.0      
ref|XP_011084503.1|  PREDICTED: probable receptor-like protein ki...    578   0.0      
ref|XP_010049259.1|  PREDICTED: probable receptor-like protein ki...    576   0.0      
ref|XP_011037052.1|  PREDICTED: glycerophosphodiester phosphodies...    576   0.0      
ref|XP_007010207.1|  Kinase superfamily protein, putative               575   0.0      
ref|XP_008232076.1|  PREDICTED: probable receptor-like protein ki...    575   0.0      
ref|XP_010247811.1|  PREDICTED: glycerophosphodiester phosphodies...    575   0.0      
ref|XP_010275239.1|  PREDICTED: probable receptor-like protein ki...    574   0.0      
ref|XP_004308545.1|  PREDICTED: probable serine/threonine-protein...    587   0.0      
ref|XP_010662817.1|  PREDICTED: glycerophosphodiester phosphodies...    570   0.0      
ref|XP_010275238.1|  PREDICTED: probable receptor-like protein ki...    570   0.0      
ref|XP_006350636.1|  PREDICTED: probable receptor-like protein ki...    570   0.0      
gb|EYU32407.1|  hypothetical protein MIMGU_mgv1a020426mg                567   0.0      
ref|XP_011014401.1|  PREDICTED: probable receptor-like protein ki...    567   0.0      
gb|KEH40397.1|  receptor-like kinase                                    566   0.0      
ref|XP_010662818.1|  PREDICTED: probable receptor-like protein ki...    560   0.0      
ref|XP_011026383.1|  PREDICTED: probable receptor-like protein ki...    565   0.0      
emb|CBI23152.3|  unnamed protein product                                562   0.0      
emb|CAN66614.1|  hypothetical protein VITISV_023172                     563   0.0      Vitis vinifera
emb|CDP12538.1|  unnamed protein product                                566   0.0      
ref|XP_010662832.1|  PREDICTED: glycerophosphodiester phosphodies...    558   0.0      
ref|XP_009596788.1|  PREDICTED: probable receptor-like protein ki...    563   0.0      
gb|KDP42829.1|  hypothetical protein JCGZ_23771                         559   0.0      
ref|XP_010662565.1|  PREDICTED: glycerophosphodiester phosphodies...    560   0.0      
ref|XP_010645764.1|  PREDICTED: probable receptor-like protein ki...    561   0.0      
ref|XP_006374064.1|  hypothetical protein POPTR_0015s00220g             558   0.0      
ref|XP_010662821.1|  PREDICTED: probable LRR receptor-like serine...    567   0.0      
ref|XP_008232091.1|  PREDICTED: probable receptor-like protein ki...    558   0.0      
ref|XP_007036620.1|  Kinase superfamily protein, putative               558   0.0      
ref|XP_008345489.1|  PREDICTED: probable receptor-like protein ki...    558   0.0      
emb|CDP22043.1|  unnamed protein product                                559   0.0      
gb|EYU40255.1|  hypothetical protein MIMGU_mgv1a025285mg                556   0.0      
ref|XP_002529765.1|  receptor serine/threonine kinase, putative         557   0.0      Ricinus communis
ref|XP_010049239.1|  PREDICTED: probable receptor-like protein ki...    556   0.0      
ref|XP_009790415.1|  PREDICTED: probable receptor-like protein ki...    556   0.0      
ref|XP_010100009.1|  putative receptor-like protein kinase              555   0.0      
ref|XP_010646610.1|  PREDICTED: glycerophosphodiester phosphodies...    547   0.0      
ref|XP_007010206.1|  Kinase superfamily protein, putative               551   0.0      
ref|XP_010646609.1|  PREDICTED: glycerophosphodiester phosphodies...    547   0.0      
ref|XP_007029390.1|  Kinase superfamily protein, putative               552   0.0      
ref|XP_010049268.1|  PREDICTED: probable receptor-like protein ki...    551   0.0      
ref|XP_009335105.1|  PREDICTED: probable receptor-like protein ki...    550   0.0      
ref|XP_010068890.1|  PREDICTED: probable receptor-like protein ki...    549   0.0      
ref|XP_009367861.1|  PREDICTED: probable receptor-like protein ki...    548   0.0      
ref|XP_004305474.1|  PREDICTED: probable receptor-like protein ki...    548   0.0      
emb|CBI23153.3|  unnamed protein product                                541   0.0      
ref|XP_002513566.1|  receptor serine/threonine kinase, putative         543   0.0      Ricinus communis
ref|XP_008347208.1|  PREDICTED: probable receptor-like protein ki...    547   0.0      
ref|XP_004306205.1|  PREDICTED: probable receptor-like protein ki...    547   0.0      
ref|XP_003607183.1|  Kinase-like protein                                549   0.0      
gb|KCW89158.1|  hypothetical protein EUGRSUZ_A01470                     547   0.0      
ref|XP_002310447.2|  hypothetical protein POPTR_0007s02200g             545   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008345517.1|  PREDICTED: probable receptor-like protein ki...    545   0.0      
ref|XP_008348789.1|  PREDICTED: probable receptor-like protein ki...    545   0.0      
ref|XP_010049204.1|  PREDICTED: probable receptor-like protein ki...    547   0.0      
gb|AES89380.2|  receptor-like kinase                                    545   0.0      
ref|XP_006373193.1|  hypothetical protein POPTR_0017s09520g             539   0.0      
ref|XP_010049248.1|  PREDICTED: probable receptor-like protein ki...    545   0.0      
ref|XP_008365837.1|  PREDICTED: probable receptor-like protein ki...    545   0.0      
ref|XP_004308547.1|  PREDICTED: probable receptor-like protein ki...    543   0.0      
ref|XP_009341643.1|  PREDICTED: probable receptor-like protein ki...    544   0.0      
gb|EYU28967.1|  hypothetical protein MIMGU_mgv1a003390mg                542   0.0      
ref|XP_010662457.1|  PREDICTED: glycerophosphodiester phosphodies...    534   0.0      
ref|XP_008347133.1|  PREDICTED: probable receptor-like protein ki...    542   0.0      
ref|XP_008370222.1|  PREDICTED: probable receptor-like protein ki...    543   0.0      
ref|XP_009343234.1|  PREDICTED: probable receptor-like protein ki...    543   0.0      
ref|XP_011037151.1|  PREDICTED: glycerophosphodiester phosphodies...    539   0.0      
emb|CBI23135.3|  unnamed protein product                                536   0.0      
ref|XP_009599593.1|  PREDICTED: probable receptor-like protein ki...    540   0.0      
ref|XP_002310448.2|  hypothetical protein POPTR_0007s02290g             538   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004306408.1|  PREDICTED: probable receptor-like protein ki...    538   1e-180   
ref|XP_008232173.1|  PREDICTED: probable receptor-like protein ki...    537   3e-180   
gb|EYU21049.1|  hypothetical protein MIMGU_mgv1a017815mg                535   9e-180   
gb|EYU29477.1|  hypothetical protein MIMGU_mgv1a003032mg                536   9e-180   
gb|EYU37100.1|  hypothetical protein MIMGU_mgv1a023511mg                535   1e-179   
ref|XP_010100008.1|  putative receptor-like protein kinase              535   1e-179   
ref|XP_002262799.3|  PREDICTED: glycerophosphodiester phosphodies...    530   2e-179   Vitis vinifera
ref|XP_006380303.1|  hypothetical protein POPTR_0007s02250g             531   2e-179   
gb|EYU21041.1|  hypothetical protein MIMGU_mgv1a003344mg                535   3e-179   
ref|XP_009343243.1|  PREDICTED: probable receptor-like protein ki...    535   4e-179   
gb|EYU21067.1|  hypothetical protein MIMGU_mgv1a023848mg                534   5e-179   
gb|EYU21073.1|  hypothetical protein MIMGU_mgv1a003869mg                532   8e-179   
gb|EYU40245.1|  hypothetical protein MIMGU_mgv1a021311mg                531   1e-178   
ref|XP_007161520.1|  hypothetical protein PHAVU_001G076200g             533   1e-178   
gb|EYU21057.1|  hypothetical protein MIMGU_mgv1a024072mg                533   2e-178   
gb|KCW89168.1|  hypothetical protein EUGRSUZ_A01481                     538   2e-178   
ref|XP_009335040.1|  PREDICTED: probable receptor-like protein ki...    532   2e-178   
gb|EYU40252.1|  hypothetical protein MIMGU_mgv1a024546mg                529   6e-178   
gb|AES59881.2|  receptor-like kinase                                    532   6e-178   
ref|XP_009782477.1|  PREDICTED: probable receptor-like protein ki...    531   7e-178   
ref|XP_003589630.1|  Kinase R-like protein                              531   1e-177   
gb|AES59891.2|  receptor-like kinase                                    530   2e-177   
gb|EYU40244.1|  hypothetical protein MIMGU_mgv1a019217mg                526   3e-177   
ref|XP_009629970.1|  PREDICTED: probable receptor-like protein ki...    529   6e-177   
ref|XP_004498292.1|  PREDICTED: probable receptor-like protein ki...    529   6e-177   
gb|EYU21079.1|  hypothetical protein MIMGU_mgv1a023647mg                526   2e-176   
ref|XP_003589651.1|  Kinase R-like protein                              527   3e-176   
gb|EYU40249.1|  hypothetical protein MIMGU_mgv1a0233662mg               525   3e-176   
ref|XP_006374119.1|  hypothetical protein POPTR_0015s020001g            523   4e-176   
ref|XP_003589648.1|  Receptor serine/threonine kinase                   543   6e-176   
ref|XP_008363247.1|  PREDICTED: probable receptor-like protein ki...    523   6e-176   
ref|XP_003589640.1|  Kinase R-like protein                              526   2e-175   
gb|EYU37097.1|  hypothetical protein MIMGU_mgv1a021978mg                523   3e-175   
ref|XP_010942306.1|  PREDICTED: probable receptor-like protein ki...    525   6e-175   
ref|XP_009796757.1|  PREDICTED: probable receptor-like protein ki...    523   1e-174   
gb|AES59899.2|  receptor-like kinase                                    539   2e-174   
gb|EYU32415.1|  hypothetical protein MIMGU_mgv1a021939mg                521   3e-174   
ref|XP_009335043.1|  PREDICTED: G-type lectin S-receptor-like ser...    528   4e-174   
ref|XP_010317309.1|  PREDICTED: uncharacterized protein LOC101250956    538   5e-174   
ref|XP_011037049.1|  PREDICTED: probable receptor-like protein ki...    514   8e-174   
ref|XP_011037048.1|  PREDICTED: probable receptor-like protein ki...    513   2e-173   
ref|XP_011037047.1|  PREDICTED: probable receptor-like protein ki...    513   4e-173   
ref|XP_010315114.1|  PREDICTED: probable receptor-like protein ki...    517   2e-172   
ref|XP_010111690.1|  putative receptor-like protein kinase              515   2e-172   
ref|XP_004498413.1|  PREDICTED: probable receptor-like protein ki...    517   3e-172   
ref|XP_008232096.1|  PREDICTED: probable receptor-like protein ki...    508   6e-172   
ref|XP_007161512.1|  hypothetical protein PHAVU_001G075500g             516   7e-172   
ref|XP_008381957.1|  PREDICTED: probable receptor-like protein ki...    511   7e-172   
ref|XP_008363397.1|  PREDICTED: probable receptor-like protein ki...    512   9e-172   
ref|XP_003549300.1|  PREDICTED: probable receptor-like protein ki...    515   1e-171   
ref|XP_010942309.1|  PREDICTED: glycerophosphodiester phosphodies...    515   5e-171   
ref|XP_006380300.1|  hypothetical protein POPTR_0007s02220g             513   5e-171   
ref|XP_004228892.1|  PREDICTED: probable receptor-like protein ki...    513   6e-171   
gb|KEH40384.1|  receptor-like kinase                                    513   7e-171   
ref|XP_008365003.1|  PREDICTED: probable receptor-like protein ki...    509   9e-171   
ref|XP_004307040.1|  PREDICTED: probable receptor-like protein ki...    509   9e-171   
ref|XP_006368004.1|  PREDICTED: probable receptor-like protein ki...    512   1e-170   
ref|XP_009772453.1|  PREDICTED: probable receptor-like protein ki...    512   2e-170   
gb|KEH40379.1|  receptor-like kinase                                    512   2e-170   
ref|XP_003549304.1|  PREDICTED: probable receptor-like protein ki...    511   5e-170   
ref|XP_004498440.1|  PREDICTED: probable receptor-like protein ki...    505   6e-170   
ref|XP_006601167.1|  PREDICTED: probable receptor-like protein ki...    511   9e-170   
gb|KEH40317.1|  receptor-like kinase                                    509   1e-169   
gb|KEH40353.1|  receptor-like kinase                                    510   1e-169   
ref|XP_002513563.1|  receptor serine/threonine kinase, putative         501   1e-169   Ricinus communis
gb|KEH40373.1|  receptor-like kinase                                    509   2e-169   
ref|XP_010662834.1|  PREDICTED: glycerophosphodiester phosphodies...    513   2e-169   
ref|XP_009609373.1|  PREDICTED: probable receptor-like protein ki...    509   4e-169   
ref|XP_010100000.1|  putative receptor-like protein kinase              508   4e-169   
ref|XP_010102664.1|  putative receptor-like protein kinase              508   8e-169   
ref|XP_003543974.2|  PREDICTED: probable receptor-like protein ki...    506   4e-168   
gb|EYU21046.1|  hypothetical protein MIMGU_mgv1a023761mg                504   7e-168   
ref|XP_008347687.1|  PREDICTED: probable receptor-like protein ki...    497   8e-168   
ref|XP_007141187.1|  hypothetical protein PHAVU_008G174300g             505   1e-167   
gb|KCW89167.1|  hypothetical protein EUGRSUZ_A01480                     497   2e-167   
ref|XP_008344513.1|  PREDICTED: probable receptor-like protein ki...    501   2e-167   
ref|XP_008354849.1|  PREDICTED: probable receptor-like protein ki...    504   3e-167   
emb|CAN78922.1|  hypothetical protein VITISV_024237                     502   3e-167   Vitis vinifera
ref|XP_008373800.1|  PREDICTED: probable receptor-like protein ki...    496   4e-167   
ref|XP_007161447.1|  hypothetical protein PHAVU_001G069600g             503   9e-167   
gb|EYU21042.1|  hypothetical protein MIMGU_mgv1a020230mg                498   3e-166   
ref|XP_008354479.1|  PREDICTED: probable receptor-like protein ki...    493   4e-166   
ref|XP_009356098.1|  PREDICTED: probable receptor-like protein ki...    491   5e-166   
ref|XP_007161451.1|  hypothetical protein PHAVU_001G070000g             501   7e-166   
gb|KEH40339.1|  receptor-like kinase                                    501   9e-166   
ref|XP_008232074.1|  PREDICTED: probable receptor-like protein ki...    493   2e-165   
ref|XP_004498417.1|  PREDICTED: probable receptor-like protein ki...    499   3e-165   
gb|EYU21074.1|  hypothetical protein MIMGU_mgv1a024071mg                496   5e-165   
ref|XP_007161436.1|  hypothetical protein PHAVU_001G068500g             496   4e-164   
gb|KEH40312.1|  receptor-like kinase                                    495   4e-164   
ref|XP_003542135.2|  PREDICTED: probable receptor-like protein ki...    496   8e-164   
gb|KHN05165.1|  Putative receptor-like protein kinase                   494   8e-164   
gb|KEH40361.1|  receptor-like kinase                                    493   2e-163   
gb|KHM99707.1|  Putative receptor-like protein kinase                   494   2e-163   
ref|XP_008245767.1|  PREDICTED: probable receptor-like protein ki...    491   3e-163   
ref|XP_004498414.1|  PREDICTED: probable receptor-like protein ki...    493   4e-163   
ref|XP_003544058.1|  PREDICTED: probable receptor-like protein ki...    493   7e-163   
ref|XP_003520047.1|  PREDICTED: probable receptor-like protein ki...    493   9e-163   
ref|XP_007052345.1|  Kinase superfamily protein, putative               492   1e-162   
ref|XP_008232006.1|  PREDICTED: probable receptor-like protein ki...    491   4e-162   
gb|KHN23637.1|  Putative receptor-like protein kinase                   489   8e-162   
gb|KEH40391.1|  receptor-like kinase                                    488   1e-161   
ref|XP_008245710.1|  PREDICTED: probable receptor-like protein ki...    481   2e-161   
ref|XP_006374065.1|  hypothetical protein POPTR_0015s00230g             481   2e-161   
ref|XP_003555056.1|  PREDICTED: probable receptor-like protein ki...    488   3e-161   
ref|XP_006348214.1|  PREDICTED: probable receptor-like protein ki...    478   3e-160   
gb|KEH40303.1|  receptor-like kinase                                    486   6e-160   
ref|XP_008245755.1|  PREDICTED: probable receptor-like protein ki...    475   1e-159   
ref|XP_008245746.1|  PREDICTED: probable receptor-like protein ki...    474   2e-159   
gb|EYU32405.1|  hypothetical protein MIMGU_mgv1a019405mg                476   6e-158   
ref|XP_007163973.1|  hypothetical protein PHAVU_L000800g                479   6e-158   
gb|KEH40329.1|  receptor-like kinase                                    480   1e-157   
ref|XP_004498420.1|  PREDICTED: probable receptor-like protein ki...    478   2e-157   
ref|XP_008232189.1|  PREDICTED: probable receptor-like protein ki...    469   2e-157   
gb|KHN05171.1|  Putative receptor-like protein kinase                   477   3e-157   
gb|KEH26119.1|  receptor-like kinase                                    476   1e-156   
gb|KDP29653.1|  hypothetical protein JCGZ_18815                         473   2e-156   
ref|XP_004498489.1|  PREDICTED: probable receptor-like protein ki...    474   5e-156   
ref|XP_007052297.1|  Kinase superfamily protein, putative               475   6e-156   
ref|XP_008218518.1|  PREDICTED: probable receptor-like protein ki...    476   7e-156   
ref|XP_008344499.1|  PREDICTED: probable receptor-like protein ki...    472   6e-155   
gb|KEH33225.1|  receptor-like kinase                                    471   1e-154   
gb|KEH40372.1|  receptor-like kinase                                    469   5e-154   
gb|KCW89163.1|  hypothetical protein EUGRSUZ_A01475                     459   3e-153   
gb|KHN05855.1|  Putative receptor-like protein kinase                   462   6e-153   
ref|XP_006366547.1|  PREDICTED: probable receptor-like protein ki...    463   1e-152   
emb|CDP15084.1|  unnamed protein product                                459   3e-152   
ref|XP_006388399.1|  hypothetical protein POPTR_0197s00200g             458   6e-152   
ref|XP_003619237.1|  Kinase-like protein                                479   5e-151   
ref|XP_003619226.1|  Kinase-like protein                                460   1e-150   
ref|XP_007141197.1|  hypothetical protein PHAVU_008G1752000g            452   1e-150   
ref|XP_006348219.1|  PREDICTED: probable receptor-like protein ki...    453   1e-150   
gb|KHN09866.1|  Putative receptor-like protein kinase                   455   1e-150   
ref|XP_004498410.1|  PREDICTED: probable receptor-like protein ki...    460   1e-150   
gb|EYU21055.1|  hypothetical protein MIMGU_mgv1a025779mg                456   3e-150   
ref|XP_006448359.1|  hypothetical protein CICLE_v10014549mg             461   1e-149   
gb|KEH40354.1|  malectin/receptor-like kinase family protein            449   1e-149   
ref|XP_004498446.1|  PREDICTED: probable receptor-like protein ki...    449   2e-149   
ref|XP_006468773.1|  PREDICTED: probable receptor-like protein ki...    458   2e-149   
ref|XP_006372929.1|  hypothetical protein POPTR_0017s06330g             453   2e-149   
ref|XP_008218520.1|  PREDICTED: probable receptor-like protein ki...    460   3e-149   
ref|XP_006448368.1|  hypothetical protein CICLE_v10014602mg             456   2e-148   
ref|XP_007163975.1|  hypothetical protein PHAVU_L001000g                458   2e-148   
ref|XP_007052349.1|  Kinase superfamily protein, putative               457   3e-148   
ref|XP_009796758.1|  PREDICTED: probable receptor-like protein ki...    447   1e-147   
gb|KEH40314.1|  receptor-like kinase                                    451   1e-147   
gb|EYU37102.1|  hypothetical protein MIMGU_mgv1a023653mg                445   1e-146   
ref|XP_008348800.1|  PREDICTED: probable receptor-like protein ki...    444   2e-145   
gb|KEH15653.1|  receptor-like kinase                                    444   2e-144   
ref|XP_009394055.1|  PREDICTED: probable receptor-like protein ki...    444   4e-144   
ref|XP_008358321.1|  PREDICTED: probable receptor-like protein ki...    431   2e-142   
ref|XP_004968010.1|  PREDICTED: probable receptor-like protein ki...    439   5e-142   
gb|KEH40321.1|  receptor-like kinase                                    433   1e-140   
gb|EAZ10294.1|  hypothetical protein OsJ_00129                          434   2e-140   
ref|XP_009386370.1|  PREDICTED: probable receptor-like protein ki...    434   3e-140   
ref|XP_010099999.1|  putative receptor-like protein kinase              433   5e-140   
gb|KEH40367.1|  receptor-like kinase                                    426   2e-139   
ref|XP_006468775.1|  PREDICTED: probable receptor-like protein ki...    423   2e-138   
ref|XP_008370766.1|  PREDICTED: probable receptor-like protein ki...    426   5e-138   
ref|XP_009379731.1|  PREDICTED: probable receptor-like protein ki...    431   8e-138   
ref|XP_009379730.1|  PREDICTED: probable receptor-like protein ki...    431   8e-138   
ref|XP_007208322.1|  hypothetical protein PRUPE_ppa002693mg             429   1e-137   
ref|XP_006448355.1|  hypothetical protein CICLE_v10017840mg             419   2e-137   
ref|NP_001041836.1|  Os01g0115600                                       426   1e-136   
ref|XP_006469098.1|  PREDICTED: probable receptor-like protein ki...    414   7e-136   
ref|XP_007052343.1|  Kinase superfamily protein, putative               419   1e-135   
ref|XP_004301779.1|  PREDICTED: probable receptor-like protein ki...    412   1e-134   
gb|EEE53760.1|  hypothetical protein OsJ_00139                          419   3e-134   
ref|XP_006448356.1|  hypothetical protein CICLE_v10018302mg             410   4e-134   
ref|XP_006645444.1|  PREDICTED: probable receptor-like protein ki...    419   9e-134   
ref|XP_010910459.1|  PREDICTED: probable receptor-like protein ki...    417   2e-133   
gb|EEE53757.1|  hypothetical protein OsJ_00133                          417   3e-133   
ref|XP_008388745.1|  PREDICTED: probable receptor-like protein ki...    408   5e-133   
ref|XP_011070618.1|  PREDICTED: probable receptor-like protein ki...    412   7e-133   
ref|XP_008389029.1|  PREDICTED: probable receptor-like protein ki...    417   2e-132   
gb|EAZ10273.1|  hypothetical protein OsJ_00108                          413   5e-132   
gb|EEC69809.1|  hypothetical protein OsI_00116                          413   5e-132   
ref|NP_001041818.1|  Os01g0113200                                       414   6e-132   
dbj|BAJ99553.1|  predicted protein                                      411   4e-131   
ref|XP_006643675.1|  PREDICTED: probable receptor-like protein ki...    411   5e-131   
ref|XP_006643670.1|  PREDICTED: probable receptor-like protein ki...    410   1e-130   
gb|EYU25702.1|  hypothetical protein MIMGU_mgv1a010493mg                399   1e-130   
gb|AAC02535.1|  receptor serine/threonine kinase                        409   2e-130   
ref|XP_010662970.1|  PREDICTED: G-type lectin S-receptor-like ser...    402   6e-130   
gb|AAC27489.1|  receptor-like protein kinase                            408   8e-130   
ref|XP_009388103.1|  PREDICTED: probable receptor-like protein ki...    407   1e-129   
gb|AAF68398.1|AF237568_1  receptor-like protein kinase                  409   1e-129   
dbj|BAB17345.1|  putative rust resistance kinase Lr10                   407   3e-129   
ref|NP_001041852.1|  Os01g0117500                                       407   4e-129   
emb|CBI75522.1|  Ser/Thr receptor-like kinase, putative, expressed      407   4e-129   
gb|ADP68614.1|  STK disease resistance protein                          400   1e-127   
gb|KEH40566.1|  receptor-like kinase                                    407   3e-127   
ref|XP_002455309.1|  hypothetical protein SORBIDRAFT_03g008150          402   6e-127   
ref|XP_010936904.1|  PREDICTED: probable receptor-like protein ki...    401   2e-126   
ref|XP_008780372.1|  PREDICTED: probable receptor-like protein ki...    389   2e-126   
ref|NP_001041828.2|  Os01g0114300                                       391   4e-126   
ref|XP_006388404.1|  hypothetical protein POPTR_0197s00240g             387   5e-126   
ref|NP_001041824.1|  Os01g0113800                                       397   2e-125   
ref|XP_010230371.1|  PREDICTED: probable receptor-like protein ki...    396   3e-125   
ref|XP_004968991.1|  PREDICTED: probable receptor-like protein ki...    395   6e-125   
ref|XP_003565250.1|  PREDICTED: probable receptor-like protein ki...    395   8e-125   
gb|EMT01426.1|  Putative receptor-like protein kinase                   395   2e-124   
emb|CDM86560.1|  unnamed protein product                                390   2e-124   
ref|XP_006448364.1|  hypothetical protein CICLE_v10018277mg             384   3e-124   
gb|AAC01746.1|  receptor-like protein kinase                            386   4e-124   
dbj|BAJ87570.1|  predicted protein                                      385   5e-124   
gb|EEE53763.1|  hypothetical protein OsJ_00142                          393   5e-124   
dbj|BAD52570.1|  putative rust resistance kinase Lr10                   394   6e-124   
gb|AAM09944.1|  receptor kinase LRK10                                   393   8e-124   
ref|XP_006643725.1|  PREDICTED: G-type lectin S-receptor-like ser...    395   9e-124   
dbj|BAJ87718.1|  predicted protein                                      385   5e-123   
ref|NP_001041839.2|  Os01g0115900                                       387   5e-123   
ref|NP_001041846.1|  Os01g0116900                                       383   6e-123   
gb|EEE53769.1|  hypothetical protein OsJ_00156                          391   7e-123   
ref|XP_003567573.1|  PREDICTED: probable receptor-like protein ki...    390   8e-123   
ref|NP_001041854.1|  Os01g0117700                                       390   9e-123   
ref|NP_001041832.1|  Os01g0114700                                       388   9e-123   
ref|XP_006643676.1|  PREDICTED: probable receptor-like protein ki...    390   2e-122   
ref|XP_002458022.1|  hypothetical protein SORBIDRAFT_03g025610          380   2e-122   
gb|EMT17872.1|  Putative receptor-like protein kinase                   389   2e-122   
gb|AAD44029.1|  receptor-like kinase LRK10                              389   3e-122   
gb|EMT14014.1|  Putative receptor-like protein kinase                   384   3e-122   
ref|XP_008346580.1|  PREDICTED: probable receptor-like protein ki...    375   3e-122   
gb|KDP22159.1|  hypothetical protein JCGZ_25990                         389   4e-122   
ref|XP_006448367.1|  hypothetical protein CICLE_v10018054mg             379   5e-122   
gb|ABB84340.1|  resistance-related receptor-like kinase                 388   5e-122   
gb|AAF78018.1|AF238474_1  receptor-like kinase                          389   5e-122   
ref|XP_003569123.1|  PREDICTED: probable receptor-like protein ki...    388   6e-122   
ref|XP_010231868.1|  PREDICTED: probable receptor-like protein ki...    384   6e-122   
gb|EYU32416.1|  hypothetical protein MIMGU_mgv1a024391mg                377   8e-122   
dbj|BAJ95981.1|  predicted protein                                      385   1e-121   
gb|AAD46917.1|AF164021_1  receptor kinase                               388   1e-121   
dbj|BAJ99243.1|  predicted protein                                      377   1e-121   
gb|ABB84341.1|  resistance-related receptor-like kinase                 387   1e-121   
gb|AAK20740.1|  LRK33                                                   387   2e-121   
ref|XP_004304784.1|  PREDICTED: uncharacterized protein LOC101298049    410   2e-121   
ref|XP_002457485.1|  hypothetical protein SORBIDRAFT_03g008100          386   2e-121   
gb|AAF78044.1|AF248493_1  receptor-like kinase                          387   3e-121   
gb|EMT25629.1|  Putative receptor-like protein kinase                   387   3e-121   
gb|AAC49629.1|  rust resistance kinase Lr10                             386   3e-121   
gb|AAK20743.1|  LRK14                                                   386   4e-121   
dbj|BAJ90475.1|  predicted protein                                      385   6e-121   
ref|XP_006448352.1|  hypothetical protein CICLE_v10017959mg             375   1e-120   
ref|XP_003634140.2|  PREDICTED: glycerophosphodiester phosphodies...    376   1e-120   
gb|EMT11931.1|  Putative receptor-like protein kinase                   385   1e-120   
ref|NP_001041850.1|  Os01g0117300                                       379   2e-120   
dbj|BAG99881.1|  unnamed protein product                                373   2e-120   
dbj|BAK03091.1|  predicted protein                                      384   3e-120   
gb|AFW57789.1|  putative protein kinase superfamily protein             374   3e-120   
ref|XP_008777484.1|  PREDICTED: probable receptor-like protein ki...    374   5e-120   
ref|XP_002513568.1|  receptor serine/threonine kinase, putative         378   7e-120   
ref|XP_010646614.1|  PREDICTED: probable receptor-like protein ki...    377   8e-120   
ref|XP_009340428.1|  PREDICTED: probable receptor-like protein ki...    377   8e-120   
ref|NP_001041821.2|  Os01g0113500                                       373   1e-119   
dbj|BAJ93673.1|  predicted protein                                      377   1e-119   
ref|XP_008389262.1|  PREDICTED: probable receptor-like protein ki...    382   1e-119   
gb|AAK20738.1|  LRK19                                                   382   1e-119   
gb|EMT00687.1|  Putative receptor-like protein kinase                   381   2e-119   
ref|XP_002267821.3|  PREDICTED: glycerophosphodiester phosphodies...    381   2e-119   
gb|ACK44484.1|  receptor-like kinase 2                                  381   2e-119   
ref|NP_001041848.1|  Os01g0117100                                       382   3e-119   
dbj|BAD45067.1|  putative rust resistance kinase Lr10                   381   3e-119   
gb|AFW79842.1|  putative protein kinase superfamily protein             372   3e-119   
ref|XP_008655561.1|  PREDICTED: probable receptor-like protein ki...    380   4e-119   
ref|XP_008663027.1|  PREDICTED: probable receptor-like protein ki...    380   5e-119   
ref|XP_008389263.1|  PREDICTED: probable receptor-like protein ki...    380   6e-119   
gb|AAM09946.1|  receptor kinase LRK9                                    375   1e-118   
ref|XP_010662830.1|  PREDICTED: probable receptor-like protein ki...    381   1e-118   
ref|XP_006840802.1|  hypothetical protein AMTR_s00213p00032300          369   2e-118   
ref|XP_003566867.1|  PREDICTED: probable receptor-like protein ki...    379   2e-118   
ref|XP_010230375.1|  PREDICTED: probable receptor-like protein ki...    379   2e-118   
ref|XP_010662829.1|  PREDICTED: probable receptor-like protein ki...    381   2e-118   
ref|XP_004967998.1|  PREDICTED: probable receptor-like protein ki...    380   3e-118   
ref|XP_009356306.1|  PREDICTED: probable receptor-like protein ki...    370   3e-118   
ref|XP_010275348.1|  PREDICTED: probable receptor-like protein ki...    369   3e-118   
ref|XP_008655567.1|  PREDICTED: probable receptor-like protein ki...    368   5e-118   
ref|XP_008361717.1|  PREDICTED: probable receptor-like protein ki...    378   6e-118   
ref|XP_008368294.1|  PREDICTED: probable receptor-like protein ki...    369   7e-118   
ref|XP_003635630.2|  PREDICTED: probable receptor-like protein ki...    369   8e-118   
ref|XP_010942304.1|  PREDICTED: putative cysteine-rich receptor-l...    379   9e-118   
ref|XP_009346597.1|  PREDICTED: probable receptor-like protein ki...    371   9e-118   
ref|XP_008347212.1|  PREDICTED: probable receptor-like protein ki...    368   9e-118   
ref|XP_009356232.1|  PREDICTED: probable receptor-like protein ki...    376   1e-117   
ref|XP_006384126.1|  hypothetical protein POPTR_0004s07470g             376   2e-117   
ref|XP_008353064.1|  PREDICTED: probable receptor-like protein ki...    368   2e-117   
ref|XP_008345483.1|  PREDICTED: probable receptor-like protein ki...    369   2e-117   
ref|XP_011037045.1|  PREDICTED: probable receptor-like protein ki...    377   3e-117   
ref|XP_008345477.1|  PREDICTED: probable receptor-like protein ki...    369   4e-117   
ref|XP_010662826.1|  PREDICTED: probable receptor-like protein ki...    378   4e-117   
emb|CAN72345.1|  hypothetical protein VITISV_041721                     370   6e-117   
ref|XP_006842387.1|  hypothetical protein AMTR_s00079p00195720          365   8e-117   
ref|XP_006829358.1|  hypothetical protein AMTR_s01480p00009240          365   8e-117   
ref|XP_002321441.2|  hypothetical protein POPTR_0015s02040g             374   1e-116   
ref|XP_004968132.1|  PREDICTED: probable receptor-like protein ki...    374   2e-116   
ref|XP_008367054.1|  PREDICTED: probable receptor-like protein ki...    373   2e-116   
gb|AAM09949.1|  receptor kinase LRK45                                   373   3e-116   
ref|XP_008339643.1|  PREDICTED: probable receptor-like protein ki...    372   4e-116   
ref|XP_007219143.1|  hypothetical protein PRUPE_ppa016018mg             373   4e-116   
ref|XP_011071254.1|  PREDICTED: probable receptor-like protein ki...    372   5e-116   
ref|XP_007021958.1|  PR5-like receptor kinase                           365   7e-116   
ref|XP_009357089.1|  PREDICTED: probable receptor-like protein ki...    364   8e-116   
ref|NP_001105659.1|  Ser/Thr receptor-like kinase1 precursor            371   8e-116   
gb|ACN34005.1|  unknown                                                 371   8e-116   
ref|XP_002263061.2|  PREDICTED: glycerophosphodiester phosphodies...    364   8e-116   
ref|XP_010942308.1|  PREDICTED: probable receptor-like protein ki...    374   8e-116   
ref|XP_006840801.1|  hypothetical protein AMTR_s00213p00028200          362   9e-116   
gb|KEH40396.1|  stress-induced receptor-like kinase, putative           372   1e-115   
ref|XP_010662819.1|  PREDICTED: probable receptor-like protein ki...    363   1e-115   
gb|AFB69786.1|  receptor serine/threonine kinase                        358   1e-115   
ref|XP_010911327.1|  PREDICTED: probable receptor-like protein ki...    362   1e-115   
ref|XP_006468743.1|  PREDICTED: probable receptor-like protein ki...    372   2e-115   
ref|XP_010662566.1|  PREDICTED: cysteine-rich receptor-like prote...    374   2e-115   
ref|XP_008350977.1|  PREDICTED: probable receptor-like protein ki...    372   2e-115   
ref|XP_010646999.1|  PREDICTED: probable receptor-like protein ki...    373   2e-115   
gb|AAF78021.1|AF238477_1  receptor-like kinase                          371   2e-115   
ref|XP_009356233.1|  PREDICTED: probable receptor-like protein ki...    364   3e-115   
gb|AAD46916.1|AF164020_1  receptor kinase                               370   3e-115   
ref|XP_010662816.1|  PREDICTED: cysteine-rich receptor-like prote...    373   3e-115   
ref|XP_006442609.1|  hypothetical protein CICLE_v10023720mg             362   3e-115   
ref|XP_004300969.1|  PREDICTED: probable receptor-like protein ki...    372   3e-115   
gb|AFW79837.1|  putative protein kinase superfamily protein             370   3e-115   
gb|AAF78016.1|AF238472_1  receptor-like kinase                          371   3e-115   
ref|XP_006589682.1|  PREDICTED: probable receptor-like protein ki...    370   4e-115   
ref|XP_010662458.1|  PREDICTED: probable receptor-like protein ki...    369   4e-115   
ref|XP_011037147.1|  PREDICTED: probable receptor-like protein ki...    363   5e-115   
ref|XP_004300967.1|  PREDICTED: probable receptor-like protein ki...    367   6e-115   
ref|XP_002263251.3|  PREDICTED: probable receptor-like protein ki...    362   6e-115   
ref|XP_011037044.1|  PREDICTED: probable receptor-like protein ki...    367   6e-115   
ref|XP_008231870.1|  PREDICTED: probable receptor-like protein ki...    370   7e-115   
ref|XP_009335119.1|  PREDICTED: probable receptor-like protein ki...    370   7e-115   
ref|XP_008243421.1|  PREDICTED: probable receptor-like protein ki...    360   8e-115   
ref|XP_006605922.1|  PREDICTED: probable receptor-like protein ki...    369   8e-115   
ref|XP_009357158.1|  PREDICTED: probable receptor-like protein ki...    369   9e-115   
gb|EMT01970.1|  Putative receptor-like protein kinase                   362   1e-114   
ref|XP_008809173.1|  PREDICTED: putative G-type lectin S-receptor...    371   1e-114   
ref|XP_004968005.1|  PREDICTED: probable receptor-like protein ki...    369   1e-114   
ref|XP_008361721.1|  PREDICTED: probable receptor-like protein ki...    361   1e-114   
ref|XP_009357183.1|  PREDICTED: probable receptor-like protein ki...    368   1e-114   
ref|XP_010646996.1|  PREDICTED: glycerophosphodiester phosphodies...    370   1e-114   
ref|XP_009357151.1|  PREDICTED: probable receptor-like protein ki...    368   1e-114   
emb|CBI23149.3|  unnamed protein product                                363   1e-114   
ref|XP_009357167.1|  PREDICTED: probable receptor-like protein ki...    368   1e-114   
ref|XP_010662972.1|  PREDICTED: glycerophosphodiester phosphodies...    370   2e-114   
ref|XP_010662971.1|  PREDICTED: glycerophosphodiester phosphodies...    370   2e-114   
gb|EMT10557.1|  Putative receptor-like protein kinase                   367   3e-114   
ref|XP_008361716.1|  PREDICTED: probable receptor-like protein ki...    367   3e-114   
ref|XP_008361720.1|  PREDICTED: probable receptor-like protein ki...    360   3e-114   
ref|XP_010942305.1|  PREDICTED: probable receptor-like protein ki...    369   3e-114   
ref|XP_011076438.1|  PREDICTED: glycerophosphodiester phosphodies...    359   4e-114   
ref|XP_002265870.3|  PREDICTED: lectin-domain containing receptor...    371   4e-114   
ref|XP_010662822.1|  PREDICTED: G-type lectin S-receptor-like ser...    370   4e-114   
ref|XP_008361719.1|  PREDICTED: probable receptor-like protein ki...    365   5e-114   
ref|XP_002513561.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    359   5e-114   
gb|KDP42824.1|  hypothetical protein JCGZ_23766                         366   5e-114   
ref|XP_003634115.2|  PREDICTED: glycerophosphodiester phosphodies...    360   5e-114   



>emb|CDP17831.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/595 (59%), Positives = 429/595 (72%), Gaps = 22/595 (4%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPL---LNAT  1757
              + C  R+C + GP I FPFRLK  QP  CG+PGFEL CT   ET LENPF +   LN T
Sbjct  24    HDNCTMRRCSDRGPAIRFPFRLKDYQPQHCGFPGFELSCTQSQETVLENPFRVKASLNQT  83

Query  1756  LQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTH  1577
              +PPF V F+I  ID E +L+ +S++DGC   LLP L+LSAS F  ++  +   F   + 
Sbjct  84    -KPPFSVNFVINKIDYESQLLYVSKLDGCLPGLLPKLDLSASLFQIQDFDDDFSFFKCSS  142

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
             +   A    + PI CL+   + +YA  SS+ L  A+ L+SCTKMF + S+ Y++      
Sbjct  143   KKWYA----MIPIPCLSNSSYQVYAIHSSVDLRDAS-LVSCTKMFEIPSLFYALIVPQIP  197

Query  1396  FSLRWTGPSC-------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVV  1238
               L W+ P+C       +    S++     C+       TGPL+K+KV G V+G  L+V+
Sbjct  198   LVLSWSAPNCGFCEAEGKFCRLSSSLAGVQCLEN----GTGPLKKIKVTGMVVGPALIVL  253

Query  1237  IVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGT  1058
             I + +YRI+R  K+KKE+Q+KI +FLEDYKALKP+RYSY+DIKKIT  FSEKLGEG YGT
Sbjct  254   IGIASYRIFRSKKLKKEDQLKIGQFLEDYKALKPSRYSYSDIKKITGNFSEKLGEGGYGT  313

Query  1057  VYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALV  878
             VYKGKLS +VFVAVKVLNNSKG G  E+F+NE+ TIG IHHIN+VRLVGYCADG+   LV
Sbjct  314   VYKGKLSNEVFVAVKVLNNSKGGG--EDFINEVGTIGQIHHINIVRLVGYCADGYRGVLV  371

Query  877   YEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
             YE+L N+SLEKF  S N++N LG EKL  IALG AKG+EYLHQGC+QRILHFDIKP NIL
Sbjct  372   YEFLPNHSLEKFTSSENERNLLGLEKLHNIALGTAKGIEYLHQGCEQRILHFDIKPHNIL  431

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LDQNFNPKISDFGQAKLCSKE+S VSMTAARGTMGYIAPEVFSRNFG VS+KSDVYSFGM
Sbjct  432   LDQNFNPKISDFGQAKLCSKEQSAVSMTAARGTMGYIAPEVFSRNFGKVSHKSDVYSFGM  491

Query  517   LLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGL  338
             LL+EMVGG+K   I G   + + YFPEWIYN L +GEE+ IQI+  +D   AKKL I+GL
Sbjct  492   LLIEMVGGRKNIKIGGQDNSAEAYFPEWIYNKLDQGEEITIQIDNEDDKITAKKLMIIGL  551

Query  337   WCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALE  173
             WCIQWYPVDRPS+K VIQMLEAEEPPSMP NPF ST+    +A   G  F + L+
Sbjct  552   WCIQWYPVDRPSMKAVIQMLEAEEPPSMPRNPFGSTNTINERATLGGGTFVNELK  606



>ref|XP_010662812.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=611

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/610 (56%), Positives = 438/610 (72%), Gaps = 40/610 (7%)
 Frame = -2

Query  1927  RNECLPRK-CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+    CG+ GP I FPF LKH QP  CGYPGFEL CT+  +T L+           
Sbjct  23    RDECMTSNGCGDQGPLIRFPFHLKH-QPHHCGYPGFELSCTENNQTMLD-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
              P  VK L++ I  + R II+   D C  + L  LNL+ASPF F+   +F +F+CS+ + 
Sbjct  71    LPVSVKLLVKKIVYKSREIIVQDPDNCLARQLRNLNLAASPFHFKFERDFILFNCSSDK-  129

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD----N  1403
                 S     I CL+ PG+ +YA  SS Y+   TDL SC ++++ S+       D     
Sbjct  130   --TESSRFQSIPCLSIPGNPVYAVSSSRYV-QYTDLSSCRRLYNASAPGNRDYGDYMFNG  186

Query  1402  TVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTK--LHTGPLRKLKVAGEVL  1259
             + FSL+W+          G  CRLK +++ E   +CI  ++K  + TG  +KL V G + 
Sbjct  187   SAFSLKWSKSICGSCPEGGKICRLKKSNSREPETECIKGVSKKLIVTGVSKKLIVTGAIF  246

Query  1258  GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
             G FL++++++V YR+Y  NK++++ +VK+++FLEDY+ LKP+RYSYADIK+IT +F +KL
Sbjct  247   GFFLLMLVIVVAYRVYSSNKVERDNRVKVKKFLEDYETLKPSRYSYADIKRITSQFKDKL  306

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             GEG YGTVYKGKLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CAD
Sbjct  307   GEGGYGTVYKGKLSDEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCAD  364

Query  898   GFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
              F RAL+YEYL N SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCDQRILHF
Sbjct  365   RFERALIYEYLPNESLEKFIFSKVVKNYSLNWKKLQEIAIGIAKGIEYLHQGCDQRILHF  424

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DIKP NILLD NFNPKISDFG AKLCSKE+S VSMT  RGTMGYIAPEV SRNFGNVSYK
Sbjct  425   DIKPHNILLDHNFNPKISDFGLAKLCSKEQSAVSMTIVRGTMGYIAPEVLSRNFGNVSYK  484

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIA  362
             SDVYSFGMLLLEMVGG+K  D++    T+Q YFPEWIYN L  GEE+ I+I++  D +IA
Sbjct  485   SDVYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEWIYNHLDIGEELHIRIKEEGDVEIA  543

Query  361   KKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFT  185
             KKL IVGL CIQW PVDRPS+K+V+QMLE E +  +MPPNPF ST P+    +KPGR+F 
Sbjct  544   KKLAIVGLSCIQWCPVDRPSMKIVVQMLEGEGDKLTMPPNPFASTVPT--NLSKPGRVFQ  601

Query  184   SALEIISEMD  155
               L IISE++
Sbjct  602   QELAIISELE  611



>ref|XP_010662813.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=602

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/608 (56%), Positives = 434/608 (71%), Gaps = 45/608 (7%)
 Frame = -2

Query  1927  RNECLPRK-CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+    CG+ GP I FPF LKH QP  CGYPGFEL CT+  +T L+           
Sbjct  23    RDECMTSNGCGDQGPLIRFPFHLKH-QPHHCGYPGFELSCTENNQTMLD-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
              P  VK L++ I  + R II+   D C  + L  LNL+ASPF F+   +F +F+CS+ + 
Sbjct  71    LPVSVKLLVKKIVYKSREIIVQDPDNCLARQLRNLNLAASPFHFKFERDFILFNCSSDK-  129

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD----N  1403
                 S     I CL+ PG+ +YA  SS Y+   TDL SC ++++ S+       D     
Sbjct  130   --TESSRFQSIPCLSIPGNPVYAVSSSRYV-QYTDLSSCRRLYNASAPGNRDYGDYMFNG  186

Query  1402  TVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
             + FSL+W+          G  CRLK +++ E   +CI  ++K       KL V G + G 
Sbjct  187   SAFSLKWSKSICGSCPEGGKICRLKKSNSREPETECIKGVSK-------KLIVTGAIFGF  239

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             FL++++++V YR+Y  NK++++ +VK+++FLEDY+ LKP+RYSYADIK+IT +F +KLGE
Sbjct  240   FLLMLVIVVAYRVYSSNKVERDNRVKVKKFLEDYETLKPSRYSYADIKRITSQFKDKLGE  299

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G YGTVYKGKLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CAD F
Sbjct  300   GGYGTVYKGKLSDEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCADRF  357

Query  892   HRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
              RAL+YEYL N SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCDQRILHFDI
Sbjct  358   ERALIYEYLPNESLEKFIFSKVVKNYSLNWKKLQEIAIGIAKGIEYLHQGCDQRILHFDI  417

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP NILLD NFNPKISDFG AKLCSKE+S VSMT  RGTMGYIAPEV SRNFGNVSYKSD
Sbjct  418   KPHNILLDHNFNPKISDFGLAKLCSKEQSAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSD  477

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             VYSFGMLLLEMVGG+K  D++    T+Q YFPEWIYN L  GEE+ I+I++  D +IAKK
Sbjct  478   VYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEWIYNHLDIGEELHIRIKEEGDVEIAKK  536

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSA  179
             L IVGL CIQW PVDRPS+K+V+QMLE E +  +MPPNPF ST P+    +KPGR+F   
Sbjct  537   LAIVGLSCIQWCPVDRPSMKIVVQMLEGEGDKLTMPPNPFASTVPT--NLSKPGRVFQQE  594

Query  178   LEIISEMD  155
             L IISE++
Sbjct  595   LAIISELE  602



>ref|XP_010646613.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=608

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/611 (56%), Positives = 438/611 (72%), Gaps = 45/611 (7%)
 Frame = -2

Query  1927  RNECLPRK-CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+    CG+ GP I FPFRLKH QP  CGYPGFEL CT+  +T L+           
Sbjct  23    RDECMTSNGCGDQGPLIRFPFRLKH-QPHHCGYPGFELSCTENNQTMLD-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIF-SCSTHR  1574
              P  VK L++ I  + R II+   D C  + L  LNL+ASPF F+   +F+ F +CS+++
Sbjct  71    LPVSVKLLVKKIVYKSREIIVQDPDNCLARQLRNLNLAASPFYFKFGLDFTFFINCSSYK  130

Query  1573  NITAGS--INISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD--  1406
                 GS   +  PI CL+ PG+ +YA  SS  +   TDL SC ++++ S+       D  
Sbjct  131   TPEPGSWAYDFEPIPCLSNPGNPVYAVYSSGSV-QYTDLSSCRRLYNASAPGNRDYGDYM  189

Query  1405  --NTVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEV  1262
                + FSL+W+          G  CRLK +++ E   +CI  ++K       KL V G +
Sbjct  190   FNGSAFSLKWSKSICGSCPEGGKICRLKKSNSREPETECIKGVSK-------KLIVIGAI  242

Query  1261  LGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
              G FL++++++V YR+Y  NK++++ +VK+++FLEDY+ALKP+RYSYADIK+IT +F +K
Sbjct  243   FGFFLLMLVIVVAYRVYSSNKVERDNRVKVKKFLEDYEALKPSRYSYADIKRITSQFKDK  302

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             LGEG YGTVYKGKLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CA
Sbjct  303   LGEGGYGTVYKGKLSDEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCA  360

Query  901   DGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILH  725
             D F RAL+YEYL N SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCDQRILH
Sbjct  361   DRFKRALIYEYLPNESLEKFIFSKVVKNYSLSWKKLQEIAIGIAKGIEYLHQGCDQRILH  420

Query  724   FDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSY  545
             FDIKP NILLD NFNPKISDFG AKLCSKE+S VSMT  RGTMGYIAPEV SRNFGNVSY
Sbjct  421   FDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAVSMTIVRGTMGYIAPEVLSRNFGNVSY  480

Query  544   KSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKI  365
             KSDVYSFGMLLLEMVGG+K  D++    T+Q YFPEWIYN L  GEE+ I+I++  D +I
Sbjct  481   KSDVYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEWIYNHLDIGEELHIRIKEEGDVEI  539

Query  364   AKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLF  188
             AKKL IVGL CIQW PVDRPS+K+V+QMLE E +  +MPPNPF ST P+    +KPGR F
Sbjct  540   AKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGEGDKLTMPPNPFASTVPT--NLSKPGRAF  597

Query  187   TSALEIISEMD  155
                L IISE+D
Sbjct  598   QQELAIISELD  608



>ref|XP_010662827.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=589

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/597 (57%), Positives = 440/597 (74%), Gaps = 36/597 (6%)
 Frame = -2

Query  1927  RNECLPRK-CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+    CG+ GP I FPFRLKH QP  CGYPGFEL CT+  +T L+     L  +  
Sbjct  23    RDECMTSNGCGDQGPLIQFPFRLKH-QPHHCGYPGFELSCTENNQTMLD-----LRGS--  74

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
                 VK L+++I  + R I +   D C  + L  LNL+ASPF F+   +F++F+CS+++ 
Sbjct  75    ----VKLLVKNITYKSREIFVQDPDNCLARQLRNLNLAASPFLFKFEQDFTLFNCSSNK-  129

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYS--IAQDNTV  1397
              T        I CL+ PG+ +YA  S+  L   TDL SC ++++ +SVP+      D + 
Sbjct  130   -TDSDNFDQSIPCLSIPGNPVYAVYSN-GLVQDTDLSSCRRLYN-ASVPFDGDYTFDGSA  186

Query  1396  FSLRWTGPS-CRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTY  1220
             FSL+W+    CRLK +++ E   +CI  ++K       K+ V G + G FL+V+++++ Y
Sbjct  187   FSLKWSNSKICRLKKSNSTET--ECIKGVSK-------KIIVTGAIFGFFLLVLVIVMPY  237

Query  1219  RIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKL  1040
             R+Y  NK++++ +VK+++FLEDY+ALKP+RYSYADIK+IT +F +KLGEG YGTVYKGKL
Sbjct  238   RVYSSNKVERDNRVKVKKFLEDYEALKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKL  297

Query  1039  SGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVN  860
             S +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CAD  +RAL+YEYL N
Sbjct  298   SDEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCADRLNRALIYEYLPN  355

Query  859   NSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNF  683
              SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCDQRILHFDIKP NILLD NF
Sbjct  356   ESLEKFIFSKVVKNYSLSWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNF  415

Query  682   NPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEM  503
             NPKISDFG AKLCSKE+S +SMT  RGTMGYIAPEV SRNFGNVSYKSDVYSFGMLLLEM
Sbjct  416   NPKISDFGLAKLCSKEQSAISMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEM  475

Query  502   VGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQW  323
             VGG+K  D+T    T+Q YFPEWIYN L  GEE+ I+IE+  D +IAKKL IVGL CIQW
Sbjct  476   VGGRKNIDVT-VESTSQVYFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQW  534

Query  322   YPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
              PVDRPS+K+V+QMLE E +  +MPPNPF ST P+    +KPGR+F   L IISE++
Sbjct  535   CPVDRPSMKIVVQMLEGEGDKLTMPPNPFASTVPT--NLSKPGRVFQQELTIISELE  589



>ref|XP_010662810.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=597

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/604 (55%), Positives = 434/604 (72%), Gaps = 42/604 (7%)
 Frame = -2

Query  1927  RNECLPRK-CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+    CG+ GP I FPFRLKH QP  CGYPGFEL CT+  +T L+           
Sbjct  23    RDECMTSNGCGDQGPLIRFPFRLKH-QPHHCGYPGFELSCTENNQTMLD-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
              P  VK L++ I  + R II+   D C  + L  LNL+ASPF F+   +F +F+CS+ + 
Sbjct  71    LPVSVKLLVKKIVYKSREIIVQDPDNCLARQLRNLNLAASPFHFKFERDFILFNCSSDK-  129

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFS  1391
                 S     I CL+ PG+ +YA  S L +   TDL SC ++++ S+ P       + FS
Sbjct  130   --TESSRFQSIPCLSIPGNPVYAVYSYLSV-QYTDLSSCRRLYNASA-PEDFMFIESAFS  185

Query  1390  LRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVV  1241
             L+W+          G  CRLK +++ E   +CI  ++K       K+ V G + G FL+V
Sbjct  186   LKWSKSICGSCPGGGKICRLKKSNSTEPETECIKGVSK-------KIIVTGAIFGFFLLV  238

Query  1240  VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYG  1061
             +++++ YR+Y  +K+++E +VK+++FLEDY+ALKP+RYSY D+K+IT +F +KLG+G YG
Sbjct  239   LVIVMLYRVYSSDKVERENRVKVKKFLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYG  298

Query  1060  TVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRAL  881
             TVYKGKLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CAD F RAL
Sbjct  299   TVYKGKLSDEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCADRFKRAL  356

Query  880   VYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRN  704
             +YEYL N SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCD+RILHFDIKP N
Sbjct  357   IYEYLPNESLEKFIFSRVVKNYTLSWKKLQEIAIGIAKGIEYLHQGCDKRILHFDIKPHN  416

Query  703   ILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSF  524
             ILLD NFNPKISDFG AKLCSKE+S VSMT  RGTMGYIAPEV SRNFGNVSYKSDVYSF
Sbjct  417   ILLDHNFNPKISDFGLAKLCSKEQSAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSF  476

Query  523   GMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIV  344
             GMLLLEMVGG+K  D++    T+Q YFPEWIYN L  GEE+ I+IE+  D +IAKKL IV
Sbjct  477   GMLLLEMVGGRKNIDVS-VESTSQVYFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIV  535

Query  343   GLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEII  167
             GL CIQW PVDRPS+K+V+QMLE E +  +MPPNPF ST P+    +KPGR+F   L II
Sbjct  536   GLSCIQWCPVDRPSMKIVVQMLEGEGDKLTMPPNPFASTIPT--NLSKPGRVFQQELAII  593

Query  166   SEMD  155
             SE++
Sbjct  594   SELE  597



>ref|XP_010662809.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=599

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/604 (55%), Positives = 433/604 (72%), Gaps = 40/604 (7%)
 Frame = -2

Query  1927  RNECLPRK-CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+    CG+ GP I FPFRLKH QP  CGYPGFEL CT+  +T L+           
Sbjct  23    RDECMTSNGCGDQGPLIRFPFRLKH-QPHHCGYPGFELSCTENNQTMLD-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
              P  VK L++ I  + R II+   D C  + L  LNL+ASPF F+   +F +F+CS+ + 
Sbjct  71    LPVSVKLLVKKIVYKSREIIVQDPDNCLARQLRNLNLAASPFHFKFERDFILFNCSSDK-  129

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFS  1391
                 S     I CL+ PG+ +YA  S L +   TDL SC ++++ S+ P       + FS
Sbjct  130   --TESSRFQSIPCLSIPGNPVYAVYSYLSV-QYTDLSSCRRLYNASA-PEDFMFIESAFS  185

Query  1390  LRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVV  1241
             L+W+          G  CRLK +++ E   +CI        G  +K+ V G + G FL+V
Sbjct  186   LKWSKSICGSCPGGGKICRLKKSNSTEPETECIKV-----KGVSKKIIVTGAIFGFFLLV  240

Query  1240  VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYG  1061
             +++++ YR+Y  +K+++E +VK+++FLEDY+ALKP+RYSY D+K+IT +F +KLG+G YG
Sbjct  241   LVIVMLYRVYSSDKVERENRVKVKKFLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYG  300

Query  1060  TVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRAL  881
             TVYKGKLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CAD F RAL
Sbjct  301   TVYKGKLSDEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCADRFKRAL  358

Query  880   VYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRN  704
             +YEYL N SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCD+RILHFDIKP N
Sbjct  359   IYEYLPNESLEKFIFSRVVKNYTLSWKKLQEIAIGIAKGIEYLHQGCDKRILHFDIKPHN  418

Query  703   ILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSF  524
             ILLD NFNPKISDFG AKLCSKE+S VSMT  RGTMGYIAPEV SRNFGNVSYKSDVYSF
Sbjct  419   ILLDHNFNPKISDFGLAKLCSKEQSAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSF  478

Query  523   GMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIV  344
             GMLLLEMVGG+K  D++    T+Q YFPEWIYN L  GEE+ I+IE+  D +IAKKL IV
Sbjct  479   GMLLLEMVGGRKNIDVS-VESTSQVYFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIV  537

Query  343   GLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEII  167
             GL CIQW PVDRPS+K+V+QMLE E +  +MPPNPF ST P+    +KPGR+F   L II
Sbjct  538   GLSCIQWCPVDRPSMKIVVQMLEGEGDKLTMPPNPFASTIPT--NLSKPGRVFQQELAII  595

Query  166   SEMD  155
             SE++
Sbjct  596   SELE  599



>ref|XP_002322015.2| hypothetical protein POPTR_0015s02010g [Populus trichocarpa]
 ref|XP_006374120.1| hypothetical protein POPTR_0015s02010g [Populus trichocarpa]
 gb|EEF06142.2| hypothetical protein POPTR_0015s02010g [Populus trichocarpa]
 gb|ERP51917.1| hypothetical protein POPTR_0015s02010g [Populus trichocarpa]
Length=607

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/602 (55%), Positives = 414/602 (69%), Gaps = 33/602 (5%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             + C   +C  +GP I FPF LK  QP +CGYPGFEL CTD+ ET            LQ P
Sbjct  27    DRCQEVRCKKDGPAIRFPFSLKEKQPDDCGYPGFELSCTDRTET-----------LLQLP  75

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCSTHRN  1571
               VK  +  ID   +LI  +  D CF + L   +LS SPF F ++   +++IF+C++ + 
Sbjct  76    NSVKLYVNKIDYISQLIFAADPDKCFPKQLRNFSLSTSPFKFRDMQQDDYAIFNCTSWKG  135

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFS  1391
              T        +ACL+ PG+ I+A  S  YL S TDL SCTK++++SSVP  I  +  +  
Sbjct  136   DT-----YQKLACLSGPGYDIFAYRSD-YLISYTDLTSCTKIYNLSSVPMEIMMEEKILR  189

Query  1390  LRWTGPSCRL--------KNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVI  1235
             L W+ P+CRL        +  + A    +C     K + G   K+  A   +GS L++++
Sbjct  190   LNWSMPACRLCEAQGKFCRWKTNARLETECYDK-PKSNEGIRIKIAAAVATVGSVLLLLV  248

Query  1234  VLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTV  1055
                 YR+Y  +K  KE Q +IE FL DYKA KP RY+YADIK+IT+ F +KLG+G+YGTV
Sbjct  249   FFAAYRVYSSDKAAKENQKRIENFLADYKAFKPTRYTYADIKRITNEFKDKLGQGAYGTV  308

Query  1054  YKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVY  875
             +KG+LS ++FVAVK+LNNS G+G  EEFVNE+ T+G IHH+NV+RLVGYCADGF RALVY
Sbjct  309   FKGQLSDEIFVAVKILNNSTGNG--EEFVNEVGTMGKIHHVNVIRLVGYCADGFRRALVY  366

Query  874   EYLVNNSLEKFVFSPN-DKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
             +YL N SLEKF+ S   D   L WEKLQ IALG+AKG+EYLHQGCDQRILHFDIKP NIL
Sbjct  367   DYLSNESLEKFISSEQGDATALSWEKLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNIL  426

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LD NFNPKISDFG AKLCSK++S VSMT ARGT+GYIAPEVFSRNFGNVSYKSDVYSFGM
Sbjct  427   LDDNFNPKISDFGLAKLCSKDQSAVSMTTARGTLGYIAPEVFSRNFGNVSYKSDVYSFGM  486

Query  517   LLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGL  338
             +LLEMVGG+K  D       NQ YFPEW+YN L  GEE+ I+IEK  D++IAKKLTIVGL
Sbjct  487   VLLEMVGGRKTID-DKIENNNQIYFPEWVYNSLDNGEELRIRIEKEGDAQIAKKLTIVGL  545

Query  337   WCIQWYPVDRPSIKVVIQMLE-AEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISE  161
             WCIQW+PVDRPS+  V+QMLE A +  +MPP+PF S    +   N PGR    ALE+ISE
Sbjct  546   WCIQWHPVDRPSMNAVVQMLEGAGDTLTMPPSPFASAGQERRNVNMPGRPLHQALEVISE  605

Query  160   MD  155
              +
Sbjct  606   AE  607



>ref|XP_011003876.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Populus euphratica]
Length=609

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/601 (55%), Positives = 413/601 (69%), Gaps = 36/601 (6%)
 Frame = -2

Query  1912  PRKCGNNGPEISFPFRLK--HIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             P  C  +GP I FPFRLK    Q   CGYPGFEL CTDK ET            LQ P  
Sbjct  30    PEACKKDGPAIRFPFRLKLKEKQSDHCGYPGFELSCTDKRET-----------LLQLPNS  78

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCSTHRNIT  1565
             VK  +  ID   +LI  +  D C  + L   NLS SPF F ++   +++ F+C++ +  T
Sbjct  79    VKLYVNKIDYASQLIFAADPDKCLPKQLRNFNLSTSPFKFGDMQQDDYAFFNCTSRKGDT  138

Query  1564  AGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLR  1385
                     +ACL+ PG+ I+A  SS YL S TDL SCTK++++SSVP+ I +   +  L 
Sbjct  139   -----YRKLACLSGPGYDIFAY-SSDYLISYTDLTSCTKIYNLSSVPWEIIRQEKIMRLN  192

Query  1384  WTGPSCRL---------KNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIV  1232
             W+ P+CRL         + N  A    +C     K   G  +K+  A   +GS L++++ 
Sbjct  193   WSMPACRLCEAQGKFCRRKNENASLETECYDK-PKSKEGIRKKIAAAVATVGSVLLLLVF  251

Query  1231  LVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVY  1052
                YR+Y  +K  KE Q +IE FL DYKA KP RY+YADIK+IT+ F +KLG+G+YGTV+
Sbjct  252   FEAYRVYSSDKAAKENQKRIENFLADYKAFKPTRYTYADIKRITNEFKDKLGQGAYGTVF  311

Query  1051  KGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYE  872
             KG+LS ++FVAVK+LNNS G+G  EEFVNE+ T+G IHH+NV+RLVGYCADGF RALVY+
Sbjct  312   KGQLSDEIFVAVKILNNSTGNG--EEFVNEVGTMGKIHHVNVIRLVGYCADGFRRALVYD  369

Query  871   YLVNNSLEKFVFSPN-DKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILL  695
             YL N SLEKF+ S + D   L WEKLQ IALG+AKG+EYLHQGCDQRILHFDIKP NILL
Sbjct  370   YLSNESLEKFISSEHGDATALSWEKLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILL  429

Query  694   DQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGML  515
             D NFNPKISDFG AKLCSK++S VSMT ARGT+GYIAPEVFSRNFGNVSYKSDVYSFGM+
Sbjct  430   DDNFNPKISDFGLAKLCSKDQSAVSMTTARGTLGYIAPEVFSRNFGNVSYKSDVYSFGMV  489

Query  514   LLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLW  335
             LLEMVGG+K  D       NQ YFPEW+YN L  GEE+ I+IEK  D++IAKKLT+VGLW
Sbjct  490   LLEMVGGRKTID-DKIENNNQIYFPEWVYNSLDNGEELRIRIEKEGDAQIAKKLTVVGLW  548

Query  334   CIQWYPVDRPSIKVVIQMLE-AEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEM  158
             CIQW+PVDRPS+  V+QMLE A +  +MPP+PF S    +  AN PGR    ALE+ISE 
Sbjct  549   CIQWHPVDRPSMNAVVQMLEGAGDTLTMPPSPFASAGQGRRNANMPGRPLHQALEVISEA  608

Query  157   D  155
             +
Sbjct  609   E  609



>ref|XP_002267774.2| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=591

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/588 (57%), Positives = 426/588 (72%), Gaps = 44/588 (7%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             NEC+  +CG++GP I FPF LK  QP  CGYPGF+L CT+K +T +E            P
Sbjct  28    NECVISRCGHHGPAIRFPFWLKDSQPDHCGYPGFQLSCTEKHQTMIE-----------LP  76

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-----NLYNFSIFSCST  1580
               VK L++ I+ + + I +     C  + L  LNLSASPF F+     +L + ++ +CS 
Sbjct  77    NSVKLLVKKINYKSQEIQVHDPADCLPKQLSDLNLSASPFQFKVKHDHSLQDITLLNCS-  135

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSSLYL---YSATDLISCTKMFHVSSVPYSIAQ  1409
                + A    +  I C + PG+ +Y  DS   L   Y   DL+SC+KM+++SSVP  I +
Sbjct  136   ---LPANRGFMRQIPCSSVPGYQVYVVDSYYTLFHDYDNYDLLSCSKMYNISSVPNDIFE  192

Query  1408  DNTVFSLRWTGP----------SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL  1259
                 F L W+ P           CRLK+NST E   +C   ++K   G + KL + G ++
Sbjct  193   H---FYLNWSKPICRNCEADGKRCRLKSNST-EPETECFI-ISKKAQG-VTKLVITGPMV  246

Query  1258  GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
             GSFL+V++V++ YR++  NK+++E Q+KIE+FLEDY+ALKP+RYS+ADIKKIT++F +KL
Sbjct  247   GSFLLVLVVIMFYRVHCTNKLQRENQIKIEKFLEDYRALKPSRYSFADIKKITNQFQDKL  306

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             G+G YGTVYKGKLS +V VAVK+L+NSKG+G  EEF+NE+ T+G IHH+NVVRLVG+CAD
Sbjct  307   GQGGYGTVYKGKLSNEVLVAVKILSNSKGNG--EEFINEVRTMGRIHHVNVVRLVGFCAD  364

Query  898   GFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
             GF RAL+YE+L N SLEKF+FS   KN  LGW+KLQ IALGIAKG+EYLHQGCDQRILHF
Sbjct  365   GFSRALIYEFLPNESLEKFIFSTTIKNRSLGWKKLQDIALGIAKGIEYLHQGCDQRILHF  424

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DIKP NILLD + NPKISDFG AKLCSKE+S VSMTAARGTMGYIAPEV SRNFG+VSYK
Sbjct  425   DIKPHNILLDHHLNPKISDFGLAKLCSKEQSTVSMTAARGTMGYIAPEVLSRNFGHVSYK  484

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIA  362
             SDV+SFGMLLLEMVGG+K  D+T    T+Q YFPEW YN L +GEE+ I+IEK  D KIA
Sbjct  485   SDVFSFGMLLLEMVGGRKNIDVT-VDNTSQLYFPEWAYNHLDQGEELHIRIEKEGDDKIA  543

Query  361   KKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPS  221
             K+LTIVGLWCIQWYP+DRP +K V+QMLE E +  +MPPNPF ST P+
Sbjct  544   KQLTIVGLWCIQWYPMDRPPMKAVVQMLEGEGDSLTMPPNPFASTSPT  591



>ref|XP_010662995.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=612

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/611 (55%), Positives = 437/611 (72%), Gaps = 43/611 (7%)
 Frame = -2

Query  1927  RNECLPRK-CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+    CG+ GP I FPFRLK  QP  CGYPGFEL CT+  +T LE           
Sbjct  23    RDECMTSNPCGDQGPLIQFPFRLKD-QPRHCGYPGFELSCTENNQTMLE-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
              P  VK L++ I  + R II+   D C  + L  LNL+ASPF F+   +F+ F+CS+++ 
Sbjct  71    LPVSVKLLVKKITYKSREIIVQDPDHCLARQLRNLNLAASPFHFKFELDFTFFTCSSYKT  130

Query  1570  ---ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD--  1406
                +         I CL+ PG+ +YA  SS+ L    DL SC ++++ S+      +D  
Sbjct  131   AAPLLRAYTFFEHIPCLSVPGNLVYAVYSSIPL-RLLDLSSCRRLYNASAPGNRDYEDYM  189

Query  1405  --NTVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEV  1262
                + FSL+W+          G  CRLK ++ A+   +CI        G L+K+ V G +
Sbjct  190   FNGSAFSLKWSKSICGSCPGGGKICRLKKSNGAQPETECI-------KGVLKKIIVTGAI  242

Query  1261  LGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
              G FL++++++  YR+YR NK+++E ++ +++FL+DY+ALKP+RYSY+DIK+IT++F +K
Sbjct  243   FGFFLLMLVIVALYRVYRSNKLEREYRINVKKFLQDYEALKPSRYSYSDIKRITNQFKDK  302

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             LG+G YG VYKGKLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+NVVRLVG+CA
Sbjct  303   LGQGGYGIVYKGKLSHEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNVVRLVGFCA  360

Query  901   DGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILH  725
             DGF RAL+YEYL N SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCDQRILH
Sbjct  361   DGFKRALIYEYLPNESLEKFIFSRAVKNYSLSWKKLQEIAIGIAKGIEYLHQGCDQRILH  420

Query  724   FDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSY  545
             FDIKP NILLD NFNPKISDFG AKLCSKE+S VSMT ARGT+GYIAP+V SRNFGNVSY
Sbjct  421   FDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAVSMTIARGTIGYIAPKVLSRNFGNVSY  480

Query  544   KSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKI  365
             KSDVYSFGMLLLEMVGG+K  D++    T+Q YFPEWIYN L  GEE+ I+IE+  D+KI
Sbjct  481   KSDVYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEWIYNHLDHGEELLIRIEEEIDAKI  539

Query  364   AKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLF  188
             AKKL IVGL CIQWYPVDRPS+K+V+QMLE E +  +MPPNPF ST P+K   +KP R F
Sbjct  540   AKKLAIVGLSCIQWYPVDRPSMKIVVQMLEGEGDKLTMPPNPFASTVPTKTNLSKPRRAF  599

Query  187   TSALEIISEMD  155
                L II E++
Sbjct  600   QQELAIILELE  610



>ref|XP_010663000.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=602

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/608 (55%), Positives = 432/608 (71%), Gaps = 45/608 (7%)
 Frame = -2

Query  1927  RNECLPRK-CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+    CG+ GP I FPFRLKH QP  CGYPGFEL CT+  +T L+           
Sbjct  23    RDECMTSNGCGDQGPLIRFPFRLKH-QPHHCGYPGFELSCTENNQTMLD-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
              P  VK L++ I  + R III   D C  + L  LNL+ASPF F+   +F +F+CS  + 
Sbjct  71    LPVSVKLLVKKIVYKSREIIIQDPDNCIARQLRNLNLAASPFHFKFERDFILFNCSADK-  129

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD----N  1403
                 S     I CL+ PG+ +YA  SS Y+   TDL SC ++++ S+       D     
Sbjct  130   --TESSRFQSIPCLSIPGNPVYAVYSSSYV-QYTDLSSCHRLYNASAPGNRDYGDFIFNG  186

Query  1402  TVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
             + FSL+W+          G  CRLK +++ E   +CI  ++K       K+ V G + G 
Sbjct  187   SAFSLKWSKSVCGSCPEGGKICRLKKSNSTEPETECIKGVSK-------KIIVTGAIFGF  239

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             FL++++++V YR+Y  NK+++E +VK+++FLEDY+ALKP+RYSYADIK+IT +F  KLGE
Sbjct  240   FLLMLVIVVPYRVYSSNKVERENRVKVKKFLEDYEALKPSRYSYADIKRITSQFKNKLGE  299

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G YGTVYKGKLS +VFVAVK+L+NS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CAD F
Sbjct  300   GGYGTVYKGKLSDEVFVAVKILDNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCADRF  357

Query  892   HRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
              RAL+YEYL N SLEKF+FS   KN+ L W+KLQ+IA+GI KG+EYLHQGCDQRILHFDI
Sbjct  358   KRALIYEYLPNESLEKFIFSKVVKNYSLSWKKLQEIAIGITKGIEYLHQGCDQRILHFDI  417

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP NILLD NFNPKISDFG AKLCSKE+S V MT  RGTMGYIAP+V SRNFGNVSYKSD
Sbjct  418   KPHNILLDHNFNPKISDFGLAKLCSKEQSAVFMTIVRGTMGYIAPKVLSRNFGNVSYKSD  477

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             VYSFGMLLLEMVGG+K  D++    T+Q YFPEWIYN L  GEE+ I+IE+  D +IAKK
Sbjct  478   VYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEWIYNHLDIGEELHIRIEEEGDVEIAKK  536

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSA  179
             L IVGL CIQW P+DRPS+K+V+QMLE E +  +MPPNPF ST P+    +KPGR+F   
Sbjct  537   LAIVGLSCIQWCPMDRPSMKIVVQMLEGEGDKLTMPPNPFASTVPT--NLSKPGRVFQQE  594

Query  178   LEIISEMD  155
             L IISE++
Sbjct  595   LAIISELE  602



>ref|XP_010646611.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=603

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/607 (55%), Positives = 430/607 (71%), Gaps = 42/607 (7%)
 Frame = -2

Query  1927  RNEC-LPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R EC    +CG+ GP I FPFRLK  QP  CGYPGF L CT+  +  LE           
Sbjct  23    RGECPTSNRCGDQGPLIQFPFRLKS-QPHHCGYPGFVLSCTENNQIMLE-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
              P  VK L+++I  + R II+   D C  + L  L+L++SPF F+   + + F+CS  + 
Sbjct  71    LPDSVKLLVKNIIYKSREIIVQNPDNCLERQLRNLSLASSPFQFKFEGDVTFFNCSLLK-  129

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT---  1400
              TA S     I CL+ PG+ +YA DS  Y     DL SC ++++ +SV Y +  D T   
Sbjct  130   -TAESFAAHFIPCLSIPGNPVYAVDS-FYPLQNMDLSSCRRLYN-ASVGYHVFTDYTFNG  186

Query  1399  -VFSLRW----------TGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
               FSL+W           G  CRLK +++ E   +CI  ++K       +  V G + G 
Sbjct  187   SAFSLKWPKSICGSCLRGGHICRLKKSNSREPETECIKGVSK-------QAMVTGTIFGF  239

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             FL+V+++ + YR+Y  +K+++E  +K++RFLEDY+ALKP+RYSY DIK+IT++F +KLG+
Sbjct  240   FLLVLVIAMFYRLYSSDKLERENGIKVKRFLEDYEALKPSRYSYVDIKRITNQFKDKLGQ  299

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G YGTVYKGKLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CADGF
Sbjct  300   GGYGTVYKGKLSHEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCADGF  357

Query  892   HRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
              RAL+YEYL N SLEKF+FS + KN+ L W+KLQ+IA+GIAKG+EYLHQGCDQRI+HFDI
Sbjct  358   KRALIYEYLPNESLEKFIFSRDVKNYSLSWKKLQEIAIGIAKGIEYLHQGCDQRIIHFDI  417

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             K  NILLD NFNPKISDFG AKLCSKE+S VSMT ARGT+GYIAPEV SRNFGNVSYKSD
Sbjct  418   KSHNILLDHNFNPKISDFGLAKLCSKEQSAVSMTVARGTIGYIAPEVLSRNFGNVSYKSD  477

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             VYSFGMLLLEMVGG+K  D++    T+Q YFPEWIYN L  GEE+ I+IE+  D +IAKK
Sbjct  478   VYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEWIYNHLDIGEELYIRIEEKGDVEIAKK  536

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSAL  176
             L IVGL CIQW+P+DRPS+K+V+QMLE     +MPPNPF ST P+K    KPG +F   L
Sbjct  537   LAIVGLSCIQWFPMDRPSMKIVVQMLEGRGKLTMPPNPFASTTPTKTNLGKPGSVFQQEL  596

Query  175   EIISEMD  155
              IISE++
Sbjct  597   AIISEIE  603



>ref|XP_010662998.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=591

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/599 (56%), Positives = 429/599 (72%), Gaps = 38/599 (6%)
 Frame = -2

Query  1927  RNECL-PRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+   +CG+ GP I FPFRL+  QPP CGYPGF L CT+  +T LE           
Sbjct  23    RDECMKSNRCGDQGPLIQFPFRLQG-QPPHCGYPGFNLSCTENNQTMLE-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
              P  VK L++ I  + R II+   D C  + L  LNLSASPF F      + F CS+ + 
Sbjct  71    LPGSVKLLVKDITYKSREIIVQDPDNCLARQLGNLNLSASPFQFNFGEENTFFDCSSDK-  129

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD----N  1403
                 +    PI CL+ PG+ +YA  SS  L    +L SC +++  S+      +D     
Sbjct  130   --TDAYFYQPIPCLSIPGNPVYAVHSS-ELVQYLNLSSCRRLYSASAPGNQAYRDYIFNG  186

Query  1402  TVFSLRWTGPS-CRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLV  1226
             + FSL+W+    CRLK + + E   +CI  ++K       K+ V G + G FL++++++V
Sbjct  187   SAFSLKWSNSKICRLKKSDSTET--ECIKGVSK-------KIIVTGAIFGFFLLMLVIVV  237

Query  1225  TYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKG  1046
              YR+Y  NK++++ +VK+++FLEDY+ALKP+RYSYADIK+IT +F +KLGEG YGTVYKG
Sbjct  238   PYRVYSSNKVERDNKVKVKKFLEDYEALKPSRYSYADIKRITSQFKDKLGEGGYGTVYKG  297

Query  1045  KLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYL  866
             KLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CAD F+RAL+YEYL
Sbjct  298   KLSDEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCADRFNRALIYEYL  355

Query  865   VNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQ  689
              N SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCDQRILHFDIKP NILLD 
Sbjct  356   PNESLEKFIFSKVVKNYSLSWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDH  415

Query  688   NFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLL  509
             NFNPKISDFG AKLCSKE+S VSMT  RGTMGYIAPEV SRNFGNVSYKSDVYSFGMLLL
Sbjct  416   NFNPKISDFGLAKLCSKEQSAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLL  475

Query  508   EMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCI  329
             EMVGG+K  D++    T+Q YFPEWIYN L  GEE+ I+IE+  D +IAKKL IVGL CI
Sbjct  476   EMVGGRKNIDVS-VESTSQVYFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCI  534

Query  328   QWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             QW PVDRPS+K+V+QMLE E +  +MPPNPF ST P+    +KP R+F   L IISE++
Sbjct  535   QWCPVDRPSMKIVVQMLEGEGDKLTMPPNPFASTVPT--NLSKPSRVFQQELTIISELE  591



>ref|XP_003635153.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=599

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/611 (55%), Positives = 432/611 (71%), Gaps = 54/611 (9%)
 Frame = -2

Query  1927  RNECLPRK-CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+    CG+ GP I FPFRLKH QP  CGYPGFEL CT+  +T L+           
Sbjct  23    RDECMTSNGCGDQGPLIRFPFRLKH-QPHHCGYPGFELSCTENNQTMLD-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIF-SCSTHR  1574
              P  VK L++ I  + R II+   D C  + L  LNL+ASPF F+   +F+ F +CS+++
Sbjct  71    LPVSVKLLVKKIVYKSREIIVQDPDNCLARQLRNLNLAASPFYFKFGLDFTFFINCSSYK  130

Query  1573  NITAGS--INISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD--  1406
                 GS   +  PI CL+ PG+ +YA  SS  +   TDL SC ++++ S+       D  
Sbjct  131   TPEPGSWAYDFEPIPCLSNPGNPVYAVYSSGSV-QYTDLSSCRRLYNASAPGNRDYGDYM  189

Query  1405  --NTVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEV  1262
                + FSL+W+          G  CRLK +++ E   +CI                 G +
Sbjct  190   FNGSAFSLKWSKSICGSCPEGGKICRLKKSNSREPETECIK----------------GAI  233

Query  1261  LGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
              G FL++++++V YR+Y  NK++++ +VK+++FLEDY+ALKP+RYSYADIK+IT +F +K
Sbjct  234   FGFFLLMLVIVVAYRVYSSNKVERDNRVKVKKFLEDYEALKPSRYSYADIKRITSQFKDK  293

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             LGEG YGTVYKGKLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CA
Sbjct  294   LGEGGYGTVYKGKLSDEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCA  351

Query  901   DGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILH  725
             D F RAL+YEYL N SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCDQRILH
Sbjct  352   DRFKRALIYEYLPNESLEKFIFSKVVKNYSLSWKKLQEIAIGIAKGIEYLHQGCDQRILH  411

Query  724   FDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSY  545
             FDIKP NILLD NFNPKISDFG AKLCSKE+S VSMT  RGTMGYIAPEV SRNFGNVSY
Sbjct  412   FDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAVSMTIVRGTMGYIAPEVLSRNFGNVSY  471

Query  544   KSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKI  365
             KSDVYSFGMLLLEMVGG+K  D++    T+Q YFPEWIYN L  GEE+ I+I++  D +I
Sbjct  472   KSDVYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEWIYNHLDIGEELHIRIKEEGDVEI  530

Query  364   AKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLF  188
             AKKL IVGL CIQW PVDRPS+K+V+QMLE E +  +MPPNPF ST P+    +KPGR F
Sbjct  531   AKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGEGDKLTMPPNPFASTVPT--NLSKPGRAF  588

Query  187   TSALEIISEMD  155
                L IISE+D
Sbjct  589   QQELAIISELD  599



>ref|XP_002268153.3| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X3 [Vitis vinifera]
Length=593

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/608 (55%), Positives = 428/608 (70%), Gaps = 54/608 (9%)
 Frame = -2

Query  1927  RNECLPRK-CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+    CG+ GP I FPF LKH QP  CGYPGFEL CT+  +T L+           
Sbjct  23    RDECMTSNGCGDQGPLIRFPFHLKH-QPHHCGYPGFELSCTENNQTMLD-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
              P  VK L++ I  + R II+   D C  + L  LNL+ASPF F+   +F +F+CS+ + 
Sbjct  71    LPVSVKLLVKKIVYKSREIIVQDPDNCLARQLRNLNLAASPFHFKFERDFILFNCSSDK-  129

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD----N  1403
                 S     I CL+ PG+ +YA  SS Y+   TDL SC ++++ S+       D     
Sbjct  130   --TESSRFQSIPCLSIPGNPVYAVSSSRYV-QYTDLSSCRRLYNASAPGNRDYGDYMFNG  186

Query  1402  TVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
             + FSL+W+          G  CRLK +++ E   +CI                 G + G 
Sbjct  187   SAFSLKWSKSICGSCPEGGKICRLKKSNSREPETECIK----------------GAIFGF  230

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             FL++++++V YR+Y  NK++++ +VK+++FLEDY+ LKP+RYSYADIK+IT +F +KLGE
Sbjct  231   FLLMLVIVVAYRVYSSNKVERDNRVKVKKFLEDYETLKPSRYSYADIKRITSQFKDKLGE  290

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G YGTVYKGKLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CAD F
Sbjct  291   GGYGTVYKGKLSDEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCADRF  348

Query  892   HRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
              RAL+YEYL N SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCDQRILHFDI
Sbjct  349   ERALIYEYLPNESLEKFIFSKVVKNYSLNWKKLQEIAIGIAKGIEYLHQGCDQRILHFDI  408

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP NILLD NFNPKISDFG AKLCSKE+S VSMT  RGTMGYIAPEV SRNFGNVSYKSD
Sbjct  409   KPHNILLDHNFNPKISDFGLAKLCSKEQSAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSD  468

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             VYSFGMLLLEMVGG+K  D++    T+Q YFPEWIYN L  GEE+ I+I++  D +IAKK
Sbjct  469   VYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEWIYNHLDIGEELHIRIKEEGDVEIAKK  527

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSA  179
             L IVGL CIQW PVDRPS+K+V+QMLE E +  +MPPNPF ST P+    +KPGR+F   
Sbjct  528   LAIVGLSCIQWCPVDRPSMKIVVQMLEGEGDKLTMPPNPFASTVPT--NLSKPGRVFQQE  585

Query  178   LEIISEMD  155
             L IISE++
Sbjct  586   LAIISELE  593



>ref|XP_010111692.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC31506.1| putative receptor-like protein kinase [Morus notabilis]
Length=607

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/605 (56%), Positives = 417/605 (69%), Gaps = 32/605 (5%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             +++C   +CG NGP I FPFRLK      CG+ GFEL C  K  T LE     L  T   
Sbjct  21    QDQCKQIRCGKNGPAIRFPFRLKDRHQDHCGFRGFELSCRGK-STVLE-----LQTT---  71

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFEN-LYNFSIFSCST-H  1577
               PVKF ++SID + ++I +   D C L +LL I  LS SPF   N L ++++F+CS   
Sbjct  72    --PVKFFVKSIDYKSQVIQLYDPDDCLLGKLLKINGLSISPFGVSNDLRDYALFNCSVID  129

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ-DNT  1400
             R+   G   I P  CL           +SLY      L  CTKM+++SSV Y +   D  
Sbjct  130   RHKLHGRGQIFP--CLGGGYGRQIVVVNSLYAIEEVPLTGCTKMYNISSVGYVLYDIDRK  187

Query  1399  VFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSF  1250
                L WT P+C          R+K N T ++ +  + P  K   G   K+   G  LG+ 
Sbjct  188   HLYLNWTRPNCSRCEEMGNGCRVKINGTRDETECFMYP--KSSKGKTTKIVATGVTLGTA  245

Query  1249  LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEG  1070
             ++ ++++VTYR Y  NK +KE Q +IERFLEDYKALKP+RYSYADIK IT +F +KLGEG
Sbjct  246   VLTLLLVVTYRSYSSNKQEKENQRRIERFLEDYKALKPSRYSYADIKHITSQFKDKLGEG  305

Query  1069  SYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFH  890
             ++GTV+KGKLS D FVAVK+LNNSK +G  E+F+NE+ TIG IHH+NVVRLVGYCADGF 
Sbjct  306   AFGTVFKGKLSNDFFVAVKILNNSKENG--EDFINEVGTIGRIHHVNVVRLVGYCADGFR  363

Query  889   RALVYEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             RALVYE+L N SL++++ SP+  +FLGW+ LQ IALGIAKG+EYLHQGCDQRILHFDIKP
Sbjct  364   RALVYEFLPNGSLQRYISSPDTDHFLGWKNLQDIALGIAKGIEYLHQGCDQRILHFDIKP  423

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
              N+LLD NF PK+SDFG AKLC+K++SIVSMT ARGTMGYIAPEVFSRNFGNVSYKSDVY
Sbjct  424   HNVLLDHNFTPKVSDFGLAKLCTKDQSIVSMTTARGTMGYIAPEVFSRNFGNVSYKSDVY  483

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             SFGMLLLEMVGG+K +D+T    T+Q Y+PEWIYN+L  GE++ I I +  D  IAKKL 
Sbjct  484   SFGMLLLEMVGGRKITDVT-EDNTSQVYYPEWIYNLLEEGEDLRIHIGEEGDCVIAKKLA  542

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEI  170
             IVGLWCI+W+PVDRPS+KVV+ MLE  E  SMPPNPF S  P+K  A  PGR     LE 
Sbjct  543   IVGLWCIKWHPVDRPSMKVVVHMLEGGEKLSMPPNPFASAGPTKTIATLPGRRMKIELEA  602

Query  169   ISEMD  155
             I+E+D
Sbjct  603   IAELD  607



>ref|XP_003634911.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=585

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/607 (55%), Positives = 430/607 (71%), Gaps = 42/607 (7%)
 Frame = -2

Query  1927  RNEC-LPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R EC    +CG+ GP I FPFRLK  QP  CGYPGF L CT+  +  LE           
Sbjct  5     RGECPTSNRCGDQGPLIQFPFRLKG-QPHHCGYPGFVLSCTENNQIMLE-----------  52

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
              P  VK L+++I  + R II+   D C  + L  L+L++SPF F+   + + F+CS  + 
Sbjct  53    LPDSVKLLVKNIIYKSREIIVQNPDNCLERQLRNLSLASSPFQFKFEGDVTFFNCSLLK-  111

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT---  1400
              TA S     I CL+ PG+ +YA DS  Y     DL SC ++++ +SV Y +  D T   
Sbjct  112   -TAESFAAHFIPCLSIPGNPVYAVDS-FYPLQNMDLSSCRRLYN-ASVGYHVFTDYTFNG  168

Query  1399  -VFSLRW----------TGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
               FSL+W           G  CRLK +++ E   +CI  ++K       +  V G + G 
Sbjct  169   SAFSLKWPKSICGSCLRAGHICRLKKSNSREPETECIKGVSK-------QAMVTGTIFGF  221

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             FL+V+++ + YR+Y  +K+++E  +K++RFLEDY+ALKP+RYSYADIK+IT++F +KLG+
Sbjct  222   FLLVLVIAMFYRLYSSDKLERENGIKVKRFLEDYEALKPSRYSYADIKRITNQFKDKLGQ  281

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G YGTVYKGKLS +VFVAVK+LNNS+G+G  EE +NE++T+G+IHH+N+VRLVG+CADGF
Sbjct  282   GGYGTVYKGKLSHEVFVAVKILNNSQGNG--EELINEVATMGTIHHVNIVRLVGFCADGF  339

Query  892   HRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
              RAL+YEYL N SLEKF+FS + KN+ L W+KLQ+IA+GIAKG+EYLHQGCD+RILHFDI
Sbjct  340   KRALIYEYLPNESLEKFIFSRDVKNYSLSWKKLQEIAIGIAKGIEYLHQGCDKRILHFDI  399

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP NILLD NFNPK+SDFG AKLCSKE+S VSMT ARGT+GYIAPEV SRNFGNVSYKS+
Sbjct  400   KPHNILLDHNFNPKVSDFGLAKLCSKEQSAVSMTIARGTIGYIAPEVLSRNFGNVSYKSN  459

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             VYSFGMLLLEMVGG+K  D+     T+Q YFPEWIYN L  GEE+ I+IE+  D +IAKK
Sbjct  460   VYSFGMLLLEMVGGRKNIDVN-VESTSQVYFPEWIYNHLDIGEELYIRIEEKGDVEIAKK  518

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSAL  176
             L IVGL CIQW+P+D PS+K+V+QMLE     +MPPNPF ST P+K   +KPG +F   L
Sbjct  519   LAIVGLSCIQWFPMDHPSMKIVVQMLEGGGKLTMPPNPFASTTPTKTNLSKPGSVFQQEL  578

Query  175   EIISEMD  155
              IISE++
Sbjct  579   AIISEIE  585



>ref|XP_011003875.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Populus euphratica]
Length=608

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/602 (54%), Positives = 408/602 (68%), Gaps = 36/602 (6%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             C    C  +GP + FPF LK  QP  C YPGFEL CTD+ ET            LQ P  
Sbjct  29    CPEASCKKHGPAVRFPFSLKEKQPDNCSYPGFELSCTDRNET-----------LLQLPNS  77

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCSTHRNIT  1565
             VK  +  ID   + I  S  D C  + L   NLS SPF F ++   +++ F+C++ +  T
Sbjct  78    VKLYVNKIDYASQWITASDPDKCLPRQLRNFNLSTSPFKFGDMEQDDYAFFNCTSRKGDT  137

Query  1564  AGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLR  1385
                     +ACL+ PG+ I+A  SS Y    +DL SCTKM+++SS+P  I   N +  L 
Sbjct  138   -----YRKLACLSGPGYDIFAYFSS-YPIGYSDLTSCTKMYNLSSIPQEIFWQNNILHLN  191

Query  1384  WTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVI  1235
             W+GP C          R KNN    + +    P +K      +K + A   +GS L++++
Sbjct  192   WSGPECVLCEAHGKFCRSKNNRAGLETECYDKPKSKEDIK--KKTEAAVATVGSVLLLLV  249

Query  1234  VLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTV  1055
                 +R+Y  +K  KE Q +IE FL DYKA KP RY+YADIK+IT+ F +KLG+G+YGTV
Sbjct  250   FFAAFRVYSSDKAAKENQKRIENFLADYKAFKPTRYTYADIKRITNEFKDKLGQGAYGTV  309

Query  1054  YKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVY  875
             +KG+LS ++FVAVK+LNNS G+G  EEFVNE+ T+G IHH+NV+RLVGYCADGF RALVY
Sbjct  310   FKGQLSDEIFVAVKILNNSTGNG--EEFVNEVGTMGKIHHVNVIRLVGYCADGFRRALVY  367

Query  874   EYLVNNSLEKFVFSPN-DKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
             +YL N SLEKF+ S + D   L WEKLQ IALG+AKG+EYLHQGCDQRILHFDIKP NIL
Sbjct  368   DYLSNESLEKFISSEHGDATALSWEKLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNIL  427

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LD NFNPKISDFG AKLCSK++S VSMT ARGT+GYIAPEVFSRNFGNVSYKSDVYSFGM
Sbjct  428   LDDNFNPKISDFGLAKLCSKDQSAVSMTTARGTLGYIAPEVFSRNFGNVSYKSDVYSFGM  487

Query  517   LLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGL  338
             +LLEMVGG+K  D       NQ YFPEW+YN L  GEE+ I+IEK  D++IAKKLT+VGL
Sbjct  488   VLLEMVGGRKTID-DKIENNNQIYFPEWVYNSLDNGEELRIRIEKEGDAQIAKKLTVVGL  546

Query  337   WCIQWYPVDRPSIKVVIQMLE-AEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISE  161
             WCIQW+PVDRPS+  V+QMLE A +  +MPP+PF S    +  AN PGR    ALE+I+E
Sbjct  547   WCIQWHPVDRPSMNAVVQMLEGAGDTLTMPPSPFASAGQGRRNANMPGRPLHQALEVITE  606

Query  160   MD  155
              +
Sbjct  607   AE  608



>ref|XP_007220557.1| hypothetical protein PRUPE_ppa003241mg [Prunus persica]
 gb|EMJ21756.1| hypothetical protein PRUPE_ppa003241mg [Prunus persica]
Length=590

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/606 (54%), Positives = 420/606 (69%), Gaps = 50/606 (8%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++ C   KCG+ GP + FPF LK   P  C +PGF L C +K ET L+ P P        
Sbjct  20    QDTCKKLKCGDKGPAVHFPFSLKGRHPDHCVFPGFVLSCNEKYETILDLPIPF-------  72

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFE--NLYNFSIFSCS-T  1580
                 KF ++SID E ++I +   + C L +LL + N S SPF F   ++ + ++F+CS  
Sbjct  73    ----KFPVKSIDYEAQVIQLHDPESCLLMKLLKVFNKSISPFHFSKNHMTDLTLFNCSLA  128

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
              R +         + C + PG+ +Y+  SS Y      L+SCTKM+++SSVPY   +  T
Sbjct  129   ERQLD------EQVPCFSGPGYQVYSVLSS-YSIEVLPLLSCTKMYNLSSVPYPSYKYAT  181

Query  1399  VFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSF  1250
             +F L W+ P+C          RLKNN T  + + C+             L  AG  LGSF
Sbjct  182   LF-LEWSEPNCGHCERQGRKCRLKNNGTKSEIE-CV------------DLSKAGASLGSF  227

Query  1249  LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEG  1070
             +V+++V+  YR+Y  ++ +KE Q+KIERFL+DY+ALKP+RYSYADIK+IT+ F +KLGEG
Sbjct  228   VVLLLVVAAYRVYSSDRKEKENQLKIERFLDDYRALKPSRYSYADIKRITNDFKDKLGEG  287

Query  1069  SYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFH  890
             +YGTVYKGKLS ++FVA KVLN+SKGDG  EEF+NE+ T+G IHH+NVVRLVG+CADGF 
Sbjct  288   AYGTVYKGKLSSELFVAAKVLNSSKGDG--EEFINEVGTMGHIHHVNVVRLVGFCADGFR  345

Query  889   RALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIK  713
             RALVYE+L N SL+ F+ SP++KN FLGW+K+Q IAL IAKG+EYLHQGCDQRILHFDIK
Sbjct  346   RALVYEFLPNGSLQDFISSPDNKNSFLGWDKMQDIALAIAKGIEYLHQGCDQRILHFDIK  405

Query  712   PRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDV  533
             P N+LLD NF PKISDFG AKLCSK++SIVSMT ARGTMGYIAPEVFSRNFGNVSYKSDV
Sbjct  406   PHNVLLDHNFTPKISDFGLAKLCSKDQSIVSMTTARGTMGYIAPEVFSRNFGNVSYKSDV  465

Query  532   YSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKL  353
             YSFGMLLLEMVGG+K    + +  TN+ Y+PEWIYN+L  G+++ I I +  + KI KK 
Sbjct  466   YSFGMLLLEMVGGRKNVG-SATENTNEIYYPEWIYNLLEEGDDLRIHIGEEGEGKIPKKF  524

Query  352   TIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALE  173
              IVGLWCIQW+PVDRPS+K V+QMLE  E  +MPPNPF ST  +   A+   R     LE
Sbjct  525   AIVGLWCIQWHPVDRPSMKAVVQMLEGGESLTMPPNPFASTGAAGTNASTAARNLNIQLE  584

Query  172   IISEMD  155
              I E++
Sbjct  585   AIPELE  590



>ref|XP_010646997.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=590

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/592 (54%), Positives = 423/592 (71%), Gaps = 37/592 (6%)
 Frame = -2

Query  1927  RNECL-PRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+   +CG+ GP I FPFRLK  +P  CGYPGFEL CT+  +T L+           
Sbjct  23    RDECMTSNRCGDQGPLIQFPFRLKD-RPHHCGYPGFELSCTENNQTMLD-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
              P  VK L++ I  + R II+   D C  + L   NL+ASPF F+   +F++F+CS+ + 
Sbjct  71    LPVSVKILVKKIAYKSREIIVQDPDNCLARQLRNFNLAASPFYFKFERDFTLFTCSSDKT  130

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFS  1391
              + G      I CL+ PG+ +YA  SS Y+   TDL SC ++++ S+ P       + FS
Sbjct  131   ESYG---FQSIPCLSIPGNPVYAVHSSRYV-EDTDLSSCRRLYNASA-PEDFMFIESAFS  185

Query  1390  LRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVV  1241
             L+W+          G  CRLK +++ E   +CI        G  +K+ V G + G FL+V
Sbjct  186   LKWSKSICGSCPGGGKICRLKKSNSTEPETECIKV-----KGVSKKIIVTGAIFGFFLLV  240

Query  1240  VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYG  1061
             +++++ YR+Y  +K+++E +VK+++FLEDY+ALKP+RYSY D+K+IT +F +KLG+G YG
Sbjct  241   LVIVMLYRVYSSDKVERENRVKVKKFLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYG  300

Query  1060  TVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRAL  881
             TVYKGKLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CAD F RAL
Sbjct  301   TVYKGKLSDEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCADRFKRAL  358

Query  880   VYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRN  704
             +YEYL N SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCDQRILHFDIKP N
Sbjct  359   IYEYLPNESLEKFIFSKVVKNYSLSWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHN  418

Query  703   ILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSF  524
             ILLD NFNPKISDFG AKLCSKE+S VSMT  RGTMGYIAPEV SRNFGNVSYKSDVYSF
Sbjct  419   ILLDHNFNPKISDFGLAKLCSKEQSAVSMTVIRGTMGYIAPEVLSRNFGNVSYKSDVYSF  478

Query  523   GMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIV  344
             GMLLLEMVGG+K  D++    ++Q YF EWIYN L  GEE+ I+IE+  D +I KKL IV
Sbjct  479   GMLLLEMVGGRKNIDVS-VESSSQVYFLEWIYNHLDIGEELHIRIEEERDVEIVKKLAIV  537

Query  343   GLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLF  188
             GL CIQW P+DRPS+ +V+QMLE  +  +MPPNPF ST  +K   +KP R+F
Sbjct  538   GLSCIQWCPMDRPSMNIVVQMLEGGDKLTMPPNPFASTVSTKTNLSKPRRVF  589



>ref|XP_002268734.3| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=575

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/579 (56%), Positives = 406/579 (70%), Gaps = 42/579 (7%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             +EC   +C   GP I FPF LK  QP  CGYPGF+L C++K +T L              
Sbjct  24    DECKESRCAVQGPSIRFPFWLKDHQPDHCGYPGFKLSCSEKNQTML-----------HLS  72

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCSTHRN  1571
               VK L+  ID + + I++   D C L    ILNLS+SPF F  EN  ++S+F+CS+   
Sbjct  73    HSVKLLVRKIDYKSQEILVHDQDDCRLTQFLILNLSSSPFHFLQENQVDYSLFNCSS---  129

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFS  1391
              T       P+ CL+ P + +YA  +S  L    +L SC K+ H+S +PY   +   +F+
Sbjct  130   -TKTDSEFQPVPCLSVPAYPVYAV-TSWALIRYLNLSSCLKI-HIS-LPYQTLEPENLFT  185

Query  1390  LRWTGP----------SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVV  1241
             + W  P           CRLK +S+ E   +CI   +K    P+    V G  LGS  ++
Sbjct  186   MNWVKPMCKSCETEGKKCRLKKSSSEEPHTECIKGASK---TPM----VTGVTLGSIFLM  238

Query  1240  VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYG  1061
             + V+  Y  Y  NK+++E Q+KIE+FLEDY ALKP+RYSY D+KKIT++F +KLGEG YG
Sbjct  239   LGVITLYHKYSSNKLERENQMKIEKFLEDYIALKPSRYSYVDVKKITNQFKDKLGEGGYG  298

Query  1060  TVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRAL  881
              VYKG LS +VFVAVK+L N KG+G  EEF+NE+ T+G+IHH+NVVRLVG+CADGF RA+
Sbjct  299   IVYKGTLSNEVFVAVKILKNFKGNG--EEFINEVETMGTIHHVNVVRLVGFCADGFRRAV  356

Query  880   VYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRN  704
             +YEYL N SLEKF+FS   KN+ L WEKLQ IALG+AKG+EYLHQGCDQRILHFDIKP N
Sbjct  357   IYEYLPNESLEKFIFSTTFKNYSLSWEKLQNIALGVAKGIEYLHQGCDQRILHFDIKPHN  416

Query  703   ILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSF  524
             ILLD NFNPKISDFG AKLCSKE+S VSMTAARGTMGYIAPE+ SRNFGNVSYKSDVYSF
Sbjct  417   ILLDHNFNPKISDFGLAKLCSKEQSAVSMTAARGTMGYIAPEMLSRNFGNVSYKSDVYSF  476

Query  523   GMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIV  344
             GMLLLEMVGG+K  D+T    ++Q YFPEWIYN L +GEE+ I+IE+  D+ IA+KLTIV
Sbjct  477   GMLLLEMVGGRKNIDVT-VENSSQAYFPEWIYNHLDQGEELHIRIEEEGDTHIARKLTIV  535

Query  343   GLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
             GLWCIQWYPVDRPS+K+V+QMLE E E   MPPNPFT T
Sbjct  536   GLWCIQWYPVDRPSMKLVVQMLEGEGESLPMPPNPFTCT  574



>ref|XP_008347622.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=604

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/605 (53%), Positives = 415/605 (69%), Gaps = 35/605 (6%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             +NEC   +CG+ GP I FPFRL+  QP  CGYPGF+L C     T LE            
Sbjct  21    QNECTESRCGDYGPPIRFPFRLREKQPSHCGYPGFDLSCDRSNNTVLE-----------L  69

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN--LYNFSIFSCSTHR  1574
             P  VKF I SI+ + ++I +   D C  + LP LNLS+S F F+   LY++++F+CS  +
Sbjct  70    PVSVKFFITSINYKSQVIQVFDPDNCLPRHLPKLNLSSSAFIFQEPYLYDYTLFNCSPAK  129

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVS-SVPYSIAQDNTV  1397
                   I    I CL+   H I++  S  ++ S + L SCTK+++   SVPY I +    
Sbjct  130   R----DIYYDTIPCLSGTSHHIFSIPSDRFVDSLS-LTSCTKLYNFPFSVPYDIFEPYYF  184

Query  1396  FSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFL  1247
               L+W+ P+C          RL+NN+      +C         G  +KL V G VLGSFL
Sbjct  185   LPLKWSKPTCNRCERRGKGCRLQNNNRTNFETECFN--VSKQNGTAKKLVVTGAVLGSFL  242

Query  1246  VVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGS  1067
             +V+I+L  +R+Y  ++ +KE +  IE FLE+Y+AL+P RYSYADIK+IT++F +KLG+G+
Sbjct  243   LVLILLGLHRVYTFDRKEKERRTMIEEFLENYRALRPTRYSYADIKRITNKFRDKLGQGT  302

Query  1066  YGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHR  887
             +GTV+KGKLS ++FVAVK+LNNSKG+G  EEF+NE+ T+G IHHINVVRLVGYCADGF R
Sbjct  303   FGTVFKGKLSSEIFVAVKMLNNSKGNG--EEFINEVGTLGRIHHINVVRLVGYCADGFRR  360

Query  886   ALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             ALVYE+  N SL+ F+ S + KN FLGWEKLQ I L IAKG+EYLH GCDQRILHFDIKP
Sbjct  361   ALVYEFAPNGSLQNFISSADSKNHFLGWEKLQHITLSIAKGIEYLHHGCDQRILHFDIKP  420

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
              N+LLD NFNPKISDFG AKLCSK++S VSMT ARGTMGYIAPEVFSRNFG VSYKSDVY
Sbjct  421   HNVLLDDNFNPKISDFGLAKLCSKDQSAVSMTTARGTMGYIAPEVFSRNFGTVSYKSDVY  480

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             SFGMLLLEMV G+K   +T    T Q YFPEW+YN+L +G+++ I +E   D+KIA KL 
Sbjct  481   SFGMLLLEMVAGRKNVQVT-EENTGQVYFPEWVYNLLEQGDDIRIHVEGENDAKIATKLA  539

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEI  170
             IVGLWCIQWYPVDRPS+K V+QMLE E+   +PPNPF+S   ++       +     L +
Sbjct  540   IVGLWCIQWYPVDRPSMKAVVQMLEGEDNVKLPPNPFSSAASARNDITMLAKRHRQELPV  599

Query  169   ISEMD  155
             ISE++
Sbjct  600   ISELE  604



>ref|XP_010645761.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=600

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/604 (54%), Positives = 417/604 (69%), Gaps = 41/604 (7%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             +EC   +C  NGP I FPF L+  QP  CG+PGFEL CT+K +T       +LN +    
Sbjct  24    DECKVSRCSPNGPAIRFPFWLRDHQPAHCGFPGFELSCTEKHQT-------MLNLS----  72

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCSTHRN  1571
               VK L++ I+ + + I +   D C L     L+L  SPF    E+  +FS+ +C++ + 
Sbjct  73    HSVKLLVKKINYKSQEIQVHDTDDCRLTQFSNLSLHVSPFQLQEESQGHFSLLNCTSTK-  131

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSAT-DLISCTKMFHVSSVPYSIAQDNTVF  1394
              TA S    P+ CL+ P + +YA  SS   YS   +L SC K+ +VS   + + QDN +F
Sbjct  132   -TAYSDYFYPVPCLSAPAYQVYAVYSS---YSIDFELSSCRKIHNVSLPDHILMQDN-IF  186

Query  1393  SLRWTGP----------SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLV  1244
              L W  P           CR K +++ E    C+        G  +K  V G  LGS L+
Sbjct  187   PLNWDKPMCKSCEAEGGKCRWKKSNSKEPETQCVK-------GASKKPMVTGITLGSILL  239

Query  1243  VVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSY  1064
             ++  +  +R+Y   K+++  Q+KIE+FLEDY ALKP RYSYADIKKIT+ F +KLGEG Y
Sbjct  240   IIGTVALHRVYSWKKLERNNQIKIEKFLEDYIALKPTRYSYADIKKITNHFQDKLGEGGY  299

Query  1063  GTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRA  884
             GTVYKGKLS +V VAVK+LNN+  +G+GEEF+NE+ T+G IHH+NVVRLVG+CADGF RA
Sbjct  300   GTVYKGKLSDEVHVAVKILNNT--NGNGEEFLNEVGTMGRIHHVNVVRLVGFCADGFRRA  357

Query  883   LVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPR  707
             L+YE+L N SLEKF+FS   KN  LGW+KLQ IALGIAKG+EYLHQGCDQRILHFDIKP 
Sbjct  358   LIYEFLPNESLEKFIFSRTIKNHSLGWKKLQDIALGIAKGIEYLHQGCDQRILHFDIKPH  417

Query  706   NILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYS  527
             NILLD NFNPKI+DFG AKLCSKE+S VSMT ARGTMGYIAPE+ SRN GNVSYKSDV+S
Sbjct  418   NILLDHNFNPKIADFGLAKLCSKEQSAVSMTTARGTMGYIAPEMLSRNLGNVSYKSDVFS  477

Query  526   FGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTI  347
             +GMLLLEMVGG+K  D+T    T+Q YFPEWIYN L +GEE++I+I++  D++I KKLTI
Sbjct  478   YGMLLLEMVGGRKNIDVT-VDNTSQVYFPEWIYNHLDQGEELQIRIDEEGDTQIVKKLTI  536

Query  346   VGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEII  167
             +GLWCIQW+P DRPS+K+V+QMLE E   S PPNPFT T P+K  A+   R     L +I
Sbjct  537   IGLWCIQWFPTDRPSMKLVVQMLEGEHNLSTPPNPFTCTTPTKTNASTSKRYLQQELTVI  596

Query  166   SEMD  155
             SE++
Sbjct  597   SEIE  600



>emb|CDP17835.1| unnamed protein product [Coffea canephora]
Length=596

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/598 (55%), Positives = 402/598 (67%), Gaps = 46/598 (8%)
 Frame = -2

Query  1942  GYSYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLN  1763
             G+    + C  R+C + GP I FPFRLK  QP +CG+PGFEL CT   ET LEN F    
Sbjct  19    GFCKIHDNCTVRRCSDQGPAIRFPFRLKDYQPQQCGFPGFELSCTQSQETLLENLF----  74

Query  1762  ATLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYN--FSIFS  1589
                      +F+I  ID E RL+ +S++DGC   LLP L+LSAS F   + ++  FS F 
Sbjct  75    ---------RFVINKIDYESRLLYVSKLDGCLSGLLPKLDLSASLFQIPDFHDHDFSFFK  125

Query  1588  CSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ  1409
             CS+ +        + PI CL+   + +YA  S+  +   + L+SC KMF + SV Y++ +
Sbjct  126   CSSKK------WYMIPIPCLSNSSYQVYATRSTDSILFPS-LVSCAKMFEIPSVSYALIE  178

Query  1408  DNTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL  1259
                   L W+ P+C          RL ++S  +     +    +     +  L  AG VL
Sbjct  179   PQLPLVLSWSAPNCGYCEAEGKFCRLSSSSAEK-----LKTRIRFCVYVMNSLWNAGMVL  233

Query  1258  GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
             G  L+V+I + +YRI+R  K+KKE+Q+KI +FLEDYKALKP RYSY+DIKKIT  F+EKL
Sbjct  234   GPALIVLIGIASYRIFRSKKLKKEDQLKIGQFLEDYKALKPTRYSYSDIKKITGNFNEKL  293

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             GEG YGTVY+GKLS +VFVAVKVLNNSKG G  E+F+NE+ TIG IHHIN+ RLVGYCAD
Sbjct  294   GEGGYGTVYEGKLSNEVFVAVKVLNNSKGGG--EDFINEVGTIGQIHHINIGRLVGYCAD  351

Query  898   GFHRALVYEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFD  719
             G+   LVYE+L N+SLEKF  S N++N LG EKL  IALGIAKG+EYLHQGC+QRI HFD
Sbjct  352   GYRGVLVYEFLPNHSLEKFTSSENERNLLGLEKLHNIALGIAKGIEYLHQGCEQRIFHFD  411

Query  718   IKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKS  539
             IKP NILLDQNFNPKISDFGQAK CSKE+S VSMTAARGTMGYIAPEVFSRNFG VS+KS
Sbjct  412   IKPHNILLDQNFNPKISDFGQAKCCSKEQSAVSMTAARGTMGYIAPEVFSRNFGKVSHKS  471

Query  538   DVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAK  359
             DVYSFGMLL+EMVGG+K   I G     + YFPEWIYN L +G E+ IQI+  +D   AK
Sbjct  472   DVYSFGMLLIEMVGGRKNIKIGGQDNGTETYFPEWIYNKLDQGGEITIQIDNEDDKITAK  531

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFT  185
             KL IVGLWCIQWYPVDRPS+K V       + PSMP NPF   +    +A   G  F 
Sbjct  532   KLMIVGLWCIQWYPVDRPSMKAV-------DRPSMPRNPFGWANEINKRATMGGGGFV  582



>ref|XP_008354881.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=604

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/605 (52%), Positives = 409/605 (68%), Gaps = 36/605 (6%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             +NEC    CG+ GP I FPFRLK  QP  CGYPGF+L C     T LE            
Sbjct  22    QNECTESHCGDYGPPIRFPFRLKDKQPSHCGYPGFDLSCDRSNNTVLE-----------L  70

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCSTHR  1574
             P  +   + SI+ + ++I +   D C  + LP LNLS+S F F+  Y  ++++F+CS  +
Sbjct  71    PVSITLFVTSINYKSQVIQVFDPDHCVPRHLPKLNLSSSAFIFQEPYQCDYTLFNCSPAK  130

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVS-SVPYSIAQDNTV  1397
                   +    I CL+   H I++  S  ++  +  L SCTK++++  SVPY I + N  
Sbjct  131   R----DLYYDSIPCLSGTSHHIFSIPSDSFV-DSLPLTSCTKLYNLPFSVPYDIFEPNYF  185

Query  1396  FSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFL  1247
               L W+ P+C          RLKNN+      +C         G ++KL V G VLGSF 
Sbjct  186   LRLEWSKPTCNRCERRGKGCRLKNNNRTNSETEC---FNVKRNGTVKKLVVTGAVLGSFS  242

Query  1246  VVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGS  1067
             +V+I++  +R+Y  ++ +KE Q  IE FLE+Y+AL+P RYSYADIK+IT++F +KLG+G+
Sbjct  243   LVLILVGLHRVYTFDRKEKERQTMIEEFLENYRALRPTRYSYADIKRITNKFRDKLGQGT  302

Query  1066  YGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHR  887
             +GTV+KGKLS ++FVAVK+LNNSKG+G   EF+NE+ T+G IHH+NVVRLVGYCADGF R
Sbjct  303   FGTVFKGKLSSEIFVAVKMLNNSKGNGG--EFINEVGTLGRIHHVNVVRLVGYCADGFRR  360

Query  886   ALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             ALVYE+  N SL+ F+ S + KN FLGWEKLQ I + IAKG+EYLH GCDQRILHFD+KP
Sbjct  361   ALVYEFAPNGSLQNFISSADSKNHFLGWEKLQHITIRIAKGIEYLHHGCDQRILHFDVKP  420

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
              N+LLD +FNPKISDFG AKLCSK++S VSMT ARGTMGYIAPEVFSRNFG VSYKSDVY
Sbjct  421   HNVLLDDHFNPKISDFGLAKLCSKDQSAVSMTTARGTMGYIAPEVFSRNFGTVSYKSDVY  480

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             SFGMLLLEMVGGKK   +T    T Q YFPEWIYN+L +G+++ I +E   D+KIA KL 
Sbjct  481   SFGMLLLEMVGGKKNVQVT-EKNTGQVYFPEWIYNLLEQGDDIRIHVEGENDAKIATKLA  539

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEI  170
             IVGLWCIQWYPVDRPS+K V+QMLE E+   +PPNPF+     +       R     L +
Sbjct  540   IVGLWCIQWYPVDRPSMKAVVQMLEGEDNVKLPPNPFSPAGSVRNGITMLARRHRQELPV  599

Query  169   ISEMD  155
             ISE++
Sbjct  600   ISELE  604



>ref|XP_010662835.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=593

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/600 (55%), Positives = 425/600 (71%), Gaps = 38/600 (6%)
 Frame = -2

Query  1927  RNECLP-RKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             R+EC+   +CG+ GP I FPFRLK  QP  CGYPGFEL CT+  +T LE           
Sbjct  23    RDECMASHRCGDQGPLIQFPFRLKD-QPCHCGYPGFELSCTENNQTMLE-----------  70

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNF-SIFSCSTHR  1574
              P  VK L+++I  + R I +     C  + L  LNL+A PF F+    F + F+CS+ +
Sbjct  71    LPVSVKLLVKNITYKSREIFVQDPYNCLARQLGNLNLAAFPFPFKFEKGFVTFFNCSSDK  130

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD----  1406
               T        I CL+ PG+ +YA +SS  L    +L SC +++  S+       D    
Sbjct  131   --TDPYNLFQSIPCLSIPGNLVYAVESS-ELVQYLNLSSCRRLYSASAPGKQHYGDYIFN  187

Query  1405  NTVFSLRWTGPS-CRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVL  1229
              + FSL+W+    CRLK  ++ E   +CI  ++K       K+ V G + G FL++++++
Sbjct  188   GSAFSLKWSKSKICRLKKCNSRET--ECIKGVSK-------KIIVTGAIFGFFLLMLVIV  238

Query  1228  VTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYK  1049
             V YR Y  NK++++ +VK+++FLEDY+ALKP+RYSYADIK+I  +F +KLGE  YGTVYK
Sbjct  239   VPYRAYSSNKVERDNRVKVKKFLEDYEALKPSRYSYADIKRIASQFKDKLGEEGYGTVYK  298

Query  1048  GKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEY  869
             GKLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+N+VRLVG+CAD F RAL+YEY
Sbjct  299   GKLSDEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEY  356

Query  868   LVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLD  692
             L N SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCDQRILHFDIKP NILLD
Sbjct  357   LPNESLEKFIFSKVVKNYSLSWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLD  416

Query  691   QNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLL  512
              NFNPKISDFG AKLCSKE+S VSMT  RGTMGYIAPEV SRNFGNVSYKSDVYSFGMLL
Sbjct  417   HNFNPKISDFGLAKLCSKEQSAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLL  476

Query  511   LEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWC  332
             LEMVGG+K  D++    T Q YFPEWIYN L  GEE+ I+IE+  D +IAKKL IVGL C
Sbjct  477   LEMVGGRKNIDVS-VESTTQLYFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSC  535

Query  331   IQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             IQW PVDRPS+K+V+QMLE E +  +MPPNPF ST P+    +KPGR+F   L IISE++
Sbjct  536   IQWCPVDRPSMKIVVQMLEGEGDKLTMPPNPFASTVPT--NLSKPGRVFQQELSIISELE  593



>ref|XP_008232081.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=603

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/606 (54%), Positives = 417/606 (69%), Gaps = 41/606 (7%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++ C   KCG+ GP + FPF LK   P  C +PGF L C +K ET LE P P        
Sbjct  24    QDTCKKLKCGDKGPAVHFPFSLKGRHPDHCVFPGFVLSCNEKHETILELPIPF-------  76

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSF--ENLYNFSIFSCS-T  1580
                 KF ++SID + + I +   + C L +LL + N S SPF F  +++ + ++F+CS  
Sbjct  77    ----KFPVKSIDYKAQAIQLYDPERCLLVKLLKVFNKSISPFHFSKDHMTDLTLFNCSLA  132

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
              R +         + C   PG+ +Y+  SS Y      L+SCTKM++ SSVPY  + D  
Sbjct  133   ERQLQ------ERVPCFNGPGYQVYSVPSS-YSIEVLPLLSCTKMYNRSSVPY-YSNDPD  184

Query  1399  VFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSF  1250
                L W+ P+C          RLKNN T  +    I  +     G  RK    G  LGSF
Sbjct  185   NLYLEWSEPNCGQCEAKGKKCRLKNNGTKSE----IECVDFSQAGTKRKWVATGASLGSF  240

Query  1249  LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEG  1070
             +V+++V+  YR+Y  ++ +K  Q+KIERFL+DY+ALKP+RYSYADIK+IT+ F +KLGEG
Sbjct  241   VVLLLVVAAYRVYSSDRKEKANQLKIERFLDDYRALKPSRYSYADIKRITNDFKDKLGEG  300

Query  1069  SYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFH  890
             +YGTVYKG LS ++FVAVKVLN+SKGDG  EEF+NE+ T+G IHH+NVVRLVG+CADGF 
Sbjct  301   AYGTVYKGMLSSELFVAVKVLNSSKGDG--EEFINEVGTMGHIHHVNVVRLVGFCADGFR  358

Query  889   RALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIK  713
             RALVYE+  N SL+ F+ SP++KN FLGW+K+Q IAL IAKG+EYLHQGCDQRILHFDIK
Sbjct  359   RALVYEFSPNGSLQDFISSPDNKNSFLGWDKMQDIALAIAKGIEYLHQGCDQRILHFDIK  418

Query  712   PRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDV  533
             P N+LLD NF PKISDFG AKLCSK++SIVSMT ARGTMGYIAPEVFSRNFGNVSYKSDV
Sbjct  419   PHNVLLDHNFTPKISDFGLAKLCSKDQSIVSMTTARGTMGYIAPEVFSRNFGNVSYKSDV  478

Query  532   YSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKL  353
             YSFGMLLLEMVGG+K  D + +  TN+ Y+P+WIYN+L  G+++ I I +G + KI KKL
Sbjct  479   YSFGMLLLEMVGGRKNVD-SATENTNEIYYPQWIYNLLEEGDDLRIHIGEGGERKIPKKL  537

Query  352   TIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALE  173
              IVGLWCIQW+PVDRPS+K V+QMLE  E  ++PPNPF ST  +   AN   R     LE
Sbjct  538   AIVGLWCIQWHPVDRPSMKAVVQMLEGGESLTVPPNPFASTGAAGTNANTAARNLNIQLE  597

Query  172   IISEMD  155
              I E++
Sbjct  598   AIPELE  603



>ref|XP_010662993.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=606

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/605 (55%), Positives = 423/605 (70%), Gaps = 41/605 (7%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++EC+  +C + GP I FPFRL   QP  CGYPGFEL C++K +T LE            
Sbjct  27    QDECMASRCSDQGPTIRFPFRLTD-QPDHCGYPGFELYCSEKKQTMLE-----------L  74

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF------ENLYNFSIFSC  1586
             P+ V  L+ +I  +   I++     CF+  L  L+L+ASPF F      E L +F+ F+C
Sbjct  75    PYSVNLLVTNISYDSHEIMVQYPYNCFVGQLQNLSLAASPFQFKLENAWEVLDDFTFFNC  134

Query  1585  STHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD  1406
             S+++        +  I CL+ PG+ +YA  SS  L    +L SC +M++++ +PYSI+  
Sbjct  135   SSNKR---EFYFVQSIPCLSIPGYPVYAIMSSADL-DEVNLSSCRRMYNLT-LPYSISDL  189

Query  1405  NTVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLG  1256
             N  FS++W+          G  CRLK NS  E   +CI   +K       KL VAG V G
Sbjct  190   NGKFSIKWSKSVCGNCEAQGKKCRLKRNS-KEPETECINNPSK--GSATTKLVVAGAVTG  246

Query  1255  SFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLG  1076
               L+V+ V V Y ++   K++++ + KIE+FLEDY+ALKP+RYSYADIKKITD+F   LG
Sbjct  247   FLLLVLAVSVLYYLHCSRKLEEKNKRKIEKFLEDYRALKPSRYSYADIKKITDQFKYILG  306

Query  1075  EGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADG  896
             +G YGTVYKGKLS +V VAVK+LNN +G+G  EEF+NEM+T+G IHH+NVVRLVG+CADG
Sbjct  307   QGGYGTVYKGKLSNEVLVAVKILNNFRGNG--EEFINEMATMGRIHHVNVVRLVGFCADG  364

Query  895   FHRALVYEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
               RAL++E+L N+SL KF+FS   K+ L WEKLQ IA+GIAKG+EYLHQGC+QRILHFDI
Sbjct  365   MRRALIFEFLPNDSLNKFIFSA--KHSLVWEKLQDIAIGIAKGMEYLHQGCEQRILHFDI  422

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP NILLD NFNPKISDFG AKLCSK++S VSMT ARGTMGYIAPEV SRNFGNVSYKSD
Sbjct  423   KPHNILLDHNFNPKISDFGLAKLCSKDQSAVSMTIARGTMGYIAPEVLSRNFGNVSYKSD  482

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             VYSFGMLLLEMV G+K SD+T     +Q YFPEWIYN L++GEE+ I+I +  D+ IAKK
Sbjct  483   VYSFGMLLLEMVSGRKNSDVTAE-NPSQVYFPEWIYNHLNQGEELHIRIMENRDATIAKK  541

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSAL  176
             L IVGLWCIQWYPVDRPS+K+V+QMLE E+  +MPPNPF ST P+  K ++        L
Sbjct  542   LAIVGLWCIQWYPVDRPSMKLVVQMLEGEDNLTMPPNPFASTSPTNTKTSQSRTPLQKEL  601

Query  175   EIISE  161
              +ISE
Sbjct  602   AVISE  606



>ref|XP_008232099.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=620

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/605 (53%), Positives = 416/605 (69%), Gaps = 36/605 (6%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             C   KC  +GP I FPFR+K   P  CGYPGF + C D+ ET LE           P  P
Sbjct  35    CEELKCSPHGPAIRFPFRIKDRHPDHCGYPGFVVSCNDRHETVLE----------LPTIP  84

Query  1738  VKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFENLYNFSIFSCSTHRNITA  1562
             VK  +ESI+ E + + +   D C + +L+ I N+S SPF   +  N ++F+CS+   +  
Sbjct  85    VKLSVESINYERQEMYLYDPDNCLVAKLIEIRNMSFSPFYVIDRQNITLFNCSS-LVMQH  143

Query  1561  GSINISP-----IACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
             G ++ +P       CL  PGH +YA DS+ ++    DL SCTKM++V SVPY    +  V
Sbjct  144   GGLDPNPNYPVAAPCLNSPGHQVYAVDSAGHV---EDLQSCTKMYNVFSVPYYFRGEQVV  200

Query  1396  FSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFL  1247
                 W+ P+C          RLKN+ T  + + C+  L K +     K  + G  LGSF+
Sbjct  201   -PFPWSKPNCTECDAEGKKCRLKNSDTNNEIE-CVLDLRKANMSATTKSVITGAFLGSFV  258

Query  1246  VVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGS  1067
             ++++V+  YR+Y  +K +KE ++KIERFLE+Y+ALKP+RYSYADIK+ITD+F +KLGEG+
Sbjct  259   LILLVIAAYRVYSYDKNEKENRLKIERFLEEYRALKPSRYSYADIKEITDQFKDKLGEGA  318

Query  1066  YGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHR  887
             YGTVYKGKLS D+FVAVKVL++SKGDG  E+F+NE+  +G IHH+NVVRLVG+CADGF R
Sbjct  319   YGTVYKGKLSSDLFVAVKVLDSSKGDG--EDFINEVGAMGRIHHVNVVRLVGFCADGFRR  376

Query  886   ALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             ALVYE+L N  L+ F+ S ++K  FLGW+KLQ IALG+A+G+EYLHQGCDQRILHFDIKP
Sbjct  377   ALVYEFLPNGPLQDFISSADNKYCFLGWDKLQDIALGVAQGIEYLHQGCDQRILHFDIKP  436

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
              N+LLD NF PK+SDFG AKLCSK++SIVSMT ARGTMGYIAPEVFSRNFG VSYKSDVY
Sbjct  437   HNVLLDYNFTPKLSDFGLAKLCSKDESIVSMTTARGTMGYIAPEVFSRNFGKVSYKSDVY  496

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             SFGMLLLE++ GKK    T +  TNQDY+PE +YN+L  GE+  I   +  D +I  KL 
Sbjct  497   SFGMLLLEIIRGKKNIGAT-TENTNQDYYPEAVYNLLEEGEDPRIHFGEEGDDEIPMKLA  555

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEI  170
             IVGLWCIQW PVDRPS+  V+QMLE  E  + PPNPF ST  +++ A  P R     LE 
Sbjct  556   IVGLWCIQWNPVDRPSMNAVVQMLEGGEKLTKPPNPFASTGSTRSFATGPSRNSNLELET  615

Query  169   ISEMD  155
             I E++
Sbjct  616   IVELE  620



>ref|XP_002513562.1| receptor serine/threonine kinase, putative [Ricinus communis]
 gb|EEF48965.1| receptor serine/threonine kinase, putative [Ricinus communis]
Length=598

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/601 (55%), Positives = 419/601 (70%), Gaps = 34/601 (6%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPG--FELLCTDKGETALENPFPLLNATLQ  1751
             ++C P KCG+    I FPFRLK  QP  CGYP   F+L C D       N F    A ++
Sbjct  21    DDCAPEKCGDE-LFIRFPFRLKEKQPKHCGYPDPRFDLSCED-------NKF----AEME  68

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-NLYNFSIFSCSTHR  1574
              P  VK  I SID   + + +   DGC  +      LS S F F  +L ++++F+CS+  
Sbjct  69    LPNSVKVHIRSIDYALQTLHVFGTDGCLARNAKDFKLSTSNFQFSASLNDYALFNCSSE-  127

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVF  1394
             NI +     + I+CL  PG+ +YA DS  Y      L SCTKM+++SS+P  +  D  V 
Sbjct  128   NINS----YAAISCLGGPGYQVYAFDS-YYRIDDLPLTSCTKMYNLSSLPQDMFNDKDVI  182

Query  1393  SLRWTGPSCR-----LKNNSTAEDADDCIA-PLTKLHTGPLRKLKVAGEVLGSFLVVVIV  1232
             SL W+ P C       K+ S   D+  C+  P+ K     L +L+ AG VLGS L++++ 
Sbjct  183   SLTWSEPKCHDCEVPRKHCSWKNDSIVCLELPIRK--ADALIRLRTAGIVLGSCLLLIVS  240

Query  1231  LVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVY  1052
                + +YR+ + +KE Q +IE+FLEDYKALKP RYSYAD+K+IT++F +KLG+G+YGTV+
Sbjct  241   AAVFHVYRIYRKQKENQARIEKFLEDYKALKPTRYSYADLKRITNQFKDKLGQGAYGTVF  300

Query  1051  KGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYE  872
             KG+LS ++FVAVK LNNS G+G  EEF+NE+ T+G IHH+NVVRLVG+CADGF RALVYE
Sbjct  301   KGRLSDEIFVAVKELNNSTGNG--EEFINEVGTMGRIHHVNVVRLVGFCADGFRRALVYE  358

Query  871   YLVNNSLEKFVFSPN-DKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILL  695
             +L N SLEKF+FS + D + LGWEKL+ IALGIAKG+EYLHQGCDQRILHFDIKP NILL
Sbjct  359   FLPNESLEKFIFSNDGDNSSLGWEKLEDIALGIAKGIEYLHQGCDQRILHFDIKPHNILL  418

Query  694   DQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGML  515
             D NF PKISDFG AKLC+K++S VSMTAARGTMGYIAPEVFSRNFG+VSYKSDVYSFGML
Sbjct  419   DDNFTPKISDFGLAKLCAKDQSAVSMTAARGTMGYIAPEVFSRNFGSVSYKSDVYSFGML  478

Query  514   LLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLW  335
             LLEMVGG+K  DI     ++Q +FPEWIY  L + EE+ I+I +  D+KIAKKLTIVGLW
Sbjct  479   LLEMVGGRKNIDID-VENSSQVFFPEWIYKHLDQEEELRIRILEIGDAKIAKKLTIVGLW  537

Query  334   CIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPSKAKANKPGRLFTSALEIISEM  158
             CIQWYP DRPS+KVV+QMLE E    +MPPNPF S    KA A   GR     L +ISE+
Sbjct  538   CIQWYPADRPSMKVVVQMLEEEGGALTMPPNPFNSESAMKANAAMRGRRLHQELAVISEV  597

Query  157   D  155
             +
Sbjct  598   E  598



>ref|XP_006376636.1| hypothetical protein POPTR_0012s01760g [Populus trichocarpa]
 gb|ERP54433.1| hypothetical protein POPTR_0012s01760g [Populus trichocarpa]
Length=608

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/600 (55%), Positives = 418/600 (70%), Gaps = 39/600 (7%)
 Frame = -2

Query  1906  KCGNNGPEISFPFRLKHIQPPECGY-PGFELLCTDKGETALENPFPLLNATLQPPFPVKF  1730
             +C  +GP I FPFRL   QP  CGY P F L C  + ET            LQ P  V  
Sbjct  32    RCKKHGPAIRFPFRLDK-QPVHCGYDPRFVLSCNQRNET-----------LLQLPTSVTL  79

Query  1729  LIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCSTHRNITAGS  1556
              I+ ID   RLII +  D C  + L   +LS SPF F   Y  ++++F+C++ +      
Sbjct  80    NIKKIDYASRLIIAADPDNCLPRQLRNFSLSQSPFKFAGQYQDDYALFNCTSKQGDY---  136

Query  1555  INISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTG  1376
                 PI+CL  PG+ IYA  S+ +L   TDL +CTKM++V S+P  + + + +  L W+ 
Sbjct  137   --YDPISCLGVPGYDIYAYSSNNFL-GYTDLTNCTKMYNVPSIPSEMIRGDNILHLNWSE  193

Query  1375  PS-----------CRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVL  1229
             P+           C  K N++  + +    P  K + G +RK++ A   +GS LV++++L
Sbjct  194   PAACVGCEEQGKFCGWKKNTSKLETECYEKP--KSNKGKIRKIEGAVATVGSVLVLLVLL  251

Query  1228  VTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYK  1049
               YR+Y  +K  K  Q +IE FL DYKALKPARY+YADIK+ITD F +KLG+G+YGTV+K
Sbjct  252   AAYRVYSSDKAAKNNQKRIENFLADYKALKPARYTYADIKRITDEFKDKLGQGAYGTVFK  311

Query  1048  GKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEY  869
             GKLS ++FVAVK+LNNS G+G  EEF+NE++T+G IHH+NV+RLVGYCADGF RALVY+Y
Sbjct  312   GKLSDEIFVAVKILNNSTGNG--EEFINEVATMGKIHHVNVIRLVGYCADGFRRALVYDY  369

Query  868   LVNNSLEKFVFSPN-DKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLD  692
             L N SLEKFV S + + + L WEKLQ IALG+AKG+EYLHQGCDQRILHFDIKP NILLD
Sbjct  370   LPNESLEKFVSSEHGETSSLSWEKLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLD  429

Query  691   QNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLL  512
              +FNPKISDFG AKLCSK++S VSMT ARGTMGYIAPEVFSRNFG+VSYKSDVYSFGM+L
Sbjct  430   DHFNPKISDFGLAKLCSKDQSAVSMTTARGTMGYIAPEVFSRNFGHVSYKSDVYSFGMVL  489

Query  511   LEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWC  332
             LEMVGG+K  D      +NQ YFPEW+YN L +GEE+ I+IEK  D++IAKKLT+VGLWC
Sbjct  490   LEMVGGRKTID-DKVENSNQIYFPEWVYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLWC  548

Query  331   IQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             IQW+PVDRPS+  V+QMLE E +  +MPP+PF S  P +  AN PGR    ALE+ISE +
Sbjct  549   IQWHPVDRPSMNTVVQMLEGEGDKLTMPPSPFASAGPGRMHANMPGRPHYQALEVISETE  608



>ref|XP_002317767.2| hypothetical protein POPTR_0012s01750g [Populus trichocarpa]
 gb|EEE95987.2| hypothetical protein POPTR_0012s01750g [Populus trichocarpa]
Length=603

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/600 (55%), Positives = 416/600 (69%), Gaps = 40/600 (7%)
 Frame = -2

Query  1906  KCGNNGPEISFPFRLKHIQPPECGY-PGFELLCTDKGETALENPFPLLNATLQPPFPVKF  1730
             KC  +GP I FPFRL   QP  CGY PGF L C ++ ET            LQ P  V  
Sbjct  28    KCKKHGPAIRFPFRLDK-QPEYCGYDPGFVLSCNERNET-----------LLQLPTSVTL  75

Query  1729  LIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNF--SIFSCSTHRNITAGS  1556
              I+ ID + RLII +  D C  + L   +LS SPF F + Y +  ++F+C++        
Sbjct  76    NIKKIDYKSRLIIAADPDNCLPRHLRNFSLSKSPFKFADQYQYDCTLFNCTSKHGDY---  132

Query  1555  INISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTG  1376
                  I CL+ PG+ IYA  S+ +L   TDL SCTKM++V+S+P  +   + +  L W+ 
Sbjct  133   --YDRIPCLSVPGYDIYAYSSNNFL-GYTDLTSCTKMYNVTSIPSEMTGGDNILHLNWSE  189

Query  1375  PS-----------CRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVL  1229
             P+           CR KNN+      +C           +RK++ A   +GS LV++++L
Sbjct  190   PAACGICEEHGMFCRWKNNTKL--GTECYKKPKSKKG-KIRKIEGAVATVGSVLVLLVLL  246

Query  1228  VTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYK  1049
               YR+Y  +K  K  Q +IE FL DYKALKPARY+YADIK+ITD F +KLG+G+YGTV+K
Sbjct  247   AAYRVYSSDKAAKNNQKRIENFLADYKALKPARYTYADIKRITDEFKDKLGQGAYGTVFK  306

Query  1048  GKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEY  869
             GKLS ++FVAVK+LNNS G+G  EEF+NE++T+G IHH+NV+RLVGYCADGF RALVY+Y
Sbjct  307   GKLSDEIFVAVKILNNSTGNG--EEFINEVATMGKIHHVNVIRLVGYCADGFRRALVYDY  364

Query  868   LVNNSLEKFVFSPN-DKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLD  692
             L N SLEKFV S + + + L WE+LQ IALG+AKG+EYLHQGCDQRILHFDIKP NILLD
Sbjct  365   LPNESLEKFVSSEHGETSSLSWERLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLD  424

Query  691   QNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLL  512
              +FNPKISDFG AKLCSK++S VSMT ARGTMGYIAPEVFSRNFG+VSYKSDVYSFGM+L
Sbjct  425   DHFNPKISDFGLAKLCSKDQSAVSMTTARGTMGYIAPEVFSRNFGHVSYKSDVYSFGMVL  484

Query  511   LEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWC  332
             LEMVGG+K  D      +NQ YFPEW+YN L +GEE+ I+IEK  D++IAKKLT+VGLWC
Sbjct  485   LEMVGGRKTID-DKVENSNQIYFPEWVYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLWC  543

Query  331   IQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             IQW+PVDRPS+  V+QMLE E +  +MPP+PF S  P +  AN PGR    ALE+ISE +
Sbjct  544   IQWHPVDRPSMNTVVQMLEGEGDKLTMPPSPFASAGPGRMHANMPGRPHYQALEVISETE  603



>ref|XP_010091110.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC36756.1| putative receptor-like protein kinase [Morus notabilis]
Length=603

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/609 (54%), Positives = 416/609 (68%), Gaps = 44/609 (7%)
 Frame = -2

Query  1930  DRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             D+  C   KCG++G  I FPFRLKH QP  CGYPGFEL C D   T LE           
Sbjct  22    DQIPCEESKCGDDGVAIRFPFRLKH-QPNHCGYPGFELSC-DGSHTVLE-----------  68

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSF-ENLYNFSIFSCSTH  1577
              P   KF +  ID + + I +     CF+ + L I NLS SPF F  +L N+S F+CS  
Sbjct  69    LPISAKFFVRRIDYKSQRIEMYEPSNCFVREFLKIRNLSTSPFHFGSDLDNYSFFNCS--  126

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLI--SCTKMFHVS--SVPYSIAQ  1409
              +    S     + C     + IYA  S     SA + +  +C K+++ +  S  Y+   
Sbjct  127   EDTLGYSPYYDTLQCFGGSSYKIYAVPSD----SAIEELPTNCFKIYNTTLPSTKYN-RP  181

Query  1408  DNTVFSLRWTGPSC-----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEV  1262
             + +   L W  P+C           RLK+N+T  +   C  P  K   G   K    G  
Sbjct  182   NQSWLRLSWQKPNCGQYCETKRKKCRLKSNATKVEIK-CFNPKPKPRKGESTKFVAIG--  238

Query  1261  LGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
              G+ ++ +++LV YR Y  NK++K+ Q +I+ FLEDY+ALKP+RYSYADIK IT +F +K
Sbjct  239   -GAPILALLLLVAYRAYSSNKLEKDTQRRIKNFLEDYRALKPSRYSYADIKHITSQFKDK  297

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             LGEG++GTV+KGKLS D FVAVK+LNNSKG+G  EEF+NE+ TIG IHH+NVVRLVGYCA
Sbjct  298   LGEGAFGTVFKGKLSEDFFVAVKILNNSKGNG--EEFINEIGTIGRIHHVNVVRLVGYCA  355

Query  901   DGFHRALVYEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
             DGF RALVYE+L N SL++++ SP+  +FLGW+ LQ +ALGIAKG+EYLHQGCDQRILHF
Sbjct  356   DGFRRALVYEFLHNGSLQQYISSPDTDHFLGWKNLQDVALGIAKGIEYLHQGCDQRILHF  415

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DIKP N+LLD NF PKISDFG AKLCSK++SIVSMT ARGTMGYIAPEVFSRNFGNVSYK
Sbjct  416   DIKPHNVLLDHNFTPKISDFGLAKLCSKDQSIVSMTTARGTMGYIAPEVFSRNFGNVSYK  475

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIA  362
             SDVYSFGMLLLEMVGG+K +++T    T+Q Y+PEWIYN+L  GE++ I+IE+  DS IA
Sbjct  476   SDVYSFGMLLLEMVGGRKITNVT-EDNTSQVYYPEWIYNLLEDGEDLRIRIEEEGDSTIA  534

Query  361   KKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTS  182
             KKL IVG+WCIQW+PVDRPS+KVV+QML+  E  SMPPNPF STD + A AN P R    
Sbjct  535   KKLAIVGVWCIQWHPVDRPSMKVVVQMLQGGETLSMPPNPFASTDSTSAVANMPRRRMNF  594

Query  181   ALEIISEMD  155
              L++I+E +
Sbjct  595   GLDVIAESE  603



>ref|XP_002264064.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=596

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/607 (54%), Positives = 413/607 (68%), Gaps = 50/607 (8%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++EC   +C N+GP I FPFRLK  QP  CGYPGFE+ C +K +T LE            
Sbjct  21    QDECKVSRCSNHGPVIRFPFRLKD-QPYNCGYPGFEISCIEKKQTILE-----------L  68

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-----NLYNFSIFSCS  1583
             P+ +   ++ I+   + II+   D C  + L  L LSASPF F+        +++ F+CS
Sbjct  69    PYSISLSVKKINYNSQEIIVHDPDFCLQRQLQNLTLSASPFRFKLTPSNYQVDYTFFNCS  128

Query  1582  THRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDN  1403
             +++  +   ++I     L+ P   +YA DS   L    DL SC K++ V+ +P  I    
Sbjct  129   SNKTHSNYFLSIPCTVLLSNP---VYAVDSDNIL-ELLDLSSCHKIYDVT-LPQDIVNGE  183

Query  1402  TVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
               FSL W+          G  C+LK+N   E   +CI              K A  V+ S
Sbjct  184   NYFSLTWSELICGNCEREGKKCKLKSNVGKEPETECID-------------KPAKAVILS  230

Query  1252  F-LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLG  1076
             F L+V++V+  Y +Y  +K+++E   KIE+FLEDYKALKP+RYSYAD+KKIT+ F EKLG
Sbjct  231   FCLLVLLVITLYHVYSSDKLERENTKKIEQFLEDYKALKPSRYSYADVKKITNHFKEKLG  290

Query  1075  EGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADG  896
             +G YGTVYKG+LS DV VAVK+LNNSK +G  EEF+NE+ T+G IHH+NVVRLVG+CADG
Sbjct  291   QGGYGTVYKGRLSRDVLVAVKILNNSKENG--EEFINEVGTMGRIHHVNVVRLVGFCADG  348

Query  895   FHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFD  719
               RAL+YE+L N SLEK++FS + K+  L WE LQ I LGIAKG+EYLHQGCD+RILHFD
Sbjct  349   VKRALIYEFLPNESLEKYIFSKSVKDCSLRWETLQNIVLGIAKGIEYLHQGCDKRILHFD  408

Query  718   IKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKS  539
             IKP NILLDQNFNPKISDFG AKLCSKE+S VSMT ARGTMGYIAPEV SRNFGNVSYKS
Sbjct  409   IKPHNILLDQNFNPKISDFGLAKLCSKEQSAVSMTTARGTMGYIAPEVLSRNFGNVSYKS  468

Query  538   DVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAK  359
             D+YSFGMLLLEMVGG+K  D+T   + NQ YFPEW+YN L +GEEV I+IE+  D KIAK
Sbjct  469   DIYSFGMLLLEMVGGRKNIDVT-MEKANQVYFPEWVYNQLDKGEEVCIRIEEDGDIKIAK  527

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSA  179
             KLTIVGLWCIQW P+DRPSIKVVIQMLE  +  +MPPNPF S DP++    +  +     
Sbjct  528   KLTIVGLWCIQWCPIDRPSIKVVIQMLEGGDKLTMPPNPFASIDPTRTNIRRRKKSLQQE  587

Query  178   LEIISEM  158
             L +ISE+
Sbjct  588   LAVISEL  594



>ref|XP_011001895.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Populus euphratica]
Length=604

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/600 (55%), Positives = 416/600 (69%), Gaps = 39/600 (7%)
 Frame = -2

Query  1906  KCGNNGPEISFPFRLKHIQPPECGY-PGFELLCTDKGETALENPFPLLNATLQPPFPVKF  1730
             KC  +GP I FPFRL   Q  +CGY P F L C ++ ET            LQ P  V  
Sbjct  28    KCKKHGPAIRFPFRLDK-QTEDCGYDPRFVLSCNERNET-----------LLQLPSSVTL  75

Query  1729  LIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCSTHRNITAGS  1556
              I+ ID + RLII +  D CF + L   +LS SPF F   Y  ++++F+C++    + G 
Sbjct  76    NIKKIDYKLRLIIAADPDNCFQRQLRNFSLSKSPFKFAGQYRDDYALFNCTSKNGDSYGR  135

Query  1555  INISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTG  1376
             I      CL  PG+ IYA  S+ ++   TDL SCTKM++V+S+P  +   + +  L W+ 
Sbjct  136   I-----PCLGVPGYDIYAYSSNDFI-GDTDLTSCTKMYNVTSIPSEMIDGDNILHLNWSE  189

Query  1375  PS-----------CRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVL  1229
             P+           C  K N+T    +    P  K + G +RK++ A   +GS LV++++ 
Sbjct  190   PAACVGCEEQGKLCGWKTNNTKLKTECYKKP--KSNEGKIRKIEGAVATVGSVLVLLVLF  247

Query  1228  VTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYK  1049
               YR+Y  +K  K  Q +IE FL DYKALKPARY+YADIK+ITD F +KLG+G+YGTV+K
Sbjct  248   AAYRVYSSDKAAKNNQKRIENFLADYKALKPARYTYADIKRITDEFKDKLGQGAYGTVFK  307

Query  1048  GKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEY  869
             GKLS ++FVAVK+LNNS G+G  EEF+NE++T+G IHH+NV+RLVGYCADGF RALVY+Y
Sbjct  308   GKLSDEIFVAVKILNNSTGNG--EEFINEVATMGKIHHVNVIRLVGYCADGFRRALVYDY  365

Query  868   LVNNSLEKFVFSPN-DKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLD  692
             L N SLEKFV S + + + L WE+LQ IALG+AKG+EYLHQGCDQRILHFDIKP NILLD
Sbjct  366   LPNESLEKFVSSEHGETSSLSWERLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLD  425

Query  691   QNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLL  512
              +FNPKISDFG AKLCSK++S VSMT ARGTMGYIAPEVFSRNFG VSYKSDVYSFGM+L
Sbjct  426   DHFNPKISDFGLAKLCSKDQSAVSMTTARGTMGYIAPEVFSRNFGLVSYKSDVYSFGMVL  485

Query  511   LEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWC  332
             LEMVGG+K  D      +NQ YFPEW YN L +GEE+ I+IEK  D++IAKKLT+VGLWC
Sbjct  486   LEMVGGRKTID-DKLENSNQIYFPEWAYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLWC  544

Query  331   IQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             IQW+PVDRPS+  V+QMLE E +  ++PP+PF S  P +  AN PGR    ALE+ISE +
Sbjct  545   IQWHPVDRPSMNTVVQMLEGEGDKLTVPPSPFASAGPGRMHANMPGRPHYQALEVISETE  604



>ref|XP_008246015.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=600

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/605 (52%), Positives = 408/605 (67%), Gaps = 40/605 (7%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             +NEC   +CG++GP I FPFRLK   P  CGY GF+L C     T LE            
Sbjct  22    QNECSELRCGDSGPPIKFPFRLKDKHPDYCGYHGFDLSCNGSNNTVLE-----------L  70

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN--LYNFSIFSCS-TH  1577
             P  VKF +  I+ + ++I +   DGC  +    LNLSAS F F+     ++++F+CS   
Sbjct  71    PISVKFTVTHINYKSQVIQVVDPDGCVPRQFHKLNLSASAFQFKGGGYQDYTLFNCSPAD  130

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
             RN+         I CL+   H + A  S   +     + SCTK++++  VP  I +   V
Sbjct  131   RNL------YYQIPCLSGTSHQMLAIYSDFSI-DEVPISSCTKLYNLPPVPLDIFESENV  183

Query  1396  FSLRWTGPSCR----------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFL  1247
               L W  P C+          LKNN+  E   +C   + K       KL V G +LGSFL
Sbjct  184   LRLEWFKPECKHCERKGGKCKLKNNNDTESETECFK-VGKQGARASTKLVVIGVILGSFL  242

Query  1246  VVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGS  1067
              VV ++  +R+Y  ++    +Q  IE FLE+Y+ALKP RYSYADIK+IT+ F +KLG+G+
Sbjct  243   FVVALVSLHRLYTFDR----KQTMIEEFLENYRALKPTRYSYADIKRITNTFRDKLGQGT  298

Query  1066  YGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHR  887
             +GTVYKGKLS ++FVAVK+LNNSKG+G  EEF+NE+ T+G IH++NVVRLVGYCADGF R
Sbjct  299   FGTVYKGKLSNEIFVAVKILNNSKGNG--EEFINEVGTLGRIHYVNVVRLVGYCADGFRR  356

Query  886   ALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             ALVYE+  N SL+ F+ S +  N FLGWEKLQ IAL +AKG+EYLH GCDQRILHFDIKP
Sbjct  357   ALVYEFAPNGSLQNFITSADSNNHFLGWEKLQYIALSVAKGIEYLHNGCDQRILHFDIKP  416

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
              N+LLD+NFNPKISDFG +KLC+ ++S VS+T ARGTMGYIAPEVFSRNFGNVSYKSDVY
Sbjct  417   HNVLLDENFNPKISDFGLSKLCANDQSAVSLTTARGTMGYIAPEVFSRNFGNVSYKSDVY  476

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             SFGMLLLEMVGG+K   +T    ++Q YFPEWIYN+L +GE++ I +E+  D+KIAKKL 
Sbjct  477   SFGMLLLEMVGGRKNVQVT-EANSSQVYFPEWIYNLLDQGEDIRIHVEQETDAKIAKKLA  535

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEI  170
             IVGLWCIQWYPVDRPS+K V+QMLE E+   MPPNPF+ST  ++ +   P +     L +
Sbjct  536   IVGLWCIQWYPVDRPSMKAVVQMLEGEDNVKMPPNPFSSTASTRDRVTIPAKRPHQELPV  595

Query  169   ISEMD  155
             ISE+D
Sbjct  596   ISELD  600



>ref|XP_010662662.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=613

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/612 (54%), Positives = 423/612 (69%), Gaps = 47/612 (8%)
 Frame = -2

Query  1930  DRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             +++EC    C  +GP I FPFR K  QP  CGY GFE+ CT+K +T LE           
Sbjct  27    NQDECKVPSCSPHGPAIKFPFRRKD-QPYHCGYLGFEISCTEKKQTILE-----------  74

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-NLYNF-------SI  1595
              P+ VK  ++ I+ + R I++   D C  + L  L LSASPF F+ +  NF       + 
Sbjct  75    LPYSVKLSVDKINYKSREIVVHDPDFCLQRQLQNLTLSASPFQFKVDSSNFESWTDDYTF  134

Query  1594  FSCSTHRNITAGSINISPIACLTKPGHF--IYAADSSLYLYSATDLISCTKMFHVSSVPY  1421
             FSCS+  +        + I C ++  H   +YA  S + L    DL SC K++++S +P 
Sbjct  135   FSCSS--DTREYEFPFTLIPCRSRFLHENPVYAVRSFMQL-DWLDLSSCHKLYNLS-LPD  190

Query  1420  SIAQDNTVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVA  1271
              I  D   FSL W+          G  CRLK+NS   + + CI    K   G   K+ +A
Sbjct  191   GIV-DGKKFSLTWSESICGNCEKAGQKCRLKSNSKGPETE-CIPKQVK---GVKEKILIA  245

Query  1270  GEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRF  1091
             G +LG F++V ++++ +R+YR N+ K+E  V+IE+FLEDYKALKP+RYSY DIKK+T+ F
Sbjct  246   GVILGFFVLVFVIIILHRVYRSNESKRENIVRIEKFLEDYKALKPSRYSYNDIKKLTNHF  305

Query  1090  SEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVG  911
              +KLG+G YGTVYKGKLS +V VA+K+LN+SKG+G  EEF+NE+ TIG IHH+NVVRLVG
Sbjct  306   KDKLGQGGYGTVYKGKLSNEVLVAIKILNDSKGNG--EEFINEVGTIGRIHHVNVVRLVG  363

Query  910   YCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQR  734
             +CADG  RAL+YE+L N SLEKF+FS + + + LGWEKLQ IA+GIAKG+EYLHQGCDQR
Sbjct  364   FCADGVKRALIYEFLPNESLEKFIFSTSVETYSLGWEKLQDIAIGIAKGIEYLHQGCDQR  423

Query  733   ILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGN  554
             ILHFDIKP NILLD+NFNPKISDFG AKLCSK++S VSMT ARGTMGYIAPEV SRNFGN
Sbjct  424   ILHFDIKPHNILLDENFNPKISDFGLAKLCSKDQSAVSMTVARGTMGYIAPEVLSRNFGN  483

Query  553   VSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGED  374
              SYKSDVYSFGMLLLEMVGG+K  D+T   ETNQ YFPEW+YN L +GE+V I+IE+  D
Sbjct  484   ASYKSDVYSFGMLLLEMVGGRKNIDVT--METNQVYFPEWVYNQLDQGEDVHIRIEEEGD  541

Query  373   SKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPG  197
              KIAKKLTIVGLWCIQWYP+DRPS+KVV+QMLE E +  ++PPNPF S   +     +  
Sbjct  542   IKIAKKLTIVGLWCIQWYPIDRPSMKVVVQMLEREGDNLTIPPNPFASIGSTGGNIRRRK  601

Query  196   RLFTSALEIISE  161
             +     L IISE
Sbjct  602   KSLQQELTIISE  613



>ref|XP_010662387.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=652

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/653 (52%), Positives = 424/653 (65%), Gaps = 87/653 (13%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             NEC    C +NGP I +PF L   QP  CG PGFEL CT K +T       +LN +    
Sbjct  24    NECKESSCSHNGPAIRYPFWLNGHQPDHCGSPGFELSCTKKNQT-------MLNLS----  72

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCSTHRN  1571
             + VKFL++ I+     I +   D C L+ L  LN+SASPF F  EN  ++S+F+CS+ R 
Sbjct  73    YSVKFLVKEINYSSMEIHVHDPDHCHLKELLSLNISASPFQFKEENQEHYSLFNCSSTRT  132

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFS  1391
                   +I    CL+ PG+ IY   SS    S+ +L  C K+ + S +P+S+     +FS
Sbjct  133   HPYYQYSI---PCLSVPGYPIYVVPSSPL--SSLNLFYCRKIKNFS-LPHSMFDQENIFS  186

Query  1390  LRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAG---------  1268
             L W+             C LK+NS   +    I    K   G  RKL VAG         
Sbjct  187   LDWSKRICGNCSAESKKCSLKSNSKEPE----IICFDKAPKGTSRKLAVAGTSRKLALQV  242

Query  1267  ----------------------------------------EVLGSFLVVVIVLVTYRIYR  1208
                                                      +LG FL+V++V+  Y +Y 
Sbjct  243   KFSMLLHFKEYGDNGSQLDFFFIFKNKETRILKLVSLCAGAILGFFLLVLVVIALYWVYS  302

Query  1207  LNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDV  1028
              +K++KE Q+KIE+FLEDY+ALKP+RYSYADIKKIT++F +KLG+G YGTVYKGKLS ++
Sbjct  303   SDKIEKENQLKIEKFLEDYRALKPSRYSYADIKKITNQFKDKLGQGGYGTVYKGKLSNEI  362

Query  1027  FVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLE  848
              VAVK+LNNS   G+GEEF+NE+ T+G IHH+NVVRLVG+CADG  RAL+YE+L N SLE
Sbjct  363   LVAVKILNNS--TGNGEEFINEVGTMGRIHHVNVVRLVGFCADGLRRALIYEFLPNESLE  420

Query  847   KFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKI  671
             KF+FS   KN  LGWEKL+ IALGIAKG+EYLHQGC QRILHFDIKP NILLDQN NPKI
Sbjct  421   KFIFSAAMKNQSLGWEKLRDIALGIAKGIEYLHQGCAQRILHFDIKPHNILLDQNLNPKI  480

Query  670   SDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGK  491
             SDFG AKLCSKEKS+VSM+AARGTMGYIAPEV SRNFGNVS+KSDVYSFGMLLLEMVGG+
Sbjct  481   SDFGLAKLCSKEKSVVSMSAARGTMGYIAPEVLSRNFGNVSHKSDVYSFGMLLLEMVGGR  540

Query  490   KKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVD  311
             +  D+T    T+Q YFPEW+YN L +GEE+ I+IEK  D+K+AK+LTIVGLWCIQWYP D
Sbjct  541   RNIDVT-VENTSQVYFPEWVYNHLDQGEELHIRIEKEGDAKMAKQLTIVGLWCIQWYPKD  599

Query  310   RPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             RPS+KVV+QMLE E +  +MP NPF S  P++    +  R     L +ISE++
Sbjct  600   RPSMKVVVQMLEGEGDNLTMPSNPFISMGPTRTNGRRLERPLQQELAVISELE  652



>ref|XP_008232078.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=603

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/606 (53%), Positives = 416/606 (69%), Gaps = 41/606 (7%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++ C   KCG+ GP + FPF LK   P  C +PGF L C +K ET LE P P        
Sbjct  24    QDTCKKLKCGDKGPAVHFPFSLKGRHPDHCVFPGFVLSCNEKHETILELPIPF-------  76

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFENLY--NFSIFSCS-T  1580
                 KF ++SID + + I +   + C L +LL + N S SPF F   Y  + ++F+CS  
Sbjct  77    ----KFPVKSIDYKAQAIQLYDPESCLLVKLLKVFNKSISPFHFSKNYMTDLTLFNCSLA  132

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
              R +        P+ C + PG+ +Y+  SS  +     L+SCTKM+++SSVPY   +   
Sbjct  133   ERQLD------EPVPCFSGPGYQVYSVVSSKSIRDLP-LLSCTKMYNLSSVPYFSYEPAN  185

Query  1399  VFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSF  1250
             ++ L W+ P+C          RLKNN T  + + C+   +K   G  RK    G  LGSF
Sbjct  186   LY-LEWSEPNCGQCEARGKMCRLKNNGTKSEIE-CV-DFSK--AGTKRKWVATGASLGSF  240

Query  1249  LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEG  1070
             +V+++V+  YR+Y  ++ +KE Q+KIERFL+DY+ALKP+RY+YADIK+IT+ F +KLGEG
Sbjct  241   VVLLLVVAAYRVYSSDRKEKENQLKIERFLDDYRALKPSRYAYADIKRITNDFKDKLGEG  300

Query  1069  SYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFH  890
             +YGTVYKG LS ++FVAVKVLN+SKGDG  EEF+ E+ T+G IHH+NV+RLVG+CADGF 
Sbjct  301   AYGTVYKGMLSSELFVAVKVLNSSKGDG--EEFIKEVGTLGHIHHVNVIRLVGFCADGFR  358

Query  889   RALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIK  713
             RALVYE+  N SL+ F+ SP++KN FLGW+K+Q IAL IAKG+EYLHQGCDQRILHFDIK
Sbjct  359   RALVYEFFPNGSLQDFISSPDNKNSFLGWDKMQDIALAIAKGIEYLHQGCDQRILHFDIK  418

Query  712   PRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDV  533
             P NILLD NF PKISDFG AKLCSK++ IVSMTAARGTMGYIAPEVFS NFGNVSYKS V
Sbjct  419   PHNILLDHNFTPKISDFGLAKLCSKDQCIVSMTAARGTMGYIAPEVFSSNFGNVSYKSHV  478

Query  532   YSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKL  353
             YSFGMLLLEMV G+K    + +  TN+ Y+PEWIYN+L  G+++ I I +  + KI KKL
Sbjct  479   YSFGMLLLEMVAGRKNVG-SATENTNEIYYPEWIYNLLEEGDDLCIHIGEEGEGKIPKKL  537

Query  352   TIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALE  173
              IVGLWCIQW+PVDRPS++ V+QMLE  E  ++PPNPF ST  +    +   R     LE
Sbjct  538   AIVGLWCIQWHPVDRPSMRAVVQMLEGGESLTVPPNPFASTGVAGTNGSTAARNLNIQLE  597

Query  172   IISEMD  155
              I E++
Sbjct  598   AIPELE  603



>ref|XP_010662988.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Vitis 
vinifera]
Length=583

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/601 (57%), Positives = 426/601 (71%), Gaps = 41/601 (7%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             C   GP I FPFRLK  QP  CGYPGFEL CT+K +T L+            P+ VK L+
Sbjct  6     CSEQGPLIRFPFRLKD-QPDHCGYPGFELSCTEKKQTVLD-----------LPYSVKLLV  53

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE------NLYNFSIFSCSTHRNITA  1562
             + ID   + I +   D C  + L  L+L+ SPF FE         +F+  +CS ++  +A
Sbjct  54    KKIDYTTQEIRVQDPDNCLPRQLQNLDLAGSPFQFELENSWDYFRDFTFVNCSVNK--SA  111

Query  1561  GSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRW  1382
                N+  I CL+ PG+ +YA  S+  L    DL SC K++++S +PY ++  N  F + W
Sbjct  112   NQYNLRSIPCLSVPGNLVYAILSNADL-GDFDLSSCRKIYNIS-LPYRMS--NNSFPMSW  167

Query  1381  T----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIV  1232
             +          G  CRLK+N+T E   +CI    K           AG ++GSFL+V++V
Sbjct  168   SKSICGKCEAEGKKCRLKSNNT-EPVTECIEK-PKTDXCSXIAFCYAGSIVGSFLLVLVV  225

Query  1231  LVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVY  1052
             +V Y +Y  NK +K+ Q+KIE+FLEDYKALKP+RY+YADIKKIT  F +KLGEG YGTVY
Sbjct  226   IVLYYVYTKNKSRKDHQMKIEKFLEDYKALKPSRYTYADIKKITSHFKDKLGEGGYGTVY  285

Query  1051  KGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYE  872
             KGKLS ++ VAVK+LNN KG+G  EEF+NE+ T+  IHHINVVRLVG+C+DGF RAL+YE
Sbjct  286   KGKLSNEILVAVKILNNFKGNG--EEFINEVGTMDRIHHINVVRLVGFCSDGFRRALIYE  343

Query  871   YLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILL  695
             +L N SLEKF+FS  DKN  LGWEKL+ IALGIAKG+EYLHQGCDQRILHFDIKP NILL
Sbjct  344   FLPNESLEKFIFSAVDKNPLLGWEKLRSIALGIAKGIEYLHQGCDQRILHFDIKPHNILL  403

Query  694   DQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGML  515
             DQNFNPKISDFG AKLCSKE+S VSMTAARGTMGYIAPE+ SRNFGNVSYKSDVYSFGML
Sbjct  404   DQNFNPKISDFGLAKLCSKEQSAVSMTAARGTMGYIAPEMLSRNFGNVSYKSDVYSFGML  463

Query  514   LLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLW  335
             LLEMVGG+K  D+T    +   YFPEW+YN L +G+E++I+IE+  D+KIAKKLTIVGL 
Sbjct  464   LLEMVGGRKNIDVTVENPSGV-YFPEWVYNHLDQGKELQIRIEEEGDAKIAKKLTIVGLR  522

Query  334   CIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEM  158
             CIQWYPVDRP++K V+QMLE E +  +MPPNPF+ST P+   A+ P R     LEIISE+
Sbjct  523   CIQWYPVDRPTMKTVVQMLEGEGDNLTMPPNPFSSTTPTSTTASGPPRPLQQELEIISEL  582

Query  157   D  155
             +
Sbjct  583   E  583



>ref|XP_008363237.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=604

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/605 (52%), Positives = 406/605 (67%), Gaps = 36/605 (6%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             +NEC    CG+ GP I FPFRLK  QP  CGYPGF+L C     T LE P   ++ TL  
Sbjct  22    QNECTESHCGDYGPPIRFPFRLKDKQPSHCGYPGFDLSCDRSNNTVLELP---VSXTLX-  77

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN--LYNFSIFSCSTHR  1574
                    + SI+ + ++I +   D C  + L  LNLS+S F F+     ++++F+CS  +
Sbjct  78    -------VTSINYKSQVIQVFDPDHCVPRXLXKLNLSSSAFIFQEPXQXDYTLFNCSPAK  130

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVS-SVPYSIAQDNTV  1397
                        I CL+   H I++  S  ++  +  L SCTK+++   SVPY I + N  
Sbjct  131   R----DXYYDSIPCLSGTSHHIFSIPSDSFV-DSLPLTSCTKLYNXPFSVPYDIFEPNYF  185

Query  1396  FSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFL  1247
               L W+ P+C          RLKNN+      +C         G ++KL V G VLGSF 
Sbjct  186   LRLEWSKPTCNRCERRGKGCRLKNNNRTNSETEC---FNVKRNGTVKKLVVTGAVLGSFS  242

Query  1246  VVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGS  1067
             +V+I++  +R+Y  ++ +KE Q  IE FLE+Y+AL+P RYSYADIK+IT++F +KLG+G+
Sbjct  243   LVLILVGLHRVYTFDRKEKERQTMIEEFLENYRALRPTRYSYADIKRITNKFRDKLGQGT  302

Query  1066  YGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHR  887
             +GTV+KGKLS ++FVAVK+LNNSKG+G   EF+NE+ T+G IHH+NVVRLVGYCADGF R
Sbjct  303   FGTVFKGKLSSEIFVAVKMLNNSKGNGG--EFINEVGTLGRIHHVNVVRLVGYCADGFRR  360

Query  886   ALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             ALVYE+  N SL+ F+ S + KN FLGWEKLQ I + IAKG+EYLH GCDQRILHFD KP
Sbjct  361   ALVYEFAPNGSLQNFISSADSKNXFLGWEKLQHITIXIAKGIEYLHHGCDQRILHFDXKP  420

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
              N+LLD  FNPKISDFG AKLCSK++S VSMT ARGTMGYIAPEVFSRNFG VSYKSDVY
Sbjct  421   HNVLLDDXFNPKISDFGLAKLCSKDQSAVSMTTARGTMGYIAPEVFSRNFGTVSYKSDVY  480

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             SFGMLLLEMVGGKK   +T    T Q YFPEWIYN+L +G+++ I +E   D+KIA KL 
Sbjct  481   SFGMLLLEMVGGKKNVQVT-EKNTGQVYFPEWIYNLLEQGDDIRIHVEGENDAKIATKLA  539

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEI  170
             IVGLWCIQWYPVDRPS+K V+QMLE E+   +PPNPF+     +       R     L +
Sbjct  540   IVGLWCIQWYPVDRPSMKAVVQMLEGEDNVKLPPNPFSPAGSVRNGITMLARRHRQELPV  599

Query  169   ISEMD  155
             ISE++
Sbjct  600   ISELE  604



>ref|XP_008376284.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=608

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/604 (54%), Positives = 414/604 (69%), Gaps = 38/604 (6%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
              + C   KCG +GP I FPFR+K   P  CGYPGF + C ++ ET LE           P
Sbjct  27    EDACKELKCGWHGPAIHFPFRIKDKHPKHCGYPGFLVSCNERNETVLE----------LP  76

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
               PVKF + SID + + I +   D C  +++L I N+S SPF      N ++F+CS    
Sbjct  77    NIPVKFSVTSIDYKYQEIQLYDPDNCLSVKVLEIQNMSFSPFDIYT-NNITLFNCSL---  132

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFS  1391
             +  GS     + CL+ PGH IYA  SS Y+    +L SC+KM++  SVP+S+ +   ++ 
Sbjct  133   VLEGSSAFD-VPCLSSPGHHIYAFASSYYV---GELQSCSKMYNRLSVPFSVYEPEALW-  187

Query  1390  LRWTGP----------SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVV  1241
             L W+ P          +CRLKNNST  +  +C+  L K       KL V G  LGSF++ 
Sbjct  188   LYWSEPNCAKCEAEGNTCRLKNNSTNSNEIECVLDLKKPSMSKTTKLVVTGASLGSFVLW  247

Query  1240  VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYG  1061
             ++V+  +R+Y  ++ +KE ++KIERFLEDY+ALKP+RYSYADIK+IT++F EKLGEG+YG
Sbjct  248   LLVIAVHRVYSYDRNEKENRLKIERFLEDYRALKPSRYSYADIKRITNQFKEKLGEGAYG  307

Query  1060  TVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRAL  881
              V+KGKLS D FVAVKVLNNSKGDG  EEF+NE+ T+G IHHINVVRLVG+CADGF RAL
Sbjct  308   AVFKGKLSSDFFVAVKVLNNSKGDG--EEFINEVGTMGHIHHINVVRLVGFCADGFRRAL  365

Query  880   VYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRN  704
             VYE+L N SL+ F+ S + K+  L W+KLQ IALGIAKGVEYLHQGCDQRILHFDIKP N
Sbjct  366   VYEFLPNGSLQNFISSADTKDCNLFWDKLQDIALGIAKGVEYLHQGCDQRILHFDIKPHN  425

Query  703   ILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSF  524
             +LLD NF PK+SDFG AKLCSK++SIVSMT ARGTMGYIAPEVFSRNFGNVSYKSDVYSF
Sbjct  426   VLLDNNFTPKLSDFGLAKLCSKDQSIVSMTTARGTMGYIAPEVFSRNFGNVSYKSDVYSF  485

Query  523   GMLLLEMVGGKKKSDITGSPE-TNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTI  347
             GMLLLEMV GK+  DI  + E T++ Y+ E +YN+L  GE+      +G D +I  KL I
Sbjct  486   GMLLLEMVRGKR--DIGATMEKTDEAYYQETVYNLL-EGEDPGGHTGEG-DGEILMKLAI  541

Query  346   VGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEII  167
             +G WCIQW+PVDRPS+KVV+QM E  E  +MPPNPF S   +   A    R     LE I
Sbjct  542   IGFWCIQWHPVDRPSMKVVVQMFEGGENLTMPPNPFASAGSTGINATATSRNLNLQLETI  601

Query  166   SEMD  155
              E++
Sbjct  602   VELE  605



>gb|KDP22160.1| hypothetical protein JCGZ_25991 [Jatropha curcas]
Length=604

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/610 (52%), Positives = 412/610 (68%), Gaps = 43/610 (7%)
 Frame = -2

Query  1939  YSYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNA  1760
             Y    NEC   +CG NGP I FPFRLK+ QP  CG PGF++ CT+  +T ++        
Sbjct  16    YGESINECQESRCGKNGPAIRFPFRLKNRQPDHCGLPGFDVSCTETEDTLID--------  67

Query  1759  TLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSC  1586
                 P  VK  I+ ID   ++I  S  + C  + L   NL  SPF FE  +  ++  F+C
Sbjct  68    ---LPSSVKLYIDKIDYVSQVIYTSDPNNCLPKQLLNFNLVDSPFKFEGSFRSDYVFFNC  124

Query  1585  ST-HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ  1409
             S+  RN+         + CL+ PG+ ++A  +  Y  ++  L SCTKM++VSSVP     
Sbjct  125   SSIDRNLYLS------MPCLSVPGYDVHAFATD-YPVASLALTSCTKMYNVSSVPMDFIS  177

Query  1408  DNTVFSLRWTGPSC----------RLKNNSTAEDADDCI-APLTKLHTGPLRKLKVAGEV  1262
              + V SL W+ P+C          RLK N+ ++   +C   P    + G   KL  AG  
Sbjct  178   RDNVLSLNWSNPACGSCEAQGKYCRLKQNTNSKPKTECFDKPKPSRNIG--MKLMAAGIA  235

Query  1261  LGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
             LG FL+V + LV Y +Y  +K +KE Q ++++FLEDYK LKP RYSY+DIK+IT++F +K
Sbjct  236   LGVFLLVSVGLVFYWLYTSDKAEKENQRRVQKFLEDYKTLKPTRYSYSDIKRITNQFKDK  295

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             LG+G+YGTV+KGKLS ++FVAVK+LNNS G+G  EEF+NE+ T+  I H+NVVR VGYCA
Sbjct  296   LGQGAYGTVFKGKLSNEIFVAVKILNNSTGNG--EEFINEVGTMARIRHVNVVRFVGYCA  353

Query  901   DGFHRALVYEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
             DGF RALVYEYL N SL+KF+FS + K+ LGWEKLQ IALGIA+G+EYLHQGCDQRILHF
Sbjct  354   DGFRRALVYEYLPNESLQKFIFSDHGKDLLGWEKLQDIALGIAEGIEYLHQGCDQRILHF  413

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DIKP NILLD NFNPKISDFG AKLCSK++S +SM+ ARGTMGY+APEVFSRNFGNVSYK
Sbjct  414   DIKPHNILLDDNFNPKISDFGLAKLCSKDQSAISMSTARGTMGYVAPEVFSRNFGNVSYK  473

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIA  362
             SDVYSFGM+LL+MV GKK  +     + N  YFPEW+Y  L +GEE+ IQI++  D +IA
Sbjct  474   SDVYSFGMVLLDMVKGKKNVEFA---DANHVYFPEWVYKCLDQGEELRIQIKEESDEQIA  530

Query  361   KKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFT  185
             KKL IVGLWC+QW+PVDR S+K V+QML+ E    +MPPNPF S   + + AN   R   
Sbjct  531   KKLIIVGLWCVQWHPVDRLSMKAVVQMLKGEGNKLTMPPNPFAS---AVSNANVTRRHLH  587

Query  184   SALEIISEMD  155
               L +I E +
Sbjct  588   QDLAVIPEAE  597



>ref|XP_002266286.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=588

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/610 (53%), Positives = 416/610 (68%), Gaps = 51/610 (8%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++ C   +C ++GP I FPFRLK  QP  CGYPGFE+ CT+K +T +E            
Sbjct  11    QDVCKVSRCSHHGPAIRFPFRLKD-QPHHCGYPGFEISCTEKKQTIVE-----------L  58

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE--NLY---NFSIFSCS  1583
             P+ VK  ++ I+ + + I++   D C  + L    LSA+PF+F+  + Y   +F  F+CS
Sbjct  59    PYSVKLSVKKINYKSQEIVVHDPDFCLQRQLQNFTLSATPFNFKFHSFYFVKDFIFFNCS  118

Query  1582  THRNITAGSINISPIACL-TKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD  1406
             + + +        P + L + P H +  +D+ L      DL SC K+F+VS +P+SI   
Sbjct  119   SSKTMYKNLFWHIPCSFLPSNPVHAV-VSDTDL---DQLDLSSCHKIFNVS-LPFSILYG  173

Query  1405  -NTVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL  1259
                 FS  W+          G  CRLK+N++ E   +C+    K            G +L
Sbjct  174   GENYFSFTWSESICGDCERQGKKCRLKSNTSKEPETECVEKPAK------------GLIL  221

Query  1258  GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
             G FL+V +V+  Y +Y  NK+ +E   KIE+FLEDYKAL P+RYSY DIKKIT+ F +KL
Sbjct  222   GFFLLVFVVITLYYVYNSNKLDRENTRKIEKFLEDYKALNPSRYSYVDIKKITNHFKDKL  281

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             G+G YG+VYKGKLS +V VAVK+LN+SKG+G  EEF+NE+ T+  IHH+NVVRLVG+CAD
Sbjct  282   GQGGYGSVYKGKLSNEVLVAVKILNDSKGNG--EEFINEVGTMSRIHHVNVVRLVGFCAD  339

Query  898   GFHRALVYEYLVNNSLEKFVF-SPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
             G  RAL+YE+L N SLEKF+F +P   + LGWEKLQ IA+GIAKG+EYLHQGC+QRILHF
Sbjct  340   GVKRALIYEFLPNESLEKFIFPTPIKNHSLGWEKLQDIAMGIAKGIEYLHQGCEQRILHF  399

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DIKP NILLDQNFNPKISDFG AKLCSKE+S +SMTAARGTMGYIAPEV SRNFGNVSYK
Sbjct  400   DIKPHNILLDQNFNPKISDFGLAKLCSKEQSAISMTAARGTMGYIAPEVISRNFGNVSYK  459

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIA  362
             SDVYSFGMLLL MVGG+K  D+T    T+Q YFPEW+Y  L + EEV I+IEK  D+KIA
Sbjct  460   SDVYSFGMLLLGMVGGRKNIDVT-VENTSQVYFPEWVYTQLDQREEVHIRIEKEGDTKIA  518

Query  361   KKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFT  185
             KKLTIVGLWCIQWYP+DRPS+KVV+QMLE   +  +MPPNPF S  P+K    +P +   
Sbjct  519   KKLTIVGLWCIQWYPIDRPSMKVVVQMLEGTGDNLTMPPNPFASIGPTKTNIKRPKKSLQ  578

Query  184   SALEIISEMD  155
               L ++ E+D
Sbjct  579   QELTVVPELD  588



>ref|XP_002279967.2| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=597

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/608 (54%), Positives = 415/608 (68%), Gaps = 51/608 (8%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++EC   +C N+GP I FPFRLK  QP  CGYPGFE+ C +K +T LE            
Sbjct  21    QDECKVSRCSNHGPVIRFPFRLKD-QPYNCGYPGFEISCIEKKQTILE-----------L  68

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-----NLYNFSIFSCS  1583
             P+ V   ++ I+   + II+   D C  + L  L+LSASPF F+      L +++ F+CS
Sbjct  69    PYSVSLSVKKINYNSQEIIVHDPDFCLQRQLQNLSLSASPFQFKLASSNYLVDYTFFNCS  128

Query  1582  THRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDN  1403
             + +       +I     L+ P   +YA DS  Y     DL SC K++ V+ +P  +    
Sbjct  129   SKKTHLDYFFSIPCTVLLSNP---VYAVDSD-YNLELLDLSSCHKIYDVT-LPVDMVYGE  183

Query  1402  TVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
               FSL W+          G  CRLK+N   E   DCI              K A  V+ S
Sbjct  184   NYFSLTWSELICGNCEREGKKCRLKSNVGKEPETDCID-------------KPAKAVILS  230

Query  1252  F-LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLG  1076
             F L+V++V+  Y +Y  +K+++E   KIE+FLEDYKALKP+RYSYADIKKIT+ F EKLG
Sbjct  231   FCLLVLVVIALYHVYSSDKLERENTKKIEQFLEDYKALKPSRYSYADIKKITNHFKEKLG  290

Query  1075  EGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADG  896
             +G YGTVYKG+LS DV VAVK+LNNSK +G  EEF+NE++T+G IHH+NVVRLVG+CADG
Sbjct  291   QGGYGTVYKGRLSSDVLVAVKILNNSKENG--EEFINEVATMGRIHHVNVVRLVGFCADG  348

Query  895   FHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFD  719
               RALVYE+L N SLEK++FS + K+  L WEKL+ +ALGIAKG+EYLHQGCD+RILHFD
Sbjct  349   VKRALVYEFLPNESLEKYIFSKSIKDCSLSWEKLRNVALGIAKGIEYLHQGCDKRILHFD  408

Query  718   IKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKS  539
             IKP NILLDQNFNPKISDFG AKLCSKE+S VSMT ARGTMGYIAPEV SRNFGNVSYKS
Sbjct  409   IKPHNILLDQNFNPKISDFGLAKLCSKEQSAVSMTTARGTMGYIAPEVLSRNFGNVSYKS  468

Query  538   DVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAK  359
             D+YSFGMLLLEMVGG+K  D+T   +T+Q YFPEW+YN L +GE+V I+I +  D+KIAK
Sbjct  469   DIYSFGMLLLEMVGGRKNIDVT-MEKTSQVYFPEWVYNQLDQGEDVCIRIVEDGDTKIAK  527

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLE-AEEPPSMPPNPFTSTDPSKAKANKPGRLFTS  182
             KLTIVGLWCIQWYP+DRPS+KVVIQMLE      +MPPNPF S D ++    +  R    
Sbjct  528   KLTIVGLWCIQWYPIDRPSMKVVIQMLEGGGNNLTMPPNPFASIDATRTNTRRRKRSLQQ  587

Query  181   ALEIISEM  158
              L +ISE+
Sbjct  588   ELAVISEL  595



>ref|XP_002263649.2| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=596

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/607 (54%), Positives = 409/607 (67%), Gaps = 50/607 (8%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++EC   +C N+GP I FPFRLK  QP  CGYPGFE+ C +K +T LE            
Sbjct  21    QDECKVSRCSNHGPVIRFPFRLKD-QPYHCGYPGFEISCIEKKQTILE-----------L  68

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-----NLYNFSIFSCS  1583
             P+ V   ++ I+   + II+   D C  + L  L LSASPF F+      L +++ F+CS
Sbjct  69    PYSVSLSVKKINYNSQEIIVHDPDFCLQRQLQNLTLSASPFQFKLASSNYLVDYTFFNCS  128

Query  1582  THRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDN  1403
             + +     S   S I C     + +YA DS   L    DL SC K++ V  +P  I    
Sbjct  129   SEK---THSHYFSSIPCTVLLSNPVYAVDSDNIL-ELLDLSSCHKIYDVI-LPEDIVNGE  183

Query  1402  TVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
               FSL W+          G  CRLK+N   E   +CI              K A  V+ S
Sbjct  184   NYFSLTWSELICGNCEREGKKCRLKSNVGKEPETECID-------------KPAKAVILS  230

Query  1252  FLVVVI-VLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLG  1076
             F ++++ V+  Y +Y  +K+++E   KIE+FLEDYKALKP+RYSYAD+KKIT+ F EKLG
Sbjct  231   FCLLLLLVIRLYHVYSSDKLERESTKKIEQFLEDYKALKPSRYSYADVKKITNHFKEKLG  290

Query  1075  EGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADG  896
             +G YGTVYKG+LS DV VAVK+LNNSK +G  EEF+NE+ T+G IHH+NVVRLVG+CADG
Sbjct  291   QGGYGTVYKGRLSSDVLVAVKILNNSKENG--EEFINEVGTMGRIHHVNVVRLVGFCADG  348

Query  895   FHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFD  719
               RAL+YE+L N SLEK++FS + K+  L WE LQ IALGIAKG+EYLHQGCD+RILHFD
Sbjct  349   VKRALIYEFLPNESLEKYIFSKSVKDCSLRWETLQNIALGIAKGIEYLHQGCDKRILHFD  408

Query  718   IKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKS  539
             IKP NILLDQNFNPKISDFG AKLCSKE+S VSMT ARGTMGYIAPEV SRNFGNVSYKS
Sbjct  409   IKPHNILLDQNFNPKISDFGLAKLCSKEQSAVSMTTARGTMGYIAPEVLSRNFGNVSYKS  468

Query  538   DVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAK  359
             D+YSFGMLLLEMVGG+K  D+T   + NQ YFPEW+YN L +GEEV I+IE+  D KIAK
Sbjct  469   DIYSFGMLLLEMVGGRKNIDVT-MEKANQVYFPEWVYNQLDKGEEVCIRIEEEGDIKIAK  527

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSA  179
             KLTIVGLWCIQW P+DRPSIKVVIQMLE  +  +MPPNPF S D ++    +  +     
Sbjct  528   KLTIVGLWCIQWCPIDRPSIKVVIQMLEGGDKLTMPPNPFDSIDSTRTNIRRRKKSLQQE  587

Query  178   LEIISEM  158
             L +ISE+
Sbjct  588   LAVISEL  594



>ref|XP_002322014.2| hypothetical protein POPTR_0015s01990g [Populus trichocarpa]
 gb|EEF06141.2| hypothetical protein POPTR_0015s01990g [Populus trichocarpa]
Length=604

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/605 (54%), Positives = 410/605 (68%), Gaps = 45/605 (7%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++ C   +C  +GP I FPFR+K  QP  CGYPGF+L CTD+ ET LE            
Sbjct  31    KDMCQEARCKKHGPVIRFPFRIKGKQPDYCGYPGFDLSCTDRKETLLE-----------L  79

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCSTHR  1574
             P  VK  I++ID    LI  +  + C  + L   +LS SPF F  +   +   F+C++ +
Sbjct  80    PTSVKLYIKNIDYASELITATDPENCLPRQLLNFSLSTSPFKFAAQLQRDLDFFNCTSRQ  139

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVF  1394
               +         +CL  PG+ IYA  S   + +  DL SC+KM+++SSVP  +   +   
Sbjct  140   RDS-----YLWTSCLGVPGYDIYAFMSG-SIVTYFDLTSCSKMYNLSSVPDDLNSWDNTL  193

Query  1393  SLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLV  1244
              L W+ P+C          RLKNN+   + +    P +   T            +GS ++
Sbjct  194   HLNWSRPACGLCGALGKFCRLKNNTDMIETECYDKPKSNEVT-----------TVGSAIL  242

Query  1243  VVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSY  1064
             ++IV   YR+Y  +K  K+ Q +IE FL DYKALKPARY+YADIK+IT+ F EKLG+G+Y
Sbjct  243   LLIVFALYRVYSSDKAAKQHQKRIEFFLADYKALKPARYTYADIKRITNDFKEKLGQGAY  302

Query  1063  GTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRA  884
             GTV+KGKLS ++FVAVK+LNNS G+G  EEFVNE+ T+G IHH+N+VRLVGYCADGF RA
Sbjct  303   GTVFKGKLSNEIFVAVKILNNSTGNG--EEFVNEVGTMGRIHHVNIVRLVGYCADGFRRA  360

Query  883   LVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPR  707
             LVY+YL N SLEKFV S + K   L WEKLQ IALGIAKG+EYLHQGCDQRILHFDIKP 
Sbjct  361   LVYDYLPNESLEKFVSSEHGKTCPLSWEKLQDIALGIAKGIEYLHQGCDQRILHFDIKPH  420

Query  706   NILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYS  527
             NILLD NF+PKISDFG AKLCSK++S VSMT ARGTMGYIAPEVFSRNFGNVS KSDVYS
Sbjct  421   NILLDDNFSPKISDFGLAKLCSKDQSAVSMTTARGTMGYIAPEVFSRNFGNVSSKSDVYS  480

Query  526   FGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTI  347
             +GM+LLEMVGG+K  D      T Q YFPEW+YN L  GEE+ I+IEK  D++IAKKLTI
Sbjct  481   YGMVLLEMVGGRKIVDNEVENHT-QIYFPEWVYNSLDNGEELIIRIEKEGDAQIAKKLTI  539

Query  346   VGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEI  170
             VGLWCIQW+PV+RPS+  V+QMLE E +  +MPP+PF+S  P + K++ PGR     LE+
Sbjct  540   VGLWCIQWHPVERPSMNTVVQMLEGEGDKLTMPPSPFSSAGPGRMKSHLPGRPLHQILEV  599

Query  169   ISEMD  155
             ISE D
Sbjct  600   ISEKD  604



>ref|XP_011003874.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Populus euphratica]
Length=613

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/605 (53%), Positives = 410/605 (68%), Gaps = 36/605 (6%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++ C   +C  +GP I FPFR+K  QP  CGYPGF+L CTD+ ET LE            
Sbjct  31    KDMCQEARCKKHGPVIRFPFRIKGKQPDYCGYPGFDLSCTDRKETLLE-----------L  79

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCSTHR  1574
             P  VK  I++ID    LI  +  + C  + L   +LS S F F      +   F+C++ +
Sbjct  80    PTSVKLYIKNIDYASELITATDPENCLPRQLLNFSLSTSAFKFAAWLQRDLDFFNCTSRQ  139

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVF  1394
               +         +CL  PG+ IYA  S   + +  DL SC+KM+ +SSVP  +   + + 
Sbjct  140   RDS-----YLWTSCLGVPGYDIYAFTSG-SIVTYFDLTSCSKMYSLSSVPDDLNSRDNIL  193

Query  1393  SLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLV  1244
              L W+ P+C          RLKNN+   + +    P  K + G ++K+  A   +GS ++
Sbjct  194   HLNWSRPACGLCGALGKFCRLKNNTDRIETECYDKP--KSNEGIIKKIVAAVTTVGSAIL  251

Query  1243  VVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSY  1064
             ++IV   YR+Y  +K  K+ Q +IE FL DYKALKPARY+YADIK+IT+ F EKLG+G+Y
Sbjct  252   LLIVFALYRVYSSDKAAKQHQKRIENFLADYKALKPARYTYADIKRITNDFKEKLGQGAY  311

Query  1063  GTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRA  884
             GTV+KGKLS ++FVAVK+LNNS G+G  EEFVNE+ T+G IHH+N+VRLVGYCADGF RA
Sbjct  312   GTVFKGKLSNEIFVAVKILNNSTGNG--EEFVNEVGTMGRIHHVNIVRLVGYCADGFRRA  369

Query  883   LVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPR  707
             LVY+YL N SLEKFV S + K   L WEKLQ IALGIAKG+EYLHQGCDQRILHFDIKP 
Sbjct  370   LVYDYLPNESLEKFVSSEHGKTCPLSWEKLQDIALGIAKGIEYLHQGCDQRILHFDIKPH  429

Query  706   NILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYS  527
             NILLD NF+PKISDFG AKLCSK++S VSMT ARGTMGYIAPEVFSRNFGNVS KSDVYS
Sbjct  430   NILLDDNFSPKISDFGLAKLCSKDQSAVSMTTARGTMGYIAPEVFSRNFGNVSSKSDVYS  489

Query  526   FGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTI  347
             +GM+LLEMVGG+K  D      T Q YFP W+YN L  GEE+ I+IEK  D++IAKKLTI
Sbjct  490   YGMVLLEMVGGRKTVDKEVENNT-QIYFPGWVYNSLDNGEELIIRIEKEGDAQIAKKLTI  548

Query  346   VGLWCIQWYPVDRPSIKVVIQMLE-AEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEI  170
             VGLWCIQW+PV+RPS+  V+QMLE   +  +MPP+P +S    + K++ PGR     LE+
Sbjct  549   VGLWCIQWHPVERPSMTTVVQMLEGGGDKLTMPPSPLSSAGQGRMKSHLPGRPLHQILEV  608

Query  169   ISEMD  155
             ISE +
Sbjct  609   ISETN  613



>ref|XP_009765439.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Nicotiana 
sylvestris]
 ref|XP_009765440.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Nicotiana 
sylvestris]
 ref|XP_009765441.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Nicotiana 
sylvestris]
 ref|XP_009765442.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Nicotiana 
sylvestris]
Length=633

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/608 (53%), Positives = 422/608 (69%), Gaps = 38/608 (6%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNA--TL  1754
             +++CLP +CG+ GP I FPFRLK+ QP  CGYPGFEL CT    +     FPL  +   +
Sbjct  28    QDQCLPTRCGDFGPVIRFPFRLKNRQPTNCGYPGFELSCTKDNVSQFMLQFPLQASIKNI  87

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDG-CFLQLLPILNLSASPFSFE-NLYN-FSIFSCS  1583
               P      ++ ID   + I +S ++  C  + +  +N SAS F+F+ N Y  F++F+CS
Sbjct  88    VIPISANVSVQEIDYNSQTIRLSELNASCLPRQISNINSSASLFTFDPNSYGGFTLFNCS  147

Query  1582  THRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDL-ISCTKMFHVSSVPYSIAQD  1406
             +++  +  S  I+   CL+ P + + A  S    YS +    SCTKM+++S VP  +   
Sbjct  148   SNKEYSTSSDRIN---CLSGPHYDVLAFRS---YYSISQFPSSCTKMYNISDVPNEVLFG  201

Query  1405  NTVFS-----LRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVA  1271
                +S     L W+          G  C+LK+N +  + +    P      GP +K+ VA
Sbjct  202   RPEYSPTQIYLHWSEPFCGNCEADGKYCKLKSNGSGSETECADIP----SKGPSKKVIVA  257

Query  1270  GEVLGS-FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDR  1094
               VLGS F   +I+LV Y+I +L K+KKE+Q +IERFLEDYKAL+P RYSYADIKKIT++
Sbjct  258   -SVLGSVFAFALIILVVYKIVKL-KIKKEDQKRIERFLEDYKALRPTRYSYADIKKITEQ  315

Query  1093  FSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLV  914
             F  KLG+G YG VYKGKL+ ++ VA+KVLNN KGDG  E+F+NE+ +IG IHH+NVVRLV
Sbjct  316   FKYKLGQGGYGKVYKGKLTNEILVAIKVLNNFKGDG--EDFINEVGSIGRIHHVNVVRLV  373

Query  913   GYCADGFHRALVYEYLVNNSLEKFVFSPNDK-NFLGWEKLQQIALGIAKGVEYLHQGCDQ  737
             GYCADG+ RALVYEYL N++L+K + S N + + L WEK+QQIA+GIAKG+EYLHQGC+Q
Sbjct  374   GYCADGYRRALVYEYLQNDTLQKIISSGNGRGSSLCWEKMQQIAVGIAKGIEYLHQGCNQ  433

Query  736   RILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFG  557
             RI+HFDIKP NILLDQ+FNPK++DFG AKLCSKE+S VSMTAARGT+GYIAPEVFSRN+G
Sbjct  434   RIVHFDIKPHNILLDQDFNPKVADFGLAKLCSKEQSAVSMTAARGTIGYIAPEVFSRNYG  493

Query  556   NVSYKSDVYSFGMLLLEMVGGKKKSDITGSP-ETNQDYFPEWIYNILSRGEEVEIQIEKG  380
             NVSYK+D+YSFGMLLL+M+GG+KK D       ++Q Y+PEW+Y  L +GEE+EIQI+  
Sbjct  494   NVSYKADIYSFGMLLLDMIGGRKKFDAANEENSSSQIYYPEWMYKQLEKGEEIEIQIDNE  553

Query  379   EDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKP  200
             +DS I KKL IVGLWCIQWYP DRPS+KVVIQMLE E  P MPPNPF S +    +    
Sbjct  554   DDSSIIKKLAIVGLWCIQWYPADRPSMKVVIQMLEGEGCPIMPPNPFGSLNSPNKRTTAE  613

Query  199   GRLFTSAL  176
             G  F+S L
Sbjct  614   GSQFSSEL  621



>ref|XP_002275176.2| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=604

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/612 (54%), Positives = 419/612 (68%), Gaps = 56/612 (9%)
 Frame = -2

Query  1930  DRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             +++EC    C  +GP I FPFR K  QP  CGY GFE+ CT+K +T LE           
Sbjct  27    NQDECKVPSCSPHGPAIKFPFRRKD-QPYHCGYLGFEISCTEKKQTILE-----------  74

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-NLYNF-------SI  1595
              P+ VK  ++ I+ + R I++   D C  + L  L LSASPF F+ +  NF       + 
Sbjct  75    LPYSVKLSVDKINYKSREIVVHDPDFCLQRQLQNLTLSASPFQFKVDSSNFESWTDDYTF  134

Query  1594  FSCSTHRNITAGSINISPIACLTKPGHF--IYAADSSLYLYSATDLISCTKMFHVSSVPY  1421
             FSCS+  +        + I C ++  H   +YA  S + L    DL SC K++++S +P 
Sbjct  135   FSCSS--DTREYEFPFTLIPCRSRFLHENPVYAVRSFMQL-DWLDLSSCHKLYNLS-LPD  190

Query  1420  SIAQDNTVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVA  1271
              I  D   FSL W+          G  CRLK+NS   + + CI              +V 
Sbjct  191   GIV-DGKKFSLTWSESICGNCEKAGQKCRLKSNSKGPETE-CIPK------------QVK  236

Query  1270  GEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRF  1091
             G +LG F++V ++++ +R+YR N+ K+E  V+IE+FLEDYKALKP+RYSY DIKK+T+ F
Sbjct  237   GVILGFFVLVFVIIILHRVYRSNESKRENIVRIEKFLEDYKALKPSRYSYNDIKKLTNHF  296

Query  1090  SEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVG  911
              +KLG+G YGTVYKGKLS +V VA+K+LN+SKG+G  EEF+NE+ TIG IHH+NVVRLVG
Sbjct  297   KDKLGQGGYGTVYKGKLSNEVLVAIKILNDSKGNG--EEFINEVGTIGRIHHVNVVRLVG  354

Query  910   YCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQR  734
             +CADG  RAL+YE+L N SLEKF+FS + + + LGWEKLQ IA+GIAKG+EYLHQGCDQR
Sbjct  355   FCADGVKRALIYEFLPNESLEKFIFSTSVETYSLGWEKLQDIAIGIAKGIEYLHQGCDQR  414

Query  733   ILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGN  554
             ILHFDIKP NILLD+NFNPKISDFG AKLCSK++S VSMT ARGTMGYIAPEV SRNFGN
Sbjct  415   ILHFDIKPHNILLDENFNPKISDFGLAKLCSKDQSAVSMTVARGTMGYIAPEVLSRNFGN  474

Query  553   VSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGED  374
              SYKSDVYSFGMLLLEMVGG+K  D+T   ETNQ YFPEW+YN L +GE+V I+IE+  D
Sbjct  475   ASYKSDVYSFGMLLLEMVGGRKNIDVT--METNQVYFPEWVYNQLDQGEDVHIRIEEEGD  532

Query  373   SKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPG  197
              KIAKKLTIVGLWCIQWYP+DRPS+KVV+QMLE E +  ++PPNPF S   +     +  
Sbjct  533   IKIAKKLTIVGLWCIQWYPIDRPSMKVVVQMLEREGDNLTIPPNPFASIGSTGGNIRRRK  592

Query  196   RLFTSALEIISE  161
             +     L IISE
Sbjct  593   KSLQQELTIISE  604



>ref|XP_004298576.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=601

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/599 (53%), Positives = 409/599 (68%), Gaps = 41/599 (7%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CG +GP I FPF  K   P   GYPGF + C +K ET LE            P PVKF I
Sbjct  28    CGKHGPVIKFPFTFKGSYPENPGYPGFLVSCNEKKETVLE-----------LPIPVKFAI  76

Query  1723  ESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFE--NLYNFSIFSCSTHRNITAGSI  1553
             ++ID E + I +   + C L  L  + ++S  PF +    + N ++F+CS+    +  S 
Sbjct  77    KTIDYEAQRIQLYDPEYCLLANLSKVHDMSIFPFQYSEYQMTNITLFNCSSAERESPASW  136

Query  1552  NISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTGP  1373
               S      +PG+ IY A SS  +     L+SCTKM  +SSVPY      +   L W+ P
Sbjct  137   LYSVPCFEERPGYQIYWASSSRSI-EYLPLLSCTKMRTLSSVPYW-----SELYLEWSEP  190

Query  1372  SCRL----------KNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVT  1223
             +C L          KNN T     +C+ P+ K  +G  + L   G  LGSF++V++    
Sbjct  191   NCTLCEAQGNICGLKNNGTTSTEIECL-PMKKGGSG--KTLLATGTSLGSFVLVLLAGAA  247

Query  1222  YRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGK  1043
             +  Y  ++ +K+ Q+KIERFLEDY+ALKP+RYSY+DIK+ITD+F +KLG+G+YGTVYKG+
Sbjct  248   FHAYSSDRKEKQNQLKIERFLEDYRALKPSRYSYSDIKRITDQFKDKLGQGAYGTVYKGE  307

Query  1042  LSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLV  863
             LS + FVAVKVL ++KGDG  EEFVNE+ T+G IHH+NVVRLVG+CADGF RALVY++L 
Sbjct  308   LSSECFVAVKVLTSTKGDG--EEFVNEVGTMGHIHHVNVVRLVGFCADGFRRALVYDFLP  365

Query  862   NNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQN  686
             N SL+ F+ S ++ N FLGW+KLQ IALGIAKG+EYLHQGCDQRILHFDIKP N+LLD N
Sbjct  366   NGSLQDFISSADNNNSFLGWDKLQDIALGIAKGIEYLHQGCDQRILHFDIKPHNVLLDHN  425

Query  685   FNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLE  506
             F PKISDFG AKLCSK++SIVSMT ARGTMGYIAPEVFSRNFGNVSYKSDVYS+GM+LLE
Sbjct  426   FTPKISDFGLAKLCSKDQSIVSMTTARGTMGYIAPEVFSRNFGNVSYKSDVYSYGMVLLE  485

Query  505   MVGGKKK--SDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWC  332
             MVGG+K   S    +PE    Y+PEWIYN+L  GE++ I + +  D+KIAK+L IVGLWC
Sbjct  486   MVGGRKNISSTTENAPEV---YYPEWIYNLLEEGEDLRIHVGEEADAKIAKRLAIVGLWC  542

Query  331   IQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             IQW+PVDRPS+K V+QMLE  E  +MPPNPF S  P+   A+ P R     LE I+E++
Sbjct  543   IQWHPVDRPSMKGVVQMLEGGENLTMPPNPFASQGPAGTSASTPARRLNLQLEPIAELE  601



>ref|XP_011001896.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Populus euphratica]
Length=595

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/602 (54%), Positives = 414/602 (69%), Gaps = 52/602 (9%)
 Frame = -2

Query  1906  KCGNNGPEISFPFRLKHIQPPECGY-PGFELLCTDKGETALENPFPLLNATLQPPFPVKF  1730
             KC  +GP I FPFRL   Q  +CGY P F L C ++ ET            LQ P  V  
Sbjct  28    KCKKHGPAIRFPFRLDK-QTEDCGYDPRFVLSCNERNET-----------LLQLPSSVTL  75

Query  1729  LIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCSTHRNITAGS  1556
              I+ ID + RLII +  D CF + L   +LS SPF F   Y  ++++F+C++    + G 
Sbjct  76    NIKKIDYKLRLIIAADPDNCFQRQLRNFSLSKSPFKFAGQYRDDYALFNCTSKNGDSYGR  135

Query  1555  INISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTG  1376
             I      CL  PG+ IYA  S+ ++   TDL SCTKM++V+S+P  +   + +  L W+ 
Sbjct  136   I-----PCLGVPGYDIYAYSSNDFI-GDTDLTSCTKMYNVTSIPSEMIDGDNILHLNWSE  189

Query  1375  PS-----------CRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEV--LGSFLVVVI  1235
             P+           C  K N+T            KL T   +K K + EV  +GS LV+++
Sbjct  190   PAACVGCEEQGKLCGWKTNNT------------KLKTECYKKPK-SNEVATVGSVLVLLV  236

Query  1234  VLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTV  1055
             +   YR+Y  +K  K  Q +IE FL DYKALKPARY+YADIK+ITD F +KLG+G+YGTV
Sbjct  237   LFAAYRVYSSDKAAKNNQKRIENFLADYKALKPARYTYADIKRITDEFKDKLGQGAYGTV  296

Query  1054  YKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVY  875
             +KGKLS ++FVAVK+LNNS G+G  EEF+NE++T+G IHH+NV+RLVGYCADGF RALVY
Sbjct  297   FKGKLSDEIFVAVKILNNSTGNG--EEFINEVATMGKIHHVNVIRLVGYCADGFRRALVY  354

Query  874   EYLVNNSLEKFVFSPN-DKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
             +YL N SLEKFV S + + + L WE+LQ IALG+AKG+EYLHQGCDQRILHFDIKP NIL
Sbjct  355   DYLPNESLEKFVSSEHGETSSLSWERLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNIL  414

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LD +FNPKISDFG AKLCSK++S VSMT ARGTMGYIAPEVFSRNFG VSYKSDVYSFGM
Sbjct  415   LDDHFNPKISDFGLAKLCSKDQSAVSMTTARGTMGYIAPEVFSRNFGLVSYKSDVYSFGM  474

Query  517   LLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGL  338
             +LLEMVGG+K  D      +NQ YFPEW YN L +GEE+ I+IEK  D++IAKKLT+VGL
Sbjct  475   VLLEMVGGRKTID-DKLENSNQIYFPEWAYNSLDKGEELRIRIEKEGDAQIAKKLTLVGL  533

Query  337   WCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISE  161
             WCIQW+PVDRPS+  V+QMLE E +  ++PP+PF S  P +  AN PGR    ALE+ISE
Sbjct  534   WCIQWHPVDRPSMNTVVQMLEGEGDKLTVPPSPFASAGPGRMHANMPGRPHYQALEVISE  593

Query  160   MD  155
              +
Sbjct  594   TE  595



>ref|XP_002513559.1| receptor serine/threonine kinase, putative [Ricinus communis]
 gb|EEF48962.1| receptor serine/threonine kinase, putative [Ricinus communis]
Length=605

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/601 (53%), Positives = 407/601 (68%), Gaps = 40/601 (7%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             C   KC  +GP I FPF +K     +CGYPGF + CT   ET LE            PF 
Sbjct  32    CPEMKCNRHGPPIKFPFSIKGSHQADCGYPGFYVSCTSTNETLLE-----------LPFS  80

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCSTHRNIT  1565
             VK  I  I+ + + + +    GC  + L  LNLSASPF F + Y  +F++FSCS    ++
Sbjct  81    VKLFISKINYKSQKLHVYEPTGCLSKHLRNLNLSASPFQFGDKYLDDFTVFSCSIGEFVS  140

Query  1564  AGSINISPIACLTK-PGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSL  1388
                  I  ++C+   P   I A  S   +     L+SCTK+++VSSVP+++         
Sbjct  141   WSEGYI--LSCVNNSPDRGIIAFYSRRSINYMPSLLSCTKLYNVSSVPHNMLFPERKIIF  198

Query  1387  RWTGPSCR---------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVI  1235
             +W+ P+CR           N ++ +   +C+  L K H G          VLGSF + ++
Sbjct  199   KWSTPNCRKCEAEGKLCRLNETSLQSETECLNIL-KQHKGA---------VLGSFFLGLV  248

Query  1234  VLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTV  1055
             + V Y  YRL+K +KE Q +I  FLEDYKALKP RYSYADIK+IT+ F E+LG+G+YGTV
Sbjct  249   IAV-YHFYRLDKTEKENQKRIRIFLEDYKALKPTRYSYADIKRITNEFMEQLGQGTYGTV  307

Query  1054  YKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVY  875
             YKGKLS ++ VAVKVLNNS G+G+  EF+NE+ST+G IHH+NVVRLVGYCADGF RALVY
Sbjct  308   YKGKLSNEILVAVKVLNNSIGNGN--EFINEVSTMGRIHHVNVVRLVGYCADGFRRALVY  365

Query  874   EYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
             EYL  NSL+K++ S + KN FLGW+KLQ IA+GIAKG+EYLHQGCDQRILHFDIKP NIL
Sbjct  366   EYLPRNSLQKYISSADTKNHFLGWKKLQDIAVGIAKGIEYLHQGCDQRILHFDIKPHNIL  425

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LD N+NPKISDFG AKLCSK++S VSMTAARGTMGYIAPEVFSRNFGNVS+KSDVYSFGM
Sbjct  426   LDDNWNPKISDFGTAKLCSKDQSAVSMTAARGTMGYIAPEVFSRNFGNVSHKSDVYSFGM  485

Query  517   LLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGL  338
             L+LEMVGG+K  ++T      Q YFPEWIYN+L  GE++ + IE+  D+ IAKKL IVGL
Sbjct  486   LVLEMVGGRKNVEVT-LENACQVYFPEWIYNLLEHGEDLRLHIEEEGDANIAKKLAIVGL  544

Query  337   WCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEM  158
              CIQW+PVDRPS+  V++MLE EE  ++PPNPF ST   +      GR     LE+I E+
Sbjct  545   RCIQWHPVDRPSMNFVVEMLEGEENLTIPPNPFASTGSGRTYTAPAGRRRHQELEVIQEL  604

Query  157   D  155
             +
Sbjct  605   E  605



>ref|XP_007039002.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY23503.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=631

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/618 (53%), Positives = 416/618 (67%), Gaps = 49/618 (8%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYP--GFELLCTDKGETALENPFPLLNATL  1754
             ++EC    C ++ P + FPFRL+  QPP CGYP  GF+L C++  +T L  P  +     
Sbjct  36    QDECKVTNCKHHEPPVKFPFRLQDRQPPHCGYPHPGFQLSCSENNQTVLNFPRSM-----  90

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENL-YN---------  1604
                   K L++ ID +++ I +     C  + L  LN+SA PF +E L Y+         
Sbjct  91    ------KLLVKHIDYKEQQIRLYDPGHCLWKQLSDLNISAFPFRYEWLSYSRLQAFQPKP  144

Query  1603  ---FSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVS  1433
                +++F+CS+          I    CL+  G  I A       Y   +L++C+K  ++S
Sbjct  145   VDFYTLFNCSSKDEFLYRRYRI---PCLSNTGSQIIAFGYDEQAYDE-NLLNCSKTGNIS  200

Query  1432  SVPYSIAQDNTVFSLRWTGPSCR----------LKNNSTAEDADDCIAPLTKLHTGPLRK  1283
             +  Y        F L W  P+CR          LK+NS  +D  +C   + + H G  ++
Sbjct  201   AAIYPYL--TGPFQLLWDKPNCRNCEAQGRGCKLKSNSR-QDQTECFD-IPRHHRGARKR  256

Query  1282  LKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKI  1103
             L +AG +LGSF++  IV+     +RL K ++E Q+KIE+FLEDY+A+KP+RYSYADIK+I
Sbjct  257   LIIAGVILGSFILATIVIGVGWAHRLKKREQESQLKIEKFLEDYRAVKPSRYSYADIKRI  316

Query  1102  TDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVV  923
             T+ F +KLG+G YGTV+KG+LS DV VAVKVLNN KG+G  EEF+NE+ ++G IHH+NV 
Sbjct  317   TNHFKDKLGQGGYGTVFKGRLSNDVLVAVKVLNNFKGNG--EEFINEVGSMGRIHHVNVT  374

Query  922   RLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQG  746
             RLVG+CADG+ RALVYEYL N SLEKF+FS   +N FL WEKLQ IALG+AKG+EYLHQG
Sbjct  375   RLVGFCADGYERALVYEYLPNESLEKFIFSATGENRFLSWEKLQDIALGVAKGIEYLHQG  434

Query  745   CDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSR  566
             C+QRILHFDIKP NILLDQNFNPKISDFG AKLCSKE+S +SMT ARGTMGYIAPEV SR
Sbjct  435   CEQRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQSAISMTTARGTMGYIAPEVLSR  494

Query  565   NFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIE  386
             NFGNVSYKSDVYSFGMLLLEMVGG+K  D+T    T+Q YFPEW YN L +GEE+ I+IE
Sbjct  495   NFGNVSYKSDVYSFGMLLLEMVGGRKNIDVTAE-NTSQVYFPEWAYNRLDKGEELGIRIE  553

Query  385   KGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEP-PSMPPNPFTSTDPSKAKA  209
               E + I KKLTIVGLWCIQWYPVDRP +KVV+QMLE E    ++PPNPF STD SK  A
Sbjct  554   DEEHTGIVKKLTIVGLWCIQWYPVDRPPMKVVVQMLEGEGSLLTVPPNPFASTDQSKMGA  613

Query  208   NKPGRLFTSALEIISEMD  155
             N P +     L  I+E++
Sbjct  614   NMPRKPVNRELPAIAELE  631



>ref|XP_009335120.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=598

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/611 (51%), Positives = 400/611 (65%), Gaps = 56/611 (9%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             +N C   KCG+ GP + FPF LK   P  CGYPGF + C +K ET LE            
Sbjct  24    QNGCKELKCGDQGPPVRFPFILKDRHPDNCGYPGFVVSCNEKQETVLE-----------L  72

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFENLY--NFSIFSCS--  1583
             P P KF ++ ID + + + +   D C L ++  ILN S SPF F   +  N ++F CS  
Sbjct  73    PIPAKFSVKIIDYKYQEVHLYDSDNCLLVKVSEILNSSISPFHFSEEFQDNLALFKCSLG  132

Query  1582  ----THRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSI  1415
                  H ++  G        CLT PGH +YA D +   Y   +L SCTK+ +V SVP S 
Sbjct  133   LERRQHVHVLNG-------PCLTSPGHHVYAVDPN---YEIDNLQSCTKIRNVLSVPSSG  182

Query  1414  AQDNTVFSLRWTGPSCR----------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGE  1265
                     L+W+ P C           +KNN    + + C+     L      K+     
Sbjct  183   V-------LKWSKPHCTECEAGGKRCIMKNNGNKSEIE-CV----NLTKSEANKVVATSA  230

Query  1264  VLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSE  1085
              LGSF   ++V+  Y+++  +  +KE Q+KI RFL+DYKA KP+RYSYADIK+IT++F +
Sbjct  231   TLGSFTFFLLVVAVYQVHYYDTKEKENQIKIRRFLQDYKAHKPSRYSYADIKRITNQFQD  290

Query  1084  KLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYC  905
             KLG+G+ GTV+KGKLS +  VAVKVLN+S  +G+GE+FV E+ T+G IHH+NVVRLVG+C
Sbjct  291   KLGQGACGTVFKGKLSSECIVAVKVLNSS--NGNGEDFVTEVGTMGRIHHVNVVRLVGFC  348

Query  904   ADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRIL  728
             ADGF+RALVYE+  N SL  F+ S ++ N FLGW+KLQ IAL +AKGV+YLHQGCDQRIL
Sbjct  349   ADGFNRALVYEFFANGSLHDFISSADNNNRFLGWDKLQDIALAVAKGVQYLHQGCDQRIL  408

Query  727   HFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVS  548
             HFDIKP N+LLD NF PKISDFG AKLCSK++SIVSMT  RGTMGYIAPEVFSRNFGNVS
Sbjct  409   HFDIKPHNVLLDDNFTPKISDFGMAKLCSKDQSIVSMTTTRGTMGYIAPEVFSRNFGNVS  468

Query  547   YKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSK  368
             YKSDVYSFGMLLLEMVGG+K  D T S  TN+ Y+PEWIYN+L  G+++ I + +  D K
Sbjct  469   YKSDVYSFGMLLLEMVGGRKNIDST-SENTNEIYYPEWIYNLLEEGDDLRIHLGEEGDGK  527

Query  367   IAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLF  188
               KKL IVGLWCIQW+P  RPS+  V+QMLE  E  +MPPNPF ST P++  A  P R  
Sbjct  528   APKKLAIVGLWCIQWHPAGRPSMNKVVQMLEGGENLTMPPNPFASTGPARTNATAPARNL  587

Query  187   TSALEIISEMD  155
                LE I+E++
Sbjct  588   NIQLETIAELE  598



>gb|KDP22153.1| hypothetical protein JCGZ_25984 [Jatropha curcas]
Length=595

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/607 (53%), Positives = 402/607 (66%), Gaps = 45/607 (7%)
 Frame = -2

Query  1930  DRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             D N C P +CG  GP + FPFRL+  QP  CGYPGFEL C +   T            LQ
Sbjct  19    DLNLCRPERCGR-GPIVRFPFRLREKQPEHCGYPGFELSCKEDEHT-----------ELQ  66

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY---NFSIFSCST  1580
              P  VK  I++ID   + +  S    CF +     +L    F F   Y   N+++F+CS 
Sbjct  67    LPNSVKLYIQTIDYVAQELSASDPSECFARNAKAFHLYTHNFEFPRAYSIDNYALFNCSL  126

Query  1579  HRNITAGSINISPIACLTKPGHF---IYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ  1409
                 ++       ++CL  PG +    +AAD+ +       L SC KM+++SSVP  I  
Sbjct  127   GNRYSS-----DLVSCLGVPGSYEVYAFAADNRI---DDLPLTSCRKMYNISSVPSEIFD  178

Query  1408  DNTVFSLRWTGP-----SCRLKNNSTAEDADDCIAPLTKLHT---GPLRKLKVAGEVLGS  1253
             +    +L W+       SC ++        D  IA     H    G L K K+A EVLG 
Sbjct  179   NTNSITLTWSKKMSKCRSCEIQGGCCGW-KDKNIACFDNFHNRKLGTLSKTKIACEVLGP  237

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             FL+V+     + +Y  N+ +KE    +E+FLEDY+ALKP RYS+AD+K+IT++F +KLG+
Sbjct  238   FLLVLAAASLFHVYWTNRKEKE---YLEKFLEDYRALKPTRYSFADLKRITNQFKDKLGQ  294

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             GSYGTV+KGK+S +++VA+K+LNNS G+G  EEF+NE+ T+G IHH+NVVRLVG+CADGF
Sbjct  295   GSYGTVFKGKISNEIYVAIKILNNSIGNG--EEFINEVGTMGRIHHVNVVRLVGFCADGF  352

Query  892   HRALVYEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIK  713
              RALVYE+L N SLEKF+FS     FLGWEKL++IALGIA+G+EYLHQGCDQRILHFDIK
Sbjct  353   KRALVYEFLPNESLEKFIFS---SKFLGWEKLEEIALGIARGIEYLHQGCDQRILHFDIK  409

Query  712   PRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDV  533
             P NILLD NFNPK+SDFG AKLCS  +S VSMTAARGTMGYIAPEVFSRNFGNVSYKSDV
Sbjct  410   PHNILLDDNFNPKVSDFGLAKLCSLGQSSVSMTAARGTMGYIAPEVFSRNFGNVSYKSDV  469

Query  532   YSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKL  353
             YSFGM+L EMVGG+K  D     ++ Q +FPEWIYN L +GEE+ I+ E+  DSKIAKKL
Sbjct  470   YSFGMVLFEMVGGRKNIDANAENDS-QVFFPEWIYNQLEKGEELRIRNEEQGDSKIAKKL  528

Query  352   TIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSAL  176
             T V LWCIQWYPVDRPSIK V+QMLE E E   MPPNPF S   +K      GR     L
Sbjct  529   TTVALWCIQWYPVDRPSIKRVVQMLEGERENIPMPPNPFASAGSAKMNVGTRGRRIHQEL  588

Query  175   EIISEMD  155
             E+ISE++
Sbjct  589   EVISEVE  595



>ref|XP_010663016.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=602

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/585 (55%), Positives = 398/585 (68%), Gaps = 59/585 (10%)
 Frame = -2

Query  1945  YGYSYDRNECLPRK-CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPL  1769
             +G    +++C  R  C   GP + FPFRLK  QP  CGYPGFEL C  K +T L      
Sbjct  56    WGIGASQDDCQVRSSCSEQGPLVQFPFRLKD-QPHSCGYPGFELACVQKKQTML------  108

Query  1768  LNATLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF----------  1619
                 L+ P  VK +++ I+ + + I++   D C  + L  LN +AS F F          
Sbjct  109   --TMLELPNSVKLMVKKINYKSQEIVVQDPDNCLSRQLLNLNPNASLFRFKLENNFPRKD  166

Query  1618  -ENLYNFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMF  1442
              E + +F+IF+CS+ +     S    PI C    G+ +YA  SS  L+S  DL SC  ++
Sbjct  167   KEVVQDFTIFNCSSPKE---ESDYFQPIRCAV--GNSVYAVPSSSNLHS-LDLFSCHGIY  220

Query  1441  HVSSVPYSIAQDNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEV  1262
               + +PY I    + F++ W    C           ++C A                G +
Sbjct  221   R-AYLPYEILVGESDFTMTWEKSIC-----------ENCGA---------------QGII  253

Query  1261  LGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
              G F+++++++  Y +YR NK KKE Q+KIE FLEDYKALKP+RYSY DIKKIT++F EK
Sbjct  254   FGFFILMLVLVAVYHVYRRNKSKKENQIKIESFLEDYKALKPSRYSYVDIKKITNKFKEK  313

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             LGEG YGTVYKGKLS D+ VAVKVLNNSKG+G  EEF+NE+ T+G IHHINVVRLVG+CA
Sbjct  314   LGEGGYGTVYKGKLSNDILVAVKVLNNSKGNG--EEFINEVGTMGRIHHINVVRLVGFCA  371

Query  901   DGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILH  725
             DG  RAL+YE+L N SLEKF+FS   +N  LGWEKLQ IA+GIAKG+EYLHQGCDQRILH
Sbjct  372   DGSIRALIYEFLPNESLEKFIFSVAGENHSLGWEKLQHIAIGIAKGIEYLHQGCDQRILH  431

Query  724   FDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSY  545
             FDIKP NILLD NFNPKISDFG AKLCSKE+S+VSMT ARGT+GYIAPEV SRNFGN S+
Sbjct  432   FDIKPHNILLDHNFNPKISDFGLAKLCSKEESVVSMTVARGTIGYIAPEVLSRNFGNASH  491

Query  544   KSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKI  365
             KSDVYSFGMLLLEMVGG+K  D T    T Q YFPEW+Y  L++G+E+ I+ EKG D+KI
Sbjct  492   KSDVYSFGMLLLEMVGGRKNIDAT-VENTGQVYFPEWVYCHLNQGKELNIRAEKGGDTKI  550

Query  364   AKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTS  233
             AKKLTIVGLWCIQWYP+DRPS+KV +QMLE E +  +MPPNPF S
Sbjct  551   AKKLTIVGLWCIQWYPIDRPSMKVAVQMLEGEGDNLTMPPNPFAS  595



>gb|KDP42825.1| hypothetical protein JCGZ_23767 [Jatropha curcas]
Length=617

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/608 (51%), Positives = 406/608 (67%), Gaps = 43/608 (7%)
 Frame = -2

Query  1921  ECLPRKCGNNGPEISFPFRLKHIQPPECGYP--GFELLCTDKGETALENPFPLLNATLQP  1748
             +C  + C +NGP + FPFR+K  QP  CGYP  GF L C++K ET LE P+         
Sbjct  34    DCNIKSCASNGPPVRFPFRIKDKQPVNCGYPEAGFVLSCSEKNETVLELPYS--------  85

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE----NLYNFSIFSCST  1580
                 K  IE ID + ++I   R + C    +  L+ + SPF F+        +++F+CS+
Sbjct  86    --KWKLFIEQIDYKSQVIFSYRTEACVATQILDLDSNISPFKFKEGNKKYRQYTLFNCSS  143

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
                      +  PI+CL+    +   A  + Y     DL+ C K+  +S V Y     N 
Sbjct  144   AYE------SYEPISCLSGNLQYRIYAIPAYYHILGLDLLRCVKIHDISQVKYDYLY-ND  196

Query  1399  VFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSF  1250
             +  L W  P C          RLK+N+T  + + C   L     G  RK    G +LGS 
Sbjct  197   ILHLSWVDPRCGSCEAKGKYCRLKSNTTGFETE-CYGELK----GSSRKHITIGVILGSI  251

Query  1249  LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEG  1070
             L+     + YR+Y   K  +E Q KIE+FL+DYK+LKP RYSYADIK++T++F E+LG+G
Sbjct  252   LLAAAASLLYRLYSSKKRDREYQSKIEKFLDDYKSLKPTRYSYADIKRVTNQFKEELGQG  311

Query  1069  SYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFH  890
             +YGTV+KGKLS ++ VAVK+LNNS G+G  EEFV+E++TIG IHH+NVVRL+G+CADGF 
Sbjct  312   AYGTVFKGKLSDEILVAVKLLNNSTGNG--EEFVDEVATIGKIHHVNVVRLIGFCADGFI  369

Query  889   RALVYEYLVNNSLEKFVFSPND--KNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
             RALVYEYL N+SL+K++ S ++  KNFLGW++LQ I LGIAKG+EYLHQGCDQRILHFDI
Sbjct  370   RALVYEYLPNDSLQKYITSADNSNKNFLGWKRLQDITLGIAKGIEYLHQGCDQRILHFDI  429

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP NILLD +FNPK+SDFG AK C+K++S VSMT ARGT+GYIAPEVFSRNFGNVSYKSD
Sbjct  430   KPHNILLDHDFNPKVSDFGLAKFCAKDQSAVSMTTARGTIGYIAPEVFSRNFGNVSYKSD  489

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             VYSFGML+LEMVGG+K  + T   +  Q YFPEWIYN+L  G+++  +IE+  D+KIAKK
Sbjct  490   VYSFGMLVLEMVGGRKNVEATEEGDDEQIYFPEWIYNLLEEGDDLRFEIEEEGDTKIAKK  549

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSA  179
             L +VGLWCIQW PVDRPS+KVV+ MLE E E   +PPNPF+S   ++  A   GRL    
Sbjct  550   LAVVGLWCIQWNPVDRPSMKVVVHMLEGEGENLPVPPNPFSSGTSTRTNARIAGRLLHRK  609

Query  178   LEIISEMD  155
             LE ISE++
Sbjct  610   LEAISEIE  617



>ref|XP_004287327.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=578

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/589 (53%), Positives = 404/589 (69%), Gaps = 43/589 (7%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CG +GP I FPF  K   P     PGF + C +K ET LE            P PVKF I
Sbjct  27    CGKHGPVIKFPFSFKGSHPEN---PGFLVSCNEKNETILE-----------LPIPVKFAI  72

Query  1723  ESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFE--NLYNFSIFSCSTHRNITAGSI  1553
             +++D + + I +   +GC L +LL + N+S SPF +    + + ++F+CS+ +     S 
Sbjct  73    KTVDYKAQKIQLYDPEGCLLAKLLKVHNMSISPFHYSENQMIDITLFNCSSAKRKKPSSW  132

Query  1552  NISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTGP  1373
               S + C     +++Y+ D+  YL     L+SCTKM ++SSVPY  A       L W+ P
Sbjct  133   LYS-VPCFGYQIYWVYSFDNIEYL----PLLSCTKMRNLSSVPYRTAPRE--LYLEWSEP  185

Query  1372  SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMK  1193
             +C L           C A  +    G  + L   G  LGSF++V++    Y  Y  ++ +
Sbjct  186   NCGL-----------CEAQGSTKKGGSGKTLVATGTSLGSFVLVLLAGAAYHAYSSDRKE  234

Query  1192  KEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVK  1013
             K+ Q+KIE FLEDY+ALKP+RYSY+DIK+ITD+F +KLG+G+YGTVYKGKLS + FVAVK
Sbjct  235   KQNQLKIESFLEDYRALKPSRYSYSDIKRITDQFKDKLGQGAYGTVYKGKLSSECFVAVK  294

Query  1012  VLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFS  833
             VL ++KGDG  EEFVNE+ T+G IHH+NVVRLVG+CADGF RALVY++L N SL+ F+ S
Sbjct  295   VLTSTKGDG--EEFVNEVGTMGHIHHVNVVRLVGFCADGFRRALVYDFLPNGSLQDFISS  352

Query  832   PNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQ  656
              ++ N FLGW+KLQ IALGIAKG+EYLHQGCDQRILHFDIKP N+LLD NF PKISDFG 
Sbjct  353   ADNNNSFLGWDKLQDIALGIAKGIEYLHQGCDQRILHFDIKPHNVLLDHNFTPKISDFGL  412

Query  655   AKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKK--S  482
             AKLCSK++SIVSMT ARGTMGYIAPEVFSRNFGNVSYKSDVYS+GM+LLEMVGG+K   S
Sbjct  413   AKLCSKDQSIVSMTTARGTMGYIAPEVFSRNFGNVSYKSDVYSYGMVLLEMVGGRKNISS  472

Query  481   DITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPS  302
                 +PE    Y+PEWIYN+L  GE++ I + +  D++IAK+L IVGLWCIQW+PVDRPS
Sbjct  473   TTENAPEV---YYPEWIYNLLEEGEDLRIHVGEEADAQIAKRLAIVGLWCIQWHPVDRPS  529

Query  301   IKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             +K V+QMLE  E  +MPPNPF S  P+   A+ P +     LE I+E++
Sbjct  530   MKGVVQMLEGGENLTMPPNPFASQGPAGTSASTPVKRLNLQLEPIAELE  578



>ref|XP_009596791.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Nicotiana 
tomentosiformis]
Length=635

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/608 (51%), Positives = 416/608 (68%), Gaps = 35/608 (6%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNA--TL  1754
             +++CLP +CG+ GP I FPFRLK+  P  CGYPGFEL CT    T  +  FPL  +   +
Sbjct  28    QDQCLPTRCGDFGPVIRFPFRLKNRHPTNCGYPGFELSCTKDNVTQFKLQFPLQASIKNI  87

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDG-CFLQLLPILNLSASPFSF-ENLYN-FSIFSCS  1583
               P      ++ ID + + I +S ++  C    +  +N SASPF++ +N Y  F++F+CS
Sbjct  88    DIPISANVSVQEIDYKSQTIRLSELNASCLPGQISNINSSASPFTYDQNSYGGFTLFNCS  147

Query  1582  THRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLI--SCTKMFHVSSVPYSI--  1415
             +++     S +   I CL+ P + + A  S    Y++      SCTKM+++S VP  +  
Sbjct  148   SNKKY---STSFDRINCLSGPHYDVLAFRS----YNSISQFPSSCTKMYNISDVPNEVLF  200

Query  1414  ---AQDNTVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKV  1274
                    T   L W+          G  C+LK+N +  + + C+        GP +K+ V
Sbjct  201   GQPEYSRTQIYLHWSEPFCGNCEADGKYCKLKSNGSGSETE-CVDIPEDPSKGPSKKVIV  259

Query  1273  AGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDR  1094
             A  VLGS    +++++        K+KKE+Q +IERFLEDYKAL+P RYSYADIKKIT++
Sbjct  260   A-SVLGSVFAFMLIILAVYKIIKLKIKKEDQKRIERFLEDYKALRPTRYSYADIKKITEQ  318

Query  1093  FSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLV  914
             F  K+G+G YG VYKGKL+ ++ VA+KVLNN KG+G  E+F+NE+ +IG IHH+NVVRLV
Sbjct  319   FKYKVGQGGYGKVYKGKLTNEILVAIKVLNNFKGNG--EDFINEVGSIGRIHHVNVVRLV  376

Query  913   GYCADGFHRALVYEYLVNNSLEKFVFSPNDK-NFLGWEKLQQIALGIAKGVEYLHQGCDQ  737
             GYCADG+ RALVYEYL N++L+K + S N++ + LGWEK+QQIA+GIAKG+EYLHQGC+Q
Sbjct  377   GYCADGYRRALVYEYLQNDTLQKIISSGNERGSSLGWEKMQQIAVGIAKGIEYLHQGCNQ  436

Query  736   RILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFG  557
             RI+HFDIKP NILLDQ+FNPK++DFG AKLCSKE+S VSMTAARGT+GYIAPEVFSRN+G
Sbjct  437   RIVHFDIKPHNILLDQDFNPKVADFGLAKLCSKEQSAVSMTAARGTIGYIAPEVFSRNYG  496

Query  556   NVSYKSDVYSFGMLLLEMVGGKKKSDITGSP-ETNQDYFPEWIYNILSRGEEVEIQIEKG  380
             NVSYK+D+YSFGMLLL+M+GG+KK D       ++Q Y+PEW+Y  L +GEE+EIQI+  
Sbjct  497   NVSYKADIYSFGMLLLDMIGGRKKFDAANEQNSSSQIYYPEWMYKQLEKGEEIEIQIDNE  556

Query  379   EDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKP  200
             +DS   KKL I GLWCIQWYP DRPS+KVVIQMLEAE  P MPPNPF S + S  +    
Sbjct  557   DDSSTIKKLAIAGLWCIQWYPADRPSMKVVIQMLEAEGVPVMPPNPFGSMNLSNTRTTAE  616

Query  199   GRLFTSAL  176
                 +S L
Sbjct  617   ASQLSSEL  624



>ref|XP_007036614.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY21115.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=638

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/627 (53%), Positives = 415/627 (66%), Gaps = 65/627 (10%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYP--GFELLCTDKGETALENPFPLLNATLQPP  1745
             C   KC  +GP + FPF LK  Q P CG+P  GFEL CT  GET            L  P
Sbjct  36    CKVTKCNRHGPPVRFPFWLKDKQSPHCGFPHPGFELACTKNGET-----------VLHLP  84

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPIL--NLSASPF--SFENLYNFSIFSCST-  1580
             + V+  +E ID + + I +S  +GC  + LP L  N SASPF  SF    N+++F+C   
Sbjct  85    WSVEMFVEDIDYKTQSIYLSDPEGCLNRQLPHLDLNFSASPFYGSFGQPDNYTLFNCPKD  144

Query  1579  --HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD  1406
                  +  G+       C+     F   A S   + +   LI C K+  +S+VP  +  D
Sbjct  145   PREDYLYYGN-------CIGYINGFQIRAASPSSMGNEYSLIKCQKVVDISAVPMELI-D  196

Query  1405  NTVFSLRWTGP----------SCRLKNNSTAEDADDC--------IAPLTKLH-------  1301
                 +L W+ P           CRLKNN+  +D  +C        I  + + H       
Sbjct  197   TPNLNLNWSKPICFSCEEEGKGCRLKNNT--QDQTECYDIPKNGTIELMFEKHNMLIHFQ  254

Query  1300  --TG-PLRKLK--VAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKP  1136
               TG P  KLK  VAG +  SFL+ +IV   Y++YR++K K+E Q+KIE FLEDY++LKP
Sbjct  255   HFTGHPYTKLKRIVAGVIPTSFLLALIVFALYKLYRIHKTKEESQLKIEEFLEDYRSLKP  314

Query  1135  ARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMS  956
             +RY+YADIK+IT++F EKLGEG YGTV+KG+LS DV VAVKVLNN KG+G  EEF+NE+ 
Sbjct  315   SRYAYADIKRITNQFKEKLGEGGYGTVFKGRLSNDVLVAVKVLNNFKGNG--EEFINEVG  372

Query  955   TIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPN-DKNFLGWEKLQQIALG  779
             ++  IHH+NV RLVG+CADG+ RALVYEYL N SLEKF+FS   + +FLGW++LQ IALG
Sbjct  373   SMSRIHHVNVARLVGFCADGYKRALVYEYLPNESLEKFIFSAKGESHFLGWDELQDIALG  432

Query  778   IAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGT  599
             IAKG+EYLHQGC+QRILHFDIKP NILLD NF PKISDFG AKLCSKE+S V MTAARGT
Sbjct  433   IAKGIEYLHQGCEQRILHFDIKPHNILLDHNFTPKISDFGLAKLCSKEQSAVFMTAARGT  492

Query  598   MGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNIL  419
             MGYIAPEV SRNFGNVSYKSDVYSFGMLLLEMVGG+K  D+T    T+Q YFPEW+YN L
Sbjct  493   MGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVT-VENTSQVYFPEWVYNHL  551

Query  418   SRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNP  242
              +GEE+ I+IE    S +A+KL+IVGLWCIQW+PVDRPS+K VIQMLE E    +MPPNP
Sbjct  552   DKGEELGIRIEDERQSLVARKLSIVGLWCIQWFPVDRPSMKAVIQMLEGEANSLTMPPNP  611

Query  241   FTSTDPSKAKANKPGRLFTSALEIISE  161
             F ST+  K   +K  +   + L II+E
Sbjct  612   FASTEHMKLGGSKYRKPVGAELAIIAE  638



>ref|XP_010662776.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=605

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/601 (54%), Positives = 406/601 (68%), Gaps = 53/601 (9%)
 Frame = -2

Query  1927  RNECL-PRKCGNNGPEISFPFRLK-HIQPPECGYPGFELLCTDKGETALENPFPLLNATL  1754
             ++EC+  + C   GP I FPFRLK H  P  CG   F L CT++ +T LE          
Sbjct  48    QDECMVSQSCSLQGPPILFPFRLKGHQYPDHCGCSLFALSCTERNQTILE----------  97

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCST  1580
               P  V  L++ I+   + I++   D CF + LP LNL++SPF F N Y  + + F C +
Sbjct  98    -LPDSVNLLVKEINYRSKEILVQDPDNCFPRQLPNLNLASSPFQFLNDYVDDLTFFKCPS  156

Query  1579  HRNITA---GSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYS-IA  1412
              RN T    GS ++S I CL  PG  IYA  S  Y   A  L SC+KM++V++ PY  I+
Sbjct  157   -RNSTKYYDGS-SVSLIPCLGGPGFQIYAVYSLEYPGIAY-LPSCSKMYNVAAAPYDVIS  213

Query  1411  QDNTVFSLRWTG-PSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVI  1235
                    L WT  P C       AE A               +KL V GE LGS  +V +
Sbjct  214   SQKNATRLTWTKLPHCE------AEGATK-------------KKLIVTGESLGSLFLVTL  254

Query  1234  VLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTV  1055
             V   YR+Y  N+ K++ ++K+ +FLEDY+ALKP+RYSY DIK+ITD F EKLGEG YGTV
Sbjct  255   VFALYRVYSSNESKRQHKIKVIKFLEDYRALKPSRYSYNDIKRITDGFKEKLGEGGYGTV  314

Query  1054  YKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVY  875
             YKGKLS ++FVAVK+LNNS  +G+GEEF+NE+ TIG IHHINVVRL+G+C+DG  RAL+Y
Sbjct  315   YKGKLSNEIFVAVKILNNS--NGNGEEFINEVGTIGRIHHINVVRLIGFCSDGCRRALIY  372

Query  874   EYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILL  695
             E+L N SLEKF+FS +    LGWEKLQ IA+GIAKG+EYLHQGCDQRILHFDIKP NILL
Sbjct  373   EFLPNESLEKFIFSNHS---LGWEKLQDIAIGIAKGIEYLHQGCDQRILHFDIKPHNILL  429

Query  694   DQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGML  515
             D NFNPKISDFG AKLCSKE+S VSM+  RGTMGYIAPE+ SRNFGNVSYKSDVYSFGML
Sbjct  430   DHNFNPKISDFGLAKLCSKEQSAVSMSVIRGTMGYIAPEMISRNFGNVSYKSDVYSFGML  489

Query  514   LLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLW  335
             L+EMVGG+K  D T    T+Q YFPEW+YN L + EE+ I IE+  D +IAKKL I+GLW
Sbjct  490   LIEMVGGRKNIDTT-VKNTSQVYFPEWVYNRLDKREELHIPIEEENDGEIAKKLLIMGLW  548

Query  334   CIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEM  158
             CIQW P++RPS+K +IQMLE E    SMPPNPFTS  P++   N    +    L +ISE+
Sbjct  549   CIQWCPMNRPSMKFIIQMLEGEGNNLSMPPNPFTSMGPTRTSPN----MHQQELAVISEI  604

Query  157   D  155
             +
Sbjct  605   E  605



>ref|XP_011037043.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X3 [Populus euphratica]
Length=596

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/590 (52%), Positives = 407/590 (69%), Gaps = 33/590 (6%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CGN GP+I FPFR+K  QP  CGYPGF+L C+D   T L  P  L              I
Sbjct  33    CGNRGPDIRFPFRIKDKQPDHCGYPGFDLSCSDDNSTVLRLPTGL-----------SVHI  81

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENL--YNFSIFSCSTHRNITAGSIN  1550
             E ID   +LI      GCFL+     +  AS F  +N   +++++F+CS        S+ 
Sbjct  82    ERIDYRYQLIYARGPQGCFLRQRLNFSFGASHFQIKNDRPHDWTLFNCSLSNE--RRSLY  139

Query  1549  ISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD-NTVFSLRWTGP  1373
             +  I CL+   H ++   SS+ + S + L+SCTKM+++  +PYS+ Q+ N V ++ W+ P
Sbjct  140   MDKIPCLSTFNHEVHFFRSSISI-SNSVLLSCTKMYNIYGIPYSLMQEENYVLTISWSNP  198

Query  1372  SCRLKNNSTAEDADDCIAPLTKLHTGPLR-KLKVAGEVLGSFLVVVIVLVTYRIYRLNKM  1196
             +C            +C + L   HT  +R KL + G +LG FL  + +   YR    +K 
Sbjct  199   TC-------GSSETECYSNLP--HTKDVRRKLLITGVILGFFLFAIAITALYRTCSNDKT  249

Query  1195  KKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAV  1016
             ++E Q ++E FL++Y++L P RYSYAD+K+IT++FS++LG+G+YGTV+KGKL+ ++ VAV
Sbjct  250   QREYQARVEMFLDNYRSLNPTRYSYADLKRITNQFSDELGQGAYGTVFKGKLTNEIAVAV  309

Query  1015  KVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVF  836
             K+LNNS G G  EEF+NE+ T+  IHH+NVVRL+ +CADGF RALVYEYL N+SL+KF+ 
Sbjct  310   KLLNNSIGKG--EEFINEVGTMARIHHVNVVRLIAFCADGFRRALVYEYLPNDSLQKFIS  367

Query  835   SPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFG  659
             S + +N FLGWE+L ++ALGIAKG+EYLHQGCDQRILHFDIKP+NILLD  FNPKI+DFG
Sbjct  368   SADSRNHFLGWERLNRVALGIAKGIEYLHQGCDQRILHFDIKPQNILLDNEFNPKIADFG  427

Query  658   QAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSD  479
              AKLCSK+KS +SMT ARGT+GYIAPEVFSRNFGNVSYKSDVYSFGML+LEMVGG+K  D
Sbjct  428   MAKLCSKDKSAISMTTARGTVGYIAPEVFSRNFGNVSYKSDVYSFGMLVLEMVGGRKNVD  487

Query  478   ITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSI  299
              T +   +Q YFPEWIYN+L + E++   I+  ED++IAKKL IVGLWCIQW P +RPS+
Sbjct  488   DT-AENGDQIYFPEWIYNLLEKEEDLRFHIDGEEDARIAKKLAIVGLWCIQWNPAERPSM  546

Query  298   KVVIQMLEAE-EPPSMPPNPFTSTDPSKAKA-NKPGRLFTSALEIISEMD  155
             K V+QMLE E E  S PP+PF+S+ P +  A + P R     L  ISE++
Sbjct  547   KTVVQMLEGEGENLSKPPDPFSSSVPKRTSAGHMPARGLHQELAAISEIE  596



>ref|XP_011037042.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Populus euphratica]
Length=598

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/592 (51%), Positives = 407/592 (69%), Gaps = 35/592 (6%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CGN GP+I FPFR+K  QP  CGYPGF+L C+D   T L  P  L              I
Sbjct  33    CGNRGPDIRFPFRIKDKQPDHCGYPGFDLSCSDDNSTVLRLPTGL-----------SVHI  81

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENL--YNFSIFSCSTHRNITAGSIN  1550
             E ID   +LI      GCFL+     +  AS F  +N   +++++F+CS        S+ 
Sbjct  82    ERIDYRYQLIYARGPQGCFLRQRLNFSFGASHFQIKNDRPHDWTLFNCSLSNE--RRSLY  139

Query  1549  ISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD-NTVFSLRWTGP  1373
             +  I CL+   H ++   SS+ + S + L+SCTKM+++  +PYS+ Q+ N V ++ W+ P
Sbjct  140   MDKIPCLSTFNHEVHFFRSSISI-SNSVLLSCTKMYNIYGIPYSLMQEENYVLTISWSNP  198

Query  1372  SCRLKNNSTAEDADDCIAPLTKLHTGPL---RKLKVAGEVLGSFLVVVIVLVTYRIYRLN  1202
             +C            +C + L   HT  +   RKL + G +LG FL  + +   YR    +
Sbjct  199   TC-------GSSETECYSNLP--HTKGIDVRRKLLITGVILGFFLFAIAITALYRTCSND  249

Query  1201  KMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFV  1022
             K ++E Q ++E FL++Y++L P RYSYAD+K+IT++FS++LG+G+YGTV+KGKL+ ++ V
Sbjct  250   KTQREYQARVEMFLDNYRSLNPTRYSYADLKRITNQFSDELGQGAYGTVFKGKLTNEIAV  309

Query  1021  AVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKF  842
             AVK+LNNS G G  EEF+NE+ T+  IHH+NVVRL+ +CADGF RALVYEYL N+SL+KF
Sbjct  310   AVKLLNNSIGKG--EEFINEVGTMARIHHVNVVRLIAFCADGFRRALVYEYLPNDSLQKF  367

Query  841   VFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISD  665
             + S + +N FLGWE+L ++ALGIAKG+EYLHQGCDQRILHFDIKP+NILLD  FNPKI+D
Sbjct  368   ISSADSRNHFLGWERLNRVALGIAKGIEYLHQGCDQRILHFDIKPQNILLDNEFNPKIAD  427

Query  664   FGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKK  485
             FG AKLCSK+KS +SMT ARGT+GYIAPEVFSRNFGNVSYKSDVYSFGML+LEMVGG+K 
Sbjct  428   FGMAKLCSKDKSAISMTTARGTVGYIAPEVFSRNFGNVSYKSDVYSFGMLVLEMVGGRKN  487

Query  484   SDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRP  305
              D T +   +Q YFPEWIYN+L + E++   I+  ED++IAKKL IVGLWCIQW P +RP
Sbjct  488   VDDT-AENGDQIYFPEWIYNLLEKEEDLRFHIDGEEDARIAKKLAIVGLWCIQWNPAERP  546

Query  304   SIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKA-NKPGRLFTSALEIISEMD  155
             S+K V+QMLE E E  S PP+PF+S+ P +  A + P R     L  ISE++
Sbjct  547   SMKTVVQMLEGEGENLSKPPDPFSSSVPKRTSAGHMPARGLHQELAAISEIE  598



>ref|XP_010662808.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=604

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/604 (52%), Positives = 407/604 (67%), Gaps = 38/604 (6%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             +EC   +C ++GP I FPFRLKH QP  CG P FEL C+++  T LE            P
Sbjct  25    DECKASRCSHHGPVIRFPFRLKH-QPEHCGCPEFELSCSEENRTILE-----------LP  72

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY-NFSIFSCSTHRNI  1568
                K  +E I+   + I++   D C  +  P  NLSASPF F N+Y NFS F+CS  +  
Sbjct  73    SSGKLWVEEINYASQEIVVHYSDDCLQRQTPNFNLSASPFQFTNVYRNFSFFNCSESKE-  131

Query  1567  TAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSL  1388
                S     I C     + +Y A  S Y  +  +L SC K+F+ +     I + +  FS+
Sbjct  132   --ESFVFRSIPCSFLSSNPVYVA-PSYYALAGVNLSSCRKIFNATLPQNYIYEWD--FSM  186

Query  1387  RWTGPSC-----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVV  1241
              W+ P C           R KNNST E    CI    K    P+ K+ +   +LG     
Sbjct  187   NWSKPMCGNCEAKGNKCQRKKNNST-EPEIKCIDKPAK--GAPIDKVVLTEVILGFLHFT  243

Query  1240  VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYG  1061
               + + + +YR NK+K+E ++ I++FLEDY+ALKP+RYSYADIKKIT+ F +KLG+G YG
Sbjct  244   FGIFIIFIVYRSNKLKREHRINIQKFLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYG  303

Query  1060  TVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRAL  881
             TVYKGKLS ++FVAVK+L++ KG+G  EEF+NE+ T+G+IHH+NVVRL+G+CADG+ +AL
Sbjct  304   TVYKGKLSNEIFVAVKILDDFKGNG--EEFINEVRTMGTIHHVNVVRLLGFCADGYKQAL  361

Query  880   VYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRN  704
             + E+L N SL+KF+FS    N+ LGW KLQ IA+GIAKG+EYLHQGCDQRILH DIKP N
Sbjct  362   ICEFLPNESLDKFIFSAFGNNYSLGWHKLQDIAIGIAKGIEYLHQGCDQRILHLDIKPHN  421

Query  703   ILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSF  524
             ILLD NFNPKISDFG AKLCSKE+S+VSMTAARGTMGYIAPE+FSRN+GNVSYK+DVYSF
Sbjct  422   ILLDHNFNPKISDFGLAKLCSKEQSLVSMTAARGTMGYIAPEMFSRNYGNVSYKADVYSF  481

Query  523   GMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIV  344
             GMLL+EMVGG+K  D T    T+Q YFPEW+YN L + +EV I+IE+  D KIAKKL+I+
Sbjct  482   GMLLIEMVGGRKNIDAT-VENTSQAYFPEWLYNHLDQEQEVHIRIEEESDIKIAKKLSII  540

Query  343   GLWCIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPSKAKANKPGRLFTSALEII  167
             GLWCIQWYP+DRPS+K+V+ MLE EE    MPPNPFTS   ++    +        L  I
Sbjct  541   GLWCIQWYPIDRPSMKIVVGMLEGEEGNLVMPPNPFTSMGQTRTSVRRRKTSIQPKLTAI  600

Query  166   SEMD  155
             SE++
Sbjct  601   SEIE  604



>ref|XP_011037041.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Populus euphratica]
Length=602

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/594 (51%), Positives = 407/594 (69%), Gaps = 35/594 (6%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CGN GP+I FPFR+K  QP  CGYPGF+L C+D   T L  P  L              I
Sbjct  33    CGNRGPDIRFPFRIKDKQPDHCGYPGFDLSCSDDNSTVLRLPTGL-----------SVHI  81

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENL--YNFSIFSCSTHRNITAGSIN  1550
             E ID   +LI      GCFL+     +  AS F  +N   +++++F+CS        S+ 
Sbjct  82    ERIDYRYQLIYARGPQGCFLRQRLNFSFGASHFQIKNDRPHDWTLFNCSLSNE--RRSLY  139

Query  1549  ISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD-NTVFSLRWTGP  1373
             +  I CL+   H ++   SS+ + S + L+SCTKM+++  +PYS+ Q+ N V ++ W+ P
Sbjct  140   MDKIPCLSTFNHEVHFFRSSISI-SNSVLLSCTKMYNIYGIPYSLMQEENYVLTISWSNP  198

Query  1372  SCRLKNNSTAEDADDCIA--PLTK---LHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYR  1208
             +C            +C +  P TK    +    RKL + G +LG FL  + +   YR   
Sbjct  199   TC-------GSSETECYSNLPHTKGMHFYLDVRRKLLITGVILGFFLFAIAITALYRTCS  251

Query  1207  LNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDV  1028
              +K ++E Q ++E FL++Y++L P RYSYAD+K+IT++FS++LG+G+YGTV+KGKL+ ++
Sbjct  252   NDKTQREYQARVEMFLDNYRSLNPTRYSYADLKRITNQFSDELGQGAYGTVFKGKLTNEI  311

Query  1027  FVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLE  848
              VAVK+LNNS G G  EEF+NE+ T+  IHH+NVVRL+ +CADGF RALVYEYL N+SL+
Sbjct  312   AVAVKLLNNSIGKG--EEFINEVGTMARIHHVNVVRLIAFCADGFRRALVYEYLPNDSLQ  369

Query  847   KFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKI  671
             KF+ S + +N FLGWE+L ++ALGIAKG+EYLHQGCDQRILHFDIKP+NILLD  FNPKI
Sbjct  370   KFISSADSRNHFLGWERLNRVALGIAKGIEYLHQGCDQRILHFDIKPQNILLDNEFNPKI  429

Query  670   SDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGK  491
             +DFG AKLCSK+KS +SMT ARGT+GYIAPEVFSRNFGNVSYKSDVYSFGML+LEMVGG+
Sbjct  430   ADFGMAKLCSKDKSAISMTTARGTVGYIAPEVFSRNFGNVSYKSDVYSFGMLVLEMVGGR  489

Query  490   KKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVD  311
             K  D T +   +Q YFPEWIYN+L + E++   I+  ED++IAKKL IVGLWCIQW P +
Sbjct  490   KNVDDT-AENGDQIYFPEWIYNLLEKEEDLRFHIDGEEDARIAKKLAIVGLWCIQWNPAE  548

Query  310   RPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKA-NKPGRLFTSALEIISEMD  155
             RPS+K V+QMLE E E  S PP+PF+S+ P +  A + P R     L  ISE++
Sbjct  549   RPSMKTVVQMLEGEGENLSKPPDPFSSSVPKRTSAGHMPARGLHQELAAISEIE  602



>ref|XP_010662831.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=597

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/608 (52%), Positives = 419/608 (69%), Gaps = 48/608 (8%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++ C   +C  +GP I FPFRLKH QP +CGYPGFE+ C+++  T LE            
Sbjct  21    QDGCKESRCSAHGPVIRFPFRLKH-QPNQCGYPGFEISCSEEKRTMLE-----------L  68

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCSTHR  1574
             P+ VK  ++ I+   + I +S  D C        NLSASPF F + Y  ++ IFSCS  +
Sbjct  69    PYSVKLSVQKINYTSQEIWVSGRDFC-----KNFNLSASPFQFMSAYRSDYIIFSCSESK  123

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSI-----AQ  1409
                    N++P  C   P + +Y+      L S  DL SC+ +++ S   +S+     ++
Sbjct  124   --ADPYKNLNPTHCSFLPNNLVYSVSPEASL-SHLDLSSCSMIYYFSIPSWSVDLGDYSE  180

Query  1408  DNTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL  1259
              N V  + W+ PSC          RL+ ++  E   +C+    K  +   ++  + G +L
Sbjct  181   YNVV--MNWSRPSCGDCEAKGKRCRLQESNIKEPEIECVDQPPKDVS---KEWTITGVIL  235

Query  1258  GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
             G FL++++V++ Y +Y  +K KKE   K+++FLEDY+AL P+RYSYADIKKIT+ F +KL
Sbjct  236   GFFLLLLVVIICYNVYTTDKSKKEHSKKLQKFLEDYRALNPSRYSYADIKKITNLFKDKL  295

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             GEG YGT+YKGKLS +VFVAVK+LN+SK +G  EEF+NE+ T+G IHHINVVRLVG+CAD
Sbjct  296   GEGGYGTIYKGKLSNEVFVAVKILNDSKENG--EEFINEVRTMGRIHHINVVRLVGFCAD  353

Query  898   GFHRALVYEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFD  719
             G+ RAL+YE+L N SLEKF+F       LGW+KL  IALGIAKG+EYLHQGCDQRILHFD
Sbjct  354   GYKRALIYEFLPNESLEKFIFKNQS---LGWQKLHDIALGIAKGIEYLHQGCDQRILHFD  410

Query  718   IKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKS  539
             IKP NILLDQNFNPKISDFG AKLCSKE+S+VSMTAARGTMGYIAPEV SRNFGNVSYKS
Sbjct  411   IKPHNILLDQNFNPKISDFGLAKLCSKEQSVVSMTAARGTMGYIAPEVLSRNFGNVSYKS  470

Query  538   DVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAK  359
             DVYSFGMLLLEMVGG+K SD      T+Q YFPEW+YN L +  E+ I+IEK ED+KIAK
Sbjct  471   DVYSFGMLLLEMVGGRKNSDAI-MENTSQMYFPEWLYNHLEQNGEIHIRIEKEEDTKIAK  529

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSA  179
             +L+IVGLWCIQW+P+DRPS+K+V++MLE E+  ++PPNPF S+ P++    +        
Sbjct  530   RLSIVGLWCIQWHPIDRPSMKIVLKMLEGEDNITLPPNPFASSGPTRTNVRRRRTSLQQE  589

Query  178   LEIISEMD  155
             L +ISE++
Sbjct  590   LIVISELE  597



>gb|EYU19635.1| hypothetical protein MIMGU_mgv1a003204mg [Erythranthe guttata]
Length=600

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/606 (51%), Positives = 402/606 (66%), Gaps = 53/606 (9%)
 Frame = -2

Query  1939  YSYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNA  1760
             ++  ++ECLP  C   GP I FPFRL   QP  CGYPGF+L C+    T  E  +P+  +
Sbjct  20    FAAGQDECLPTSCHAPGPIIRFPFRLIGRQPERCGYPGFDLSCSSTNTTEFEFQYPVRAS  79

Query  1759  TLQPPFPV--KFLIESIDCEDRLIIISRVDG-CFLQLLPILNLSASPFSFE-----NLYN  1604
                   P+  K  +  ID  +++I +S ++G C    +P L+ +A+P  FE     +   
Sbjct  80    ARNTVLPISAKATVLEIDYMNQVIRVSVLNGSCLPNRVPQLSSAAAPSPFEVDLRYDSSG  139

Query  1603  FSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATD--LISCTKMFHVSS  1430
             +++F+CS   +  A S    P+ CL   G  +YA  SS   YS TD  + +C KM+++S 
Sbjct  140   YTLFNCSKLPDSRAASY---PVTCLNHGGFRVYAFGSS---YSVTDFPMSTCLKMYNISD  193

Query  1429  V-------PYSIAQDNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVA  1271
             +       P   + D+T   LRW  PSCR    S                    RK  VA
Sbjct  194   ISRVLFDGPAEFSVDDTY--LRWPEPSCRTCEAS--------------------RKYSVA  231

Query  1270  GEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRF  1091
               V+G F+  V +     +Y   K K++   +I RFLEDYKALKP RY+Y+DIK I D F
Sbjct  232   --VIGVFVTAVALAAILYVYITKKRKRDNGKRISRFLEDYKALKPTRYTYSDIKVIADGF  289

Query  1090  SEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVG  911
               KLG+G YGTV+KGKLS D+ VAVK+LNN+KG+GD  EF+NE++TIG IHH+NVVRLVG
Sbjct  290   KHKLGQGGYGTVFKGKLSNDIPVAVKILNNTKGNGD--EFINEVATIGKIHHVNVVRLVG  347

Query  910   YCADGFHRALVYEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRI  731
             YCADG+ RALVYE+L N+SLEK++ S N  + LGWEKL  +ALG+AKG++YLHQGC+QRI
Sbjct  348   YCADGYRRALVYEFLENDSLEKYISSGNQSSTLGWEKLHSVALGVAKGIDYLHQGCNQRI  407

Query  730   LHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNV  551
             LHFDIKP NILLD N +PK++DFG AKLCSKE+S+V+MT ARGT+GYIAPEVFSRNFG V
Sbjct  408   LHFDIKPHNILLDHNLSPKVADFGLAKLCSKEQSVVTMTGARGTIGYIAPEVFSRNFGKV  467

Query  550   SYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQD--YFPEWIYNILSRGEEVEIQIEKGE  377
             SYKSD+YSFGMLLL+MVGG+K  D  G  E + D  YFPEW+YN L +GE++ I+IEK  
Sbjct  468   SYKSDIYSFGMLLLDMVGGRKSFD-AGVQEDSSDEIYFPEWMYNKLDKGEDIAIEIEKEG  526

Query  376   DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKAN-KP  200
             +S+IAK+L IVGLWCIQWYPVDRPS KVVIQMLE E  P MPPNPF ++ P+ A +    
Sbjct  527   ESEIAKRLIIVGLWCIQWYPVDRPSTKVVIQMLEGENMPVMPPNPFAASKPANANSTAST  586

Query  199   GRLFTS  182
             G L+ S
Sbjct  587   GSLYHS  592



>ref|XP_002268653.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=619

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/618 (53%), Positives = 412/618 (67%), Gaps = 53/618 (9%)
 Frame = -2

Query  1927  RNEC-LPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             +++C +P KC   GP I FPFRLK   P  CG PGFEL CT      +          L+
Sbjct  28    QDQCTVPAKCSPQGPPIRFPFRLKG-HPKNCGCPGFELSCTGTTNQTM----------LE  76

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENL-----YNFSIFSC  1586
              PFP K  +E I+   R I +   D C  + L   +L+ SPF   +L       ++ FSC
Sbjct  77    LPFPAKLPVEEINYTTREIRVHYKDSCLPRQL-TRSLADSPFKLMDLDLVDDQYYTFFSC  135

Query  1585  STHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD  1406
             S ++   + S +++P  C    G  +Y   SS       DL SC ++ +V      I Q 
Sbjct  136   SLNK---SESYDLTPYTCHIFGGSTVYGV-SSDDDLGDLDLYSCQRIDNV------IVQS  185

Query  1405  NT--VFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHT-GPLRKLKVAGE  1265
             N    F ++W           G  CR K+NS   + + CI    K     P     VAG 
Sbjct  186   NVENSFHVKWANTICGDCEAEGGKCRPKSNSMKHETE-CIHKHRKPEKDAPRIPELVAGI  244

Query  1264  VLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSE  1085
             +LG   +  I    Y +Y L+K ++E + KIE+FLEDY+ALKP+RYSYAD+KKIT +F +
Sbjct  245   ILGFLFLGSIAFALYHVYSLDKSQRENRKKIEKFLEDYRALKPSRYSYADMKKITHQFKD  304

Query  1084  KLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYC  905
             KLG+G+YGTVYKGKLS +VFVAVK+LN+SKG+GD  EF+NE++T+G+IHH++VVRLVG+C
Sbjct  305   KLGQGAYGTVYKGKLSNEVFVAVKILNDSKGNGD--EFINEVATMGTIHHVHVVRLVGFC  362

Query  904   ADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRIL  728
             AD F RAL+YE+L N SLEKF+F  N KN  LGW KLQ IALGIAKG+EYLHQGCD+RIL
Sbjct  363   ADRFKRALIYEFLPNESLEKFIFPKNGKNHSLGWLKLQDIALGIAKGIEYLHQGCDKRIL  422

Query  727   HFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVS  548
             HFDIKP NILLD NF PKISDFG AKLCSKE+S+VSMT ARGT+GYIAPEV SRNFGN++
Sbjct  423   HFDIKPHNILLDHNFTPKISDFGLAKLCSKEQSVVSMTTARGTIGYIAPEVLSRNFGNIT  482

Query  547   YKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSK  368
             YKSDVYSFGMLLLEMVGG+K  D+T   +T Q YFPEW+YN L +GEE+ I+IE+  D+K
Sbjct  483   YKSDVYSFGMLLLEMVGGRKNIDVTME-KTGQVYFPEWVYNHLDQGEELHIRIEEEGDAK  541

Query  367   IAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAK------AN  206
             IAKKLTIVGLWCIQWYP+DRPS+K V+QMLE E+   MPPNPFT+TD    K       +
Sbjct  542   IAKKLTIVGLWCIQWYPIDRPSMKAVVQMLEREDNLIMPPNPFTATDRIMVKDRMRINTS  601

Query  205   KPGR-LFTSALEIISEMD  155
             KP R L    LE+I+E++
Sbjct  602   KPPRPLPEKELEVITELE  619



>ref|XP_007010199.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY19009.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=610

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/612 (54%), Positives = 408/612 (67%), Gaps = 44/612 (7%)
 Frame = -2

Query  1936  SYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNAT  1757
             S DR+ C P+ C N  P + +PFRLK  QP  CG  GF+L C +K +T LE         
Sbjct  23    SADRDVCEPKHCKNGQPRVRYPFRLKGRQPDHCGSSGFDLSCNNKNQTVLE---------  73

Query  1756  LQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE---------NLYN  1604
                P  VK L++ ID   + I +   DGC  + L  L LSASPF +          +  N
Sbjct  74    --LPRSVKLLVKRIDYVHQRIHVYDEDGCVQKQLQNLILSASPFMYSSGSDPYYYSDSGN  131

Query  1603  FSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVP  1424
             F++F+CS          + S I CL+  G ++   +S       + L++C K   +S VP
Sbjct  132   FTLFNCSIEDQSDYYDSSWS-IPCLSGSGFYVKYVESD---SGRSYLLNCRKTTDISEVP  187

Query  1423  YSIAQDN-TVFSLRWTGPSCRL--------KNNSTAEDADDCIAPLTKLHTGPLRKLKVA  1271
             Y +  D    F   WT P+C L        + N+T     +C + + +   G   KL ++
Sbjct  188   YGMMDDRKNKFDFNWTKPACGLCEVKGQGCRPNTTNTSGIECYS-IHREDKGARMKLMIS  246

Query  1270  GEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRF  1091
             G  +GS L+++ V+    ++ LNK +K+ Q KIE+FLEDYKALKP+RYSYAD+K+IT++F
Sbjct  247   GLTIGSLLLLLSVIGLCWLHHLNKKEKDGQRKIEQFLEDYKALKPSRYSYADVKRITNQF  306

Query  1090  SEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVG  911
              EKLG+G YGTV+KG LS DV VAVKVLNN KG+G  EEFVNE+ ++G IHH+NV RLVG
Sbjct  307   KEKLGQGGYGTVFKGTLSNDVSVAVKVLNNFKGNG--EEFVNEVGSMGRIHHVNVTRLVG  364

Query  910   YCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQR  734
             +CADG++RALVYEYL N SLEKF+F+   +N FL WEKL +IALGIAKG+EYLHQGC+QR
Sbjct  365   FCADGYNRALVYEYLPNESLEKFIFAAKGENRFLSWEKLHEIALGIAKGIEYLHQGCEQR  424

Query  733   ILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGN  554
             ILHFDIKP NILLDQNF PKISDFG AKLCSKE+S VSMTAARGTMGYIAPEV SRNFGN
Sbjct  425   ILHFDIKPHNILLDQNFTPKISDFGLAKLCSKEQSAVSMTAARGTMGYIAPEVLSRNFGN  484

Query  553   VSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGED  374
             VSYKSDVYSFGMLLLEMVGG+K  D+T + E+ Q YFPEW+YN L +GEE+ I IE    
Sbjct  485   VSYKSDVYSFGMLLLEMVGGRKNIDVTVANES-QVYFPEWVYNRLDKGEELGIDIEDEGH  543

Query  373   SKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPG  197
              KIAKKLTIVGL CIQWYPVDRPS+K V+QMLE E +  +MPPNPF S D       KP 
Sbjct  544   HKIAKKLTIVGLRCIQWYPVDRPSMKSVVQMLEGEADNLTMPPNPFASKD-----EKKPK  598

Query  196   RLFTSALEIISE  161
             +     L  ISE
Sbjct  599   KPINRELAAISE  610



>ref|XP_010646615.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=588

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/608 (52%), Positives = 411/608 (68%), Gaps = 57/608 (9%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++ C   +C  +GP I FPFRLKH QP +CGYPGFE+ C+++  T LE            
Sbjct  21    QDGCKESRCSAHGPVIRFPFRLKH-QPNQCGYPGFEISCSEEKRTMLE-----------L  68

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCSTHR  1574
             P+ VK  ++ I+   + I +S  D C        NLSASPF F + Y  ++ IFSCS  +
Sbjct  69    PYSVKLSVQKINYTSQEIWVSGRDFC-----KNFNLSASPFQFMSAYRSDYIIFSCSESK  123

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSI-----AQ  1409
                    N++P  C   P + +Y+      L S  DL SC+ +++ S   +S+     ++
Sbjct  124   --ADPYKNLNPTHCSFLPNNLVYSVSPEASL-SHLDLSSCSMIYYFSIPSWSVDLGDYSE  180

Query  1408  DNTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL  1259
              N V  + W+ PSC          RL+ ++  E   +C+    K               L
Sbjct  181   YNVV--MNWSRPSCGDCEAKGKRCRLQESNIKEPEIECVDQPPKGLI------------L  226

Query  1258  GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
             G FL++++V++ Y +Y  +K KKE   K+++FLEDY+AL P+RYSYADIKKIT+ F +KL
Sbjct  227   GFFLLLLVVIICYNVYTTDKSKKEHSKKLQKFLEDYRALNPSRYSYADIKKITNLFKDKL  286

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             GEG YGT+YKGKLS +VFVAVK+LN+SK +G  EEF+NE+ T+G IHHINVVRLVG+CAD
Sbjct  287   GEGGYGTIYKGKLSNEVFVAVKILNDSKENG--EEFINEVRTMGRIHHINVVRLVGFCAD  344

Query  898   GFHRALVYEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFD  719
             G+ RAL+YE+L N SLEKF+F       LGW+KL  IALGIAKG+EYLHQGCDQRILHFD
Sbjct  345   GYKRALIYEFLPNESLEKFIFKNQS---LGWQKLHDIALGIAKGIEYLHQGCDQRILHFD  401

Query  718   IKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKS  539
             IKP NILLDQ FNPKISDFG AKLCSKE+S+VSMTAARGTMGYIAPEV SRNFGNVSYKS
Sbjct  402   IKPHNILLDQKFNPKISDFGLAKLCSKEQSVVSMTAARGTMGYIAPEVLSRNFGNVSYKS  461

Query  538   DVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAK  359
             DVYSFGMLLLEMVGG+K SD      T+Q YFPEW+YN L    E+ I+IEK ED+KIAK
Sbjct  462   DVYSFGMLLLEMVGGRKNSDAI-MENTSQMYFPEWLYNHLKHNGEIHIRIEKEEDTKIAK  520

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSA  179
             +L+IVGLWCIQW+P+DRPS+K+V++MLE E+  ++PPNPF S+ P++    +        
Sbjct  521   RLSIVGLWCIQWHPIDRPSMKIVLKMLEGEDNITLPPNPFASSGPTRTNVRRRRTSLQQE  580

Query  178   LEIISEMD  155
             L +ISE++
Sbjct  581   LIVISELE  588



>ref|XP_010662564.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=605

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/603 (51%), Positives = 402/603 (67%), Gaps = 35/603 (6%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             +EC   +C ++GP I FPFRLKH QP  CGYP FEL C+++  T LE            P
Sbjct  25    DECKASRCSHHGPLIRFPFRLKH-QPEHCGYPKFELSCSEEKRTILE-----------LP  72

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRNIT  1565
             +  K  ++ I+   + I +   D C  + +   NLSASPF++E  Y+FS F+CS  +   
Sbjct  73    YSGKLWVKEINYASQEIGVHHSDDCLQRQILNFNLSASPFTYEYAYDFSFFNCSESK---  129

Query  1564  AGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLR  1385
             A S  +  I C     + +YA  SS  L +  +L SC K+F+ +     I        + 
Sbjct  130   AESFWLISIPCSFLSSNPVYATWSSRSL-AEVNLSSCWKIFNATLPENYIYGGEYDTFMN  188

Query  1384  WTGPSC-----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVV  1238
             W+ P C           R KNNST E   +CI    K    P+ K+ +   +LG      
Sbjct  189   WSKPMCGKCEAKGNKCQRKKNNST-EPEIECIDKPAK--GAPMDKMVLTEAILGFLHFTF  245

Query  1237  IVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGT  1058
              + + + +Y  NK+K+E ++ I++FLEDY+ALKP+RYSYADIKKIT+ F +KLG+G YGT
Sbjct  246   GIFIIFIVYCSNKLKREHRINIQKFLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGT  305

Query  1057  VYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALV  878
             VYKGKLS +VFVAVK+L++ KG+G  E+F+NE+ T+ +IHH+NVVRL+G+CADG+ RAL+
Sbjct  306   VYKGKLSNEVFVAVKILDDFKGNG--EDFINEVGTMSTIHHVNVVRLLGFCADGYKRALI  363

Query  877   YEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNI  701
             YE+L N SL+KF+FS    N+ LGW KLQ IA+GIAKG+EYLHQGCDQRILH DIKP NI
Sbjct  364   YEFLPNESLDKFIFSAFGNNYSLGWHKLQDIAIGIAKGIEYLHQGCDQRILHLDIKPHNI  423

Query  700   LLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFG  521
             LLD NFNPKISDFG AKLCSKE+S VSMTAARGTMGYIAPE+ SRNFGNVS KSDVYSFG
Sbjct  424   LLDHNFNPKISDFGLAKLCSKEQSAVSMTAARGTMGYIAPEMLSRNFGNVSSKSDVYSFG  483

Query  520   MLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVG  341
             MLL+EMVGG+K  D T     +Q YFPEW+YN L + +EV I+IE   D KI KKL+I+G
Sbjct  484   MLLIEMVGGRKNIDAT-VENISQAYFPEWLYNHLDQEQEVHIRIEDESDIKITKKLSIIG  542

Query  340   LWCIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPSKAKANKPGRLFTSALEIIS  164
             LWCIQWYP+DRPS+K+V+ MLE EE    MPPNPFTS   ++    +        L +IS
Sbjct  543   LWCIQWYPIDRPSMKIVVGMLEGEEGNLVMPPNPFTSMGQTRTSVRRRKTSIQPELTVIS  602

Query  163   EMD  155
             E++
Sbjct  603   EIE  605



>ref|XP_004235104.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Solanum 
lycopersicum]
Length=635

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/617 (51%), Positives = 421/617 (68%), Gaps = 41/617 (7%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
              ++CLP +CG+ GP I FPF LK+ QP  CGYPGFEL CT K  T     FP+  AT+  
Sbjct  26    HDQCLPTRCGDFGPVIRFPFHLKNHQPSHCGYPGFELSCTSKNITQFNLRFPI-QATINK  84

Query  1747  ---PFPVKFLIESIDCEDRLIIISRVDG-CFLQLLPILNLSASPFSFE-NLYN-FSIFSC  1586
                       +E I+ + + I +S ++  C  + +   N SAS F+F+ N Y  F++F+C
Sbjct  85    FDISISANVSVEEINYKSQTITLSDLNASCLPRQIANTNSSASIFTFDPNAYGGFTLFNC  144

Query  1585  STHRNITAGSINISPIACLTKPGHFIYAADS--SLYLYSATDLISCTKMFHVSSVPYSIA  1412
             S+ +  ++ SI I    CL+ P + + A  S  S+  Y +    SCT M+++S VPY + 
Sbjct  145   SSKQKYSSASIRID---CLSSPQYDVLAFRSYNSISEYPS----SCTMMYNISDVPYELL  197

Query  1411  QDNTVFS-----LRWTGP----------SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLK  1277
                  +S     L W+ P           C++K+NS+  + + CI    +   G  +K+ 
Sbjct  198   YGKQEYSYTRIFLHWSEPFCGNCEEDGKYCKMKSNSSRSETE-CIDIPEEPSKGLSKKVT  256

Query  1276  VAGEVLGS-FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKIT  1100
             VA  V GS F  V++ L  Y+I +L KMKKE+Q +IERFLEDYKAL+P RYSYADIKKIT
Sbjct  257   VA-IVFGSLFAFVLVSLAVYKIVKL-KMKKEDQRRIERFLEDYKALRPTRYSYADIKKIT  314

Query  1099  DRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVR  920
             ++F  KLG+G YG VYKGKLS ++ VAVKVLNN KG+G  E+F+NE+ +IG IHH+NVVR
Sbjct  315   EQFKYKLGQGGYGKVYKGKLSNEILVAVKVLNNFKGEG--EDFINEVGSIGRIHHVNVVR  372

Query  919   LVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNFLG--WEKLQQIALGIAKGVEYLHQG  746
             LVGYCADG+ RALVYEYL N++L+K + S N +      WEK+ QI++GIAKG+EYLHQG
Sbjct  373   LVGYCADGYRRALVYEYLSNDTLQKIISSGNGRGSSSLGWEKMLQISVGIAKGLEYLHQG  432

Query  745   CDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSR  566
             C+QRI+HFDIKP NILLDQ+FNPK++DFG AKLC+KE+S VSMTAARGT+GYIAPEVFSR
Sbjct  433   CNQRIVHFDIKPHNILLDQDFNPKVADFGLAKLCAKEQSAVSMTAARGTIGYIAPEVFSR  492

Query  565   NFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPE--TNQDYFPEWIYNILSRGEEVEIQ  392
             N+G+VSY++D+YSFGMLLL+M+GG+ K D     E  ++Q Y+PEW+Y  L +GEE+ IQ
Sbjct  493   NYGDVSYRADIYSFGMLLLDMIGGRNKFDDAAKAENSSSQIYYPEWMYKQLEKGEEIAIQ  552

Query  391   IEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAK  212
             IE  +++ I KKL IVGLWCIQW+P DRPS+KVVIQML  E  P MPPNPF S + +  K
Sbjct  553   IEHDDENSIIKKLAIVGLWCIQWFPADRPSMKVVIQMLVGEGIPIMPPNPFGSMNSTDMK  612

Query  211   ANKPGRLFTSALEIISE  161
              +     ++S ++  SE
Sbjct  613   TSADRNQYSSEIQRSSE  629



>ref|XP_010247813.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Nelumbo nucifera]
 ref|XP_010247814.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Nelumbo nucifera]
Length=638

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/626 (52%), Positives = 409/626 (65%), Gaps = 61/626 (10%)
 Frame = -2

Query  1930  DRNECLPRKCGNNGPEISFPFRLKH-IQPPECGYPGFELLCTDKGETALENPFPLLNATL  1754
             ++++C    C ++GP+I FPFRLK   Q   CGY G EL CT+K ET LE          
Sbjct  38    NQDDCNVSNCKHHGPDIRFPFRLKEDRQHSRCGYAGLELSCTEKKETKLE----------  87

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPF---------------SF  1619
               PF   FL+++ID   +L+      GC ++ L  LN SASPF               + 
Sbjct  88    -LPFSGAFLVKAIDYRSQLMETYDPQGCIIKRLLRLNFSASPFHQTPSPQLYYGDGIPAP  146

Query  1618  ENLYNFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSS--LYLYSATDLISCTKM  1445
             + ++   I +CS+   I         + CL   G+ +YA   S   +L       SC K+
Sbjct  147   DFVHFIIILNCSSTELIGKAQ----RVNCLEVSGYQVYAVHVSDDQWLQGYMPPPSCRKV  202

Query  1444  FHVSSVPYS------IAQDNTVFSLRWTGPSCR----------LKNNSTAEDADDCIAPL  1313
               +S VP+S      I   +      W  P+C            KN+++         P 
Sbjct  203   RTIS-VPFSDHFLSHINDPDLSIFFSWKSPNCSYCEEKGKRCTWKNHTSGSRIQCLDIPT  261

Query  1312  TKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPA  1133
               +  G +    V G  +G  L+++I +  Y +Y  +K+ K++Q +IE+FL+DYKAL+P 
Sbjct  262   KGVSIGQV----VTGVSVG-LLLLMIAITIYLVYN-SKLSKQDQARIEKFLDDYKALRPR  315

Query  1132  RYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMST  953
             RYSYADIK+IT++F+EKLG+G YG+V+KGKLS ++ VAVKVLN +KG+GD  EF+NE+ST
Sbjct  316   RYSYADIKRITNQFNEKLGQGGYGSVFKGKLSNEILVAVKVLNYAKGNGD--EFINEVST  373

Query  952   IGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGI  776
             IG IHH+NVVRLVG+CADGF RALVYE+L N SLEKF+FS N  N FL WEKLQ+IA+GI
Sbjct  374   IGRIHHVNVVRLVGFCADGFRRALVYEFLPNESLEKFIFSKNANNPFLNWEKLQKIAIGI  433

Query  775   AKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTM  596
             A+G+EYLHQGCDQRILHFDIKP NILLD NFN KISDFG AKLCSK+KSIVSMTAARGTM
Sbjct  434   ARGMEYLHQGCDQRILHFDIKPHNILLDHNFNXKISDFGLAKLCSKDKSIVSMTAARGTM  493

Query  595   GYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILS  416
             GYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGG+K  D T   +T+Q YFPEW+YN LS
Sbjct  494   GYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDAT-EEKTSQVYFPEWVYNHLS  552

Query  415   RGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPF  239
             +GEE+EI++ +  D+KIAKKLTIV LWCIQWYPVDRPS+ VV+QMLE E E   MPPNPF
Sbjct  553   QGEEMEIRVIEDGDAKIAKKLTIVALWCIQWYPVDRPSMNVVVQMLEGEAERLIMPPNPF  612

Query  238   TSTDPSKAKANKPGRLFTSALEIISE  161
              ST      A  P   F   L +I E
Sbjct  613   ASTTKENTNAVNPKMPFHIGLTVIDE  638



>ref|XP_007039000.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY23501.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=573

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/603 (52%), Positives = 395/603 (66%), Gaps = 73/603 (12%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
              +C     G+NG  I FPFRLK + P  CGYPGF+L CT+K +T LE            P
Sbjct  31    QDCPELSWGSNGTAIRFPFRLKGMHPESCGYPGFDLSCTEKNQTLLE-----------LP  79

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRNIT  1565
               V+  +E ID + + I  S  DGC          S      E +Y FS+        + 
Sbjct  80    HSVRVFVERIDYQSQEIYTSHPDGC----------SKGTPKLEFVY-FSL-------PVQ  121

Query  1564  AGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLR  1385
                I+  P++                         SCTK++   S P  +  D  +  L+
Sbjct  122   VDDISKYPLS-------------------------SCTKLYS-GSYPDGMFLD--ILPLK  153

Query  1384  WTGP----------SCRLKNNSTAEDADDCIAPLTKLHT-GPLRKLKVAGEVLGSFLVVV  1238
             WT P           CRLKN+ST    +   AP+    T G +RKL  AG VLGS LVV+
Sbjct  154   WTEPMCGFCEQNGKHCRLKNDSTVAQIERFDAPIKAKGTKGTMRKLVTAGVVLGSRLVVI  213

Query  1237  IVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGT  1058
              ++  Y +Y  NKM+KE   KIE+FLED+++LKP+RYSYADIK+IT++F EKLGEG+YGT
Sbjct  214   AIIAVYYLYSSNKMRKENDAKIEKFLEDHRSLKPSRYSYADIKRITNQFKEKLGEGAYGT  273

Query  1057  VYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALV  878
             V+KG LS ++ VAVK+LN+S GDG  EEF+NE+ T+G IH +NVVRLVG+CADGF RALV
Sbjct  274   VFKGTLSSEIHVAVKILNSSIGDG--EEFINEIGTMGRIHRVNVVRLVGFCADGFRRALV  331

Query  877   YEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNI  701
             YE+L N SLEK +FS + +   LGWEKL  IA+GIAKG+EYLHQGCDQRILHFDIKP NI
Sbjct  332   YEFLPNESLEKLIFSSDGRQHSLGWEKLLDIAIGIAKGIEYLHQGCDQRILHFDIKPHNI  391

Query  700   LLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFG  521
             LLD+ FNPKISDFG AKLCSK++SIVSMTAARGTMGYIAPEV+SRNFGNVSYKSDVYSFG
Sbjct  392   LLDEKFNPKISDFGLAKLCSKDQSIVSMTAARGTMGYIAPEVYSRNFGNVSYKSDVYSFG  451

Query  520   MLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVG  341
             ML+LEMVGG+K  D+T     +Q YFPEW Y+ L++G+E+ I+IE+   + IAK+LTIVG
Sbjct  452   MLILEMVGGRKNVDVT-VESASQVYFPEWAYSRLNQGDELIIRIEEDGHANIAKRLTIVG  510

Query  340   LWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIIS  164
             LWCIQWYPV RPS+K V+QMLE E +  SMPPNPF ST P +   + P R       +IS
Sbjct  511   LWCIQWYPVGRPSMKNVVQMLEGEGDNLSMPPNPFGSTGPIRMNPSMPVRNVHQESAVIS  570

Query  163   EMD  155
             E +
Sbjct  571   ETE  573



>ref|XP_011084503.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Sesamum 
indicum]
Length=634

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/604 (50%), Positives = 396/604 (66%), Gaps = 42/604 (7%)
 Frame = -2

Query  1939  YSYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNA  1760
             ++  ++EC P  C  +GP + FPFRLK  QP  CGYPGF+L C     T  E  FP+  +
Sbjct  19    FAAAQDECEPTSCHASGPVVRFPFRLKGRQPEHCGYPGFDLSCNPNNSTEFEFQFPVRAS  78

Query  1759  TLQPPFPV--KFLIESIDCEDRLIIISRVDG-CFLQLLPILNLSASPFSFENLYN-----  1604
             T      +  +  ++ ID   ++I +S  +G C    +P +N  ASPF     Y+     
Sbjct  79    TRNIVLSISARATVQEIDYRSQVIRVSLFNGSCLPSRVPDVNSPASPFEMYYSYSPGTDG  138

Query  1603  FSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSV-  1427
             F++F+CS              ++CL   G  +YA   S Y  +   + SC KM+++S + 
Sbjct  139   FTLFNCSGKPEDNYSD----RVSCLDHGGFRVYAY-RSYYSVTEASVSSCVKMYNISDIS  193

Query  1426  ------PYSIAQDNTVFSLRWTGPSC----------RLKNNSTAEDADDCI----APLTK  1307
                   P   + DNT   L W+ PSC          R KNN    +  +C      P   
Sbjct  194   EVILYGPREYSVDNT--QLYWSEPSCGSCEARGMYCRSKNNG-PNNGTECFDIPRVPPEP  250

Query  1306  LHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARY  1127
                G  + + +A  V+  FL  ++     R+Y + K K++ Q +IE+FLEDYKAL+P RY
Sbjct  251   KKKGLSKNVVIAVLVVSVFLTALVFAALCRVYTVWKRKRQNQRRIEQFLEDYKALRPTRY  310

Query  1126  SYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIG  947
             ++++IK+ITD F +KLG G YGTVYKGKLS D+ VAVKVLNN KGDG  +EF+NE+ TIG
Sbjct  311   TFSEIKRITDDFKQKLGRGGYGTVYKGKLSSDIPVAVKVLNNIKGDG--QEFINEVGTIG  368

Query  946   SIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKG  767
              IHH+NVVRLVGYCADG+ RALVYE+L N+SLEK++ S    + LGWEK+ +IALGIAKG
Sbjct  369   KIHHVNVVRLVGYCADGYRRALVYEFLENDSLEKYISSGKQSSTLGWEKVHKIALGIAKG  428

Query  766   VEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYI  587
             ++YLHQGC+QRILHFDIKP NILLD N NPK++DFG AKLCSKE+S+V+MTAARGT+GYI
Sbjct  429   IDYLHQGCNQRILHFDIKPHNILLDHNLNPKVADFGLAKLCSKEQSVVTMTAARGTIGYI  488

Query  586   APEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGE  407
             APEVFSRNFG VSYKSD+YS+GMLLL++VGG++     G   ++Q YFPEW+YN L +GE
Sbjct  489   APEVFSRNFGKVSYKSDIYSYGMLLLDLVGGRRNFQANGQDSSSQVYFPEWMYNQLDKGE  548

Query  406   EVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTD  227
             ++ IQIEK +DS I K+L IVGLWCIQWYP DRPS KVVIQMLE E  P MPPNPF    
Sbjct  549   DIAIQIEKEDDSDIVKRLIIVGLWCIQWYPADRPSTKVVIQMLEGENMPIMPPNPFA---  605

Query  226   PSKA  215
             PSK+
Sbjct  606   PSKS  609



>ref|XP_010049259.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Eucalyptus grandis]
 gb|KCW89169.1| hypothetical protein EUGRSUZ_A01482 [Eucalyptus grandis]
Length=604

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/599 (52%), Positives = 396/599 (66%), Gaps = 33/599 (6%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             R+ C P  C  +GP + FPF     Q PECGY GFEL+C D+G TAL  P      T QP
Sbjct  29    RHRCPPTSC-PSGPRVRFPFWFPGRQGPECGYKGFELICDDRGRTALSVP-----NTSQP  82

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY------NFSIFSC  1586
                   L+ESID + + +++    GC    L I NL+ S FS   LY      N+ +F C
Sbjct  83    -----LLVESIDYKSQSVVLHDPTGCLP--LVIANLTQSRFSASKLYSNQDPYNYVLFKC  135

Query  1585  STHRNITAGSINISPIACLTKPGHF-IYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ  1409
                         ++ +AC +KP  + +YA +SS Y+     L+ C +   V  +P  I  
Sbjct  136   PP-----PDRDYMTEVACRSKPPSYRVYAVESSDYV-GNLPLVYCERSGSVDPLPNPIDD  189

Query  1408  DNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGP-LRKLKVAGEVLGSFLVVVIV  1232
                     WT P C+             I      H  P + KL++ G ++GSFL++V +
Sbjct  190   MIDQAQFEWTTPDCKKCAEGLCGWNGSKIECFPPRHGQPAILKLEITGGIVGSFLLLVGL  249

Query  1231  LVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVY  1052
             +    +    +  K  Q+KIE FL DY+ALKP RYSY DIK+IT+ F EKLG+G+YGTVY
Sbjct  250   IGLGYVLNERRRDKAFQLKIESFLHDYEALKPTRYSYNDIKRITNDFEEKLGQGAYGTVY  309

Query  1051  KGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYE  872
             KGKLS ++FVAVK+L+NS G+G  EEF+NE+ST+G IHH+NVVR+VG+CADGF RALVYE
Sbjct  310   KGKLSNEIFVAVKMLDNSFGNG--EEFINEVSTMGRIHHVNVVRMVGFCADGFRRALVYE  367

Query  871   YLVNNSLEKFVFSPND--KNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
             +L N SLEKF+F   D    FL WE+L  IALG+AKG+EYLHQGCD +ILHFDIKP NIL
Sbjct  368   FLPNESLEKFIFQGEDTLDPFLSWERLHDIALGVAKGIEYLHQGCDHKILHFDIKPHNIL  427

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LD NFNPKI+DFG AKLCSKE+S VSMTAARGTMGYIAPEVFSRNFG+VS KSDVYSFGM
Sbjct  428   LDDNFNPKIADFGLAKLCSKEQSAVSMTAARGTMGYIAPEVFSRNFGSVSSKSDVYSFGM  487

Query  517   LLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGL  338
             LLLEMVGG+K  D+      +Q YFP+W+YN L++GEE+EI+I +  D KIA+KL IVGL
Sbjct  488   LLLEMVGGRKNVDVNAK-NMSQMYFPQWVYNHLNKGEELEIRIREDGDCKIARKLAIVGL  546

Query  337   WCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISE  161
             WCI WYP DRP +KVV+QMLE EE P MP NPF S++  +A A   GRL+ + LE+I E
Sbjct  547   WCIHWYPADRPPVKVVVQMLEGEECPVMPKNPFVSSNSGEA-ATMQGRLWNTNLEVIEE  604



>ref|XP_011037052.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Populus euphratica]
Length=595

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/589 (51%), Positives = 409/589 (69%), Gaps = 32/589 (5%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CGN GP+I FPFR+K  QP  CGY GF+L C++   T L+ P  L              I
Sbjct  33    CGNRGPDIRFPFRIKDKQPDHCGYHGFDLSCSEDNSTVLKLPTGL-----------SLHI  81

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPI-LNLSASPFSFEN--LYNFSIFSCSTHRNITAGSI  1553
             E ID   +LI      GCFL+   +  +L AS F  E+  L ++++F+CS     +    
Sbjct  82    ERIDYIYQLIYARVPQGCFLRQRRLNFSLGASHFQIESYSLCDYTLFNCSL---SSDSRS  138

Query  1552  NISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTGP  1373
             ++  I CL+   H +YA  SS+ + S +DL+SCTKM+++  +P+ + Q+  +  + W+ P
Sbjct  139   SMYKIPCLSTHKHEVYAVGSSISI-SDSDLLSCTKMYNIYGIPHGMVQEEYLLPISWSYP  197

Query  1372  SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMK  1193
             +C      ++E       P TK      RKL + G +LG  L  V++   YR Y  +K +
Sbjct  198   TC-----GSSETKCYSNPPHTK---DVRRKLLITGVILGLLLFAVVITALYRAYSNDKTQ  249

Query  1192  KEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVK  1013
             +E Q ++E FL+DY++L P RYSYAD+K+IT++F ++LG+G+YGTV+KGKL+ ++ VAVK
Sbjct  250   REYQARVEMFLDDYRSLNPTRYSYADLKRITNQFGDELGQGAYGTVFKGKLTNEITVAVK  309

Query  1012  VLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFS  833
             +LNNS G G  EEF+NE+ T+ SIHH+NVVRL+G+CADGF RALVYEYL N+SL+KF+ S
Sbjct  310   LLNNSIGKG--EEFINEVGTMASIHHVNVVRLIGFCADGFRRALVYEYLPNDSLQKFISS  367

Query  832   PNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQ  656
              + +N FLGWE+L ++ALGIA+G+EYLHQGCDQRILHFDIKP+NILLD  FNPKI+DFG 
Sbjct  368   ADSRNHFLGWERLNRVALGIAEGIEYLHQGCDQRILHFDIKPQNILLDNEFNPKIADFGM  427

Query  655   AKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDI  476
             AKLCSK+KS +SMT ARGT+GYIAPEVFSRNFGNVSYKSDVYSFGML+LEMVGG+K  D 
Sbjct  428   AKLCSKDKSAISMTTARGTVGYIAPEVFSRNFGNVSYKSDVYSFGMLVLEMVGGRKNVDD  487

Query  475   TGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIK  296
             T +   +Q YFPEWIYN+L + E++   I+  ED++IAKKL IVGLWCIQW P +RPS+K
Sbjct  488   T-AENGDQIYFPEWIYNLLEKEEDLRFHIDGEEDARIAKKLAIVGLWCIQWNPAERPSMK  546

Query  295   VVIQMLEAE-EPPSMPPNPFTSTDPSKAKANK-PGRLFTSALEIISEMD  155
              V+QMLE E E  + PP+PF+S+ P +  A + P R     L  ISE++
Sbjct  547   TVVQMLEGEGENLTKPPDPFSSSVPKRTSAGRMPARRLHQELAAISEIE  595



>ref|XP_007010207.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY19017.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=577

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/586 (54%), Positives = 391/586 (67%), Gaps = 56/586 (10%)
 Frame = -2

Query  1936  SYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNAT  1757
             S D++ C P+ C    P + +PFRLK  QP  CG  GF+L C +K +T LE         
Sbjct  25    SPDQDACEPKHCKPGQPSVRYPFRLKGRQPDHCGSSGFDLSCNNKNQTVLE---------  75

Query  1756  LQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTH  1577
                P  VK L++ ID  ++ I +   DGC  + L  L L ASPF+               
Sbjct  76    --LPRSVKLLVKHIDYVNQRIQVYDEDGCVQKQLQNLTLFASPFT---------------  118

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDN-T  1400
                         I+CL+ PG ++   DS    Y   DL++C+K   +  +P  +  D   
Sbjct  119   ------------ISCLSVPGFYVEYFDSDDGGY---DLLNCSKTIDIIDIPRGLMSDQKN  163

Query  1399  VFSLRWTGPSCR--------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLV  1244
              F   WT P+C          + N+T     +C   +   H G   KL ++G  +GS L+
Sbjct  164   KFYFSWTNPACGSCEIQGKGCRRNTTKALGIECYY-IHMDHKGARMKLMISGLTIGSLLL  222

Query  1243  VVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSY  1064
             ++ V+    ++ LNK +KE Q KIE+FLEDYKALKP+RYSYADIK+IT++F EKLG+G Y
Sbjct  223   LLSVIGLCWLHHLNKKEKEGQRKIEQFLEDYKALKPSRYSYADIKRITNQFKEKLGQGGY  282

Query  1063  GTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRA  884
             GTV+KG LS DV VAVKVLNN KG+G  EEFVNE+ ++G IHH+NV RLVG+CADG++RA
Sbjct  283   GTVFKGTLSNDVSVAVKVLNNFKGNG--EEFVNEVGSMGRIHHVNVTRLVGFCADGYNRA  340

Query  883   LVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPR  707
             LVYEYL N SLEKF+F+   +N FL WEKL +IALGIAKG+EYLHQGC+QRILHFDIKP 
Sbjct  341   LVYEYLPNESLEKFIFAAKGENRFLSWEKLHEIALGIAKGIEYLHQGCEQRILHFDIKPH  400

Query  706   NILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYS  527
             NILLDQNF PKISDFG AKLCSKE+S VSMTAARGTMGYIAPEV SRNFGNVSYKSDVYS
Sbjct  401   NILLDQNFTPKISDFGLAKLCSKEQSAVSMTAARGTMGYIAPEVLSRNFGNVSYKSDVYS  460

Query  526   FGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTI  347
             FGMLLLEMVGG+K  D+T + E+ Q YFPEW+YN L +GEE+ I IE     KIAKKLTI
Sbjct  461   FGMLLLEMVGGRKNIDVTVANES-QVYFPEWVYNRLDKGEELGIDIEDEGHHKIAKKLTI  519

Query  346   VGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAK  212
             VGL CIQWYPVDRPS+K V+QMLE E +  +MPPNPF S D  K K
Sbjct  520   VGLRCIQWYPVDRPSMKSVVQMLEGEADNLTMPPNPFASKDEKKPK  565



>ref|XP_008232076.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=605

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/611 (51%), Positives = 399/611 (65%), Gaps = 49/611 (8%)
 Frame = -2

Query  1927  RNECLPRKCGNN-GPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             ++ C   KC ++ G  I FPF L+H     CG PG E  C+ + E  LE    L      
Sbjct  24    QDTCAESKCSDDHGLAIHFPFHLEH----RCGDPGLE--CSGRQEKVLEEQVAL------  71

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPIL--NLSASPFSF--ENLYNFSIFSCS  1583
                 VKF ++SID +  LI +   DGC L L+P+   N+  SPF     N+ N + F C 
Sbjct  72    ----VKFFVKSIDYKRGLIEVYNPDGCLL-LMPLETPNIPVSPFHLLDSNIRNVTFFLCP  126

Query  1582  THRNITAGSINISPIACLTK-PGHFIYAADSSLYLYSA-TDLISCTKMFHVSSVPYS--I  1415
             T   +    I    + CL+  PG+ +Y   S   L+     L SCT+M+ V SVP+   +
Sbjct  127   T---LAERDIYAYQVPCLSSSPGYRVYGVSSFFQLFDHFPALQSCTRMYDVLSVPFGTWV  183

Query  1414  AQDNTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGE  1265
               D+ +   +W+ P+C          RL  N    + + CI       T    +    G 
Sbjct  184   GVDSYILRFKWSEPNCTECEAEGKRCRLNKNGIKSEVE-CIHVRKASKT---MEFVATGA  239

Query  1264  VLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSE  1085
              LGS  ++V+V+  YR+Y  ++ +KE Q+KIERFL DYKALKP+RYSYADIK+IT++F +
Sbjct  240   TLGSSFLLVLVIAVYRVYSADQKEKENQLKIERFLADYKALKPSRYSYADIKRITNQFKD  299

Query  1084  KLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYC  905
             KLG+G+YGTV+KGKLS + FVAVKVLNNSKG+G  EEFVNE+  +G IHH+NVVRLVG+C
Sbjct  300   KLGQGAYGTVFKGKLSSEFFVAVKVLNNSKGNG--EEFVNEVGMMGHIHHVNVVRLVGFC  357

Query  904   ADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRIL  728
             ADGF RALVYE+  N SL+ F+ S + KN FLGWEKL  IA+GIAKG+EYLHQGCD RIL
Sbjct  358   ADGFRRALVYEFFPNGSLQDFISSADSKNSFLGWEKLHDIAVGIAKGIEYLHQGCDLRIL  417

Query  727   HFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVS  548
             HFDIKP N+LLD NF PKISDFG AKLCSK++S+VSMT ARGTMGYIAPEVFSRNFGNVS
Sbjct  418   HFDIKPHNVLLDHNFTPKISDFGLAKLCSKDQSMVSMTTARGTMGYIAPEVFSRNFGNVS  477

Query  547   YKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSK  368
             YKSDVYSFGMLLLEMVGG+K    + + + N+ Y+PEWIYN+L  G+++ I I    D K
Sbjct  478   YKSDVYSFGMLLLEMVGGRKNIG-SSTKDANEIYYPEWIYNLLEGGDDLRIHIGDDGDGK  536

Query  367   IAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLF  188
             I K L IVGLWCIQW+PVDRPS+++ + MLE  +  +MPPNPF S  P+   A+ P    
Sbjct  537   IPKTLAIVGLWCIQWHPVDRPSMQIAVHMLEGGDNLAMPPNPFVSAGPTTTHASIPANRL  596

Query  187   TSALEIISEMD  155
                LE I E++
Sbjct  597   E--LEAIPELE  605



>ref|XP_010247811.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Nelumbo nucifera]
Length=634

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/621 (53%), Positives = 408/621 (66%), Gaps = 54/621 (9%)
 Frame = -2

Query  1930  DRNECLPRKCGNNGPEISFPFRLKH-IQPPECGYPGFELLCTDKGETALENPFPLLNATL  1754
             +++ C   +C ++GP I FPFRLK   Q   CGYPGFEL CT   ET LE          
Sbjct  37    NQDNCTISECKHHGPAIRFPFRLKEDRQQSHCGYPGFELSCTANKETKLE----------  86

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPF------SFENLYNFSI-  1595
               PF   FL+++ID   +LI      GC ++ L  LN S SPF         + Y+  I 
Sbjct  87    -LPFSGAFLVKAIDYRSQLIEXYDPQGCIIKRLLHLNFSTSPFHQTLSSDGNDYYDLIII  145

Query  1594  FSCS-THRNITAGSINISPIACLTKPGHFIYAAD--SSLYLYSATDLISCTKMFHVSSVP  1424
              +CS T     A  IN     CL   G+ ++A       +L       SC K+  +S VP
Sbjct  146   LNCSSTELRGKAHRIN-----CLEVSGYQVFAVHVLDDDWLSGYMPPPSCHKVRTIS-VP  199

Query  1423  YS------IAQDNTVFSLRWTGPSCRLKN---------NSTAEDADDCIAPLTKLHTGPL  1289
             +S      I   ++     W  P+C   N         N+T+  +  C+   TK  +G  
Sbjct  200   FSNHFLSHINDPDSSLXFGWKSPNCSYCNEKGKRCAFKNNTSTGSIWCLDIPTKGESG--  257

Query  1288  RKLKVAGEVLGSFLVVVIVLVTYRIYRL--NKMKKEEQVKIERFLEDYKALKPARYSYAD  1115
              K  + G  +G  LV + +L +  IY +  +K+ KE+Q +IE+FLEDY+AL+P RYSYAD
Sbjct  258   -KQLLTGLTIGLILVEIAILTSITIYFVYNSKLDKEDQARIEKFLEDYQALRPTRYSYAD  316

Query  1114  IKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHH  935
             IK+IT++F EKLG+G YG+V+KGKLS ++ VAVKVLN SKG+G  EEF+NE+STIG IHH
Sbjct  317   IKRITNQFKEKLGQGGYGSVFKGKLSNEILVAVKVLNYSKGNG--EEFINEVSTIGRIHH  374

Query  934   INVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEY  758
             +NVVRLVG+CADGF RALVYE+L N SLEKF+FS +  N  L  EKL  IA+GIAKG+EY
Sbjct  375   VNVVRLVGFCADGFRRALVYEFLPNESLEKFIFSKDANNPSLDSEKLMDIAMGIAKGIEY  434

Query  757   LHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPE  578
             LHQGCDQRILHFDIKP NILLD NFNPKISDFG AKLCSK+KSIVSMTAARGTMGYIAPE
Sbjct  435   LHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKDKSIVSMTAARGTMGYIAPE  494

Query  577   VFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYN-ILSRGEEV  401
             VFSRNFGNVSYKSDVYSFGMLLLEMVGG+K  D T   +++Q YFPEWIYN ++S+GEE+
Sbjct  495   VFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDTT-VEKSSQAYFPEWIYNHLISQGEEL  553

Query  400   EIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDP  224
             +I+I +  D KI ++LTIV LWCIQWYPVDRPS+K V+QMLE + E   MPPNPF ST  
Sbjct  554   KIRIAEDGDGKIERRLTIVALWCIQWYPVDRPSMKAVVQMLEGDAENLIMPPNPFASTTK  613

Query  223   SKAKANKPGRLFTSALEIISE  161
             +      P + F + L II E
Sbjct  614   TNTSGVNPKKPFHTGLTIIEE  634



>ref|XP_010275239.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nelumbo nucifera]
Length=617

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/609 (53%), Positives = 403/609 (66%), Gaps = 46/609 (8%)
 Frame = -2

Query  1924  NECLPRKCGN--NGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             + C    C +  NGP + FPF L+  QP  CGYPGFEL C++  ET L  PF  +     
Sbjct  34    DNCTVSGCKDHGNGPSVRFPFWLRGRQPDHCGYPGFELSCSENKETVLNLPFSGI-----  88

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFS--FENLYNFSIFSCSTH  1577
                   F +++ID   ++I I    GC ++ L  LN S+SPF   +E + ++S+F+CS  
Sbjct  89    ------FFVKAIDYRSQVIEIYDPHGCIVKRLLNLNFSSSPFQRRYEYVKSYSLFNCSA-  141

Query  1576  RNITAGSINISPIACL-TKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
                T     + PI CL     H +YA DS+  +     L SC K  +VS    S    N 
Sbjct  142   ---TESGNGVYPINCLRVSAAHPVYAVDSTRSMNFLPPLSSCEKFGNVSVDTKSSYDPNW  198

Query  1399  VFSL--RWTGPSC-RLKNNSTA---EDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVV  1238
               +L  +W  P C + +  S A    +     AP  +    P +     G  +G  L+VV
Sbjct  199   DLALLIKWKAPDCSKCEAESKACGLNNHTSVGAPTIQCFDFPPQ-----GITIGIVLLVV  253

Query  1237  IVLV---TYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGS  1067
               L+    Y +Y  NK++K+ Q  +E+FL+DYKALKP+RYSYA+IK+IT+ F +KLG+G 
Sbjct  254   ATLMLIKVYHVYASNKVEKQNQAMVEKFLDDYKALKPSRYSYAEIKRITNNFKDKLGQGG  313

Query  1066  YGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHR  887
             YG+V+KG LS D+ VAVKVLNNSKG+G  EEF+NE+ TIG IHH+NVVRLVG+CADGF R
Sbjct  314   YGSVFKGNLSNDILVAVKVLNNSKGNG--EEFINEVGTIGRIHHVNVVRLVGFCADGFRR  371

Query  886   ALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             ALVYE+L N SLEKF+FS + KN  LGWEKL  IA+GIAKG++YLHQGC+QRILHFDIKP
Sbjct  372   ALVYEFLPNESLEKFIFSRDAKNPSLGWEKLHIIAVGIAKGIDYLHQGCEQRILHFDIKP  431

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
              NILLD + NPKISDFG AKLCSK+ S+VSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY
Sbjct  432   HNILLDHSLNPKISDFGLAKLCSKDVSVVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  491

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGED--SKIAKK  356
             SFGMLLLEMVGG+K  D+     T+Q YFPEWIYN L +GEE+EI+ ++  D  S+I KK
Sbjct  492   SFGMLLLEMVGGRKNIDLRAE-RTSQVYFPEWIYNRLIQGEELEIREDEDGDSNSRIVKK  550

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPF---TSTDPSKAKANKPGRLF  188
             LT V LWCIQWYP DRPS+K V+QMLE + E  SMPPNPF   TS + S     KP  L 
Sbjct  551   LTTVALWCIQWYPADRPSMKDVVQMLEGDAESLSMPPNPFASATSINTSMLNTKKP--LH  608

Query  187   TSALEIISE  161
                L +I+E
Sbjct  609   QGGLTVIAE  617



>ref|XP_004308545.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Fragaria vesca subsp. vesca]
Length=1011

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/578 (54%), Positives = 399/578 (69%), Gaps = 42/578 (7%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CG +GP I FPF  K   P   GYPGF + C +K ET            L  P PVKF+I
Sbjct  27    CGKHGPVIKFPFSFKGSHPENPGYPGFLVSCNEKKET-----------ILVLPIPVKFVI  75

Query  1723  ESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFE--NLYNFSIFSCSTHRNITAGSI  1553
             ++I  + + I +   + C L +LL + N+S  PF +    + + ++F+CS+    +  S 
Sbjct  76    KTIYHKAQKIQLYDPEDCLLAKLLKVHNMSIFPFHYSEYQMTDITLFNCSSAERESPAS-  134

Query  1552  NISPIACLTK-PGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV-FSLRWT  1379
             ++  + CL + PG+ IY   SS Y      L+SCTKM ++SSVP+    D T    L W+
Sbjct  135   SLYSVPCLVEGPGYQIYWVSSS-YGIEYLPLLSCTKMRNLSSVPF---MDKTRELYLEWS  190

Query  1378  GPSCRL----------KNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVL  1229
              P+CRL          KNN T     +C   L     G  + L   G  LGSF++V++  
Sbjct  191   EPNCRLCEAQGKICGLKNNGTTSTEIEC---LLMKKGGSGKTLVATGTSLGSFVLVLLAG  247

Query  1228  VTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYK  1049
               Y  Y  ++ +K+ Q+KIE FLEDY+AL+P+RYSY+DIK+ITD+F +KLG+G+YGTVYK
Sbjct  248   AAYHAYSSDRKEKQNQLKIETFLEDYRALRPSRYSYSDIKRITDQFKDKLGQGAYGTVYK  307

Query  1048  GKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEY  869
             GKLS + FVAVKVL ++KGDG  EEF NE+ T+G IHH+NVVRLVG+CADGF RALVY++
Sbjct  308   GKLSSECFVAVKVLTSTKGDG--EEFFNEVGTMGHIHHVNVVRLVGFCADGFRRALVYDF  365

Query  868   LVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLD  692
             L N SL+ F+ S ++ N FLGW+KLQ IALGIAKG+EYLHQGCDQRILHFDIKP N+LLD
Sbjct  366   LPNGSLQDFISSADNNNSFLGWDKLQYIALGIAKGIEYLHQGCDQRILHFDIKPHNVLLD  425

Query  691   QNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLL  512
              NF PKISDFG AKLCSK++SIVSMT ARGTMGYIAPEVFSRNFGNVSYKSDVYS+GM+L
Sbjct  426   HNFTPKISDFGLAKLCSKDQSIVSMTTARGTMGYIAPEVFSRNFGNVSYKSDVYSYGMVL  485

Query  511   LEMVGGKKK--SDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGL  338
             LE+VGG+K   S    +PE    Y+PEWIYN+L  GE++ I + +  D+KIAK+L IVGL
Sbjct  486   LEIVGGRKNISSTTENAPEV---YYPEWIYNLLEEGEDLRIHVGEEADAKIAKRLAIVGL  542

Query  337   WCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDP  224
             WCIQW+PVDRPS+K V+QMLE  E  +MPPNPF S DP
Sbjct  543   WCIQWHPVDRPSMKGVVQMLEGGENLTMPPNPFASQDP  580


 Score =   259 bits (661),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 147/338 (43%), Positives = 193/338 (57%), Gaps = 66/338 (20%)
 Frame = -2

Query  1231  LVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVY  1052
             ++   I++  +        IE FL       P RYSY++IKK++  F +KLG G YG+V+
Sbjct  718   MIALLIHKWRRRHWSTYRTIEDFLHS-DNFMPIRYSYSNIKKMSAGFKDKLGVGGYGSVF  776

Query  1051  KGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYE  872
             K KL                      F++E++TIG IHH+NVV+LVGYC +G  RALVY+
Sbjct  777   KCKL--------------------RNFMSEVATIGRIHHVNVVQLVGYCVEGSKRALVYD  816

Query  871   YLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLD  692
             ++ N SL+++++S          K + I L I    EYLHQGC+ +ILHFDIKP NILLD
Sbjct  817   FMPNGSLDRYIYS----------KEESITLSI----EYLHQGCEMQILHFDIKPHNILLD  862

Query  691   QNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLL  512
             +NF PKISDFG AKL     SIVS  AARGTMGYIAPE+F +N G VSYK+DVYSFGMLL
Sbjct  863   ENFVPKISDFGLAKLYPANNSIVSSMAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLL  922

Query  511   LEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWC  332
             +EM                              G+++EI     E+ K+ +K+ +  LWC
Sbjct  923   MEM------------------------------GKDLEIGDATAEEKKLIRKMIVAALWC  952

Query  331   IQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPS  221
             IQ  P DRPS+K V QML  + E   MPP P     P+
Sbjct  953   IQMKPSDRPSMKRVTQMLVGDVENLKMPPKPSLCPQPT  990



>ref|XP_010662817.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=617

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/611 (50%), Positives = 400/611 (65%), Gaps = 39/611 (6%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             +EC   +C ++GP I FPFRLKH QP  CGYP FEL C+++  T LE            P
Sbjct  25    DECKASRCSHHGPVIRFPFRLKH-QPEHCGYPEFELSCSEEKRTILE-----------LP  72

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY---NFSIFSCSTH-  1577
                K  ++ I+   + I++          +   NLSA PF F++ Y   NFS F+CS   
Sbjct  73    SSGKLWVKEINYTSQEIVLWYPRDYLQWQILNFNLSAFPFQFKDEYTYSNFSFFNCSEDI  132

Query  1576  -RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYS----IA  1412
                ++     +  I C     + +Y A SS Y  +  +L SC K+F+ +   Y     + 
Sbjct  133   TNQLSYADNQLWSIPCSILSSNPVYVAPSS-YSLAEVNLSSCRKIFNATLPEYYTYNYMV  191

Query  1411  QDNTVFSLRWTGP----------SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEV  1262
                  F + W+ P           C+ K N++ E   +CI    K    P+ K+ +   +
Sbjct  192   YHEREFYMNWSKPMCGNCEAKGNKCQRKKNNSREPEIECIDKPAK--GAPMDKMVLTEAI  249

Query  1261  LGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
             LG       + + + +YR NK+K+E ++ I++FLEDY+ALKP+RYSYADIKKIT+ F +K
Sbjct  250   LGFLHFTFGIFIIFIVYRSNKLKREHRINIQKFLEDYRALKPSRYSYADIKKITNNFKDK  309

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             LG+G YGTVYKGKLS +VFVAVK+L+  KG+G  EEF+NE+ T+ +IHH+NVVRL+G+CA
Sbjct  310   LGQGGYGTVYKGKLSNEVFVAVKILDGFKGNG--EEFINEVGTMSTIHHVNVVRLLGFCA  367

Query  901   DGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILH  725
             DG+ RAL+YE+L N SL+KF+FS    N+ LGW KLQ+IA+GIAKG+EYLHQGCDQRILH
Sbjct  368   DGYKRALIYEFLPNESLDKFIFSAFGNNYSLGWHKLQEIAIGIAKGIEYLHQGCDQRILH  427

Query  724   FDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSY  545
              DIKP NILLD N NPKISDFG AKLCSKE+S VSMTAARGTMGYIAPE+ SRNFGNVSY
Sbjct  428   LDIKPHNILLDHNSNPKISDFGLAKLCSKEQSAVSMTAARGTMGYIAPEMLSRNFGNVSY  487

Query  544   KSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKI  365
             KSDVYSFGMLL+EMVGG+K  D T    T+Q YFPEW+YN L + +EV I+IE   D KI
Sbjct  488   KSDVYSFGMLLIEMVGGRKNIDAT-VENTSQAYFPEWLYNHLDQEQEVHIRIEDESDIKI  546

Query  364   AKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPSKAKANKPGRLF  188
             AKKL+I+GLWCIQWYP+DRPS+K+VI MLE E     MPPNPFTS   ++    +     
Sbjct  547   AKKLSIIGLWCIQWYPIDRPSMKIVIGMLEREGGNLVMPPNPFTSMGQTRTSVRRRITSI  606

Query  187   TSALEIISEMD  155
                L +I+E++
Sbjct  607   QPELTVITEIE  617



>ref|XP_010275238.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nelumbo nucifera]
Length=626

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/613 (52%), Positives = 404/613 (66%), Gaps = 45/613 (7%)
 Frame = -2

Query  1924  NECLPRKCGN--NGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             + C    C +  NGP + FPF L+  QP  CGYPGFEL C++  ET L  PF  +     
Sbjct  34    DNCTVSGCKDHGNGPSVRFPFWLRGRQPDHCGYPGFELSCSENKETVLNLPFSGI-----  88

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFS--FENLYNFSIFSCSTH  1577
                   F +++ID   ++I I    GC ++ L  LN S+SPF   +E + ++S+F+CS  
Sbjct  89    ------FFVKAIDYRSQVIEIYDPHGCIVKRLLNLNFSSSPFQRRYEYVKSYSLFNCSA-  141

Query  1576  RNITAGSINISPIACL-TKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
                T     + PI CL     H +YA DS+  +     L SC K  +VS    S    N 
Sbjct  142   ---TESGNGVYPINCLRVSAAHPVYAVDSTRSMNFLPPLSSCEKFGNVSVDTKSSYDPNW  198

Query  1399  VFSL--RWTGPSC-RLKNNSTA---EDADDCIAPLTKLHTGP-----LRKLKVAGEVLGS  1253
               +L  +W  P C + +  S A    +     AP  +    P      +++ +   +   
Sbjct  199   DLALLIKWKAPDCSKCEAESKACGLNNHTSVGAPTIQCFDFPPQGSSTKQIVIGITIGIV  258

Query  1252  FLVVVIVLV--TYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
              LVV  +++   Y +Y  NK++K+ Q  +E+FL+DYKALKP+RYSYA+IK+IT+ F +KL
Sbjct  259   LLVVATLMLIKVYHVYASNKVEKQNQAMVEKFLDDYKALKPSRYSYAEIKRITNNFKDKL  318

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             G+G YG+V+KG LS D+ VAVKVLNNSKG+G  EEF+NE+ TIG IHH+NVVRLVG+CAD
Sbjct  319   GQGGYGSVFKGNLSNDILVAVKVLNNSKGNG--EEFINEVGTIGRIHHVNVVRLVGFCAD  376

Query  898   GFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
             GF RALVYE+L N SLEKF+FS + KN  LGWEKL  IA+GIAKG++YLHQGC+QRILHF
Sbjct  377   GFRRALVYEFLPNESLEKFIFSRDAKNPSLGWEKLHIIAVGIAKGIDYLHQGCEQRILHF  436

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DIKP NILLD + NPKISDFG AKLCSK+ S+VSMTAARGTMGYIAPEVFSRNFGNVSYK
Sbjct  437   DIKPHNILLDHSLNPKISDFGLAKLCSKDVSVVSMTAARGTMGYIAPEVFSRNFGNVSYK  496

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGED--SK  368
             SDVYSFGMLLLEMVGG+K  D+     T+Q YFPEWIYN L +GEE+EI+ ++  D  S+
Sbjct  497   SDVYSFGMLLLEMVGGRKNIDLRAE-RTSQVYFPEWIYNRLIQGEELEIREDEDGDSNSR  555

Query  367   IAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPF---TSTDPSKAKANKP  200
             I KKLT V LWCIQWYP DRPS+K V+QMLE + E  SMPPNPF   TS + S     KP
Sbjct  556   IVKKLTTVALWCIQWYPADRPSMKDVVQMLEGDAESLSMPPNPFASATSINTSMLNTKKP  615

Query  199   GRLFTSALEIISE  161
               L    L +I+E
Sbjct  616   --LHQGGLTVIAE  626



>ref|XP_006350636.1| PREDICTED: probable receptor-like protein kinase At5g39030-like 
[Solanum tuberosum]
Length=635

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/613 (51%), Positives = 419/613 (68%), Gaps = 41/613 (7%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
              ++CLP  CG+ GP I FPFRL++ QP  CGYPGFEL CT K  T     FP+  AT+  
Sbjct  26    HDQCLPTTCGDFGPVIRFPFRLQNHQPSHCGYPGFELSCTSKNVTQFNLQFPI-QATINK  84

Query  1747  ---PFPVKFLIESIDCEDRLIIISRVDG-CFLQLLPILNLSASPFSFE-NLYN-FSIFSC  1586
                       ++ I+ + + I +S ++  C  + +  +N SAS F+F  N Y  F++F+C
Sbjct  85    VDISISANVSVQEINYKSQTITLSDLNASCLPRHIANINSSASIFTFNPNAYGGFTLFNC  144

Query  1585  STHRNITAGSINISPIACLTKPGHFIYAADS--SLYLYSATDLISCTKMFHVSSVPYSIA  1412
             S+ +  ++ SI I+   CL+ P + + A  S  S+  Y +    SCT M+++S VP  + 
Sbjct  145   SSKQTYSSSSIRIN---CLSSPQYDVLAFRSYNSISEYPS----SCTTMYNISDVPDEVL  197

Query  1411  QDNTVFS-----LRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLK  1277
                  +S     LRW+          G  C+LK NS++ + + C+    +   G  +K+ 
Sbjct  198   FGKQEYSYTRIYLRWSVPFCGNCEEHGKYCKLKYNSSSSETE-CVDIPEEPSKGLSKKVT  256

Query  1276  VAGEVLGS-FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKIT  1100
             VA  VLGS F  V++ L  Y+I +L KMKKE+Q +IERFLEDYKAL+P RYSYADIKKIT
Sbjct  257   VA-IVLGSLFAFVLVSLAVYKIVKL-KMKKEDQKRIERFLEDYKALRPTRYSYADIKKIT  314

Query  1099  DRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVR  920
             ++F  KLG+G YG VYKGKLS ++ VAVKVLNN KG+G  E+F+NE+ +IG IHH+NVVR
Sbjct  315   EQFKYKLGQGGYGKVYKGKLSNEILVAVKVLNNFKGEG--EDFINEVGSIGRIHHVNVVR  372

Query  919   LVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNFLG--WEKLQQIALGIAKGVEYLHQG  746
             LVGYCADG+ RALVYEYL N++L+K + S N +      WEK+ QI++GIAKG+EYLHQG
Sbjct  373   LVGYCADGYRRALVYEYLSNDTLQKIISSGNGRGSSSLGWEKMLQISVGIAKGLEYLHQG  432

Query  745   CDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSR  566
             C+QRI+HFDIKP NILLDQ+FNPK++DFG AKLC+KE+S VSMTAARGT+GYIAPEVFSR
Sbjct  433   CNQRIVHFDIKPHNILLDQDFNPKVADFGLAKLCAKEQSAVSMTAARGTIGYIAPEVFSR  492

Query  565   NFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPE--TNQDYFPEWIYNILSRGEEVEIQ  392
             N+G+VSY++D+YSFGMLLL+M+GG+ K D     E  ++Q Y+PEW+Y  L +GEE+ IQ
Sbjct  493   NYGDVSYRADIYSFGMLLLDMIGGRNKFDDAAKAENSSSQIYYPEWMYKQLEKGEEIAIQ  552

Query  391   IEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAK  212
             IE  +++ I KKL IVGLWCIQW+P DRPS+KVVIQML  E  P MPPNPF S + +  K
Sbjct  553   IENEDENSIIKKLAIVGLWCIQWFPADRPSMKVVIQMLVGEGIPIMPPNPFGSMNSTDMK  612

Query  211   ANKPGRLFTSALE  173
              +       S ++
Sbjct  613   TSAERSQLNSEIQ  625



>gb|EYU32407.1| hypothetical protein MIMGU_mgv1a020426mg [Erythranthe guttata]
Length=588

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/606 (51%), Positives = 404/606 (67%), Gaps = 58/606 (10%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             ++C+P +C NNGP I FPFR  + QP  CGYPGF+L C  K            N  L  P
Sbjct  22    DDCMPIRCRNNGPIIRFPFRHTNRQPQRCGYPGFDLFCDHKN-----------NTLLVLP  70

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCS--TH  1577
             F V  +++ I+   + +++   + CF Q LP+LNLSASPF F  + L N+++F+CS  + 
Sbjct  71    FSVNVIVKKINYVSQRVLVYDQEKCFPQKLPLLNLSASPFRFLIKFLDNYTLFNCSDPSR  130

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
             R+++        + CL       YA DS L + S   L SCTK +   SVP+ I Q+N  
Sbjct  131   RDLSI------VVPCLGDSTCQFYAVDSKLSMESLP-LTSCTKTYEFKSVPWKIFQEND-  182

Query  1396  FSLRWTGPSCRL----------KNNSTAEDADDCIAPL-TKLHTGPLRKLKVAGEVLGSF  1250
             F L W+ P+C +           N++T++    C+  L T  H G            GS 
Sbjct  183   FYLEWSEPACSVCEDKGKRCSSYNSTTSDRRIQCVDQLPTTNHHG-----------FGSI  231

Query  1249  LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEG  1070
             LVV+I+     +Y   +  +E +  I +FL DYKALKP+R+SY+DIK+IT +FSEKLGEG
Sbjct  232   LVVIILAAFVYLYIRVRTYRENRTMIGKFLRDYKALKPSRFSYSDIKRITHQFSEKLGEG  291

Query  1069  SYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFH  890
              YG VYKGKL+ ++ VAVKVLNNS  +G+GEEFVNE+STIG IHH+N+VRL+G+CADGF 
Sbjct  292   GYGIVYKGKLNNEIVVAVKVLNNS--NGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFR  349

Query  889   RALVYEYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIK  713
             RALVYE+L N SLEK +F   +++  L WEKL+ IALGIAKG+EYLH+GCDQ+ILHFDIK
Sbjct  350   RALVYEFLPNGSLEKSIFQAGSNRITLDWEKLKNIALGIAKGIEYLHEGCDQQILHFDIK  409

Query  712   PRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDV  533
             P+N+LLD N NPKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDV
Sbjct  410   PQNVLLDHNLNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDV  469

Query  532   YSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGE-EVEIQIEKGEDSKIAKK  356
             YSFGMLLLEMVGG+K  D      T+Q YFP+WIYN ++ G+     QI++G  + IA+K
Sbjct  470   YSFGMLLLEMVGGRKNED-RNVNHTSQVYFPQWIYNHINAGDNNFWSQIDEG--NSIARK  526

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSA  179
             L++VGLWCIQW P DRPS+KVV+QMLE E +  +MPPNPF +T  S       GR + + 
Sbjct  527   LSMVGLWCIQWCPTDRPSMKVVVQMLEGEFDDLTMPPNPFPATTNS-----IDGRHYQTE  581

Query  178   LEIISE  161
             + II E
Sbjct  582   MSIILE  587



>ref|XP_011014401.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Populus 
euphratica]
 ref|XP_011014402.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Populus 
euphratica]
Length=598

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/598 (51%), Positives = 398/598 (67%), Gaps = 44/598 (7%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CGN G  I FPF +K  Q  +CGYPGF+L C +KG+  LE         LQ    VK  I
Sbjct  30    CGNRGLHIRFPFWIKDRQLEQCGYPGFDLSCNEKGDIVLE---------LQDA--VKLHI  78

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE---NLYNFSIFSCSTHRNITAGSI  1553
             + ID ++++I  S   GC L      N  +S F  +   +  NF+IF+CS +    A S 
Sbjct  79    DKIDYKNQVIYASDPQGCLLSQHS--NFYSSGFHIQFKMSKVNFTIFNCSLN---NARSQ  133

Query  1552  NISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTGP  1373
             N   + CL+   + + A  S L +     L+SCTKM+ +  VP  I        L W+ P
Sbjct  134   NWM-VPCLSTLHYDVLAVKSELSIDGNELLLSCTKMYDLP-VPQDI-------RLSWSNP  184

Query  1372  SCR----------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVT  1223
             +CR          L+ NS+ E   +C + L     G  +K    G   GS L  V+V+  
Sbjct  185   NCRSCEATGKLCGLRGNSSTELETECYS-LPSPEKGARKKNLTIGVTTGSILFGVLVIAV  243

Query  1222  YRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGK  1043
             Y++Y + K ++E Q K+ERFL+DY+A+ P RYS+AD+KK+T++F ++LG+G+YGTV+KGK
Sbjct  244   YQVYSIRKSEEEYQGKVERFLDDYRAMNPTRYSHADLKKMTNQFRDELGQGAYGTVFKGK  303

Query  1042  LSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLV  863
             L+ ++ VAVKVL+NS   G  EEFVNEM T+  IHH+NVVRL+G+CADGF RALVYEYL 
Sbjct  304   LTSEIPVAVKVLSNSTEKG--EEFVNEMQTMARIHHVNVVRLIGFCADGFRRALVYEYLP  361

Query  862   NNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQN  686
             N+SL+KF+ S N +N FLGWE+L  IALG+AKG+EYLHQGCDQ ILHFDIKP NILLD +
Sbjct  362   NDSLQKFISSANARNVFLGWERLHHIALGVAKGIEYLHQGCDQTILHFDIKPHNILLDND  421

Query  685   FNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLE  506
             FNPKI+DFG AKLCSK KS +SMT  RGT+GYIAPEVFSRNFGNVSYKSDVYSFGML+LE
Sbjct  422   FNPKIADFGLAKLCSKYKSAISMTRVRGTVGYIAPEVFSRNFGNVSYKSDVYSFGMLVLE  481

Query  505   MVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQ  326
             MVGG+K    T +   +Q YFPEWI+N+L  GE++ + IE+  D+KIAKKL IVGLWCIQ
Sbjct  482   MVGGRKNVGDT-AENGDQVYFPEWIHNLLEEGEDLRLHIEEEGDAKIAKKLAIVGLWCIQ  540

Query  325   WYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             W P DRPS+K+V+QMLE E +  + PPNP  S+ P +  A+  GR     L  ISE++
Sbjct  541   WNPADRPSMKIVVQMLEGEGDNLTKPPNPLRSSAPKRKTASIAGRRLHQELAAISEIE  598



>gb|KEH40397.1| receptor-like kinase [Medicago truncatula]
Length=595

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/587 (51%), Positives = 401/587 (68%), Gaps = 39/587 (7%)
 Frame = -2

Query  1921  ECLPRKCGN-NGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             +C+  +C + + P I +PFRL++IQP  CG  G++L C +  +T            L+ P
Sbjct  31    QCMKTRCNHKDAPTIQYPFRLQNIQPQNCGKIGYDLSCYENQQT-----------ILKLP  79

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCSTHRN  1571
               + F++  ID + + I ++  +GC  +LL  LN++++PF F   +  N+++F+CS+   
Sbjct  80    NSINFIVNKIDYKSQTIHVTYPNGCLPKLLSNLNVTSTPFHFIDNSNSNYTLFNCSSMN-  138

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFS  1391
              TA     S I CL+  G+ +YA +S+L L   T L  CTK++ +S VP     ++ VFS
Sbjct  139   -TALQSYYSSITCLSSNGYEVYALNSTLQLKDVT-LTYCTKLYDMSFVP-----EDVVFS  191

Query  1390  ------LRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVL  1229
                   L W   SC     + +E   +C   + K   G  +K+++   +L    ++++V 
Sbjct  192   HGDDLILGW-DTSC----GNESETEHECYNNVNK-SKGAGKKVEILVPILSCLGILLLVT  245

Query  1228  VTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYK  1049
             V Y      +  KE + +IE+FLEDY+ALKP RYSY+DIK+IT++F  +LG+G+YGTVYK
Sbjct  246   VLYHFRYRTQKDKENEARIEKFLEDYRALKPTRYSYSDIKRITNKFKNELGQGAYGTVYK  305

Query  1048  GKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEY  869
             GKLS D++VAVK+L  S G+G   EF+NE+ T+  IHH+NVV LVG+CADG  RALVYEY
Sbjct  306   GKLSSDIYVAVKLLKTSTGNG--PEFINEVGTMSQIHHVNVVHLVGFCADGHTRALVYEY  363

Query  868   LVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLD  692
             L N SL+KF+ + + KN FL WEKLQ+IALGIAKG+EYLHQGCDQRILHFDIKP NILLD
Sbjct  364   LPNGSLQKFISTTDFKNHFLSWEKLQEIALGIAKGIEYLHQGCDQRILHFDIKPHNILLD  423

Query  691   QNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLL  512
              NF PKISDFG AKLCSK++S VSMTAARGT+GYIAPEVFSRNFGNVSYKSDVYSFGMLL
Sbjct  424   NNFTPKISDFGLAKLCSKDQSAVSMTAARGTIGYIAPEVFSRNFGNVSYKSDVYSFGMLL  483

Query  511   LEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWC  332
             LEMVGG++  D+  +  +   YFPEWIYN+L +G ++   IE  + +KIAKKL I GLWC
Sbjct  484   LEMVGGRQNVDVVET-RSGLGYFPEWIYNLLEQGIDLREHIEVEKYAKIAKKLAIAGLWC  542

Query  331   IQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGR  194
             IQW+PVDRPS++VV+ MLE + E  SMPPNPF S DP+    +  GR
Sbjct  543   IQWHPVDRPSMQVVVHMLEGDGEKLSMPPNPFASADPAIMNVSLIGR  589



>ref|XP_010662818.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Vitis 
vinifera]
Length=443

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/453 (61%), Positives = 352/453 (78%), Gaps = 26/453 (6%)
 Frame = -2

Query  1468  DLISCTKMFHVSSVPYSIAQDNT----VFSLRW----------TGPSCRLKNNSTAEDAD  1331
             DL SC ++++ +SV Y +  D T     FSL+W           G  CRLK +++ E   
Sbjct  2     DLSSCRRLYN-ASVGYHVFTDYTFNGSAFSLKWPKSICGSCLRAGHICRLKKSNSREPET  60

Query  1330  DCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDY  1151
             +CI  ++K       +  V G + G FL+V+++ + YR+Y  +K+++E  +K++RFLEDY
Sbjct  61    ECIKGVSK-------QAMVTGTIFGFFLLVLVIAMFYRLYSSDKLERENGIKVKRFLEDY  113

Query  1150  KALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEF  971
             +ALKP+RYSYADIK+IT++F +KLG+G YGTVYKGKLS +VFVAVK+LNNS+G+G  EEF
Sbjct  114   EALKPSRYSYADIKRITNQFKDKLGQGGYGTVYKGKLSHEVFVAVKILNNSQGNG--EEF  171

Query  970   VNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQ  794
             +NE++T+G+IHH+N+VRLVG+CADGF RAL+YEYL N SLEKF+FS + KN+ L W+KLQ
Sbjct  172   INEVATMGTIHHVNIVRLVGFCADGFKRALIYEYLPNESLEKFIFSRDVKNYSLSWKKLQ  231

Query  793   QIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMT  614
             +IA+GIAKG+EYLHQGCDQRILHFDIKP NILLD NFNPKISDFG AKLCSKE+S VSMT
Sbjct  232   EIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAVSMT  291

Query  613   AARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEW  434
              ARGT+GYIAP+V SRNFGNVSYKSDVYSFGMLLLEMVGG+K  D++    T+Q YFPEW
Sbjct  292   VARGTIGYIAPKVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEW  350

Query  433   IYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSM  254
             IYN L RGEE+ I+IE+  D +IAKKL IVGL CIQW+P+DRPS+K+V+QMLE     +M
Sbjct  351   IYNHLDRGEELYIRIEEKGDVEIAKKLAIVGLSCIQWFPMDRPSMKIVVQMLEGRGKLTM  410

Query  253   PPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             PPNPF ST P+K   +KP  +F   L IISE++
Sbjct  411   PPNPFASTTPTKTNLSKPRSVFQQELAIISEIE  443



>ref|XP_011026383.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Populus 
euphratica]
Length=598

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/598 (51%), Positives = 397/598 (66%), Gaps = 44/598 (7%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CGN G  I FPF +K  Q  +CGYPGF+L C +KG+  LE         LQ    VK  I
Sbjct  30    CGNRGLHIRFPFWIKDRQLEQCGYPGFDLSCNEKGDIVLE---------LQDA--VKLHI  78

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE---NLYNFSIFSCSTHRNITAGSI  1553
             + ID ++++I  S   GC L      N  +S F  +   +   F+IF+CS +    A S 
Sbjct  79    DKIDYKNQVIYASDPQGCLLSQHS--NFYSSGFHIQFKMSKVTFTIFNCSLN---NARSQ  133

Query  1552  NISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTGP  1373
             N   + CL+   + + A  S L +     L+SCTKM+ +  VP  I        L W+ P
Sbjct  134   NWM-VPCLSTLHYDVLAVKSELSIDGNELLLSCTKMYDLP-VPQDI-------RLSWSNP  184

Query  1372  SCR----------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVT  1223
             +CR          L+ NS+ E   +C + L +   G  +K    G   GS L  V+V+  
Sbjct  185   NCRSCEATGKLCGLRGNSSTELETECYS-LPRPEKGARKKNLTIGVTTGSILFGVLVIAV  243

Query  1222  YRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGK  1043
             Y+IY + K ++E Q K+ERFL+DY+A+ P RYSYAD+KK+T++F ++LG+G+YGTV+KGK
Sbjct  244   YQIYSIRKSEEEYQGKVERFLDDYRAMNPTRYSYADLKKMTNQFRDELGQGAYGTVFKGK  303

Query  1042  LSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLV  863
             L+ ++ VAVKVL+NS     GEEFVNEM T+  IHH+NVVRL+G+CADGF RALVYEYL 
Sbjct  304   LTSEIPVAVKVLSNS--SEKGEEFVNEMQTMARIHHVNVVRLIGFCADGFRRALVYEYLP  361

Query  862   NNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQN  686
             N+SL+KF+ S N +N FLGWE+L  IALG AKG+EYLHQGCDQ ILHFDIKP NILLD +
Sbjct  362   NDSLQKFICSANARNVFLGWERLHHIALGGAKGIEYLHQGCDQTILHFDIKPHNILLDND  421

Query  685   FNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLE  506
             FNPKI+DFG AKLCSK KS +SMT  RGT+GYIAPEVFSRNFGNVSYKSDVYSFGML+LE
Sbjct  422   FNPKIADFGLAKLCSKYKSAISMTRVRGTVGYIAPEVFSRNFGNVSYKSDVYSFGMLVLE  481

Query  505   MVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQ  326
             MVGG+K    T +   +Q YFPEWI+N+L  GE++ + IE+  D+KIAKKL IVGLWCIQ
Sbjct  482   MVGGRKNVGDT-AENGDQVYFPEWIHNLLEEGEDLRLHIEEEGDAKIAKKLAIVGLWCIQ  540

Query  325   WYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             W P DRPS+K+V+QMLE E +  + PPNP  S+ P +  A+  GR     L  ISE++
Sbjct  541   WNPADRPSMKIVVQMLEGEGDNLTKPPNPLRSSAPKRKTASIAGRRLHQELAAISEIE  598



>emb|CBI23152.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/520 (58%), Positives = 378/520 (73%), Gaps = 29/520 (6%)
 Frame = -2

Query  1672  CFLQLLPILNLSASPFSF------ENLYNFSIFSCSTHRNITAGSINISPIACLTKPGHF  1511
             CF+  L  L+L+ASPF F      E L +F+ F+CS+++        +  I CL+ PG+ 
Sbjct  8     CFVGQLQNLSLAASPFQFKLENAWEVLDDFTFFNCSSNKR---EFYFVQSIPCLSIPGYP  64

Query  1510  IYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWT----------GPSCRL  1361
             +YA  SS  L    +L SC +M++++ +PYSI+  N  FS++W+          G  CRL
Sbjct  65    VYAIMSSADL-DEVNLSSCRRMYNLT-LPYSISDLNGKFSIKWSKSVCGNCEAQGKKCRL  122

Query  1360  KNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQ  1181
             K NS  E   +CI   +K       KL VAG V G  L+V+ V V Y ++   K++++ +
Sbjct  123   KRNSK-EPETECINNPSK--GSATTKLVVAGAVTGFLLLVLAVSVLYYLHCSRKLEEKNK  179

Query  1180  VKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNN  1001
              KIE+FLEDY+ALKP+RYSYADIKKITD+F   LG+G YGTVYKGKLS +V VAVK+LNN
Sbjct  180   RKIEKFLEDYRALKPSRYSYADIKKITDQFKYILGQGGYGTVYKGKLSNEVLVAVKILNN  239

Query  1000  SKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDK  821
              +G+G  EEF+NEM+T+G IHH+NVVRLVG+CADG  RAL++E+L N+SL KF+FS   K
Sbjct  240   FRGNG--EEFINEMATMGRIHHVNVVRLVGFCADGMRRALIFEFLPNDSLNKFIFSA--K  295

Query  820   NFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCS  641
             + L WEKLQ IA+GIAKG+EYLHQGC+QRILHFDIKP NILLD NFNPKISDFG AKLCS
Sbjct  296   HSLVWEKLQDIAIGIAKGMEYLHQGCEQRILHFDIKPHNILLDHNFNPKISDFGLAKLCS  355

Query  640   KEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPE  461
             K++S VSMT ARGTMGYIAPEV SRNFGNVSYKSDVYSFGMLLLEMV G+K SD+T    
Sbjct  356   KDQSAVSMTIARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVSGRKNSDVTAE-N  414

Query  460   TNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQM  281
              +Q YFPEWIYN L++GEE+ I+I +  D+ IAKKL IVGLWCIQWYPVDRPS+K+V+QM
Sbjct  415   PSQVYFPEWIYNHLNQGEELHIRIMENRDATIAKKLAIVGLWCIQWYPVDRPSMKLVVQM  474

Query  280   LEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISE  161
             LE E+  +MPPNPF ST P+  K ++        L +ISE
Sbjct  475   LEGEDNLTMPPNPFASTSPTNTKTSQSRTPLQKELAVISE  514



>emb|CAN66614.1| hypothetical protein VITISV_023172 [Vitis vinifera]
Length=544

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/596 (52%), Positives = 388/596 (65%), Gaps = 66/596 (11%)
 Frame = -2

Query  1909  RKCGNNGPEISFPFRLK-HIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVK  1733
             + C   GP I FPF LK H  P  CG   F L C ++ +T LE            P  V 
Sbjct  4     QSCSLQGPPIHFPFXLKGHQYPDHCGCSLFXLSCXERNQTILE-----------LPDSVN  52

Query  1732  FLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNF----SIFSCSTHRNIT  1565
              L++ I+   + I++   D CF +    LNL +SPF F  LY++    + F C + RN T
Sbjct  53    LLVKXINYRSKEILVQDPDNCFPRQFRNLNLXSSPFQF--LYDYPEALTFFKCPS-RNST  109

Query  1564  A---GSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVP-YSIAQDNTV  1397
                 GS ++S I CL  PG  +YA  SS     A  L SC+KM++V++ P Y+I      
Sbjct  110   KYYDGS-SVSLIPCLGGPGFQVYAVSSSGNPRIAY-LPSCSKMYNVAAAPSYAIDSVENA  167

Query  1396  FSLRWTG-PSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTY  1220
               L+WT  P C                             +  GE LGS  +V +V   Y
Sbjct  168   TRLKWTKLPHC-----------------------------EAEGESLGSLFLVTLVFALY  198

Query  1219  RIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKL  1040
             R+Y  N+ K++ ++K+ +FLEDY+ALKP+RYSY DIK+ITD F EKLGEG YGTVYKGKL
Sbjct  199   RVYSSNESKRQHKIKVIKFLEDYRALKPSRYSYNDIKRITDGFKEKLGEGGYGTVYKGKL  258

Query  1039  SGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVN  860
             S ++ VAVK+LN S  +G+GEEF+NE+ TIG IHHINVV L+G+C+DG  RAL+YE+L N
Sbjct  259   SNEIXVAVKILNXS--NGNGEEFINEVGTIGRIHHINVVXLIGFCSDGXRRALIYEFLXN  316

Query  859   NSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFN  680
              SLEKF+FS +    LGWEKLQ IA+GIAKG+EYLHQGCDQRILHFDIKP NILLD NFN
Sbjct  317   ESLEKFIFSNHS---LGWEKLQDIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFN  373

Query  679   PKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMV  500
             PKISDFG AKLCSKE+S VSM+  RGTMGYIAPE+ SRNFGNVSYKSDVYSFGMLL+EMV
Sbjct  374   PKISDFGLAKLCSKEQSAVSMSVIRGTMGYIAPEMISRNFGNVSYKSDVYSFGMLLIEMV  433

Query  499   GGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWY  320
             GG+K  D T    T+Q YFPEW+YN L + EE+ I IE+  D +IAKKL IVGLWCIQW 
Sbjct  434   GGRKNIDTT-VKNTSQVYFPEWVYNRLDKREELHIPIEEENDGEIAKKLLIVGLWCIQWC  492

Query  319   PVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             P +RPS+K +IQMLE E    SMPPNPFTS  P++   N    +    L +ISE++
Sbjct  493   PTNRPSMKFIIQMLEGEGNNLSMPPNPFTSMGPTRTSPN----MHQQELAVISEIE  544



>emb|CDP12538.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/609 (50%), Positives = 401/609 (66%), Gaps = 40/609 (7%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGY--PGFELLCTDKGETALENPFPLLNATLQPP  1745
             C  ++C   GP + FPF L   QP ECGY  PG+ L C +   T LE           PP
Sbjct  39    CAEKRCSPYGPAVRFPFLLLGKQPEECGYNNPGYNLYCDNGNHTLLE----------FPP  88

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN----LYNFSIFSCSTH  1577
               +KF++++ID + ++I +   +GC L+ L  L+LS++PF F      +Y +++F+CS  
Sbjct  89    SSMKFVVKNIDYKTQMIQVQFAEGCQLKYLRNLDLSSTPFQFSAPDYMIYRYTLFNCSLA  148

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYL-YSATDLISCTKMFHVSSVPYSIAQDNT  1400
                +  S       CL  PG+ + A  S   + + + +L  CTKM+  + V   +     
Sbjct  149   NGDSWSSDEGYDFRCLDTPGYKVRATPSDTEIRFLSVEL--CTKMYDTNLVSGELFGMRD  206

Query  1399  VFSLRWT-----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
               +L W+           G  CR KN +   +  DC     K  +G  +KL ++G + G 
Sbjct  207   SLNLAWSLSACKKCEVQEGGICRSKNGTN--NKFDCFGG-KKPDSGVSKKLLISGPIAGC  263

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             F +++     Y +Y+  K+ +E Q +I  FLEDY A+KP RYSYADIK+IT+ F +KLGE
Sbjct  264   FFLILATSALY-VYKTKKIDRENQKRIRTFLEDYAAMKPTRYSYADIKRITNDFKDKLGE  322

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G YG V+KGK+S ++FVAVK+L+NS G+G  EEF+NE+ T+G+IHH+NVVRLVG+CADGF
Sbjct  323   GGYGNVFKGKISNEIFVAVKLLHNSTGNG--EEFINEVGTMGTIHHVNVVRLVGFCADGF  380

Query  892   HRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
              RALVYE+L N SL+KF+F    ++  LG EKLQ IA GIA+G+EYLHQGC+QRILHFDI
Sbjct  381   KRALVYEFLPNGSLDKFIFPEGQEHHNLGMEKLQNIAFGIARGIEYLHQGCEQRILHFDI  440

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP NILLD NFNPKISDFG AKLC K +S VSMTAARGTMGYIAPEVFSR+FGNVSYKSD
Sbjct  441   KPHNILLDNNFNPKISDFGLAKLCEKGRSAVSMTAARGTMGYIAPEVFSRHFGNVSYKSD  500

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             +YSFGMLLLEMVG +K  D       +Q Y+PEW+Y  L +GE++ IQ+E+  +  IAKK
Sbjct  501   IYSFGMLLLEMVGRRKNID-ANVQNVSQVYYPEWVYGRLVQGEDLRIQVEEDGEEIIAKK  559

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDP-SKAKANKPGRLFTS  182
             L IVGLWCIQW PVDRPSI  V+QMLE   E PS+PP+PFTSTDP + +  +  GR   S
Sbjct  560   LAIVGLWCIQWNPVDRPSITFVLQMLEGNGESPSLPPSPFTSTDPMNPSNPSLHGRHLAS  619

Query  181   ALEIISEMD  155
              L +ISE++
Sbjct  620   GLAVISELE  628



>ref|XP_010662832.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=443

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/453 (60%), Positives = 353/453 (78%), Gaps = 26/453 (6%)
 Frame = -2

Query  1468  DLISCTKMFHVSSVPYSIAQD----NTVFSLRW----------TGPSCRLKNNSTAEDAD  1331
             DL SC ++++ +SV Y +  D     + FSL+W           G  CRLK +++ E   
Sbjct  2     DLSSCRRLYN-ASVGYHVFTDYKFNGSAFSLKWPKSICGSCLRGGHICRLKKSNSKEPET  60

Query  1330  DCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDY  1151
             +CI  ++K       +  V G + G FL+V+++ + YR+YR +K+++E  +K++RFLEDY
Sbjct  61    ECIKGVSK-------QAIVTGTIFGFFLLVLVIAMFYRLYRSDKLERENGIKVKRFLEDY  113

Query  1150  KALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEF  971
             +ALKP+RYSYADIK+IT++F +KLG+G YGTVYKGKLS +VFVAVK+LNNS+G+G  EEF
Sbjct  114   EALKPSRYSYADIKRITNQFKDKLGQGGYGTVYKGKLSHEVFVAVKILNNSQGNG--EEF  171

Query  970   VNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQ  794
             +NE++T+G+IHH+N+VRLVG+CADGF RAL+YEYL N SLEKF+FS + KN+ L W+KLQ
Sbjct  172   INEVATMGTIHHVNIVRLVGFCADGFKRALIYEYLPNESLEKFIFSRDVKNYSLSWKKLQ  231

Query  793   QIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMT  614
             +IA+GIAKG+EYLHQGCD+RILHFDIKP NILLD NFNP++SDFG AKLCSKE+S VSMT
Sbjct  232   EIAIGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFNPRVSDFGLAKLCSKEQSAVSMT  291

Query  613   AARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEW  434
              ARGT+GYIAPEV SRNFGNVSYKSDVYSFGMLLLEMVGG+K  D++    T+Q YFPEW
Sbjct  292   VARGTIGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEW  350

Query  433   IYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSM  254
             IYN L  GEE+ I+IE+  D +IAKKL IVGL CIQW+P+DRPS+K+V+QMLE     +M
Sbjct  351   IYNHLDIGEELYIRIEEKGDVEIAKKLAIVGLSCIQWFPMDRPSMKIVVQMLEGGGKLTM  410

Query  253   PPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             PPNPF ST P+K   +KPG +F   L IISE++
Sbjct  411   PPNPFASTTPTKTNLSKPGSVFQQELAIISEIE  443



>ref|XP_009596788.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Nicotiana 
tomentosiformis]
Length=624

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/606 (51%), Positives = 405/606 (67%), Gaps = 38/606 (6%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNAT--L  1754
             +++CLP +CG  GP I FPFRLK++QPP CGYPGFEL CT    T     FPL  +T  +
Sbjct  24    QDKCLPTRCGEFGPLIRFPFRLKNLQPPRCGYPGFELTCTPDNITQFMLKFPLWASTNNI  83

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDG-CFLQLLPILNLSASPFS--FENLY-NFSIFSC  1586
                      +  ID + + I +S  +  C  + LP +N+S SPF+   ++ Y  +++F+C
Sbjct  84    DISISTNVSVREIDYKSQKIKVSGFNPLCLPRQLPNINVSPSPFTTIHQDPYVGYTLFNC  143

Query  1585  STHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSI---  1415
             S+             I CL+ P + + A  SS+ +   T   SC  M+++S +P  +   
Sbjct  144   SSDNAYA------DRITCLSGPHYGVLAFGSSISISFLTS--SCKYMYNISYIPDEVLFG  195

Query  1414  --AQDNTVFSLRWTGP----------SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVA  1271
                   T   L W+ P           C+LK+N +  + + C+    K   GP +++ +A
Sbjct  196   QQELSQTQIPLHWSEPFCGKCEADGNYCKLKSNGSGSETE-CVDRPGKPSKGPSKEV-IA  253

Query  1270  GEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRF  1091
               VLGS    V V   Y + +L K+KKE+Q +IERFLEDYKAL+P RYSYADIKKIT +F
Sbjct  254   ASVLGSLSAFVAV---YGLVKL-KIKKEDQKRIERFLEDYKALRPTRYSYADIKKITKQF  309

Query  1090  SEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVG  911
               KLG+G YG VY GKL+ ++ VAVKVLNN KGDG  E+F+NE+ +IG IHH+NVV LVG
Sbjct  310   KYKLGQGGYGKVYTGKLTNEILVAVKVLNNFKGDG--EDFINEVGSIGRIHHVNVVSLVG  367

Query  910   YCADGFHRALVYEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRI  731
             YCADG+ RALVYEYL N++L+K + S N K  LGWEK+QQIA+ IAKG+EYLHQGC+QRI
Sbjct  368   YCADGYRRALVYEYLPNDTLQKIISSGNGKASLGWEKMQQIAVAIAKGIEYLHQGCNQRI  427

Query  730   LHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNV  551
             +HFDIKP NILLDQ+FN K++DFG AKLCSKE+S VSMTAARGT+GYIAPEVFSRN+GNV
Sbjct  428   VHFDIKPHNILLDQDFNTKVADFGLAKLCSKEQSAVSMTAARGTIGYIAPEVFSRNYGNV  487

Query  550   SYKSDVYSFGMLLLEMVGGKKKSDITGSPET-NQDYFPEWIYNILSRGEEVEIQIEKGED  374
             SYK+D+YSFGMLLL+M+GG+KK ++       ++ Y+PEW+Y  L +GEE+EIQIE  +D
Sbjct  488   SYKADIYSFGMLLLDMIGGRKKFEVANEQNNISEIYYPEWMYKQLEKGEEIEIQIEDEDD  547

Query  373   SKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGR  194
             S I KKL IVGLWCIQW P DRPS+KVVIQMLE E  P MP NPF S +     A   G 
Sbjct  548   SSIIKKLAIVGLWCIQWSPADRPSMKVVIQMLEGEGIPIMPANPFGSLNSPNMGATAEGS  607

Query  193   LFTSAL  176
              F S L
Sbjct  608   QFGSEL  613



>gb|KDP42829.1| hypothetical protein JCGZ_23771 [Jatropha curcas]
Length=532

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/548 (55%), Positives = 372/548 (68%), Gaps = 31/548 (6%)
 Frame = -2

Query  1756  LQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCS  1583
             +Q P  V+ L++ ID   ++I  +    C  + L   NLS S F F  E+  +F +F C 
Sbjct  2     IQLPDSVELLVKDIDYVSQVIYTTDPQNCLPKQLSNFNLSGSSFRFLNEDSNSFVLFKCP  61

Query  1582  THRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYS-IAQD  1406
                    GS     + C +   + I    S + +     L+ CTKM+ V   P   I   
Sbjct  62    ------KGSSEFLQMPCASANEYQINVFSSGISI-DNVGLLYCTKMYDVLPFPSEMIDGG  114

Query  1405  NTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLG  1256
               +  L W  PSC          RLK NST  + + C   L +  T    K    G VLG
Sbjct  115   GNILHLTWYNPSCGFCPAQGKYCRLKANSTQFETE-CSGKLERSST----KFLALGIVLG  169

Query  1255  SFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLG  1076
              FL VV++L  YR+Y  +K++KE Q KIE FL+DYKA KP RYSYADIK+IT++F E+LG
Sbjct  170   LFLPVVVLLALYRLYINDKIEKEYQSKIENFLDDYKAFKPTRYSYADIKRITNQFKEELG  229

Query  1075  EGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADG  896
             EG+YGTV++GKLS ++ VAVKVLNN KGDG  EEFVNE+ TIG IHH+NVVRLVG+CADG
Sbjct  230   EGAYGTVFRGKLSDEITVAVKVLNNFKGDG--EEFVNEVGTIGKIHHVNVVRLVGFCADG  287

Query  895   FHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFD  719
             F RALVYEYL N+SL+KF+ SP+DKN FLGW+KLQ IALGIA+G+EYLHQGC+QRILHFD
Sbjct  288   FRRALVYEYLPNDSLDKFISSPDDKNHFLGWKKLQDIALGIARGIEYLHQGCNQRILHFD  347

Query  718   IKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKS  539
             IKP NILLD NFNPK+SDFG AKLCSK++S V MT ARGT+GYIAPEVFSRNFGNVSYKS
Sbjct  348   IKPHNILLDNNFNPKVSDFGLAKLCSKDQSTVPMTTARGTVGYIAPEVFSRNFGNVSYKS  407

Query  538   DVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAK  359
             DVYSFGML+LEMV G+K   +      +Q YFPEWIYN+L  GE++  + E+ ED+ IAK
Sbjct  408   DVYSFGMLVLEMVAGRK---VIAEGNDDQIYFPEWIYNLLEEGEDLRFEFEEEEDANIAK  464

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSA  179
             KL IVGLWCIQW PVDRPS+K+V+QMLE  +  S+PPNPF+ST P +  A    R     
Sbjct  465   KLAIVGLWCIQWNPVDRPSMKIVVQMLEGGDNLSIPPNPFSSTKPMRTYARIRRRHLHRE  524

Query  178   LEIISEMD  155
             + +ISE +
Sbjct  525   MAVISETE  532



>ref|XP_010662565.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=579

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/595 (49%), Positives = 393/595 (66%), Gaps = 45/595 (8%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             +EC   +C ++GP I FPFRLKH QP  CGYP FEL C+++  T LE            P
Sbjct  25    DECKASRCSHHGPLIRFPFRLKH-QPEHCGYPKFELSCSEEKRTILE-----------LP  72

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRNIT  1565
             +  K  ++ I+   + I +   D C  + +   NLSASPF+++ L +  +++  + R++ 
Sbjct  73    YSGKLWVKEINYASQEIGVHHSDDCLQRQILNFNLSASPFTYDFLSSNPVYATWSSRSL-  131

Query  1564  AGSINISP---IACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVF  1394
                +N+S    I   T P ++IY  +   ++  +  +  C K                  
Sbjct  132   -AEVNLSSCWKIFNATLPENYIYGGEYDTFMNWSKPM--CGK------------------  170

Query  1393  SLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRI  1214
                  G  C+ K N++ E   +CI    K    P+ K+ +   +LG       + + + +
Sbjct  171   -CEAKGNKCQRKKNNSTEPEIECIDKPAK--GAPMDKMVLTEAILGFLHFTFGIFIIFIV  227

Query  1213  YRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSG  1034
             Y  NK+K+E ++ I++FLEDY+ALKP+RYSYADIKKIT+ F +KLG+G YGTVYKGKLS 
Sbjct  228   YCSNKLKREHRINIQKFLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGTVYKGKLSN  287

Query  1033  DVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNS  854
             +VFVAVK+L++ KG+G  E+F+NE+ T+ +IHH+NVVRL+G+CADG+ RAL+YE+L N S
Sbjct  288   EVFVAVKILDDFKGNG--EDFINEVGTMSTIHHVNVVRLLGFCADGYKRALIYEFLPNES  345

Query  853   LEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNP  677
             L+KF+FS    N+ LGW KLQ IA+GIAKG+EYLHQGCDQRILH DIKP NILLD NFNP
Sbjct  346   LDKFIFSAFGNNYSLGWHKLQDIAIGIAKGIEYLHQGCDQRILHLDIKPHNILLDHNFNP  405

Query  676   KISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVG  497
             KISDFG AKLCSKE+S VSMTAARGTMGYIAPE+ SRNFGNVS KSDVYSFGMLL+EMVG
Sbjct  406   KISDFGLAKLCSKEQSAVSMTAARGTMGYIAPEMLSRNFGNVSSKSDVYSFGMLLIEMVG  465

Query  496   GKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYP  317
             G+K  D T     +Q YFPEW+YN L + +EV I+IE   D KI KKL+I+GLWCIQWYP
Sbjct  466   GRKNIDAT-VENISQAYFPEWLYNHLDQEQEVHIRIEDESDIKITKKLSIIGLWCIQWYP  524

Query  316   VDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             +DRPS+K+V+ MLE EE    MPPNPFTS   ++    +        L +ISE++
Sbjct  525   IDRPSMKIVVGMLEGEEGNLVMPPNPFTSMGQTRTSVRRRKTSIQPELTVISEIE  579



>ref|XP_010645764.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=608

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/618 (51%), Positives = 396/618 (64%), Gaps = 51/618 (8%)
 Frame = -2

Query  1942  GYSYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLN  1763
             G S D  EC   +C ++GP I FPFRLKH Q   CGYP FEL C++  +T LE       
Sbjct  20    GRSQDE-ECKASRCSHHGPVIRFPFRLKH-QSDHCGYPEFELSCSENKQTILE-------  70

Query  1762  ATLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFS  1589
                 PP+ +K  +E I+   + II  R D C  +     NLSASPF F   Y  +FS FS
Sbjct  71    ----PPYSLKLSVEKINYTSQEII-GRPDYCHRRKFQNFNLSASPFQFTESYLRSFSFFS  125

Query  1588  CSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVS-SVPYSIA  1412
             CS ++   A S  +  I C       +YA +SS  L   T+L  C K    S S    IA
Sbjct  126   CSENK---AKSYGLKSIPCSFLSSDPVYAIESSSSL-DFTNLSFCRKQKERSVSGRRVIA  181

Query  1411  QDNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTG-----------------PLRK  1283
             Q+    +L        +        A    +P   +H                   P  K
Sbjct  182   QNPKSNAL--------INQQKVINPASSSFSPFKPVHISYYDFNRLVLGIMLVIDIPYAK  233

Query  1282  LKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKI  1103
               +   +LG   + + + + + +YR NK+K+E ++ I+RFLEDYKALKP+RY YADIKKI
Sbjct  234   DILFEVILGFCHLSLGIFIIFIVYRSNKLKREHKINIQRFLEDYKALKPSRYCYADIKKI  293

Query  1102  TDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVV  923
             T+ F +KLG+G YGTVYKG+LS +VFVAVK+LN+ KG+G  EEF+NE+ T+G+IHH+NVV
Sbjct  294   TNNFKDKLGQGGYGTVYKGRLSNEVFVAVKILNDFKGNG--EEFINEVRTMGTIHHVNVV  351

Query  922   RLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQG  746
             RLVG+CADG+ RAL+ E+L N+SLEKF+FS    N  LGW KL  IA+GIAKG+EYLHQG
Sbjct  352   RLVGFCADGYKRALICEFLPNDSLEKFIFSTFGNNRSLGWCKLHDIAIGIAKGIEYLHQG  411

Query  745   CDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSR  566
             CDQRILHFDIKP NILLD NFNPKISDFG AKLCSKE+S VS+TA RGTMGYIAPE+ SR
Sbjct  412   CDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSTVSVTATRGTMGYIAPEMLSR  471

Query  565   NFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIE  386
             NFG+VSYKSDVYSFGMLLLEMVGG+K  D+T     +Q YF EW+YN L + +EV I+IE
Sbjct  472   NFGSVSYKSDVYSFGMLLLEMVGGRKNIDVT-VENISQAYFSEWLYNHLDQEQEVHIRIE  530

Query  385   KGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPSKAKA  209
             +  D+KIAKKL+I+GLWCIQWYP DRPS+KVV++MLE EE    MPPNPF     +    
Sbjct  531   EENDTKIAKKLSIIGLWCIQWYPSDRPSMKVVVRMLEREEDNLVMPPNPFAFMGQTSTSV  590

Query  208   NKPGRLFTSALEIISEMD  155
              +        L +ISE++
Sbjct  591   KRRKASVQLGLTVISEIE  608



>ref|XP_006374064.1| hypothetical protein POPTR_0015s00220g [Populus trichocarpa]
 gb|ERP51861.1| hypothetical protein POPTR_0015s00220g [Populus trichocarpa]
Length=542

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/555 (54%), Positives = 371/555 (67%), Gaps = 57/555 (10%)
 Frame = -2

Query  1852  QPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLIESIDCEDRLIIISRVDG  1673
             QP  C YPGFEL CTD+ ET L     LL      P  VK  +  ID   +LII S  D 
Sbjct  27    QPDNCSYPGFELSCTDRRETLL-----LL------PNSVKLYVNKIDYASQLIIASDPDQ  75

Query  1672  CFLQLLPILNLSASPFSFENLY--NFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAA  1499
             C    L   NLS SPF F ++   +++ F+C++ +  T+       +ACL+ PG+ I+A 
Sbjct  76    CLPGQLRHFNLSTSPFKFGDMEQDDYAFFNCTSWKGDTS-----RQLACLSGPGYDIFAY  130

Query  1498  DSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTGPSC----------RLKNNS  1349
              SS Y    +DL SCTKM+++SS+P  I   N +  L W+GP C          R KNNS
Sbjct  131   FSS-YPIGYSDLTSCTKMYNLSSIPREIFWQNNILHLNWSGPECVHCEAHGKFCRSKNNS  189

Query  1348  TAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIE  1169
                  +    P +K         +VA   +GS L++++    +R+Y  +K  KE Q +IE
Sbjct  190   AGLGTECYDKPKSK---------EVA--TVGSVLLLLVFFAAFRVYSSDKAAKENQKRIE  238

Query  1168  RFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGD  989
              FL DYKA KP RY+YADIK+IT+ F +KLG+G+YGTV+KG+LS ++FVAVK+LNNS G+
Sbjct  239   NFLADYKAFKPTRYTYADIKRITNEFKDKLGQGAYGTVFKGQLSDEIFVAVKILNNSTGN  298

Query  988   GDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNFLG  809
             G  EEF+NE+ T+G IHH+NV+RLVGYCADGF RALVY+YL N SLEKF+ S +      
Sbjct  299   G--EEFINEVGTMGKIHHVNVIRLVGYCADGFRRALVYDYLSNESLEKFISSEHGD----  352

Query  808   WEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKS  629
                        A  +EYLHQGCDQRILHFDIKP NILLD NFNPKISDFG AKLCSK++S
Sbjct  353   ---------ASALRIEYLHQGCDQRILHFDIKPHNILLDDNFNPKISDFGLAKLCSKDQS  403

Query  628   IVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQD  449
              VSMT ARGTMGYIAPEVFSRNFGNVSYKSDVY FGM+LLEMVGG+K  D       NQ 
Sbjct  404   AVSMTTARGTMGYIAPEVFSRNFGNVSYKSDVYGFGMVLLEMVGGRKTID-DKIENNNQI  462

Query  448   YFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE  269
             YFPEW+YN L  GEE+ I+IEK  D++IAKKLTIVGLWCIQW+PVDRPS+  V+QMLE E
Sbjct  463   YFPEWVYNSLDNGEELRIRIEKEGDAQIAKKLTIVGLWCIQWHPVDRPSMNAVVQMLEGE  522

Query  268   -EPPSMPPNPFTSTD  227
              +  +MPP+PF S D
Sbjct  523   GDTLTMPPSPFASAD  537



>ref|XP_010662821.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RKF3 [Vitis vinifera]
Length=794

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/599 (53%), Positives = 409/599 (68%), Gaps = 49/599 (8%)
 Frame = -2

Query  1927  RNECLPR-KCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             ++EC+   KC + GP I FPF+LK   P  CG P FEL CT+K +T LE           
Sbjct  237   QDECMASSKCSDQGPAIRFPFQLKDRHPHHCGCPLFELSCTEKNQTMLE-----------  285

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF-ENLYNFSIFSCSTHR  1574
              P  VKFL+++I+ + + I++   D C  + L  L+L+A+PF F E L N + F CS+  
Sbjct  286   LPHSVKFLVKNINYKSQQILVHDPDYCLPRQLGNLDLAATPFKFSEELENSTFFICSSVN  345

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVP---YSIAQDN  1403
               T G      + CL  PG+ ++   SS  + S  +L+ C    + SS+P   Y   ++N
Sbjct  346   GQTFGE----RVPCLDVPGYQVWKFPSSEVM-SFPELLPCGNKMYASSLPKDEYGEIKNN  400

Query  1402  TVFSLRWTGPS-CRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLV  1226
               F L WT PS C+ K                      ++ L V G ++G  L++ I++ 
Sbjct  401   --FHLNWTTPSHCKGKG-------------------ALIKPLIVTGVIVGFPLLMSIIIA  439

Query  1225  TYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKG  1046
              Y++Y  NKM +E +++IE+FLEDY+ALKP+RY+Y DIKKIT++F +KLGEG YG VYKG
Sbjct  440   LYKVYDSNKMGREYKIRIEKFLEDYRALKPSRYTYIDIKKITNQFKDKLGEGGYGIVYKG  499

Query  1045  KLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYL  866
             KLS +V VAVK+LNNSKG+G  EEF+NE+ T+G IHH+NVVRLVG+CA+G  RAL+YE+ 
Sbjct  500   KLSNEVLVAVKILNNSKGNG--EEFINEVGTMGRIHHVNVVRLVGFCAEGSKRALIYEFQ  557

Query  865   VNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQ  689
              N SLEKF+FS   KN  LGW+KLQ IA+GIAKG+EYLHQGCDQRILHFDIKP NILLD 
Sbjct  558   PNESLEKFIFSEAVKNHSLGWKKLQGIAVGIAKGIEYLHQGCDQRILHFDIKPHNILLDH  617

Query  688   NFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLL  509
             NFNPKISDFG AK+CSKE+S VSMT ARGTMGYIAPEV SRNFG+VSYKSDVYSFGMLLL
Sbjct  618   NFNPKISDFGLAKVCSKEQSRVSMTTARGTMGYIAPEVLSRNFGSVSYKSDVYSFGMLLL  677

Query  508   EMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCI  329
             EMVGG+K  D++     +Q YFPEW+YN L++GEE+ I+IE+  D +IAKKLTIVGLWCI
Sbjct  678   EMVGGRKNIDVS-VENASQVYFPEWVYNHLNQGEEIHIRIEEERDFEIAKKLTIVGLWCI  736

Query  328   QWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             QW P++RPS+K V+QMLE E    ++PPNPF  T P++       R     L +ISE++
Sbjct  737   QWCPINRPSMKDVVQMLEEERNNVTIPPNPFAFTGPTRTNIKSLQRPL-QELTVISELE  794


 Score =   114 bits (284),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 112/220 (51%), Gaps = 30/220 (14%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             ++EC+  +C + GP I FPFRLK  QP  CGYPGFEL CT+  +T L+            
Sbjct  25    KDECMVSRCSDQGPAIRFPFRLKD-QPENCGYPGFELSCTETNQTILDM-----------  72

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-----NLYNFSIFSCS  1583
             P  VK  +++I  + R I++   + C    L  L LSASPF F+      L  F+ F+CS
Sbjct  73    PSSVKLSVKNIKYKSREIVVEDPNNCLQSQLQNLRLSASPFHFKLNHSFELQAFTFFNCS  132

Query  1582  THRNITA--GSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ  1409
              +R+ ++   SI     +C   PG+ +YA DSS  L +  D+ SC +++++S   Y I +
Sbjct  133   ANRSDSSYFKSIKSFSKSCSFLPGNPLYAVDSSTSL-TDLDVSSCRRIYNLSLPTYYIYE  191

Query  1408  DNTVFSLRW----------TGPSCRLKNNSTAEDADDCIA  1319
                   L+W           G  CRLK ++  +   +CI 
Sbjct  192   GENRLYLKWEESICGNCEAEGKKCRLKKSNGKKPETECIT  231



>ref|XP_008232091.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=589

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/607 (51%), Positives = 400/607 (66%), Gaps = 44/607 (7%)
 Frame = -2

Query  1927  RNECLPRKCGNN-GPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             ++ C   KC ++ G  I FP  ++H     CG P  E  C+ + E  LE    L      
Sbjct  11    QDTCTESKCSDDHGLAIHFPLHVRH----HCGDPRLE--CSGRQEKVLEEQVAL------  58

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFEN--LYNFSIFSCST  1580
                 VKF ++SID +  LI +   DGC L + L   N+  S F   +  ++N ++F C T
Sbjct  59    ----VKFFVKSIDYKRGLIDVYNTDGCLLLKPLETPNIPISRFHLLDSYIFNVTLFHCPT  114

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATD-LISCTKMFHVSSVPYSIAQDN  1403
                +      +  + CL  PG+ +    S   L+     L SCT+M+ V SVP S   D+
Sbjct  115   ---LAERDTYLYQVPCLGGPGYSVKVFFSHFDLFDNLPYLKSCTRMYDVLSVPISSWVDS  171

Query  1402  TVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
             ++   +W+ P+C          RLK+N    + + C+  L K       +    G  LGS
Sbjct  172   SILRFKWSKPNCTECEAEGKRCRLKDNGINSEVE-CVH-LKK--ASKTMEFVATGATLGS  227

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
              L++V+V+  YR+Y  ++ +KE Q+KIERFLEDYKALKP+RYSYADIK+IT++F +KLG+
Sbjct  228   SLLLVLVIAVYRVYSADQKEKENQLKIERFLEDYKALKPSRYSYADIKRITNQFKDKLGQ  287

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G+YGTV+KGKLS + FVAVKVLNNSKG+G  EEFVNE+  +G IHH+NVVRLVG+CADGF
Sbjct  288   GAYGTVFKGKLSSEFFVAVKVLNNSKGNG--EEFVNEVGMMGHIHHVNVVRLVGFCADGF  345

Query  892   HRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
              RALVYE+  N SL+ F+ S + KN FLGWEKL  IA+GIAKG+EYLHQGCDQRILHFDI
Sbjct  346   RRALVYEFFPNGSLQDFISSADSKNSFLGWEKLHDIAVGIAKGIEYLHQGCDQRILHFDI  405

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP N+LLD NF PKISDFG AKLCSK++SIVSMT ARGTMGYIAPEVFSRNFG VSYKSD
Sbjct  406   KPHNVLLDHNFTPKISDFGLAKLCSKDQSIVSMTTARGTMGYIAPEVFSRNFGIVSYKSD  465

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             VYSFGMLLLEMVGGKK    + + + N+ Y+PEWIYN+L  G+++ I I    D KI K 
Sbjct  466   VYSFGMLLLEMVGGKKNIG-SSTKDANEIYYPEWIYNLLEGGDDLRIHIGDDGDGKIPKT  524

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSAL  176
             L IVGLWCIQW+PVDRPS+++V+ ML   +  +MPPNPF S  P+   A+ P R     L
Sbjct  525   LAIVGLWCIQWHPVDRPSMQIVVHMLGGGDNLAMPPNPFVSAGPTTTHASIPAR--RVEL  582

Query  175   EIISEMD  155
             E I E++
Sbjct  583   EAIPELE  589



>ref|XP_007036620.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY21121.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=589

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/553 (56%), Positives = 384/553 (69%), Gaps = 33/553 (6%)
 Frame = -2

Query  1765  NATLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPF--SFENLYNFSIF  1592
                L  P  VK  +E ID + + I  S    C +     +N SASPF  S E   N+++F
Sbjct  52    QTVLHLPPSVKMFVEDIDYKTQRINRSYPVDCAMIPYFSINFSASPFRQSIEP-DNYTMF  110

Query  1591  SCSTHRNITAGSINISPIACLTKPGHFIYAADSSLY---LYSATDLISCTKMFHVSSVPY  1421
             +CS   N T  S       CL     FIY  + S      + A +L++C+K+  +S  P 
Sbjct  111   NCS--ENPTEDSFFFYEKTCLD----FIYDFNISAIPSDSWEAYNLLNCSKVVDISVKPA  164

Query  1420  S-IAQDNTVFSLRWTGP----------SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKV  1274
               I+++N    L W+ P           CR+KNN+  ED  +C     K H   L+++ +
Sbjct  165   GPISREN--LYLEWSKPMCARCEAEGKGCRVKNNT--EDQTECYDIPYKGHPTKLKRI-L  219

Query  1273  AGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDR  1094
             AG +  SF++ +IV+  Y++Y L K KKE Q+K+E FLEDYK+LKP+RYSYADIK+IT++
Sbjct  220   AGVIPASFVLALIVVALYKLYHLEKTKKESQLKVEEFLEDYKSLKPSRYSYADIKRITNQ  279

Query  1093  FSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLV  914
             F EKLGEG YGTV+KG+LS DV VAVKVLNN KG+G  EEF+NE+ ++  IHH+NV RLV
Sbjct  280   FKEKLGEGGYGTVFKGRLSNDVLVAVKVLNNFKGNG--EEFINEVGSMSRIHHVNVARLV  337

Query  913   GYCADGFHRALVYEYLVNNSLEKFVFSPN-DKNFLGWEKLQQIALGIAKGVEYLHQGCDQ  737
             G+CADG+ RALVYEYL N SLEKF+FS   + +FLGW+KLQ IALGIAKG+EYLHQGC+Q
Sbjct  338   GFCADGYKRALVYEYLPNESLEKFIFSAKGESHFLGWDKLQDIALGIAKGIEYLHQGCEQ  397

Query  736   RILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFG  557
             RILHFDIKP NILLD NF PKISDFG AKLCSKE+S VSMTAARGTMGYIAPEV SRNFG
Sbjct  398   RILHFDIKPHNILLDHNFTPKISDFGLAKLCSKEQSAVSMTAARGTMGYIAPEVLSRNFG  457

Query  556   NVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGE  377
             NVSYKSDVYSFGMLLLEMVGG+K  D+T    T+Q YFPEW+YN L  GE++ I+IE   
Sbjct  458   NVSYKSDVYSFGMLLLEMVGGRKNIDVT-VENTSQVYFPEWVYNHLDEGEDLGIRIEDER  516

Query  376   DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKP  200
              S IA+KL+IVGLWCIQW+PVDRPS+KVVIQMLE E +  ++PPNPF STD  K   +K 
Sbjct  517   QSMIARKLSIVGLWCIQWFPVDRPSMKVVIQMLEGEADSLTLPPNPFASTDYMKLGGSKY  576

Query  199   GRLFTSALEIISE  161
                  + L II+E
Sbjct  577   KNPVGTELAIIAE  589



>ref|XP_008345489.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=599

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/606 (50%), Positives = 397/606 (66%), Gaps = 51/606 (8%)
 Frame = -2

Query  1918  CLPRKCG-NNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPF  1742
             C   KC  + GP I +P R        CG PG E                  N   + P 
Sbjct  27    CAESKCAEDQGPAIHYPLRRSGTH--HCGNPGLEC-----------------NQIYEQPI  67

Query  1741  PVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFS--FENLYNFSIFSCSTHRN  1571
              VK+ ++ I+ + + I +     C L + + I N+  SPFS     ++N ++FSC+T   
Sbjct  68    VVKYFVKHINYKRQEIQVYPSSDCLLLKPVEIPNMPLSPFSVSIAYIFNVTLFSCATP--  125

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYL-YSATDLISCTKMFHVSSVPYSIAQDNT-V  1397
                 ++    + CL  P   I A  S   L +   DL SC+KM+ V SVP++  + N  V
Sbjct  126   ----AMYDYQVPCLGDPSSRISAVLSDRRLKFLIPDLRSCSKMYDVLSVPFADWEGNGPV  181

Query  1396  FSLRWTGPSCR----------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFL  1247
                +W+ P+CR           KNN T  + + C       +T    KL V G +LGS +
Sbjct  182   LQFKWSKPNCRECEAEGKRCRWKNNGTNSEIE-CQHVRKPSNT---TKLVVTGGILGSLV  237

Query  1246  VVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGS  1067
             +V++ +  YR+Y  ++ +KE +++IE FLEDYKALKP+RY YADI++IT++F +KLG+G+
Sbjct  238   LVLLTIAAYRVYSADRKEKESRLRIEGFLEDYKALKPSRYLYADIRRITNQFKDKLGQGA  297

Query  1066  YGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHR  887
             YGTV+KGKL  + F+AVKVLN+SKGDG  EEFVNE+ T+G IHH+NV RLVG+CAD F R
Sbjct  298   YGTVFKGKLYSEFFIAVKVLNSSKGDG--EEFVNEVRTMGQIHHVNVARLVGFCADRFVR  355

Query  886   ALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             ALVYE+  N SL+ F+ S + KN FLGW+KLQ IALGIAKG++YLHQGCDQRILHFDIKP
Sbjct  356   ALVYEFFPNGSLQDFISSADCKNSFLGWDKLQDIALGIAKGIDYLHQGCDQRILHFDIKP  415

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
              NILLDQNF PKISDFG AKLCSK++S+VSMT ARGTMGYIAPEVFSRNFGNVSYK+DVY
Sbjct  416   HNILLDQNFTPKISDFGLAKLCSKDQSMVSMTTARGTMGYIAPEVFSRNFGNVSYKADVY  475

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             SFGMLL+EMVGG+K    T    TN+ Y+P+WIYN+L  G+++ I I +  D KI KKL 
Sbjct  476   SFGMLLIEMVGGRKNIGSTIENTTNEIYYPQWIYNLLEEGDDLRIHIGEEGDGKIPKKLA  535

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALE  173
             IVGLWCIQW+PVDRP++K V+QMLE E E  +MPPNPF  T P+    + P R     LE
Sbjct  536   IVGLWCIQWHPVDRPAMKTVVQMLEGEGESLTMPPNPFLPTGPTTRNGSIPARRL--ELE  593

Query  172   IISEMD  155
              I+E++
Sbjct  594   AIAELE  599



>emb|CDP22043.1| unnamed protein product [Coffea canephora]
Length=633

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/616 (48%), Positives = 400/616 (65%), Gaps = 49/616 (8%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGY--PGFELLCTDKGETALENPFPLLNATLQPP  1745
             C  ++C   GP + FPF L+  QP ECGY  PG+ L C ++  T LE           PP
Sbjct  39    CAVKRCSPEGPAVRFPFLLRGKQPEECGYNNPGYNLYCDNENHTLLE----------FPP  88

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-----------NLYNFS  1598
               +KF+++SI+ + ++I +   +GC L+ L  L+LS++PF F             +  ++
Sbjct  89    SSMKFVVKSINYKTQMIQVQFAEGCQLKYLRNLDLSSTPFQFSAPDYTIYRYLFRIDRYT  148

Query  1597  IFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYL-YSATDLISCTKMFHVSSVPY  1421
             +F+CS        S +    +CL  PG+ + A  S   + + + +L  CTKM+  + V  
Sbjct  149   LFNCSLANGDGWSSDDEYDFSCLDTPGYKVRATRSDTEIRFLSVEL--CTKMYDTNLVSG  206

Query  1420  SIAQDNTVFSLRWT-----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKV  1274
              + +     +L W+           G  CR KN +   +  DC        +G    + +
Sbjct  207   ELFRMQDSMNLAWSLSACKKCEGKEGGICRWKNGTN--NKFDCFGG----KSGTYHLVFL  260

Query  1273  AGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDR  1094
              G ++G F +++     Y +Y+  K+ +E Q +I  FLEDY A+KP RYSYADIK+IT+ 
Sbjct  261   PGPIVGCFFLILATSALYNVYKTKKIDRENQKRIRTFLEDYAAMKPTRYSYADIKRITND  320

Query  1093  FSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLV  914
             F +KLGEG YG V+KGK+S ++FVAVK+L+NS G+G  EEF+NE+ T+G+IHH+NVVRLV
Sbjct  321   FKDKLGEGGYGNVFKGKISNEIFVAVKLLHNSTGNG--EEFINEVGTMGTIHHVNVVRLV  378

Query  913   GYCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQ  737
             G+CADGF RALVYE+L N SL+KF+F    ++  LG EKLQ IA GIA+G+EYLHQGC+Q
Sbjct  379   GFCADGFKRALVYEFLPNGSLDKFIFPEGQEHHNLGMEKLQNIAFGIARGIEYLHQGCEQ  438

Query  736   RILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFG  557
             RILHFDIKP NILLD NFNPKISDFG AKLC K +S VSMTAARGTMGYIAPEVFSR+FG
Sbjct  439   RILHFDIKPHNILLDNNFNPKISDFGLAKLCEKGRSAVSMTAARGTMGYIAPEVFSRHFG  498

Query  556   NVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGE  377
             NVSYKSD+YSFGMLLLEMVG +K  D       +Q Y+PEW+Y  L +GE++ IQ+E+  
Sbjct  499   NVSYKSDIYSFGMLLLEMVGRRKNID-ANVQNVSQVYYPEWVYGRLVQGEDLRIQVEEDG  557

Query  376   DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDP-SKAKANK  203
             +  IAKKL IVGLWCIQW PVDRPSI  V+QMLE   E PS+PP+PFTSTDP + +  + 
Sbjct  558   EDVIAKKLAIVGLWCIQWNPVDRPSITFVLQMLEGNGESPSLPPSPFTSTDPMNPSNPSL  617

Query  202   PGRLFTSALEIISEMD  155
               R   S L +ISE++
Sbjct  618   HRRHLASGLAVISELE  633



>gb|EYU40255.1| hypothetical protein MIMGU_mgv1a025285mg [Erythranthe guttata]
Length=563

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/595 (52%), Positives = 396/595 (67%), Gaps = 43/595 (7%)
 Frame = -2

Query  1915  LPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPV  1736
             +P +C NNGP I FPFR  + QP  CGYPGF+L C  K            N  L  PF V
Sbjct  1     MPIRCRNNGPIIRFPFRHTNRQPQRCGYPGFDLFCDHKN-----------NTLLVLPFSV  49

Query  1735  KFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCS--THRNI  1568
               +++ I+   + +++   + CF Q LP+LNLSASPF F  + L N+++F+CS  + R++
Sbjct  50    NVIVKKINYVSQRVLVYDQEKCFPQKLPLLNLSASPFRFLIKFLDNYTLFNCSDPSRRDL  109

Query  1567  TAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSL  1388
             +        + CL       YA DS L + S   L SCTK +   SVP+ I Q+N  F L
Sbjct  110   SI------VVPCLGDSTCQFYAVDSKLSMESLP-LTSCTKTYEFKSVPWKIFQEND-FYL  161

Query  1387  RWTGPSCRLKNNSTAED-ADDCIAPLTKLHTGPLRKLKVAGE--VLGSFLVVVIVLVTYR  1217
              W+ P+C     S  ED    C +       G  RK    GE    GS LV +I+     
Sbjct  162   EWSEPAC-----SVCEDKGKRCSSLSNYFLIGTRRKQLTEGEYFCFGSILVAIILAAFVY  216

Query  1216  IYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLS  1037
             +Y   +  +E +  I +FL DYKALKP+R+SY+DIK+IT +F++KLGEG YG VYKGKL+
Sbjct  217   LYIRVRTYQENRTMIGKFLRDYKALKPSRFSYSDIKRITHQFNDKLGEGGYGIVYKGKLN  276

Query  1036  GDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNN  857
              ++ VAVKVLNNS  +G+GEEFVNE+STIG IHH+N+VRL+G+CADGF RALVYE+L N 
Sbjct  277   NEIVVAVKVLNNS--NGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNG  334

Query  856   SLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFN  680
             SLEK +F   +++  L WEKL+ IALGIAKG++YLH+GCDQ+ILHFDIKP+N+LLDQNFN
Sbjct  335   SLEKSIFQAGSNRITLDWEKLKDIALGIAKGIKYLHEGCDQQILHFDIKPQNVLLDQNFN  394

Query  679   PKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMV  500
             PKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYSFGMLLLEMV
Sbjct  395   PKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMV  454

Query  499   GGKKKSDITGSPETNQDYFPEWIYN-ILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQW  323
             GG+K  D      T+Q YF +WIYN I +R   +  QI++ + + IA+KL+IVGLWCIQW
Sbjct  455   GGRKNED-RNVNNTSQVYFLQWIYNHINARDNNLWSQIDE-DGNNIARKLSIVGLWCIQW  512

Query  322   YPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISE  161
              P +RPS+K V+QMLE E    +MPPNPF +T  S       GR + + + II E
Sbjct  513   CPTNRPSMKDVVQMLEGELNDLTMPPNPFPATTNS-----IDGRHYQTQMSIILE  562



>ref|XP_002529765.1| receptor serine/threonine kinase, putative [Ricinus communis]
 gb|EEF32631.1| receptor serine/threonine kinase, putative [Ricinus communis]
Length=597

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/596 (51%), Positives = 391/596 (66%), Gaps = 64/596 (11%)
 Frame = -2

Query  1942  GYSYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYP--GFELLCTDKGETALENPFPL  1769
             G   ++++C   KC  +GP I FPFR+K +QP  C YP  GF+L CT+K ET        
Sbjct  31    GLGLNKDDCKESKCSRHGPAIRFPFRIKGLQPDHCAYPEVGFDLSCTEKKET--------  82

Query  1768  LNATLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF----ENLYNF  1601
                 L  P  VK L+++ID   ++I  S  + C  + L  LNLSASPF +    +N  + 
Sbjct  83    ---VLVLPNSVKLLVKTIDYASQVIHASDPENCLPRQLSNLNLSASPFQYLELDQNTQSH  139

Query  1600  SIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPY  1421
              +F+C+  +N          + CL+ P + +Y   S++ +  + DL+ CTKM+ VS    
Sbjct  140   VLFNCTWRKN------PFFQVPCLSAPNYQVYIFSSTIRI-DSPDLMYCTKMYDVSLPEN  192

Query  1420  SIAQDNTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVA  1271
              I  ++ V  L W  PSC          RLK N+T  + + C   L ++ T    K  V 
Sbjct  193   MIFSNDYVLQLTWFNPSCGSCAIQGKYCRLKANNTQPETE-CSGELKRI-TWAAPKFLVT  250

Query  1270  GEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRF  1091
             G + G  LVV++    YRIY  +K++KE Q +IE+FL+DYKA KP RYSY+DIK+IT++F
Sbjct  251   GIIFGMLLVVLMGFALYRIYIFDKIEKEYQSRIEKFLDDYKAFKPGRYSYSDIKRITNQF  310

Query  1090  SEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVG  911
              E+LG+G+YGTV+KGKLS ++ VAVKVLNNSKG+G  EEFVNE+ TIG IHH NVVR +G
Sbjct  311   KEELGKGAYGTVFKGKLSDEILVAVKVLNNSKGNG--EEFVNEVRTIGRIHHANVVRFIG  368

Query  910   YCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQR  734
             +CADGF RALVYEYL N+SLEKF+ S + KN FLGW                      +R
Sbjct  369   FCADGFRRALVYEYLPNDSLEKFISSADAKNHFLGW----------------------KR  406

Query  733   ILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGN  554
             ILHFDIKP+NILLD NFNPKISDFG AKLCSK++S VSMT ARGT+GYIAPEVFSRNFGN
Sbjct  407   ILHFDIKPQNILLDHNFNPKISDFGLAKLCSKDQSAVSMTTARGTIGYIAPEVFSRNFGN  466

Query  553   VSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGED  374
             VS+KSDVYSFGML+LEMVGG+K  D  G  E    YFPEWIYN+L  GE++ ++ E+ ED
Sbjct  467   VSFKSDVYSFGMLVLEMVGGRKSVD--GKNEKGHIYFPEWIYNLLEVGEDLRLEFEEEED  524

Query  373   SKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKA  209
             + IAKKL IVGLWC QW PVDRP++K VIQMLE E +  S+PPNPF+S +P +  A
Sbjct  525   AMIAKKLAIVGLWCSQWNPVDRPTMKSVIQMLEGEGDNLSVPPNPFSSVNPRRMNA  580



>ref|XP_010049239.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Eucalyptus 
grandis]
 gb|KCW89166.1| hypothetical protein EUGRSUZ_A01478 [Eucalyptus grandis]
Length=606

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/606 (51%), Positives = 399/606 (66%), Gaps = 47/606 (8%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHI-QPPECGYP-GFELLCTDKGETALENPFPLLNATLQPP  1745
             C PR C ++GP++ FPF L+   QP  CGY   F L C D+ +T L  P        + P
Sbjct  28    CRPRSC-HHGPDVQFPFLLERSGQPDGCGYSRDFHLSC-DRRDTLLSLP--------ETP  77

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLS--------ASPFSFENLYNFSIFS  1589
              P+  L+  ID ++R I +   +GC   LL  LN S         SP+S    YN+++F 
Sbjct  78    RPL--LVTDIDYKNRSISVRDREGCIPLLLANLNHSIFSYKMSPRSPYSSYPPYNYTLFQ  135

Query  1588  CSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ  1409
             C       +G   ++ + C++   + ++A +S+ Y+     L+SC +   +  +P +I  
Sbjct  136   CPLGGRSDSG---MTRLGCVSTSEYDVFAVESNSYV-GDLPLVSCMRNGSIDLLPTTIGD  191

Query  1408  DNTVFSLRWTGPSC--------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
                  +L W  P C        R K N T      CI P  + H     KL++AG V+  
Sbjct  192   IMRDVNLVWDKPDCGCTKGKLCRRKGNGT-----HCIDP-PRGHE-ERTKLEIAGGVVSF  244

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             FL +V +     +    +  K  Q+KIE FL+DY+ALKP RYSY DIK+IT+ F EKLG+
Sbjct  245   FLFLVGLSGLGYVINEKRRDKAFQLKIESFLQDYEALKPTRYSYNDIKRITNDFEEKLGQ  304

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G+YGTVYKGKLS ++FVAVK+L+NS G+G  EEF+NE+ST+G IHH+NVVR+VG+CADGF
Sbjct  305   GAYGTVYKGKLSDEIFVAVKMLDNSFGNG--EEFINEVSTMGRIHHVNVVRMVGFCADGF  362

Query  892   HRALVYEYLVNNSLEKFVFSPND--KNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFD  719
              RALVYE+L N SLEKF+F   D    FL WE+L  IALG+AKG+EYLHQGCD +ILHFD
Sbjct  363   RRALVYEFLANESLEKFIFQGEDTLDPFLSWERLHDIALGVAKGIEYLHQGCDHKILHFD  422

Query  718   IKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKS  539
             IKP NILLD NFNPKI+DFG AKLCSKE+S VSMTAARGTMGYIAPEVFSRNFG+VS KS
Sbjct  423   IKPHNILLDNNFNPKIADFGLAKLCSKEQSAVSMTAARGTMGYIAPEVFSRNFGSVSSKS  482

Query  538   DVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAK  359
             DVYSFGMLLLEMVGG+K  D+  +   +Q YFP+W+YN L++GEE+EI+I +  D KIAK
Sbjct  483   DVYSFGMLLLEMVGGRKNVDVN-AKNMSQMYFPQWVYNHLNKGEELEIRIREDGDHKIAK  541

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSA  179
             KL IVGLWCI WYP DRP +K V+QMLE +E P MP NPF S+    A   + GRL+ + 
Sbjct  542   KLAIVGLWCIHWYPADRPPVKAVVQMLEGDECPVMPKNPFVSSSSGDAAIMR-GRLWNTD  600

Query  178   LEIISE  161
             LE+I+E
Sbjct  601   LEVIAE  606



>ref|XP_009790415.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=630

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/606 (51%), Positives = 403/606 (67%), Gaps = 35/606 (6%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNAT--L  1754
             +++CLP +CG+ GP I FPFRLK+ QPP CGYPGFEL CT    T    PFPL  +T  +
Sbjct  25    QDKCLPTRCGDFGPLIRFPFRLKNQQPPGCGYPGFELSCTSDNITQFMLPFPLWASTKNI  84

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDG-CFLQLLPILNLSASPFSF---ENLYNFSIFSC  1586
                      +  ID + + I +S  +  C  + L  +N SASPF+    +    +++F+C
Sbjct  85    DISLSTNVSVGEIDYKSQKIKVSGFNPLCLPRHLQNINASASPFTTIPQDPYVGYTLFNC  144

Query  1585  STHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSI---  1415
             S+ +     +I    I CL+ P + + A  SS+ +       SC  M+++S +P  +   
Sbjct  145   SSDKGY---AIPFDRITCLSGPHYDVLALASSMSISFLPS--SCKYMYNISYIPDEVLFG  199

Query  1414  --AQDNTVFSLRWTGP----------SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVA  1271
                   T   L W+ P           C+LK+N +  + + C+    +   G L K  + 
Sbjct  200   QQELSQTQIPLHWSEPFCGNCEADGNYCKLKSNGSGSETE-CVDGPGEPSKG-LSKEGIV  257

Query  1270  GEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRF  1091
               VLG     V V   Y + +L K+KKE+Q ++ERFLEDYKAL+P RYSYADIKKIT +F
Sbjct  258   ASVLGGASAFVAV---YGLVKL-KIKKEDQKRVERFLEDYKALRPTRYSYADIKKITKQF  313

Query  1090  SEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVG  911
               KLG+G YG VY GKL+ ++ VAVKVLNN KGDG  E+F+NE+ +IG IHH+NVVRLVG
Sbjct  314   KYKLGQGGYGKVYTGKLTKEILVAVKVLNNFKGDG--EDFINEVGSIGRIHHVNVVRLVG  371

Query  910   YCADGFHRALVYEYLVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRI  731
             YCADG+ RALVYEYL N++L+K + S N    LGWEK+QQIA+GIAKG+EYLHQGC+QRI
Sbjct  372   YCADGYRRALVYEYLPNDTLQKIISSGNGNTSLGWEKMQQIAVGIAKGIEYLHQGCNQRI  431

Query  730   LHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNV  551
             +HFDIKP NILLDQ+FNPK++DFG AKLC+K++S VSMTAARGT+GYIAPEVFSRN+GNV
Sbjct  432   VHFDIKPHNILLDQDFNPKVADFGLAKLCAKDQSAVSMTAARGTIGYIAPEVFSRNYGNV  491

Query  550   SYKSDVYSFGMLLLEMVGGKKKSDITGSP-ETNQDYFPEWIYNILSRGEEVEIQIEKGED  374
             SYK+D+YSFGMLLL+M+GG+KK ++     + ++ Y+PEW+Y  L +GEE+EIQIE  +D
Sbjct  492   SYKADIYSFGMLLLDMIGGRKKFEVANEQNDISEIYYPEWMYKQLEKGEEIEIQIEDEDD  551

Query  373   SKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGR  194
             S I KKL IVGLWCIQW P DRPS+KVVIQMLE E  P MP NPF S +     +N    
Sbjct  552   SSIIKKLAIVGLWCIQWSPADRPSMKVVIQMLEGEGIPIMPANPFGSINSPNVGSNAERS  611

Query  193   LFTSAL  176
              F   L
Sbjct  612   QFGCEL  617



>ref|XP_010100009.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB81114.1| putative receptor-like protein kinase [Morus notabilis]
Length=611

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/604 (50%), Positives = 400/604 (66%), Gaps = 43/604 (7%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLK--HIQPPE--CGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             C   +CG NGP I FPFRLK    +P +  C YPGF+L C    ETALE P  L      
Sbjct  33    CKESRCGRNGPTIKFPFRLKDTRTRPSDEACSYPGFDLFCIG-NETALELPVSL------  85

Query  1750  PPFPVKF--LIESIDCEDRLIIISRVDGCFLQ---LLPILNLSASP---FSFENLYNFSI  1595
                P+K+   +  ID E + I +   D C L+   L   +N+SASP   F F+     ++
Sbjct  86    ---PIKYQPFVSKIDYELQRIHLYNRDKCGLEEQYLELFINISASPDSQFIFDEHGGSTL  142

Query  1594  FSCSTHRNITAGSINISPIACLTKPGHFIYAADS-SLYLYSATDLISCTKMFHVSSVPYS  1418
               C + +      ++      ++   H+I A  S S   Y   +L SC+K ++  +    
Sbjct  143   LKCPSSQRPEL--VSNRKYCQISDSNHYITALPSRSTIDYQLPELTSCSKFWYKPNC---  197

Query  1417  IAQDNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLT-KLHTGPLRK-LKV-AGEVLGSFL  1247
                          G  CRLK     +D  +C   L+ K   G  +K L V AG + GSF 
Sbjct  198   -------MDCEVKGKRCRLKKPGNGDDKTECYTVLSSKPRKGTSKKYLSVTAGAIAGSFG  250

Query  1246  VVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGS  1067
             V++  +  +  Y L+K ++E + +I+ FLEDYKALKP+R++YADIKKIT+ F +KLG+G+
Sbjct  251   VILAAIAVFHAYTLDKNERENRKRIKIFLEDYKALKPSRFTYADIKKITNHFKDKLGQGA  310

Query  1066  YGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHR  887
             +GTV+KGKLS D++VAVK+LN+ K +G  EEF+NE++T+G IHH+NVVRL+GYCADGF R
Sbjct  311   FGTVFKGKLSNDIYVAVKILNDIKENG--EEFINEVATMGRIHHVNVVRLLGYCADGFKR  368

Query  886   ALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             ALVYE+L N+SLEK++      N  LGWE LQ IA+G+AKG+EYLHQGCDQRILHFDIKP
Sbjct  369   ALVYEFLPNDSLEKYISIAGGANHSLGWEILQDIAIGVAKGIEYLHQGCDQRILHFDIKP  428

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
              N+LLD+ F PKISDFG AKLCS+++SIVSMT ARGTMGYIAPEVFSRNFG+VSYKSDVY
Sbjct  429   HNVLLDEKFAPKISDFGMAKLCSRDQSIVSMTNARGTMGYIAPEVFSRNFGSVSYKSDVY  488

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             SFGM+LLEMVGG+K +++     T Q Y+PEWIYN+L  GE++ I+IE+  D+KIAKKL 
Sbjct  489   SFGMVLLEMVGGRKNTNMV-EENTEQIYYPEWIYNLLEEGEDLRIRIEEEGDAKIAKKLA  547

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDP-SKAKANKPGRLFTSALE  173
             IVGLWCIQW+P+ RP++KVV+QMLE  +   MPPNPF S+ P SK  A  P R     LE
Sbjct  548   IVGLWCIQWHPISRPTMKVVLQMLEGGQELIMPPNPFASSGPSSKTNAKIPARRMALELE  607

Query  172   IISE  161
              I+E
Sbjct  608   GIAE  611



>ref|XP_010646610.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=443

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/454 (60%), Positives = 348/454 (77%), Gaps = 28/454 (6%)
 Frame = -2

Query  1468  DLISCTKMFHVSSVPYSIAQDNT----VFSLRWT----------GPSCRLKNNSTAEDAD  1331
             DL SC +++  S+       D+      FSL+W+          G  CRLK +++ E   
Sbjct  2     DLSSCRRLYSASAPSNRDYGDSMFNARAFSLKWSKSICGSCPGGGKICRLKKSNSTEQET  61

Query  1330  DCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDY  1151
             +CI  ++K       K+ V G + G FL+V+++++ YR+Y  +K+++E +VK+++FLEDY
Sbjct  62    ECIKGVSK-------KIIVTGAIFGFFLLVLVIVMLYRVYSSDKVERENRVKVKKFLEDY  114

Query  1150  KALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEF  971
             +ALKP+RYSY D+K+IT +F +KLG+G YGTVYKGKLS +VFVAVK+LNNS+G+G  EEF
Sbjct  115   EALKPSRYSYVDVKRITSQFKDKLGQGGYGTVYKGKLSDEVFVAVKILNNSQGNG--EEF  172

Query  970   VNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQ  794
             +NE++T+G+IHH+N+VRLVG+CAD F RAL+YEYL N SLEKF+FS   KN+ L W+KLQ
Sbjct  173   INEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSLSWKKLQ  232

Query  793   QIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMT  614
             +IA+GIAKG+EYLHQGCDQRILHFDIKP NILLD NFNPKISDFG AKLCSKE+S VSMT
Sbjct  233   EIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAVSMT  292

Query  613   AARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEW  434
               RGTMGYIAPEV SRNFGNVSYKSDVYSFGMLLLEMVGG+K  D++    T+Q YFPEW
Sbjct  293   IVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEW  351

Query  433   IYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPS  257
             IYN L  GEE+ I+IE+  D +IAKKL IVGL CIQW PVDRPS+K+V+QMLE E +  +
Sbjct  352   IYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGEGDKLT  411

Query  256   MPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             MPPNPF ST P+    +KPGR+F   L IISE++
Sbjct  412   MPPNPFASTVPT--NLSKPGRVFQQELAIISELE  443



>ref|XP_007010206.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY19016.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=542

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/526 (57%), Positives = 370/526 (70%), Gaps = 28/526 (5%)
 Frame = -2

Query  1729  LIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY---------NFSIFSCSTH  1577
             L+  ID  ++ I +   DGC  + L  L LSASPF+F +           NF++F+CS  
Sbjct  13    LVRHIDYVNQRIQVYDEDGCVQKQLQNLTLSASPFTFRSDIDPYYDSKPGNFTLFNCSI-  71

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDN-T  1400
              + +    N   I+CL+ PG ++   DS    Y   DL++C+K   +  +P  +  D   
Sbjct  72    EDQSNDYDNYGSISCLSVPGFYVKYLDSD---YGGYDLLNCSKTIDIIDIPRGLMSDQKN  128

Query  1399  VFSLRWTGPSCR--------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLV  1244
              F   WT P+C          + N+T     +C   +   H G   KL ++G  +GS L+
Sbjct  129   KFYFSWTNPACGSCEIQGKGCRRNTTKALGIECYY-IHMDHKGARMKLMISGLTIGSLLL  187

Query  1243  VVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSY  1064
             ++ V+    ++ LNK +KE Q KIE+FLEDYKALKP+RYSYADIK+IT++F EKLG+G Y
Sbjct  188   LLSVIGLCWLHHLNKKEKEGQRKIEQFLEDYKALKPSRYSYADIKRITNQFKEKLGQGGY  247

Query  1063  GTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRA  884
             GTV+KG LS DV VAVKVLNN KG+G  EEFVNE+ ++G IHH+NV RLVG+CADG++RA
Sbjct  248   GTVFKGTLSNDVSVAVKVLNNFKGNG--EEFVNEVGSMGRIHHVNVTRLVGFCADGYNRA  305

Query  883   LVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPR  707
             LVYEYL N SLEKF+F+   +N FL WEKL +IALGIAKG+EYLHQGC+QRILHFDIKP 
Sbjct  306   LVYEYLPNESLEKFIFAAKGENRFLSWEKLHEIALGIAKGIEYLHQGCEQRILHFDIKPH  365

Query  706   NILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYS  527
             NILLDQNF PKISDFG AKLCSKE+S VSMTAARGTMGYIAPEV SRNFGNVSYKSDVYS
Sbjct  366   NILLDQNFTPKISDFGLAKLCSKEQSAVSMTAARGTMGYIAPEVLSRNFGNVSYKSDVYS  425

Query  526   FGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTI  347
             FGMLLLEMVGG+K  D+T + E+ Q YFPEW+YN L +GEE+ I IE     KIAKKLTI
Sbjct  426   FGMLLLEMVGGRKNIDVTVANES-QVYFPEWVYNRLDKGEELGIDIEDEGHHKIAKKLTI  484

Query  346   VGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAK  212
             VGL CIQWYPVDRPS+K V+QMLE E +  +MPPNPF S D  K K
Sbjct  485   VGLRCIQWYPVDRPSMKSVVQMLEGEADNLTMPPNPFASKDEKKPK  530



>ref|XP_010646609.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=445

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/454 (60%), Positives = 347/454 (76%), Gaps = 26/454 (6%)
 Frame = -2

Query  1468  DLISCTKMFHVSSVPYSIAQDNT----VFSLRWT----------GPSCRLKNNSTAEDAD  1331
             DL SC +++  S+       D+      FSL+W+          G  CRLK +++ E   
Sbjct  2     DLSSCRRLYSASAPSNRDYGDSMFNARAFSLKWSKSICGSCPGGGKICRLKKSNSTEQET  61

Query  1330  DCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDY  1151
             +CI        G  +K+ V G + G FL+V+++++ YR+Y  +K+++E +VK+++FLEDY
Sbjct  62    ECIKV-----KGVSKKIIVTGAIFGFFLLVLVIVMLYRVYSSDKVERENRVKVKKFLEDY  116

Query  1150  KALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEF  971
             +ALKP+RYSY D+K+IT +F +KLG+G YGTVYKGKLS +VFVAVK+LNNS+G+G  EEF
Sbjct  117   EALKPSRYSYVDVKRITSQFKDKLGQGGYGTVYKGKLSDEVFVAVKILNNSQGNG--EEF  174

Query  970   VNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQ  794
             +NE++T+G+IHH+N+VRLVG+CAD F RAL+YEYL N SLEKF+FS   KN+ L W+KLQ
Sbjct  175   INEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSLSWKKLQ  234

Query  793   QIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMT  614
             +IA+GIAKG+EYLHQGCDQRILHFDIKP NILLD NFNPKISDFG AKLCSKE+S VSMT
Sbjct  235   EIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAVSMT  294

Query  613   AARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEW  434
               RGTMGYIAPEV SRNFGNVSYKSDVYSFGMLLLEMVGG+K  D++    T+Q YFPEW
Sbjct  295   IVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEW  353

Query  433   IYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPS  257
             IYN L  GEE+ I+IE+  D +IAKKL IVGL CIQW PVDRPS+K+V+QMLE E +  +
Sbjct  354   IYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGEGDKLT  413

Query  256   MPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             MPPNPF ST P+    +KPGR+F   L IISE++
Sbjct  414   MPPNPFASTVPT--NLSKPGRVFQQELAIISELE  445



>ref|XP_007029390.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY09892.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=595

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/606 (50%), Positives = 386/606 (64%), Gaps = 69/606 (11%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGY-PGFELLCTDKGETALENPFPLLNATLQP  1748
              EC   +C  +GP + FPF+LK I P  C Y  GF+L CT K ET LE            
Sbjct  29    QECRELRCSRHGPSVRFPFQLKGIHPDHCAYRTGFDLSCTTKNETVLE-----------L  77

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRNI  1568
             P  VK  +  ID + +++ +       L LL  L     P     L++ ++F        
Sbjct  78    PVSVKLFVSKIDYQSQMLHLYDPT---LTLLKRLQFLIYPILHSVLFSGTLFL------K  128

Query  1567  TAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSL  1388
               G  + SP                         L SCTKM++V SVP  I  +N     
Sbjct  129   WEGGSDKSP------------------------SLFSCTKMYNVYSVPLDILYENHDIQF  164

Query  1387  RWTGPSCRLKNNSTAEDADDCIAPLT-----------KLHTGPLRKLKVAGEVLGSFLVV  1241
             RW+ P  +L+  S  E+   C   +                G      V G VLGS L+ 
Sbjct  165   RWSSP--KLECGSCKEEGKICGWKMNASEPQTLCFPKHRERGASTGQVVTGVVLGSCLLA  222

Query  1240  VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYG  1061
             +IV+  Y  Y  +K+ +E Q++I+RF+EDYKALKP RYSYADIK+IT++F E+LG+GSYG
Sbjct  223   IIVMALYEAYISDKLDRENQIRIKRFMEDYKALKPTRYSYADIKRITNQFKEELGQGSYG  282

Query  1060  TVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRAL  881
             TV+KGKLS ++ VAVKVLN +KG+G  EEF+NE+ TIG IHHINVVRLVG+CADGF RAL
Sbjct  283   TVFKGKLSNEILVAVKVLNETKGNG--EEFINEVGTIGKIHHINVVRLVGFCADGFRRAL  340

Query  880   VYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRN  704
             VYE+L N SL+KF+ S + K  FLGWEKLQ IALG+AKG+EYLH+GCDQRILHFDIKP N
Sbjct  341   VYEFLPNGSLQKFIASADSKTLFLGWEKLQGIALGVAKGLEYLHRGCDQRILHFDIKPHN  400

Query  703   ILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSF  524
             ILLD NFNPKI DFG +K+CSK++S VSMT ARGT+GYIAPEVFSRNFGNVSYKSDVYSF
Sbjct  401   ILLDHNFNPKICDFGLSKMCSKDQSAVSMTTARGTIGYIAPEVFSRNFGNVSYKSDVYSF  460

Query  523   GMLLLEMVGGKKKSDITGSPETN-QDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTI  347
             GMLLLEMVGGKK  +I G  +   + Y+P+WI+N+L  GE++ I IE  E SKIAKKL  
Sbjct  461   GMLLLEMVGGKK--NIDGKDDNAVEAYYPDWIHNLLEDGEDLRIPIEGEESSKIAKKLAT  518

Query  346   VGLWCIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNP--FTSTDPSKAKANKPGRLFTSAL  176
             VGLWCIQW+PVDRPS++VV+QMLE +E    +PPN   FT T P+ +   +  R     L
Sbjct  519   VGLWCIQWHPVDRPSMEVVVQMLEGKEDHLKIPPNSFDFTGTRPNASMPERRRR--QQEL  576

Query  175   EIISEM  158
             ++ISE+
Sbjct  577   DVISEV  582



>ref|XP_010049268.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X2 [Eucalyptus grandis]
Length=603

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/599 (51%), Positives = 390/599 (65%), Gaps = 34/599 (6%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             R+ C P  C  +GP + FPF     Q PECGY GFEL+C D+G TAL  P      T QP
Sbjct  29    RHRCPPTSC-PSGPRVRFPFWFPGRQGPECGYKGFELICDDRGRTALSVP-----NTSQP  82

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY------NFSIFSC  1586
                   L+ESID + + +++    GC    L I NL+ S FS   LY      N+ +F C
Sbjct  83    -----LLVESIDYKSQSVVLHDPTGCLP--LVIANLTQSRFSASKLYSNQDPYNYVLFKC  135

Query  1585  STHRNITAGSINISPIACLTKPGHF-IYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ  1409
                         ++ +AC +KP  + +YA +SS Y+     L+ C +   V  +P  I  
Sbjct  136   PP-----PDRDYMTEVACRSKPPSYRVYAVESSDYV-GNLPLVYCERSGSVDPLPNPIDD  189

Query  1408  DNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGP-LRKLKVAGEVLGSFLVVVIV  1232
                     WT P C+             I      H  P + KL++ G V+G  L++V++
Sbjct  190   MIDQAQFEWTTPDCKKCAEGLCGWNGSKIECFPPRHGQPAILKLEITGGVVGPLLLLVVL  249

Query  1231  LVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVY  1052
             +    +    +  K  Q+K+E FL DY+ALKP RYSY DIK+IT+ F EKLG+G+YGTVY
Sbjct  250   IGLGYVLNERRRDKAFQLKVESFLHDYEALKPTRYSYNDIKRITNDFEEKLGQGAYGTVY  309

Query  1051  KGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYE  872
             KGKLS ++FVAVK+L+NS G+G  EEF+NE+ST+G IHH+NVVR+VG+CADGF RALVYE
Sbjct  310   KGKLSNEIFVAVKMLDNSFGNG--EEFINEVSTMGRIHHVNVVRMVGFCADGFRRALVYE  367

Query  871   YLVNNSLEKFVFSPND--KNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
             +L N SLEKF+F   D    FL W +L  IALG+AKG+EYLHQGCD +ILHFDIKP NIL
Sbjct  368   FLANESLEKFIFQGEDTLDPFLSWGRLHDIALGVAKGIEYLHQGCDHKILHFDIKPHNIL  427

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LD NFNPKI+DFG AKLCSKE+S VSMTAARGTMGYIAPE FSRNFG+VS KSDVYSFGM
Sbjct  428   LDDNFNPKIADFGLAKLCSKEQSAVSMTAARGTMGYIAPEDFSRNFGSVSSKSDVYSFGM  487

Query  517   LLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGL  338
             LLLEMVGG+K  D+      +Q YFP+W+YN L++GEE+EI+I +  D KIA+KL I+GL
Sbjct  488   LLLEMVGGRKNVDVNAK-NMSQMYFPQWVYNHLNKGEEIEIRIREDSDHKIARKLAIIGL  546

Query  337   WCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISE  161
             WCI WYP DRP +KVV+QMLE EE P +P NPF S+   +A   +   L+ + LE+I E
Sbjct  547   WCIHWYPADRPPVKVVVQMLEGEECPVIPKNPFVSSGSGEAGTMR--GLWNTNLEVIEE  603



>ref|XP_009335105.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Pyrus 
x bretschneideri]
Length=607

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/608 (51%), Positives = 393/608 (65%), Gaps = 48/608 (8%)
 Frame = -2

Query  1918  CLPRKCGNN-GPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPF  1742
             C   KCG++ G  I FPFR  H       + G   + ++ G  A+ +          P  
Sbjct  28    CTESKCGDDHGLAIHFPFRRGH-------HSGDNKIESNGGYEAVPD---------HPMV  71

Query  1741  PVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFEN--LYNFSIFSCSTHRN  1571
              VKFL++ ID + + I +   D C L + L I N   SPF F N  + N ++  C T   
Sbjct  72    LVKFLVKHIDYKHQEIQVYHPDNCLLLKPLEITNTVISPFYFTNYEVRNVTLVRCPT---  128

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLY-SATDLISCTKMFHVSSVPYSIAQDNTVF  1394
             +    I    + CL   G+ +Y   S   L+ S   L SCT+M+ V SVP     +N  F
Sbjct  129   LVERDIYAYQVPCLGGHGYRVYGVSSFFRLFDSFAALQSCTRMYDVLSVPIGDWVENGNF  188

Query  1393  -SLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGP--LRKLKVAGEVLGS  1253
                +W+ P+C          RL  N T  + + C+      H  P   +     G  LGS
Sbjct  189   LQFKWSQPNCTECEAEGKRCRLNINGTKSEIE-CVH-----HRKPSKTKTFVATGATLGS  242

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             F++++   V YR+Y  ++ +KE ++K+E FL DYKALKP+RYSYADIK+IT++F  KLG+
Sbjct  243   FVLLLGFFVAYRVYSADQKEKENRLKLETFLADYKALKPSRYSYADIKRITNQFKYKLGQ  302

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G+YGTV+KGKLS + FVAVKVLNNSKGDG  EEFVNE+  +G IHH+NVVRLVG+CADGF
Sbjct  303   GAYGTVFKGKLSSECFVAVKVLNNSKGDG--EEFVNEVGAMGHIHHVNVVRLVGFCADGF  360

Query  892   HRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
              RALVYE+  N SL+ ++ S + KN FLGW+KLQ IA+GIAKG+EYLH GCD RILHFDI
Sbjct  361   RRALVYEFFPNGSLQDYISSVDRKNSFLGWDKLQDIAIGIAKGIEYLHLGCDLRILHFDI  420

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP NILLDQNF PKISDFG AKLCSK++SIVSMT ARGTMGYIAPEVFSRNFGNVSYK+D
Sbjct  421   KPHNILLDQNFTPKISDFGLAKLCSKDQSIVSMTTARGTMGYIAPEVFSRNFGNVSYKAD  480

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             VYSFGMLLLE++GGKK    T    TN+ Y+PEWIYN+L  G+++ I I +  D KI K+
Sbjct  481   VYSFGMLLLEIIGGKKNIGSTTEDTTNEIYYPEWIYNLLEEGDDLRIHIGEEGDGKIPKQ  540

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSK-AKANKPGRLFTSA  179
             L IVGL CIQW+PVDRPS+K V+QML   E   MPPNPF S  P++ ++A  P R     
Sbjct  541   LAIVGLCCIQWHPVDRPSMKTVVQMLGGGENLRMPPNPFVSAGPTQTSQAGIPKRR-RLE  599

Query  178   LEIISEMD  155
             LE I E++
Sbjct  600   LEAIVELE  607



>ref|XP_010068890.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Eucalyptus 
grandis]
Length=593

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/599 (51%), Positives = 390/599 (65%), Gaps = 43/599 (7%)
 Frame = -2

Query  1897  NNGPEISFPFRL-KHIQPPECGYP-GFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             ++GP + FPF L +  Q  +CGY   F L C   G T L  P      TL+P      ++
Sbjct  18    HHGPLVQFPFLLERKGQHDDCGYSRDFHLSCDQSGNTLLSLP-----GTLRP-----LVV  67

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENL-----------YNFSIFSCSTH  1577
               I+ E   I +   DGC    LP+ NL+ S FS+E             YN+++F C   
Sbjct  68    TDINYEGSSISVRDRDGCIP--LPLANLNHSIFSYEKSQPSQYSSYQPPYNYTLFQCPRD  125

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
                      ++ + C +   + ++A +S  Y+     L+SC +   +  +P  I+    V
Sbjct  126   GRSEG---RMTRLDCQSTSAYDVFAVESYSYV-GDLPLVSCMRSGSIDLLPKMISMMGEV  181

Query  1396  FSLRWTGPSCRL--KNNSTA---EDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIV  1232
              +L W  P C L  KN S     E+   CI P         RKL++AG V+G FL +V++
Sbjct  182   -NLVWEKPDCGLCTKNGSLCRGNENGIRCINPPGGYKE--RRKLEIAGGVVGFFLFLVVL  238

Query  1231  LVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVY  1052
                  +    +  K  Q+KIE FL DY+ALKP RYSY DIK+IT+ F EKLG+G+YGTVY
Sbjct  239   SGLSYVINEKRRDKAFQLKIESFLHDYEALKPTRYSYNDIKRITNDFEEKLGQGAYGTVY  298

Query  1051  KGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYE  872
             KGKLS ++FVAVK+L+NS G+G  EEF+NE+ST+G IHH+NVVR+VG+CADGF RALVYE
Sbjct  299   KGKLSNEIFVAVKMLDNSFGNG--EEFINEVSTMGRIHHVNVVRMVGFCADGFRRALVYE  356

Query  871   YLVNNSLEKFVFSPND--KNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
             +L N SLEKF+F   D    FL WE+L  IALG+AKG+EYLHQGCD +ILHFDIKP NIL
Sbjct  357   FLPNESLEKFIFQGEDALDPFLSWERLHDIALGVAKGIEYLHQGCDHKILHFDIKPHNIL  416

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LD NFNPKI+DFG AKLCSKE+S VSMTAARGTMGYIAPEVFSRNFG+VS KSDVYSFGM
Sbjct  417   LDNNFNPKIADFGLAKLCSKEQSAVSMTAARGTMGYIAPEVFSRNFGSVSSKSDVYSFGM  476

Query  517   LLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGL  338
             LLLEMVGG+K  D+  +   +Q YFP+W+YN L++ EE+EI+I +  D KIAKKL IVGL
Sbjct  477   LLLEMVGGRKNVDVN-AKNMSQMYFPQWVYNHLNKDEELEIRIREDGDRKIAKKLAIVGL  535

Query  337   WCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISE  161
             WCI WYP DRP +K V+QMLE +E P MP NPF S+    A   + GRL+ + LE+I+E
Sbjct  536   WCIHWYPADRPPVKAVVQMLEGDEYPVMPKNPFVSSGSGDAAIMR-GRLWNTDLEVIAE  593



>ref|XP_009367861.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Pyrus 
x bretschneideri]
Length=600

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/610 (50%), Positives = 398/610 (65%), Gaps = 58/610 (10%)
 Frame = -2

Query  1918  CLPRKCGNN-GPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPF  1742
             C   KC ++ GP I FP  LKH     CG PG E   TD+                QP  
Sbjct  27    CSESKCSDDQGPAIHFPLHLKH----HCG-PGLECNQTDE----------------QPII  65

Query  1741  PVKFLIESIDCEDRLIIISR---VDGCFLQLLPIL--NLSASPF--SFENLYNFSIFSCS  1583
              VKF ++ ID + + I +      + C L + P+   N+  SPF  S  N+ N ++FSC 
Sbjct  66    LVKFFVKRIDYKRQEIQVRDPYYYNNCLLLIKPVKLPNMPLSPFYLSIFNILNVTLFSCP  125

Query  1582  THRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYS--IAQ  1409
                    G+   + + CL  PG   Y             L SCT+M+ V SVP    + +
Sbjct  126   P-----VGTYYGNQVPCLGDPGSTTYGVYGDNSFEFIRWLPSCTRMYDVLSVPIGTWLGK  180

Query  1408  DNTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL  1259
             ++ V   +W+ P+C          R KN+ T  + +    P          KL   G +L
Sbjct  181   EHGVLRFKWSKPNCTECEADGKRCRWKNSGTNSEIECVRKPSNTW------KLLATGGIL  234

Query  1258  GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
             GS L+V++++  YR+Y  ++ +KE +++IERFL DYKALKP+RY YADIK+ITD+F +KL
Sbjct  235   GSLLLVLLMIAAYRVYSADRKEKESRLRIERFLMDYKALKPSRYLYADIKRITDQFKDKL  294

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             G+G+YGTV+KG+LS +  +AVKVLN+SKGDG  EEFVNE+ T+G IHH+NV RLVG+CAD
Sbjct  295   GQGAYGTVFKGRLSSEFLIAVKVLNSSKGDG--EEFVNEVRTMGHIHHVNVARLVGFCAD  352

Query  898   GFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
             GF RALVYE+  N SL+ F+ S + KN FLGW+KLQ IALGIAKG+EYLHQGCDQRILHF
Sbjct  353   GFVRALVYEFFPNGSLQDFISSADSKNSFLGWDKLQNIALGIAKGIEYLHQGCDQRILHF  412

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DIKP N+LLDQNF PKISDFG AKLCSK++S+VSMT ARGTMGYIAPEVFSRNFGNVSYK
Sbjct  413   DIKPHNVLLDQNFTPKISDFGLAKLCSKDQSLVSMTTARGTMGYIAPEVFSRNFGNVSYK  472

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIA  362
             +DVYSFGMLLLEMVGG+K    T    TN+ Y+P+WIYN+L  G+++ I I +  D KI 
Sbjct  473   ADVYSFGMLLLEMVGGRKNIGSTIENTTNEIYYPQWIYNLLEEGDDLRIHIGEEGDGKIP  532

Query  361   KKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFT  185
             KKL I+GLWCIQW+PVDRPS+K+ +Q+LE + E  +MPPNPF +T P+    + P R   
Sbjct  533   KKLAIIGLWCIQWHPVDRPSMKIAVQLLEGDGESLTMPPNPFVATGPTTKNGSIPARRL-  591

Query  184   SALEIISEMD  155
               LE I+E++
Sbjct  592   -ELEPIAELE  600



>ref|XP_004305474.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=602

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/599 (50%), Positives = 395/599 (66%), Gaps = 51/599 (9%)
 Frame = -2

Query  1945  YGYSYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLL  1766
             +G S     C   +C  +GP I FPFRLK IQP  CGYPGF+L CT   +T L+     +
Sbjct  26    HGESVGPENCTEVRCKRHGPVIRFPFRLKGIQPLHCGYPGFDLSCTTDKQTVLQ-----I  80

Query  1765  NATLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQL-------LP--ILNLSASPFSFEN  1613
             N++       KFL++ I+   + I I   D  +  +       +P  I  LS+SPF F +
Sbjct  81    NSSSAD----KFLVKRINYTAQEIEIYLYDSHYDYMNDFQYICIPRQIFKLSSSPFEFSD  136

Query  1612  LY---NFSIFSC--STHRNITAGSINISPIA-CLTKPGHFIYA-ADSSLYLYSATDLISC  1454
                  N++IFSC  S  R+ +     ++ ++ CL    + +YA  D    L     L+SC
Sbjct  137   AQEKTNYTIFSCPPSDERDQSPSFCPLAKLSPCLGNHSNKMYALEDGCAELMYMPQLVSC  196

Query  1453  TKMFHVSSVPYSIAQDNTVFSLRWTGPSCRLKN---------NSTAEDADDCIAPLTKLH  1301
             TK+    SVP    Q      L+WT PSC+            N  A+D         ++ 
Sbjct  197   TKVEDYMSVPSVWMQP---VKLKWTRPSCKRCEEMGKKCGFLNQVADDQKTEETQCLEVP  253

Query  1300  TGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSY  1121
              GP R  ++        L +++  V Y +Y   K ++E Q++IE+FL DY+ALKP+RY+Y
Sbjct  254   KGPNRGKRI--------LEILVATVIYYVYSSKKTEEENQLRIEKFLGDYRALKPSRYAY  305

Query  1120  ADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSI  941
              DI++IT++F +KLG+G+YGTVYKGKLS ++ VAVK+L+NS  +  GE+F+NE+ T+G I
Sbjct  306   GDIRRITNQFEDKLGQGAYGTVYKGKLSSELLVAVKILDNS--NEKGEDFINEVGTMGLI  363

Query  940   HHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGV  764
             HH+NVVRLVG+CADGF RAL+YEYL N SL+ ++ S +DKN FLGWEKLQ IALGIAKG+
Sbjct  364   HHVNVVRLVGFCADGFIRALIYEYLPNGSLQNYLSSADDKNSFLGWEKLQDIALGIAKGI  423

Query  763   EYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIA  584
             EYLHQGCDQRILHFDIKP NILLD +F PK+SDFG AKLCSK++S +SMT ARGTMGYIA
Sbjct  424   EYLHQGCDQRILHFDIKPNNILLDHDFTPKVSDFGLAKLCSKDQSAISMTTARGTMGYIA  483

Query  583   PEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEE  404
             PEVFSRNFGNVSYKSDVYSFG+LLLEMVGGKK   +     T+  YFPEWIYN+L +G +
Sbjct  484   PEVFSRNFGNVSYKSDVYSFGILLLEMVGGKKNFKVM-EDSTSHIYFPEWIYNLLEQGSD  542

Query  403   VEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
             + I IE  ED K+A+KL I+GLWCIQW+P+DRPS+  V+QMLE E +  SMPP PF ST
Sbjct  543   LRIHIED-EDVKLARKLAIIGLWCIQWHPIDRPSMSNVVQMLEREGDSLSMPPYPFAST  600



>emb|CBI23153.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/430 (62%), Positives = 341/430 (79%), Gaps = 22/430 (5%)
 Frame = -2

Query  1408  DNTVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL  1259
             + + FSL+W+          G  CRLK ++ A+   +CI        G L+K+ V G + 
Sbjct  3     NGSAFSLKWSKSICGSCPGGGKICRLKKSNGAQPETECI-------KGVLKKIIVTGAIF  55

Query  1258  GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
             G FL++++++  YR+YR NK+++E ++ +++FL+DY+ALKP+RYSY+DIK+IT++F +KL
Sbjct  56    GFFLLMLVIVALYRVYRSNKLEREYRINVKKFLQDYEALKPSRYSYSDIKRITNQFKDKL  115

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             G+G YG VYKGKLS +VFVAVK+LNNS+G+G  EEF+NE++T+G+IHH+NVVRLVG+CAD
Sbjct  116   GQGGYGIVYKGKLSHEVFVAVKILNNSQGNG--EEFINEVATMGTIHHVNVVRLVGFCAD  173

Query  898   GFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
             GF RAL+YEYL N SLEKF+FS   KN+ L W+KLQ+IA+GIAKG+EYLHQGCDQRILHF
Sbjct  174   GFKRALIYEYLPNESLEKFIFSRAVKNYSLSWKKLQEIAIGIAKGIEYLHQGCDQRILHF  233

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DIKP NILLD NFNPKISDFG AKLCSKE+S VSMT ARGT+GYIAP+V SRNFGNVSYK
Sbjct  234   DIKPHNILLDHNFNPKISDFGLAKLCSKEQSAVSMTIARGTIGYIAPKVLSRNFGNVSYK  293

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIA  362
             SDVYSFGMLLLEMVGG+K  D++    T+Q YFPEWIYN L  GEE+ I+IE+  D+KIA
Sbjct  294   SDVYSFGMLLLEMVGGRKNIDVS-VESTSQVYFPEWIYNHLDHGEELLIRIEEEIDAKIA  352

Query  361   KKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFT  185
             KKL IVGL CIQWYPVDRPS+K+V+QMLE E +  +MPPNPF ST P+K   +KP R F 
Sbjct  353   KKLAIVGLSCIQWYPVDRPSMKIVVQMLEGEGDKLTMPPNPFASTVPTKTNLSKPRRAFQ  412

Query  184   SALEIISEMD  155
               L II E++
Sbjct  413   QELAIILELE  422



>ref|XP_002513566.1| receptor serine/threonine kinase, putative [Ricinus communis]
 gb|EEF48969.1| receptor serine/threonine kinase, putative [Ricinus communis]
Length=493

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/433 (62%), Positives = 328/433 (76%), Gaps = 19/433 (4%)
 Frame = -2

Query  1471  TDLISCTKMFHVSSVPYSIAQDNTVFSLRWTGPSC----------RLKNNSTAEDADDCI  1322
             TDL  CTK+++VSSVP      + V    WT P+C          R KNN+T  + +   
Sbjct  43    TDLTYCTKLYNVSSVPLEFISRDNVLQFNWTRPACGICEEQGTFCRFKNNTTRLETECIE  102

Query  1321  APLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKAL  1142
              P      G   KL +AG VLG+FL+VV+  + YRIY  ++ +KE Q +IE+FL DYKAL
Sbjct  103   KPKRPSRIGF--KLMIAGIVLGAFLLVVVGFLLYRIYSSDRAEKENQRRIEKFLGDYKAL  160

Query  1141  KPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNE  962
             KPARY Y+DIK+IT+ F +KLG+G+YG+V+KG LS ++FVAVKVLNNS GDG   EF+NE
Sbjct  161   KPARYLYSDIKRITNHFKDKLGQGAYGSVFKGSLSSEIFVAVKVLNNSAGDG--TEFINE  218

Query  961   MSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIA  785
             + T+G IHH+NVVRLVGYCADGF RALVYEYL N SLEKF+FS ++K+  LGWEKL+ IA
Sbjct  219   VGTMGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKFIFSNDEKDIPLGWEKLRDIA  278

Query  784   LGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAAR  605
             LGIAKG+EYLHQGCDQRILHFDIKP NILLD+NFNPKISDFG AKLCSK++S +SMT AR
Sbjct  279   LGIAKGIEYLHQGCDQRILHFDIKPHNILLDENFNPKISDFGLAKLCSKDQSAISMTTAR  338

Query  604   GTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYN  425
             GTMGYIAPEVFSRNFGNVSYKSDVYSFGM+LL+MV G+K  D     + +Q YFPEW+YN
Sbjct  339   GTMGYIAPEVFSRNFGNVSYKSDVYSFGMVLLDMVRGRKNIDFA---DGSQVYFPEWVYN  395

Query  424   ILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPP  248
              L +GEE+ I+I++  D KIAKKL  VGLWCIQW P+DRPS+K V+QMLE E    +MPP
Sbjct  396   RLDQGEELRIRIKEVNDEKIAKKLIFVGLWCIQWNPMDRPSMKAVVQMLEGEGNKLTMPP  455

Query  247   NPFTSTDPSKAKA  209
             NPF S   + A A
Sbjct  456   NPFGSAGATLASA  468



>ref|XP_008347208.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=608

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/609 (49%), Positives = 390/609 (64%), Gaps = 52/609 (9%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             C   KCG++G  I   FR  H   P       E    D G+                   
Sbjct  31    CEKSKCGDHGEAIHILFRRGHPCSPTSDCHANE---DDYGQE-------------HRVVV  74

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLPI------LNLSASPFSFENLY--NFSIFSCS  1583
             VKFL++ ID + + + + +   C L L P       ++L AS F  +     N ++F C 
Sbjct  75    VKFLVKRIDYKHQEVQVYQPRNCLL-LKPSEVDNINISLPASQFYLQESMPSNATLFHCP  133

Query  1582  THRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVP--YSIAQ  1409
               R      +N + + C++ PG+ +YA +SS        L SCTKM+ V ++P  Y    
Sbjct  134   AER-----ELNGAKVPCISGPGYRVYAIESSYETMDYPLLESCTKMYDVLAIPQMYYYGL  188

Query  1408  DNTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL  1259
             ++T  +L+W  P+C          R+K N T  +   C+  L+K       K    G  L
Sbjct  189   EDT--NLKWKKPNCTECEAEGKKCRIKYNHTNTEIQ-CVR-LSKASV--TXKFAAVGTTL  242

Query  1258  GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
             GSF+V+ +V+  YR+ R N+ +KE Q+KIE FLEDYKA KP+RYSYADIK+IT++F +KL
Sbjct  243   GSFVVLJLVVAAYRVXRSNRKEKESQLKIETFLEDYKAXKPSRYSYADIKRITNQFQDKL  302

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             G+G+YGTV+KGKLS + FVAVKVLN+S  +G+GE+F+ E+  +GSIHH+NVVRLVG+CAD
Sbjct  303   GQGAYGTVFKGKLSSECFVAVKVLNSS--NGNGEDFIKEVGMMGSIHHVNVVRLVGFCAD  360

Query  898   GFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
             GF+RALVYE+  N SL  F+ S ++ N FLGW+KLQ IAL +AKG+ YLHQ C QRILHF
Sbjct  361   GFNRALVYEFFANGSLHDFISSADNNNRFLGWDKLQDIALAVAKGIYYLHQECXQRILHF  420

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DIKP N+LLD NF PKISDFG AKLCSK++SIVSMT ARGTMGYIAPEVFSRNFGNVSYK
Sbjct  421   DIKPHNVLLDBNFTPKISDFGLAKLCSKDQSIVSMTTARGTMGYIAPEVFSRNFGNVSYK  480

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIA  362
             SDVYSFGMLLLEMVGG K  D T S    + Y+PEWIYN+L  G+++   + +  D +  
Sbjct  481   SDVYSFGMLLLEMVGGXKNIDST-SAIPXEIYYPEWIYNLLEEGDDLRXHLGEEGDGRTP  539

Query  361   KKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTS  182
             KKL IVGLWCIQW+P  RPS+K V+QMLE  E  +MPPNPF ST P++  A  P R   S
Sbjct  540   KKLAIVGLWCIQWHPAGRPSMKEVVQMLEGGEILTMPPNPFASTSPARTNAATPARNLNS  599

Query  181   ALEIISEMD  155
              LE I+E++
Sbjct  600   QLEAIAELE  608



>ref|XP_004306205.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=595

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/587 (50%), Positives = 396/587 (67%), Gaps = 40/587 (7%)
 Frame = -2

Query  1921  ECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPF  1742
              C+  +C ++GP + FPFR++  QP  CGY GF++ CT+  +T LE         + P  
Sbjct  24    HCIETRCKHHGPTVRFPFRIRGSQPNHCGYEGFDISCTNDKQTVLE---------VMPLS  74

Query  1741  PVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNL-SASPFSF-ENLYNFSIFSCSTHRN  1571
               KF ++SI+   + I I    GC   Q+  +++L S+SPF F E   N+++FSC + + 
Sbjct  75    ASKFFVKSINYASQEIEIYYQIGCPPQQVFDLISLLSSSPFKFVEGGRNYTLFSCPSSKE  134

Query  1570  ITAGSINISPIACLTKPGHFIYAAD---SSLYL----YSATD---LISCTKM---FHVSS  1430
             +     +  P  C+ K G   + ++   +  Y     Y   D   L+SCTK+   + +SS
Sbjct  135   LDEYRRSHGPY-CVAKLGSCNHGSNPVGNQFYTVRDDYCTVDSLPLVSCTKVHDYYTLSS  193

Query  1429  VP-YSIAQDNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
             VP  S    + V  L+W+ PSC+       E    C     +     +   +      G+
Sbjct  194   VPDMSTRSRHNVLKLQWSKPSCQ----HCEEMGMTCRFKSEEFRPNQIETTECLHMPKGT  249

Query  1252  FLVVVIVLVT----YRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSE  1085
             F   VI++VT    Y IY   K + E Q++IERFL+DY+ALKP+RYSYADIK+IT +F +
Sbjct  250   FSSSVILIVTGAVIYYIYSSKKAEDENQLRIERFLDDYRALKPSRYSYADIKRITKKFED  309

Query  1084  KLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYC  905
             KLG+G+YGTVYKGKLS D+FVAVK+L+NS  +  G +F+NE+ T+G I+H+NVVRLVG+C
Sbjct  310   KLGQGAYGTVYKGKLSSDLFVAVKILDNS--NEKGGDFINEVGTMGRIYHVNVVRLVGFC  367

Query  904   ADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRIL  728
             ADG+ RAL+YE+L N SL+ F+ S + KN FLGW++LQ IALG+AKG+EYLHQGCDQRIL
Sbjct  368   ADGYIRALIYEFLPNGSLQNFLSSADSKNSFLGWDRLQDIALGVAKGIEYLHQGCDQRIL  427

Query  727   HFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVS  548
             HFDIKP N+LLD++F PK+SDFG AKLCSK++S VSMTAARGTMGYIAPEVFSRNFGNVS
Sbjct  428   HFDIKPHNVLLDEDFTPKVSDFGLAKLCSKDQSAVSMTAARGTMGYIAPEVFSRNFGNVS  487

Query  547   YKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSK  368
             YKSDVYSFG LLLEMVGG+K   +T    T+Q YFPEWIYN+L  G ++ I +E   D K
Sbjct  488   YKSDVYSFGTLLLEMVGGRKNFRVT-EDSTSQVYFPEWIYNLLEEGNDLRIHMEDKGDGK  546

Query  367   IAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
             IA+KL IVGL CIQW+PVDRP +K+V+QMLE E +  +MPPNPF +T
Sbjct  547   IARKLAIVGLRCIQWHPVDRPPMKLVVQMLEREGDNLTMPPNPFATT  593



>ref|XP_003607183.1| Kinase-like protein [Medicago truncatula]
Length=661

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/600 (50%), Positives = 401/600 (67%), Gaps = 45/600 (8%)
 Frame = -2

Query  1936  SYDRNECLPRKC-GNNGPEISFPFRLKHIQPPECGY--PGFELLCTDKGETALENPFPLL  1766
             S+  + C    C G +GP I FPFRLK  QP  CG+    +EL CTD  +T LE      
Sbjct  26    SFHDDPCKESSCDGIHGPFIRFPFRLKGRQPQWCGHNDSWYELYCTDTNQTVLE------  79

Query  1765  NATLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE---NLYNFSI  1595
                   PF  K ++++I+   ++I +S  + C  + +P  N+S+SPF F     L  +++
Sbjct  80    -----LPFSSKTILKTINYTSQIITVSYPEFCLHKQIPNFNISSSPFQFNYEFGLNQYAL  134

Query  1594  FSCS--THRNITAGSINI---SPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSS  1430
             F+CS  +HR       NI      +CL  PG F   A  S+     T L+SCT++  +  
Sbjct  135   FNCSATSHRKTYYTYYNILTSGNFSCLNVPG-FEVIAVQSISSIIGTPLLSCTRIQDLVL  193

Query  1429  VPYSIAQDNTVFSLRWTGPSCR--------LKNNSTAEDAD-DCIAPLTKLHTGPLRKLK  1277
             +P S+  +N    L W  P CR         K N  A   + DCI     L  G +    
Sbjct  194   LPNSLFNNNVDAGLNWFQPDCRNCERKGGQCKANRYASQHEFDCIGIDKGLSKGKV----  249

Query  1276  VAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITD  1097
             +AG +LG F ++ + +  Y IY +  ++++  ++I++FL+ YKALKP+RYSYADIK+I++
Sbjct  250   IAGGILGPFSLIFVGVTVYCIY-VACIERKNYIRIKKFLKYYKALKPSRYSYADIKRISN  308

Query  1096  RFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRL  917
             +F E+LG+G++G+V+KGKLS +V VAVKVLN S G+G  +EF+NEM  +  IHH+NV RL
Sbjct  309   QFKEELGQGAFGSVFKGKLSNEVQVAVKVLNTSTGNG--QEFINEMEAMCQIHHVNVARL  366

Query  916   VGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCD  740
             VG+CADG  RALVYE+L   SL+ F+ S ++K+ FLGW++LQ I+LGIAKG+EYLHQGCD
Sbjct  367   VGFCADGNKRALVYEFLPKGSLQNFISSADNKDVFLGWDRLQNISLGIAKGIEYLHQGCD  426

Query  739   QRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNF  560
             +RILHFDIKP N+LLD NF PKISDFG AKLCSKE+SIVSMT ARGT+GYIAPEVFSRNF
Sbjct  427   KRILHFDIKPHNVLLDDNFTPKISDFGLAKLCSKERSIVSMTTARGTLGYIAPEVFSRNF  486

Query  559   GNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKG  380
             G VSYKSDVYS+GMLLLEMVGG+K +D+T     N  ++P+WIYN+L   E+++I IE  
Sbjct  487   GIVSYKSDVYSYGMLLLEMVGGRKVTDVT-DENNNHVHYPQWIYNLLENNEDIKIDIEGE  545

Query  379   EDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANK  203
             ED++IAKKL+IVGLWCIQW+PV+RP++KVV+QMLE   E   MPPNPF    PS A A +
Sbjct  546   EDTRIAKKLSIVGLWCIQWHPVNRPTMKVVVQMLEGNGEKLEMPPNPFA---PSSATATR  602



>gb|KCW89158.1| hypothetical protein EUGRSUZ_A01470 [Eucalyptus grandis]
Length=618

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/614 (50%), Positives = 391/614 (64%), Gaps = 51/614 (8%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHI-QPPECGY-PGFELLCTDKGETALENPFPLLNATLQPP  1745
             C PR C + GP++ FPF L+H  QP  CGY P F+L C ++G T L            P 
Sbjct  28    CRPRSCPH-GPDVQFPFLLEHSDQPHNCGYSPDFKLSCDERGHTQLS----------LPD  76

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN----------------  1613
              P   ++  ID  +  I +   D C   LL   NL+ S F ++N                
Sbjct  77    TPRPLVVTDIDYNNTSIGVRDRDSCIPVLLA--NLNHSIFFYDNSSLNRDSSGYSYSGYS  134

Query  1612  -LYNFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHV  1436
               YN+++F C       +   +++ + C+    + ++A  S  Y+     L+SC +   +
Sbjct  135   PPYNYTLFQCPKDGRSDS---SMTRLGCVKTSEYDVFAVQSDSYV-GDLPLVSCMRNGSI  190

Query  1435  SSVPYSIAQDNTVFSLRW--TGPSC-RLKNNS----TAEDADDCIAPLTKLHTGPLRKLK  1277
               +P  I        L W    P C R  N        E    CI P +  H G  R L+
Sbjct  191   DLLPMMIDSMMDEVRLFWDKKKPDCGRCTNQGKWCRQNERGIFCINP-SGGHEGK-RNLE  248

Query  1276  VAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITD  1097
             +AG V+G FL +V++     +    +  K  Q+KIE FL DY+ALKP RYSY DIK+IT+
Sbjct  249   IAGGVVGFFLFLVVLSGLGYVINEKRRDKAFQLKIESFLHDYEALKPTRYSYNDIKRITN  308

Query  1096  RFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRL  917
              F EKLG+G+YGTVYKGKLS ++FVAVK+L+NS G+G  EEF+NE+ST+G IHH+NVVR+
Sbjct  309   DFEEKLGQGAYGTVYKGKLSDEIFVAVKMLDNSFGNG--EEFINEVSTMGRIHHVNVVRM  366

Query  916   VGYCADGFHRALVYEYLVNNSLEKFVFSPND--KNFLGWEKLQQIALGIAKGVEYLHQGC  743
             VG+CADGF RALVYE+L N SLEKF+F   D    FL WE+L  IALG+AKG+EYLHQGC
Sbjct  367   VGFCADGFRRALVYEFLANESLEKFIFQGEDTLDPFLSWERLHDIALGVAKGIEYLHQGC  426

Query  742   DQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRN  563
             D +ILHFDIKP NILLD NFNPKI+DFG AKLCSKE+S VSMTAARGTMGYIAPEVFSRN
Sbjct  427   DHKILHFDIKPHNILLDNNFNPKIADFGLAKLCSKEQSAVSMTAARGTMGYIAPEVFSRN  486

Query  562   FGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEK  383
             FG+VS KSDVYSFGMLLLEMVGG+K  D+  +   +Q YFP+W+YN L++GEE+EI+I +
Sbjct  487   FGSVSSKSDVYSFGMLLLEMVGGRKNVDVN-AKNMSQMYFPQWVYNHLNKGEELEIRIRE  545

Query  382   GEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANK  203
               D  IAKKL IVGLWCI WYP DRP +K V+QMLE +E P MP NPF S+    A   +
Sbjct  546   DGDHNIAKKLAIVGLWCIHWYPADRPPVKAVVQMLEGDECPVMPKNPFVSSSSGDAAIMR  605

Query  202   PGRLFTSALEIISE  161
              GRL+ + LE+I+E
Sbjct  606   -GRLWNTDLEVIAE  618



>ref|XP_002310447.2| hypothetical protein POPTR_0007s02200g [Populus trichocarpa]
 gb|EEE90897.2| hypothetical protein POPTR_0007s02200g [Populus trichocarpa]
Length=579

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/596 (50%), Positives = 383/596 (64%), Gaps = 53/596 (9%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CGN+G +I FPF +K  QP + GYPGF L C D G   LE         LQ    VK  I
Sbjct  24    CGNHGLDIRFPFWVKDRQPEQSGYPGFVLSCNDMGVIVLE---------LQAA--VKLYI  72

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-NLYNFSIFSCSTHRNITAGSINI  1547
             E ID ++++I  +   GC L      N S     F+ +  N +IF+CS +      +I+ 
Sbjct  73    EKIDYKNQVIYATDPQGCLLSHHSNFNSSVFHIQFKMSKVNLTIFNCSLN-----NAISR  127

Query  1546  SPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTGPSC  1367
               IACL+   + + A DS   +    +L+SCTKM+ +      + +D     L W+ P C
Sbjct  128   PRIACLSTLHYDVLAVDSEQSI-DDNELLSCTKMYDLP-----VQRD---IRLSWSNPKC  178

Query  1366  ----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYR  1217
                       RL+ NS++E   +C   L +   G  ++    G   GS L  V+V+  Y+
Sbjct  179   GYCEETGKLCRLRINSSSELETECYG-LPRPKKGARKRNLTIGVTTGSILFGVVVIAVYQ  237

Query  1216  IYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLS  1037
             IY   K ++E Q K+ERFL+DY+A+ P RYS+AD+KK+T++F ++LG+G+YGTV+KGKL+
Sbjct  238   IYNFRKSEEEYQAKVERFLDDYRAMNPTRYSHADLKKMTNQFRDELGQGAYGTVFKGKLT  297

Query  1036  GDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNN  857
              ++ VAVKVL NS   G  EEFVNEM T+  IHH+NVVRL+G+CADGF RAL        
Sbjct  298   SEIPVAVKVLTNSSEKG--EEFVNEMGTMARIHHVNVVRLIGFCADGFRRAL--------  347

Query  856   SLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFN  680
                 F+ S N KN FLGWE+L  IALG AKG+EYLHQGCDQ ILHFDIKP NILLD +FN
Sbjct  348   ---NFISSANAKNVFLGWERLHHIALGAAKGIEYLHQGCDQTILHFDIKPHNILLDNDFN  404

Query  679   PKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMV  500
             PKI+DFG AKLCSK KS +SMT ARGT+GYIAPEVFSRNFGNVSYKSDVYSFGM +LEMV
Sbjct  405   PKIADFGLAKLCSKYKSAISMTTARGTVGYIAPEVFSRNFGNVSYKSDVYSFGMWVLEMV  464

Query  499   GGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWY  320
             GG+K  D T +   +Q YFPEWIY +L  GE++  QIE+  D+KIAKKL IVGLWCIQW 
Sbjct  465   GGRKNVDDT-AENGDQVYFPEWIYILLEEGEDLRFQIEEEGDAKIAKKLAIVGLWCIQWN  523

Query  319   PVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             PVDRPS+K+V+QMLE E +  + PPNP  S+ P +  A+  GR     L  ISE +
Sbjct  524   PVDRPSMKIVVQMLEGEGDNLTKPPNPLRSSAPKRKTASIAGRRLHQELAAISETE  579



>ref|XP_008345517.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=597

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/606 (50%), Positives = 394/606 (65%), Gaps = 53/606 (9%)
 Frame = -2

Query  1918  CLPRKCGNN-GPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPF  1742
             C   +CG++ GP I FP R+       CG PG E                  N   +   
Sbjct  27    CPESECGDDQGPAIHFPLRISRTH--HCGNPGLEC-----------------NGRYEQQI  67

Query  1741  PVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFEN--LYNFSIFSCSTHRN  1571
              VK  I+ ID + + I +     C L + + I N+  SPF   N  + N ++FSC T   
Sbjct  68    LVKLFIKQIDYKRQEIQVHPPSNCLLLKPVEITNVPPSPFYLSNFSISNVTLFSCPTVAR  127

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYL-YSATDLISCTKMFHVSSVPYSIAQDNT-V  1397
             +T    +     CL  PG  IY  DS   L Y   +L SC+KM+ V SVP+   + N  +
Sbjct  128   VTYAYQD----PCLGDPGRRIYXIDSKHQLEYLFQNLQSCSKMYDVLSVPFGYWKGNGYI  183

Query  1396  FSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFL  1247
                +W+ P+C          R  NN T  + + C       +T    KL V G +LG+ L
Sbjct  184   LQFKWSKPNCTECEAZGKRCRWNNNGTNSEIE-CQHVRKPSNTW---KLVVTGGILGALL  239

Query  1246  VVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGS  1067
             +V++++  +R+Y  ++ +KE Q++IERFLEDYKALKP+RYSYADIK+IT++F +KLGEG+
Sbjct  240   LVLLMIAAFRVYSADRKEKESQLRIERFLEDYKALKPSRYSYADIKRITNQFKDKLGEGA  299

Query  1066  YGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHR  887
             YGTV+KG LS + F+AVKVLN+SKGDG  EEF+NE+ T+G IHH+NV RLVG+CADGF R
Sbjct  300   YGTVFKGMLSSEFFIAVKVLNSSKGDG--EEFINEVRTMGHIHHVNVARLVGFCADGFIR  357

Query  886   ALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             ALVYE+  N SL+ F+ S   KN FLGW+KLQ IALGIAKG+EYLHQGCD RILHFDIKP
Sbjct  358   ALVYEFFPNGSLQDFISSAGSKNSFLGWDKLQDIALGIAKGIEYLHQGCDLRILHFDIKP  417

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
              N+LLDQNF PKISDFG AKLCSK++S+VSMT ARGT+GYIAPEVFSRNFGNVSYK+DVY
Sbjct  418   HNVLLDQNFTPKISDFGLAKLCSKDQSLVSMTTARGTIGYIAPEVFSRNFGNVSYKADVY  477

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             SFGMLLLEMVGG+K   +T    T++ Y P+WIYN+L  G+++ I I + ED KI KKL 
Sbjct  478   SFGMLLLEMVGGRKNIGVTIDNNTDEIYHPQWIYNLLEEGDDLRIHIGEEEDGKIPKKLA  537

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLE-AEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALE  173
             I+GLWCIQW+P DRPS+K  +QMLE   E  ++PPNPF  T P+     +        LE
Sbjct  538   IIGLWCIQWHPSDRPSMKTAVQMLEGGGESLTVPPNPFMPTGPTTRNVRR------LELE  591

Query  172   IISEMD  155
              I+E++
Sbjct  592   AIAELE  597



>ref|XP_008348789.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=603

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/616 (49%), Positives = 389/616 (63%), Gaps = 62/616 (10%)
 Frame = -2

Query  1924  NECLPRKCGNN-GPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             + CL  KC ++ G  I FP R+   +   CG PG E                  N   + 
Sbjct  24    HACLESKCSDDQGAAIHFPLRIS--RKHHCGNPGLEC-----------------NVRYEQ  64

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFL-----------QLLPILNLSASPFSFENLYNF  1601
                VK  ++ ID + + I +     C L           +   IL    S  S+  + N 
Sbjct  65    QILVKLFVKHIDYKRQEIQVYPPSBCLLLKPVEVTNIDYKRQEILVSPPSNLSYSFIRNL  124

Query  1600  SIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSA-TDLISCTKMFHVSSVP  1424
             ++FSC T     A       + CL  PG  IYA DS+  L +   +L SC+KM+ V S  
Sbjct  125   TLFSCPTS---VARDTYAYQVHCLGDPGSRIYALDSTYQLENLFENLQSCSKMYDVLSGN  181

Query  1423  YSIAQDNTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKV  1274
             +    + +V   +W+ P+C          R KNN    + + C       +T    KL V
Sbjct  182   WE--GNGSVLQFKWSKPNCTECEAEGKMCRWKNNGXNSEIE-CQRVRKPSNTW---KLVV  235

Query  1273  AGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDR  1094
              G +LG+  +V++++  YR+Y  ++ +KE +++IERFL DYKALKP+RYSYADIK+IT++
Sbjct  236   TGGILGALJLVLLMIAAYRVYSTDRKEKESRLRIERFLXDYKALKPSRYSYADIKRITNQ  295

Query  1093  FSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLV  914
             F +KLGEG+YGTV+KG LS + F+AVKVLN+SKGDG  EEFVNE+ T+G IHH+NV RLV
Sbjct  296   FKDKLGEGAYGTVFKGMLSSEFFIAVKVLNSSKGDG--EEFVNEVRTMGHIHHVNVARLV  353

Query  913   GYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQ  737
             G+CADGF RALVYE+  N SL+ F+ S + KN  LGW+KLQ IALGIAKG+EYLHQGCD 
Sbjct  354   GFCADGFVRALVYEFFPNGSLQDFISSADSKNSLLGWDKLQDIALGIAKGIEYLHQGCDL  413

Query  736   RILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFG  557
             RILHFDIKP N+LLDQ F PKISDFG AKLCSK++S+VSMT ARGTMGYIAPEVFSRNFG
Sbjct  414   RILHFDIKPHNVLLDQKFTPKISDFGLAKLCSKDQSLVSMTTARGTMGYIAPEVFSRNFG  473

Query  556   NVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGE  377
             NVSYK+DVYSFGMLLLEMVGG+K    T    TN+ Y P+WIYN+L +G+++ I+I + E
Sbjct  474   NVSYKADVYSFGMLLLEMVGGRKNIGSTTENTTNEIYHPQWIYNLLEKGDDLRIRIGQEE  533

Query  376   DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLE--AEEPPSMPPNPFTSTDPSKAKANK  203
             D KI KKL I+GLWCIQW+P DR S+K  +QMLE    E  +MPPNPF  T P+   A +
Sbjct  534   DGKIPKKLAIIGLWCIQWHPSDRLSMKTAVQMLEGGGGESLTMPPNPFMPTGPTTRNARR  593

Query  202   PGRLFTSALEIISEMD  155
                     LE I+E++
Sbjct  594   ------LELEAIAELE  603



>ref|XP_010049204.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Eucalyptus 
grandis]
Length=662

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/614 (50%), Positives = 391/614 (64%), Gaps = 51/614 (8%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHI-QPPECGY-PGFELLCTDKGETALENPFPLLNATLQPP  1745
             C PR C + GP++ FPF L+H  QP  CGY P F+L C ++G T L            P 
Sbjct  72    CRPRSCPH-GPDVQFPFLLEHSDQPHNCGYSPDFKLSCDERGHTQLS----------LPD  120

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN----------------  1613
              P   ++  ID  +  I +   D C   LL   NL+ S F ++N                
Sbjct  121   TPRPLVVTDIDYNNTSIGVRDRDSCIPVLLA--NLNHSIFFYDNSSLNRDSSGYSYSGYS  178

Query  1612  -LYNFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHV  1436
               YN+++F C       +   +++ + C+    + ++A  S  Y+     L+SC +   +
Sbjct  179   PPYNYTLFQCPKDGRSDS---SMTRLGCVKTSEYDVFAVQSDSYV-GDLPLVSCMRNGSI  234

Query  1435  SSVPYSIAQDNTVFSLRW--TGPSC-RLKNNS----TAEDADDCIAPLTKLHTGPLRKLK  1277
               +P  I        L W    P C R  N        E    CI P +  H G  R L+
Sbjct  235   DLLPMMIDSMMDEVRLFWDKKKPDCGRCTNQGKWCRQNERGIFCINP-SGGHEGK-RNLE  292

Query  1276  VAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITD  1097
             +AG V+G FL +V++     +    +  K  Q+KIE FL DY+ALKP RYSY DIK+IT+
Sbjct  293   IAGGVVGFFLFLVVLSGLGYVINEKRRDKAFQLKIESFLHDYEALKPTRYSYNDIKRITN  352

Query  1096  RFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRL  917
              F EKLG+G+YGTVYKGKLS ++FVAVK+L+NS G+G  EEF+NE+ST+G IHH+NVVR+
Sbjct  353   DFEEKLGQGAYGTVYKGKLSDEIFVAVKMLDNSFGNG--EEFINEVSTMGRIHHVNVVRM  410

Query  916   VGYCADGFHRALVYEYLVNNSLEKFVFSPND--KNFLGWEKLQQIALGIAKGVEYLHQGC  743
             VG+CADGF RALVYE+L N SLEKF+F   D    FL WE+L  IALG+AKG+EYLHQGC
Sbjct  411   VGFCADGFRRALVYEFLANESLEKFIFQGEDTLDPFLSWERLHDIALGVAKGIEYLHQGC  470

Query  742   DQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRN  563
             D +ILHFDIKP NILLD NFNPKI+DFG AKLCSKE+S VSMTAARGTMGYIAPEVFSRN
Sbjct  471   DHKILHFDIKPHNILLDNNFNPKIADFGLAKLCSKEQSAVSMTAARGTMGYIAPEVFSRN  530

Query  562   FGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEK  383
             FG+VS KSDVYSFGMLLLEMVGG+K  D+  +   +Q YFP+W+YN L++GEE+EI+I +
Sbjct  531   FGSVSSKSDVYSFGMLLLEMVGGRKNVDVN-AKNMSQMYFPQWVYNHLNKGEELEIRIRE  589

Query  382   GEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANK  203
               D  IAKKL IVGLWCI WYP DRP +K V+QMLE +E P MP NPF S+    A   +
Sbjct  590   DGDHNIAKKLAIVGLWCIHWYPADRPPVKAVVQMLEGDECPVMPKNPFVSSSSGDAAIMR  649

Query  202   PGRLFTSALEIISE  161
              GRL+ + LE+I+E
Sbjct  650   -GRLWNTDLEVIAE  662



>gb|AES89380.2| receptor-like kinase [Medicago truncatula]
Length=610

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/617 (49%), Positives = 407/617 (66%), Gaps = 55/617 (9%)
 Frame = -2

Query  1936  SYDRNECLPRKC-GNNGPEISFPFRLKHIQPPECGY--PGFELLCTDKGETALENPFPLL  1766
             S+  + C    C G +GP I FPFRLK  QP  CG+    +EL CTD  +T LE      
Sbjct  26    SFHDDPCKESSCDGIHGPFIRFPFRLKGRQPQWCGHNDSWYELYCTDTNQTVLE------  79

Query  1765  NATLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE---NLYNFSI  1595
                   PF  K ++++I+   ++I +S  + C  + +P  N+S+SPF F     L  +++
Sbjct  80    -----LPFSSKTILKTINYTSQIITVSYPEFCLHKQIPNFNISSSPFQFNYEFGLNQYAL  134

Query  1594  FSCS--THRNITAGSINI---SPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSS  1430
             F+CS  +HR       NI      +CL  PG F   A  S+     T L+SCT++  +  
Sbjct  135   FNCSATSHRKTYYTYYNILTSGNFSCLNVPG-FEVIAVQSISSIIGTPLLSCTRIQDLVL  193

Query  1429  VPYSIAQDNTVFSLRWTGPSCR--------LKNNSTAEDAD-DCIAPLTKLHTGPLRKLK  1277
             +P S+  +N    L W  P CR         K N  A   + DCI  + K          
Sbjct  194   LPNSLFNNNVDAGLNWFQPDCRNCERKGGQCKANRYASQHEFDCIG-IDK----------  242

Query  1276  VAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITD  1097
               G +LG F ++ + +  Y IY +  ++++  ++I++FL+ YKALKP+RYSYADIK+I++
Sbjct  243   --GGILGPFSLIFVGVTVYCIY-VACIERKNYIRIKKFLKYYKALKPSRYSYADIKRISN  299

Query  1096  RFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRL  917
             +F E+LG+G++G+V+KGKLS +V VAVKVLN S G+G  +EF+NEM  +  IHH+NV RL
Sbjct  300   QFKEELGQGAFGSVFKGKLSNEVQVAVKVLNTSTGNG--QEFINEMEAMCQIHHVNVARL  357

Query  916   VGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCD  740
             VG+CADG  RALVYE+L   SL+ F+ S ++K+ FLGW++LQ I+LGIAKG+EYLHQGCD
Sbjct  358   VGFCADGNKRALVYEFLPKGSLQNFISSADNKDVFLGWDRLQNISLGIAKGIEYLHQGCD  417

Query  739   QRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNF  560
             +RILHFDIKP N+LLD NF PKISDFG AKLCSKE+SIVSMT ARGT+GYIAPEVFSRNF
Sbjct  418   KRILHFDIKPHNVLLDDNFTPKISDFGLAKLCSKERSIVSMTTARGTLGYIAPEVFSRNF  477

Query  559   GNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKG  380
             G VSYKSDVYS+GMLLLEMVGG+K +D+T     N  ++P+WIYN+L   E+++I IE  
Sbjct  478   GIVSYKSDVYSYGMLLLEMVGGRKVTDVT-DENNNHVHYPQWIYNLLENNEDIKIDIEGE  536

Query  379   EDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANK  203
             ED++IAKKL+IVGLWCIQW+PV+RP++KVV+QMLE   E   MPPNPF    PS A A +
Sbjct  537   EDTRIAKKLSIVGLWCIQWHPVNRPTMKVVVQMLEGNGEKLEMPPNPFA---PSSATATR  593

Query  202   P-GRLFTSALEIISEMD  155
                R     L++ISE++
Sbjct  594   TCARRLNLELDVISEIE  610



>ref|XP_006373193.1| hypothetical protein POPTR_0017s09520g [Populus trichocarpa]
 gb|ERP50990.1| hypothetical protein POPTR_0017s09520g [Populus trichocarpa]
Length=455

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/467 (57%), Positives = 349/467 (75%), Gaps = 20/467 (4%)
 Frame = -2

Query  1540  IACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYS-IAQDNTVFSLRWTGPSCR  1364
             I CL+   H +YA DSS  + S +DL+SCTKM+++  + YS I ++N V ++ W+ P+C 
Sbjct  4     IPCLSTFNHEVYAFDSSTTI-SDSDLLSCTKMYNIYGISYSMIPEENDVLTMSWSNPTCE  62

Query  1363  LKNNSTAEDADDCIAPLTKLHTGPLR-KLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKE  1187
                        +C       HT  +R KL + G +LG FL  ++++  YR Y  +K ++E
Sbjct  63    -------SSETECYLQ----HTKDVRPKLLITGVILGFFLFAIVIIALYRAYSNDKTQRE  111

Query  1186  EQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVL  1007
              Q ++E FL+DY++L P RYSYAD+K+IT++F ++LG+G+YGTV+KGKL+ ++ VAVK+L
Sbjct  112   YQARVEMFLDDYRSLNPTRYSYADLKRITNQFGDELGQGAYGTVFKGKLTTEIAVAVKLL  171

Query  1006  NNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPN  827
             NNS G G  EEF+NE+ T+  IHH+NVVRL+G+CADGF RALVYEYL N+SL+KF+ S +
Sbjct  172   NNSIGKG--EEFINEVGTMARIHHVNVVRLIGFCADGFRRALVYEYLPNDSLQKFISSAD  229

Query  826   DKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAK  650
              +N FLGWE+L ++ALGIAKG+EYLHQGCDQRILHFDIKP+NILLD  FNPKI+DFG AK
Sbjct  230   SRNHFLGWERLNRVALGIAKGIEYLHQGCDQRILHFDIKPQNILLDNEFNPKIADFGMAK  289

Query  649   LCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITG  470
             LCSK+KS +SMT ARGT+GYIAPEVFSRNFGNVSYKSDVYSFGML+LEMVGG+K  D T 
Sbjct  290   LCSKDKSAISMTTARGTVGYIAPEVFSRNFGNVSYKSDVYSFGMLVLEMVGGRKNVDDT-  348

Query  469   SPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVV  290
             +   +Q YFPEWIYN+L + E++   I+  ED+KIAKKL IVGLWCIQW P +RPS+K V
Sbjct  349   AENGDQIYFPEWIYNLLEKEEDLRFHIDGEEDAKIAKKLAIVGLWCIQWNPAERPSMKTV  408

Query  289   IQMLEAE-EPPSMPPNPFTSTDPSKAKA-NKPGRLFTSALEIISEMD  155
             +QMLE E E  + PP+PF+S+ P +  A + P R     L  ISE++
Sbjct  409   VQMLEGEGENLTKPPDPFSSSVPKRTSAGHMPARRLHQELAAISEIE  455



>ref|XP_010049248.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Eucalyptus 
grandis]
 gb|KCW89162.1| hypothetical protein EUGRSUZ_A01474 [Eucalyptus grandis]
Length=620

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/617 (49%), Positives = 396/617 (64%), Gaps = 50/617 (8%)
 Frame = -2

Query  1930  DRNECLPRKCGNNGPEISFPFRLKHIQPPECGY-PGFELLCTDKGETALENPFPLLNATL  1754
             +++ C P+ C + GP++ FPF L+    P CGY P F+L C ++G T L           
Sbjct  27    EKDRCPPQNCPH-GPDVQFPFLLEGKGQPGCGYSPDFKLSCDERGHTQLS----------  75

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN-------------  1613
              P  P   ++  ID  +  I +   D C   LL   NL+ S F ++N             
Sbjct  76    LPDTPRPLVVTDIDYNNTSIGVRDRDSCIPLLLA--NLNHSIFFYDNSSLNRDSSGYSYS  133

Query  1612  ----LYNFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKM  1445
                  YN+++F C       +   +++ + C+    + ++A  S  Y+     L+SC + 
Sbjct  134   GYSPPYNYTLFQCPKDGRSDS---SMTRLDCVKTSEYDVFAVQSYSYV-GDLPLVSCMRN  189

Query  1444  FHVSSVPYSIAQDNTVFSLRW--TGPSC-RLKNNS----TAEDADDCIAPLTKLHTGPLR  1286
               +  +P  I        L W    P C R  N+S      E    CI P    H G  +
Sbjct  190   GSIDLLPMMIDSMMDEVRLFWDKKKPDCGRCTNHSKWCRQNESGIFCINPPGG-HKG-RK  247

Query  1285  KLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKK  1106
             KL++AG V+G FL +V++     +    +  K  Q+KIE FL+DY+ALKP RYSY DIK+
Sbjct  248   KLEIAGGVVGFFLFLVVLSGLGYVINEKRRDKAFQLKIESFLQDYEALKPTRYSYNDIKR  307

Query  1105  ITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINV  926
             IT+ F EKLG+G+YGTVYKGKLS ++FVAVK+L+NS G+G  EEF+NE+ST+G IHH+NV
Sbjct  308   ITNDFEEKLGQGAYGTVYKGKLSDEIFVAVKMLDNSFGNG--EEFINEVSTMGRIHHVNV  365

Query  925   VRLVGYCADGFHRALVYEYLVNNSLEKFVFSPND--KNFLGWEKLQQIALGIAKGVEYLH  752
             VR+VG+CADGF RALVYE+L N SLEKF+F   D    FL WE+L  IALG+AKG+EYLH
Sbjct  366   VRMVGFCADGFRRALVYEFLANESLEKFIFQGEDTLDPFLSWERLHDIALGVAKGIEYLH  425

Query  751   QGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVF  572
             QGCD +ILHFDIKP NILLD NFNPKI+DFG AKLCSKE+S VSMTAARGTMGYIAPEVF
Sbjct  426   QGCDHKILHFDIKPHNILLDNNFNPKIADFGLAKLCSKEQSAVSMTAARGTMGYIAPEVF  485

Query  571   SRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQ  392
             SRNFG+VS KSDVYSFGMLLLEMVGG+K  D+  +   +Q YFP+W+YN L++GEE+EI+
Sbjct  486   SRNFGSVSSKSDVYSFGMLLLEMVGGRKNVDVN-AKNMSQMYFPQWVYNHLNKGEELEIR  544

Query  391   IEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAK  212
             I++  D  IAKKL IVGLWCI WYP DRP +K V+QMLE +E P MP NPF S+    A 
Sbjct  545   IQEDGDHNIAKKLAIVGLWCIHWYPADRPPVKAVVQMLEGDECPVMPKNPFVSSSSGDAA  604

Query  211   ANKPGRLFTSALEIISE  161
               + GRL+ + LE+I+E
Sbjct  605   IMR-GRLWNTDLEVIAE  620



>ref|XP_008365837.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Malus 
domestica]
Length=620

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/607 (50%), Positives = 398/607 (66%), Gaps = 54/607 (9%)
 Frame = -2

Query  1918  CLPRKCGNN-GPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPF  1742
             C   KCG++ GP I  P R+      +CG PG E                  N   +   
Sbjct  27    CPESKCGDDQGPAIQSPLRISVXH--QCGNPGLEC-----------------NGGYEQQI  67

Query  1741  PVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPF---SFENLYNFSIFSCSTHR  1574
              +K  ++ ID + + I +     C L +   I  +  SPF   +F NL N ++F C T  
Sbjct  68    LIKSFVKHIDYKRQEIQVYDPSNCLLLKXAEITTMPPSPFYLXNFRNL-NLTLFXCPTS-  125

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSA-TDLISCTKMFHVSSVPYS-IAQDNT  1400
                A  +++  + CL  P   IYA DS+  L     +L SC+KM+ V SVP+   A +  
Sbjct  126   --VARDMDLYQVPCLGDPXXRIYAIDSTYELEDFFQNLQSCSKMYDVLSVPFGDWAGNGR  183

Query  1399  VFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSF  1250
             V   +W+ P+C          + KNN T  + + C       +T    KL V G VLGS 
Sbjct  184   VLQFKWSKPNCTECEAEGKRCKWKNNGTNSEIE-CQHVSKPSNTW---KLVVTGGVLGSL  239

Query  1249  LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEG  1070
             L+V++++  YR+YR ++ +KE Q++IERFLEDYKALKP+RYSYADIK+IT++F +KLG+G
Sbjct  240   LLVLLMIAAYRVYRADRKEKESQLRIERFLEDYKALKPSRYSYADIKRITNQFKDKLGZG  299

Query  1069  SYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFH  890
             +YGTV+KG LS + F+AVKVLN+SKGDG  EEFVNE+ T+G IHH+NV RLVG+CADGF 
Sbjct  300   AYGTVFKGMLSSEFFIAVKVLNSSKGDG--EEFVNEVRTMGHIHHVNVARLVGFCADGFV  357

Query  889   RALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIK  713
             RALVYE+  N SL+ F+ S + KN FLGW+KLQ IALGIAKG+EYLHQGCD RILHFDIK
Sbjct  358   RALVYEFFPNGSLQDFISSADSKNSFLGWDKLQDIALGIAKGIEYLHQGCDLRILHFDIK  417

Query  712   PRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDV  533
             P N+LLDQNF PKISDFG AKLCSK++S+VSMT ARGTMGYIAPEVFSRNFGNVSYK+DV
Sbjct  418   PHNVLLDQNFTPKISDFGLAKLCSKDQSLVSMTTARGTMGYIAPEVFSRNFGNVSYKADV  477

Query  532   YSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKL  353
             YSFGMLLLEMVGG+K    T    TN+ Y+P+WIYN+L  G+++ I   + ED KI +KL
Sbjct  478   YSFGMLLLEMVGGRKNIGSTTENTTNEIYYPQWIYNLLEEGDDLRIHTGEEEDGKIPRKL  537

Query  352   TIVGLWCIQWYPVDRPSIKVVIQMLE-AEEPPSMPPNPFTSTDPSKAKANKPGRLFTSAL  176
              I+GLWCIQW+P DRPS+K  +Q+LE   E  ++PPNPF  T P+   A +        L
Sbjct  538   AIIGLWCIQWHPSDRPSMKTAVQILEGGGESLTVPPNPFMHTGPTTRNARR------LEL  591

Query  175   EIISEMD  155
             E I+E++
Sbjct  592   EAIAELE  598



>ref|XP_004308547.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=601

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/618 (50%), Positives = 407/618 (66%), Gaps = 54/618 (9%)
 Frame = -2

Query  1924  NECLPRKCGNN-GPEISFPFRLKHIQPPECGYPGFELLCTDKGETAL-ENPFPLLNATLQ  1751
             + C   KCGNN G  I +PF    I+   CGY    L CT   ET + EN   L      
Sbjct  10    SSCTESKCGNNDGLAIHYPF----IRGQHCGYDPV-LQCTQPHETVVAENSVVL------  58

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSF--ENLY---NFSIFS  1589
                 VKF ++ ID + + I +++ D C L +   I ++  SPF F  + L+   N +++ 
Sbjct  59    ----VKFFVKHIDYKHQRIQLNQPDDCLLLKPFDITHMPTSPFYFPQDRLFSSMNITLYH  114

Query  1588  CSTHRNITAGSINISPIACLTKPGHFIYA--ADSSLYLYSATDLISCTKMFHVSSVPYSI  1415
             C T   +      +  + CL  P   +YA  ++S L  Y  + + SCTKM+ V S+P+  
Sbjct  115   CPT---VPVEREYLKQVPCLGGPTAQVYAFPSNSDLLTYMVS-VRSCTKMYDVLSLPFGT  170

Query  1414  AQDNTV-FSLRWTGP----------SCRLKNNSTAEDADDCI---APLTKLHTGPLRKLK  1277
                N   F L W+ P          SCRL+ N T  + + C+    P     T    K  
Sbjct  171   WWGNKEDFILNWSKPNCTECEAEGKSCRLQRNGTNTEVE-CVHLKKPSKAFATCATTKFV  229

Query  1276  VAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITD  1097
               G  +GSF+++++++  YR Y  ++ + E Q KIERFLEDYKALKP+RYSYADIK+IT+
Sbjct  230   ATGATVGSFVLLLLLIPAYRAYNSDRKETEFQRKIERFLEDYKALKPSRYSYADIKRITN  289

Query  1096  RFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRL  917
             +F +K+GEG+YG+V+KG LS +++VAVKVL  S  DG+GEEF+NE+ T+G IHH+NVVRL
Sbjct  290   QFKDKIGEGAYGSVFKGNLSSELYVAVKVLKIS--DGNGEEFINEVETLGHIHHVNVVRL  347

Query  916   VGYCADGFHRALVYEYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCD  740
             VG+CADGF RALVY++  + SL+ F+ S  N K FLGW+KLQ +ALGIAKG+EYLHQGC 
Sbjct  348   VGFCADGFERALVYDFFPSGSLQDFISSADNKKGFLGWDKLQDVALGIAKGIEYLHQGCV  407

Query  739   QRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNF  560
             Q+ILHFDIKP N+LLDQN  PKISDFG AKLCSK++SIVSMT ARGTMGY+APEVFSRNF
Sbjct  408   QQILHFDIKPHNVLLDQNLTPKISDFGLAKLCSKDQSIVSMTTARGTMGYVAPEVFSRNF  467

Query  559   GNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKG  380
             GNVSYKSDVYS+GM+LLEMVGG+K    T +  T + Y+PEWIY++L   E V+++I  G
Sbjct  468   GNVSYKSDVYSYGMVLLEMVGGRKNISST-TENTTEVYYPEWIYSLL---EGVDLRIHVG  523

Query  379   E--DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAK-A  209
             E  D+KIAK+L IVGLWCIQW+PVDRPS+K V+QMLE  E  +MPPNP  ++  S+A   
Sbjct  524   EEADAKIAKRLAIVGLWCIQWHPVDRPSMKGVVQMLEGGEKLTMPPNPSATSGHSRANDG  583

Query  208   NKPGRLFTSALEIISEMD  155
             + P R     LE I+E++
Sbjct  584   STPKRPMYLELETITELE  601



>ref|XP_009341643.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Pyrus 
x bretschneideri]
Length=613

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/587 (50%), Positives = 386/587 (66%), Gaps = 48/587 (8%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             C    C ++GP I FPFRLK  QP +CGY GF+L CT+ G+T LE           P   
Sbjct  49    CTEVSCEHHGPAIRFPFRLKG-QPFQCGYQGFDLSCTNGGQTVLE----------MPSSS  97

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLP--ILNLSASPFSFENLY-----NFSIFSCST  1580
              K ++E+I+   + I +      F   LP  I N S S  +F+ ++     ++++F C +
Sbjct  98    NKLIVETINYASQEIGVY-----FQNCLPKDIFNFSLSSSTFQFVHRRFDTSYTLFGCPS  152

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
                   G I + P           Y A    Y      L+SCTK+   +SVP      + 
Sbjct  153   LLETDHGLIKLCPSGLDNPENQTNYYAVDGGYSIDNMYLVSCTKLRDYTSVP---DISSG  209

Query  1399  VFSLRWTGPSCR--------------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEV  1262
                L+W+ PSCR              +      ++  +C++  +   T     L+++G  
Sbjct  210   AMMLQWSKPSCRGCEEMGKTCRLKRTIGQYHFTDNQTECVSEDS---TRGRTSLEISGIF  266

Query  1261  LGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
               S +V V+  + YR+Y  NK++K  Q++IE+FL+DY A KP+RYSYADIK+IT++F+EK
Sbjct  267   TLSVVVTVVGTLIYRVYSSNKIEKTNQLRIEKFLDDYIAHKPSRYSYADIKRITNQFNEK  326

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             LG+G+YGTVYKG+LS D+ VAVK+LNNS  +  GE+F+NE+ T+G +HH+NVVRLVG+CA
Sbjct  327   LGQGAYGTVYKGQLSSDLLVAVKILNNS--NEKGEDFINEVRTMGRVHHVNVVRLVGFCA  384

Query  901   DGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILH  725
             DG+  ALVYEYL N SL+  + S + K+ FLGW+K+ +IALGIAKG+EYLHQGCD RILH
Sbjct  385   DGYTTALVYEYLPNGSLQNILSSADSKSAFLGWDKVHEIALGIAKGIEYLHQGCDLRILH  444

Query  724   FDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSY  545
             FDIKP NILLDQNF PK+SDFG AKLCSK++S VSMT  RGT+GYIAPEVFSRNFGNVSY
Sbjct  445   FDIKPHNILLDQNFTPKVSDFGLAKLCSKDQSAVSMTTIRGTIGYIAPEVFSRNFGNVSY  504

Query  544   KSDVYSFGMLLLEMVGGKKKSDITGSPET-NQDYFPEWIYNILSRGEEVEIQIEKGEDSK  368
             KSDVYSFGMLLLEMVGG+K         T +Q YFPEWIYN+L +G+++ I IE G D++
Sbjct  505   KSDVYSFGMLLLEMVGGRKNFKFMEEDSTSSQVYFPEWIYNLLEQGDDLRIHIEDGGDAE  564

Query  367   IAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
              AKKL IVGLWC+QW+P+DRPS+KVVIQMLE E +  ++P NPF ST
Sbjct  565   TAKKLAIVGLWCVQWHPIDRPSMKVVIQMLEGEADNLTVPANPFRST  611



>gb|EYU28967.1| hypothetical protein MIMGU_mgv1a003390mg [Erythranthe guttata]
Length=588

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/603 (50%), Positives = 398/603 (66%), Gaps = 43/603 (7%)
 Frame = -2

Query  1933  YDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATL  1754
             +  N+C P +C  NGP I FPFR KH QP  CGY GF++ C               N  L
Sbjct  19    FASNDCTPTRCRGNGPAIRFPFRHKHRQPQSCGYTGFDVDCDHNN-----------NTVL  67

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF---ENLYNFSIFSCS  1583
               P  +   +++I+   + I++S  + CF Q LP LNLSASPF F   E L ++ +F+CS
Sbjct  68    VLPSSINVNVKNINYASQTILVSVQEHCFPQKLPRLNLSASPFHFFNPEYLADYIVFNCS  127

Query  1582  THRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDN  1403
             T      G +    I CL+   +  YA +S+  + S   L SCT+   + S P+ +   N
Sbjct  128   TPERSVLGMV----ITCLSDSKYKFYAFNSNFSMESFP-LTSCTRTCEILSAPWYVFHKN  182

Query  1402  TVFSLRWTGPSCRLKNNSTAEDADDCIAPL-TKLHTGPLRKLK---VAGEVLGSFLVVVI  1235
               F L W+ PSC    N T  D+  C   L T+    P ++ K   + G   G FL  +I
Sbjct  183   E-FYLEWSDPSC----NYTKFDSIQCPDKLPTETRGAPKKQPKKQLITG--FGCFLAAII  235

Query  1234  VLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTV  1055
             +     +    ++ +E Q+KIE+FL DY+ALKP+R+SY+DI ++T +F  KLGEGSYG V
Sbjct  236   LAALIYLGIRFRIGRENQIKIEKFLHDYRALKPSRFSYSDITRMTHQFRHKLGEGSYGIV  295

Query  1054  YKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVY  875
             YKGKL+ ++ VAVKVLNNSKG+G  EEFVNE+STIG IHH+NVVRLVG+CADGF RALVY
Sbjct  296   YKGKLNNEINVAVKVLNNSKGNG--EEFVNEVSTIGRIHHVNVVRLVGFCADGFRRALVY  353

Query  874   EYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
             E+L N SLEK +    +++  L WEKL+ IALG+A+G+EYLH+GCDQ+ILHFDIKP+N+L
Sbjct  354   EFLPNGSLEKSISQEGSNRVSLDWEKLKDIALGVARGIEYLHEGCDQQILHFDIKPQNVL  413

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LD NFNPKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYSFGM
Sbjct  414   LDHNFNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGM  473

Query  517   LLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGE-EVEIQIEKGEDSKIAKKLTIVG  341
             +LLE+V G K  D T +  T++ YFP+WIYN +S G+     QI++ E + IA+KL+IVG
Sbjct  474   VLLEIVEGAKNVD-TNADNTSKVYFPQWIYNHISVGDNHFWAQIDE-EGNSIARKLSIVG  531

Query  340   LWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIIS  164
             LWCIQW P DRPS+KVV+QMLE E +  +MPPNPF + +      + P   + + L II 
Sbjct  532   LWCIQWCPTDRPSMKVVVQMLEGECDDLTMPPNPFPAAN------SVPESYYEAELPIIL  585

Query  163   EMD  155
             E++
Sbjct  586   ELE  588



>ref|XP_010662457.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=380

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/374 (68%), Positives = 307/374 (82%), Gaps = 4/374 (1%)
 Frame = -2

Query  1273  AGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDR  1094
             AG  LGS L+++  +  +R+Y L K+++  Q+KIE+FLEDY ALKP RYSYADIKKIT++
Sbjct  10    AGVTLGSILLILGTVALHRVYSLKKLERNNQIKIEKFLEDYIALKPTRYSYADIKKITNQ  69

Query  1093  FSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLV  914
             F +KLGEG  GTVYKGKLS +V VAVK+LNNSKG+G  EEF+NE+ T+G IHH+NVVRLV
Sbjct  70    FQDKLGEGGCGTVYKGKLSDEVHVAVKILNNSKGNG--EEFINEVGTMGRIHHVNVVRLV  127

Query  913   GYCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQ  737
             G+CADGF RAL+YE+L N SLEKF+FS   +N  LGW+KLQ IALGIAKG+EYLHQGCDQ
Sbjct  128   GFCADGFRRALIYEFLPNESLEKFIFSRTTENHSLGWKKLQDIALGIAKGIEYLHQGCDQ  187

Query  736   RILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFG  557
             RILHFDIKP NILLD NFNPKISDFG AKLCSKE+S VSMT+ARGTMGYIAPE+ SRNFG
Sbjct  188   RILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAVSMTSARGTMGYIAPEMLSRNFG  247

Query  556   NVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGE  377
             NVSYKSDV+S+GMLLLEMVGG+K  DIT    T Q YFPEWIYN L +GEE++I+I++  
Sbjct  248   NVSYKSDVFSYGMLLLEMVGGRKNIDIT-VDNTCQVYFPEWIYNHLDQGEELQIRIDEDG  306

Query  376   DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPG  197
             D++I KKLTIVGLWCIQW+  DRPS+K+V+QMLE E   SMPPNPFT T P+K  A+ P 
Sbjct  307   DTQIVKKLTIVGLWCIQWFSADRPSMKLVVQMLEGEHNLSMPPNPFTCTGPTKTNASTPE  366

Query  196   RLFTSALEIISEMD  155
             R     L +ISE++
Sbjct  367   RYLQQELIVISEIE  380



>ref|XP_008347133.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=584

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/597 (49%), Positives = 385/597 (64%), Gaps = 52/597 (9%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             C   +CGN+G  I FPF  +H     CG P       ++G+   E+   ++         
Sbjct  31    CTESECGNHGKAIHFPFHRRH----HCGRP--TDCHANEGDGGQEHRVVVM---------  75

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLPI------LNLSASPFSFENLY--NFSIFSCS  1583
              KFL++ ID +++ + + +   C L L P+      + L+AS F F   +  N+++F C 
Sbjct  76    -KFLVKRIDYKNQEVQVHKPYNCLL-LKPLEVDNINMPLTASQFYFLPFFTRNYTLFHCP  133

Query  1582  THRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDN  1403
               R +       +P+ C+  PG+ +YA  S  +L+ +  L SCTKM+ V S   ++ +  
Sbjct  134   VERELD------TPVPCIGGPGYRVYALSSDYFLWDSLALESCTKMYDVLS---NVKRKA  184

Query  1402  TVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVT  1223
             TV  L   G +             +C+  L K      RKL      LGSF V+V+V+  
Sbjct  185   TVVELYAAGYA-----------EIECVY-LKK--ASATRKLVATCASLGSFAVLVLVVAA  230

Query  1222  YRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGK  1043
             YR+Y  N+ +KE Q+KI++FLEDYKA KP+RYSYADIK+IT++F +KLG+G+YGTV+KGK
Sbjct  231   YRVYSSNRKEKESQLKIDKFLEDYKAHKPSRYSYADIKRITNQFQDKLGQGAYGTVFKGK  290

Query  1042  LSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLV  863
             LS + FVAVKVLN+S  + +GE+F+ E+  +G IHH+NVVRLV +CAD F+ ALVYE+  
Sbjct  291   LSSECFVAVKVLNSS--NRNGEDFIKEVGMMGRIHHVNVVRLVSFCADRFNGALVYEFFA  348

Query  862   NNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQN  686
             N SL  F+ S ++ N FLGW+KLQ IAL +AKG+ YLHQ CDQRILHFDIKP N+LLD N
Sbjct  349   NGSLHXFISSADNNNRFLGWDKLQDIALAVAKGIYYLHQECDQRILHFDIKPHNVLLDBN  408

Query  685   FNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLE  506
             F PKISDFG AKLCSK +SIVSMT ARGTMGYIAPEVFSRNFGNVSYKS VYSFGMLLLE
Sbjct  409   FTPKISDFGLAKLCSKXQSIVSMTXARGTMGYIAPEVFSRNFGNVSYKSXVYSFGMLLLE  468

Query  505   MVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQ  326
             MVGG K  D T +  T + Y+PEWIYN+L  G++  I + +  D    KKL IVGLWCIQ
Sbjct  469   MVGGXKNIDXTSAIPT-EIYYPEWIYNLLEEGDDJRIHLGEEGDGXTPKKLAIVGLWCIQ  527

Query  325   WYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             W+P  RPS K V+QMLE  E  +MPPNPF ST P++  A  P R     LE I+E++
Sbjct  528   WHPXGRPSXKEVVQMLEGGEXLTMPPNPFASTXPARTNAXTPARNLNXQLEAIAELE  584



>ref|XP_008370222.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=609

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/607 (50%), Positives = 397/607 (65%), Gaps = 54/607 (9%)
 Frame = -2

Query  1918  CLPRKCGNN-GPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPF  1742
             C   KCG++ GP I  P R+      +CG PG E                  N   +   
Sbjct  38    CPESKCGDDQGPAIQSPLRISVXH--QCGNPGLEC-----------------NGGYEQQI  78

Query  1741  PVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPF---SFENLYNFSIFSCSTHR  1574
              +K  ++ ID + + I +     C L +   I  +  SPF   +F NL N ++F C T  
Sbjct  79    LIKSFVKHIDYKRQEIQVYDPSNCLLLKXAEITTMPPSPFYLXNFRNL-NLTLFXCPTS-  136

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSA-TDLISCTKMFHVSSVPYS-IAQDNT  1400
                A  +++  + CL  P   IYA DS+  L     +L SC+KM+ V SVP+   A +  
Sbjct  137   --VARDMDLYQVPCLGDPXXRIYAIDSTYELEDFFQNLQSCSKMYDVLSVPFGDWAGNGR  194

Query  1399  VFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSF  1250
             V   +W+ P+C          + KNN T  + + C       +T    KL V G VLGS 
Sbjct  195   VLQFKWSKPNCTECEAEGKRCKWKNNGTNSEIE-CQHVSKPSNTW---KLVVTGGVLGSL  250

Query  1249  LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEG  1070
             L+V++++  YR+YR ++ +KE Q++IERFLEDYKALKP+RYSYADIK+IT++F +KLG+G
Sbjct  251   LLVLLMIAAYRVYRADRKEKESQLRIERFLEDYKALKPSRYSYADIKRITNQFKDKLGZG  310

Query  1069  SYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFH  890
             +YGTV+KG LS + F+AVKVLN+SKGDG  EEFVNE+ T+G IHH+NV RLVG+CADGF 
Sbjct  311   AYGTVFKGMLSSEFFIAVKVLNSSKGDG--EEFVNEVRTMGHIHHVNVARLVGFCADGFV  368

Query  889   RALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIK  713
             RALVYE+  N SL+ F+ S + KN FLGW+KLQ IALGIAKG+EYLHQGCD RILHFDIK
Sbjct  369   RALVYEFFPNGSLQDFISSADSKNSFLGWDKLQDIALGIAKGIEYLHQGCDLRILHFDIK  428

Query  712   PRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDV  533
             P N+LLDQNF PKISDFG AKLCSK++S+VSMT ARGTMGYIAPEVFSRNFGNVSYK+DV
Sbjct  429   PHNVLLDQNFTPKISDFGLAKLCSKDQSLVSMTTARGTMGYIAPEVFSRNFGNVSYKADV  488

Query  532   YSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKL  353
             YSFGMLLLEMVGG+K    T    TN+ Y+P+WIYN+L  G+++ I   + ED KI +KL
Sbjct  489   YSFGMLLLEMVGGRKNIGSTTENTTNEIYYPQWIYNLLEEGDDLRIHTGEEEDGKIPRKL  548

Query  352   TIVGLWCIQWYPVDRPSIKVVIQMLE-AEEPPSMPPNPFTSTDPSKAKANKPGRLFTSAL  176
              I+GLWCIQW+P DRPS+   +Q+LE   E  ++PPNPF  T P+   A +        L
Sbjct  549   AIIGLWCIQWHPSDRPSMXTAVQILEGGGESLTVPPNPFMPTGPTTRNARR------LEL  602

Query  175   EIISEMD  155
             E I+E++
Sbjct  603   EAIAELE  609



>ref|XP_009343234.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Pyrus 
x bretschneideri]
Length=620

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/580 (51%), Positives = 383/580 (66%), Gaps = 38/580 (7%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             C ++GP I FPFRLK  QP +CGY GF+L CT+  +T LE           P    K ++
Sbjct  55    CEHHGPAIRFPFRLKG-QPFQCGYHGFDLSCTNGRQTVLE----------MPSSSNKLIV  103

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENL---YNFSIFSCSTHRNITAGSI  1553
             E+I+   + I +   + C  + +   NLS+S F F +     N+++FSC +      G I
Sbjct  104   ETINYASQEIGVYFQNDCPPKDIFNFNLSSSIFQFVHGPFDANYTLFSCPSLLETDDGLI  163

Query  1552  NISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPY-SIAQDNTVFSLRWTG  1376
              + P           Y A    Y     +L+SCTK+   +SVPY S  +   +  L+W+ 
Sbjct  164   KLCPSGLDNPENQTNYYAVDGQYSIDHMNLVSCTKLRDYTSVPYISSVRAFQLMMLQWSK  223

Query  1375  PSC---------------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVV  1241
             PSC                  +N TAE   +C++    L +  L      G    S +V 
Sbjct  224   PSCGRCEEMGKTCRLGQYNFTDNQTAET--ECVSE-ENLTSSKLISSVSVGIFTLSVVVT  280

Query  1240  VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYG  1061
             V+  + YR+Y  NK++K  Q++IERFL+DY A KP+RYSYADIK+IT++F+EKLG+G+YG
Sbjct  281   VVGTLIYRVYSSNKIEKTNQLRIERFLDDYIAHKPSRYSYADIKRITNQFNEKLGQGAYG  340

Query  1060  TVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRAL  881
             TVYKG+LS D+ VAVK+LNNS  +  GE+ +NE+ T+G +HH+NVVRLVG+CADG+   L
Sbjct  341   TVYKGQLSSDLLVAVKILNNS--NEKGEDLINEVGTMGRVHHVNVVRLVGFCADGYTITL  398

Query  880   VYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRN  704
             VYEYL N SL+  + S + K+ FLGW+KL +IALGIAKG+EYLHQGCD RILHFDIKP N
Sbjct  399   VYEYLPNGSLQNILSSADSKSAFLGWDKLHEIALGIAKGIEYLHQGCDLRILHFDIKPHN  458

Query  703   ILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSF  524
             ILLDQNF PK+SDFG AKLCS+++S VSMT  RGT+GYIAPEVFSRNFGNVSYKSDVYSF
Sbjct  459   ILLDQNFTPKVSDFGLAKLCSRDQSAVSMTTIRGTIGYIAPEVFSRNFGNVSYKSDVYSF  518

Query  523   GMLLLEMVGGKKKSDITGSPET-NQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTI  347
             GMLLLEMVGG+K         T +Q YFPEWIYN+L + + + I IE G D++ AKKL I
Sbjct  519   GMLLLEMVGGRKNFKFMEEDSTSSQVYFPEWIYNLLEQRDNLRIHIEDGGDAETAKKLAI  578

Query  346   VGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
             VGLWC+QW+P+DRPS+KVVIQMLE E +  ++P NPF ST
Sbjct  579   VGLWCVQWHPIDRPSMKVVIQMLEGEGDNLTVPANPFRST  618



>ref|XP_011037151.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Populus euphratica]
Length=548

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/587 (49%), Positives = 378/587 (64%), Gaps = 81/587 (14%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CGN GP+I FPFR+K  QP  CG   F+L C+              N  L+ P  +   I
Sbjct  39    CGNRGPDIRFPFRIKDKQPDHCG---FDLSCSKDN-----------NTVLKLPTGLSLHI  84

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRNITAGSINIS  1544
             E ID   RLI      GCFL                          S  R     S+ I 
Sbjct  85    ERIDYIHRLIYARDPQGCFL--------------------------SEKR-----SLYIG  113

Query  1543  PIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD-NTVFSLRWTGPSC  1367
              I CL    H +YA +SS+ + S  DL+SCTKM+++  +PYS+ Q+ N V ++ W+ P+C
Sbjct  114   KIPCLRTYKHEVYAVESSISI-SNFDLLSCTKMYNIYGIPYSMMQEENYVLTMSWSNPTC  172

Query  1366  RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKE  1187
                   ++E       P TK                       ++   YR Y  +K  +E
Sbjct  173   -----GSSETKCYSNLPHTK-----------------------VITALYRAYSNDKTHRE  204

Query  1186  EQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVL  1007
              Q ++E FL+DY++L P RYSYAD+K+IT++FS++LG+G+YGTV+KGKL+ ++ VAVK+L
Sbjct  205   YQARVEMFLDDYRSLNPTRYSYADLKRITNQFSDELGQGAYGTVFKGKLTNEITVAVKLL  264

Query  1006  NNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPN  827
             +NS G G  EEF+NE+ T+ +IHH+NVVRL+G+CADGF RALVYE L N+SL+KF+ S +
Sbjct  265   SNSIGKG--EEFINEVGTMANIHHVNVVRLIGFCADGFRRALVYESLPNDSLQKFISSAD  322

Query  826   DKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAK  650
              +N FLGWE+L ++ALGIA G+EYLHQGCDQRILHFD KP+NILLD  FNPKI+DFG AK
Sbjct  323   SRNLFLGWERLNRVALGIAMGIEYLHQGCDQRILHFDNKPQNILLDNEFNPKIADFGMAK  382

Query  649   LCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITG  470
             LCSK+KS +SMT ARGT+GYIAPEVFSRNFGNVSYKSDVYSFGML+LEMVGG+K  D T 
Sbjct  383   LCSKDKSAISMTTARGTVGYIAPEVFSRNFGNVSYKSDVYSFGMLVLEMVGGRKNIDDT-  441

Query  469   SPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVV  290
             +   +Q YFPEWIYN+L + E++   I+  ED++IAKKL IVGLW IQW P +RPS+K V
Sbjct  442   AENGDQIYFPEWIYNLLEKEEDLRFHIDGEEDARIAKKLAIVGLWRIQWNPAERPSMKTV  501

Query  289   IQMLEAE-EPPSMPPNPFTSTDPSKAKANK-PGRLFTSALEIISEMD  155
             +QMLE E E  + PP+PF+S+ P +  A + P R     L  ISE++
Sbjct  502   VQMLEGEGENLTKPPDPFSSSIPKRTSAGRMPARRLHQELAAISEIE  548



>emb|CBI23135.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/504 (57%), Positives = 359/504 (71%), Gaps = 35/504 (7%)
 Frame = -2

Query  1603  FSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVP  1424
             ++ FSCS ++   + S +++P  C    G  +Y   SS       DL SC ++ +V    
Sbjct  11    YTFFSCSLNK---SESYDLTPYTCHIFGGSTVYGV-SSDDDLGDLDLYSCQRIDNV----  62

Query  1423  YSIAQDNT--VFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHT-GPLRK  1283
               I Q N    F ++W           G  CR K+NS   + + CI    K     P   
Sbjct  63    --IVQSNVENSFHVKWANTICGDCEAEGGKCRPKSNSMKHETE-CIHKHRKPEKDAPRIP  119

Query  1282  LKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKI  1103
               VAG +LG   +  I    Y +Y L+K ++E + KIE+FLEDY+ALKP+RYSYAD+KKI
Sbjct  120   ELVAGIILGFLFLGSIAFALYHVYSLDKSQRENRKKIEKFLEDYRALKPSRYSYADMKKI  179

Query  1102  TDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVV  923
             T +F +KLG+G+YGTVYKGKLS +VFVAVK+LN+SKG+GD  EF+NE++T+G+IHH++VV
Sbjct  180   THQFKDKLGQGAYGTVYKGKLSNEVFVAVKILNDSKGNGD--EFINEVATMGTIHHVHVV  237

Query  922   RLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQG  746
             RLVG+CAD F RAL+YE+L N SLEKF+F  N KN  LGW KLQ IALGIAKG+EYLHQG
Sbjct  238   RLVGFCADRFKRALIYEFLPNESLEKFIFPKNGKNHSLGWLKLQDIALGIAKGIEYLHQG  297

Query  745   CDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSR  566
             CD+RILHFDIKP NILLD NF PKISDFG AKLCSKE+S+VSMT ARGT+GYIAPEV SR
Sbjct  298   CDKRILHFDIKPHNILLDHNFTPKISDFGLAKLCSKEQSVVSMTTARGTIGYIAPEVLSR  357

Query  565   NFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIE  386
             NFGN++YKSDVYSFGMLLLEMVGG+K  D+T   +T Q YFPEW+YN L +GEE+ I+IE
Sbjct  358   NFGNITYKSDVYSFGMLLLEMVGGRKNIDVT-MEKTGQVYFPEWVYNHLDQGEELHIRIE  416

Query  385   KGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAK--  212
             +  D+KIAKKLTIVGLWCIQWYP+DRPS+K V+QMLE E+   MPPNPFT+TD    K  
Sbjct  417   EEGDAKIAKKLTIVGLWCIQWYPIDRPSMKAVVQMLEREDNLIMPPNPFTATDRIMVKDR  476

Query  211   ----ANKPGR-LFTSALEIISEMD  155
                  +KP R L    LE+I+E++
Sbjct  477   MRINTSKPPRPLPEKELEVITELE  500



>ref|XP_009599593.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
tomentosiformis]
Length=604

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/579 (52%), Positives = 379/579 (65%), Gaps = 42/579 (7%)
 Frame = -2

Query  1921  ECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPF  1742
             +C   +CG++GP + FPFRL+H QP  CGYPGFEL C  K +T L     L N+      
Sbjct  26    DCKESRCGSDGPSLHFPFRLQH-QPEYCGYPGFELFCDSKNKTIL----TLSNS------  74

Query  1741  PVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-----NLYNFSIFSCSTH  1577
              V+  +E ID   + I +   + C +  L  LNLS SPF F       L ++S+F CS  
Sbjct  75    -VRLSVEEIDYMSQQIRLYDPERCLILTLVHLNLSTSPFFFTVEPYLRLADYSVFKCS--  131

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
               ITA      P A        I+A DSS YLY      +C K+  + SVPY I  +   
Sbjct  132   -GITADYQTQQPCA----SDKAIFAIDSSSYLYYLPP-TTCKKILEIPSVPYEIVYN--Y  183

Query  1396  FSLRWTGPSCRLK---------NNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLV  1244
               LRW+ P CR            N T +    C+        G L+K  +AG VLG  L+
Sbjct  184   LQLRWSNPECRYCEGLGKDCGFKNYTKQLRTQCLDRPYTTKAGTLKKPLIAGGVLGLILL  243

Query  1243  VVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSY  1064
              +I+L  Y  Y  +K+++E Q ++E+FLEDY+AL+P RY+YAD+KK+T+ F E+LGEG+Y
Sbjct  244   GIIMLALYEFYSSSKIERENQARVEKFLEDYRALRPTRYTYADLKKVTNLFQERLGEGAY  303

Query  1063  GTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRA  884
             G VYKG LS ++ VAVKVLN+S G+G  EEF+NE++ +G IHH NVVRLVGYCADGF  A
Sbjct  304   GVVYKGTLSNEIHVAVKVLNDSIGNG--EEFINEVAAMGKIHHFNVVRLVGYCADGFRNA  361

Query  883   LVYEYLVNNSLEKFVF--SPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             LVYEYL N +LEK +F  S  D   L W+KLQ IA+GIAKG+EYLHQGCDQ+ILHFDIKP
Sbjct  362   LVYEYLPNQTLEKLIFPASSKDHIILNWKKLQNIAMGIAKGLEYLHQGCDQQILHFDIKP  421

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
             +NILLD+N NPKISDFG AKLCSKEKS+V+MT ARGTMGYIAPEV S NFG  S+KSDVY
Sbjct  422   QNILLDRNLNPKISDFGLAKLCSKEKSVVTMTEARGTMGYIAPEVLSSNFGKASHKSDVY  481

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             SFGM+LLEMVGG+K  D      T+Q  FPEWI+  L++GE ++I+IE+ +D  I +KL 
Sbjct  482   SFGMMLLEMVGGRKNFD--AKANTSQMNFPEWIHQQLNQGEVLKIRIEEDDDIIIVRKLA  539

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTS  233
             I+GLWCIQW   DRPSIKVV QM+E +      P PFT+
Sbjct  540   IIGLWCIQWNATDRPSIKVVTQMVEGDGSNLTIPPPFTA  578



>ref|XP_002310448.2| hypothetical protein POPTR_0007s02290g [Populus trichocarpa]
 gb|EEE90898.2| hypothetical protein POPTR_0007s02290g [Populus trichocarpa]
Length=562

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/578 (50%), Positives = 370/578 (64%), Gaps = 68/578 (12%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CGN G  I FPF +K  QP +CGY GF+L C + G+  LE         LQ    VK  I
Sbjct  31    CGNRGLHIRFPFWIKDRQPEQCGYRGFDLSCNEMGDIVLE---------LQGA--VKLYI  79

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRNITAGSINIS  1544
             + ID ++++I  S   GC                               R+ T  SI + 
Sbjct  80    DKIDYKNQVIYASDPQGCL------------------------------RSPTQTSIRLG  109

Query  1543  ---PIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTGP  1373
                 + C +   + + A  S L ++    L+SCTKM+ +  VP+ I        L W+ P
Sbjct  110   FTYSLRCRSTLHYDVLAVKSELSIHGNELLLSCTKMYDLP-VPHDI-------RLSWSNP  161

Query  1372  SCR----------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVT  1223
             +C           L+ NS+ E   +C   L +   G  +K    G   GS L  V+ +  
Sbjct  162   NCGSCEARGKLCGLRENSSTELETECYG-LPRPEKGARKKRLTLGVTTGSILFGVLAIAV  220

Query  1222  YRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGK  1043
             Y+IY   K ++E Q K+ERFL+DY+A+ P RYS+AD+KK+T++F ++LG+G+YGTV+KG 
Sbjct  221   YQIYSFRKSEEEYQAKVERFLDDYRAMNPTRYSHADLKKMTNQFRDELGQGAYGTVFKGM  280

Query  1042  LSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLV  863
             L+ ++ VAVKVL+NS     GEEFVNEM T+  IHH+NVVRL+G+CADGF RALVYEYL 
Sbjct  281   LTSEIPVAVKVLSNS--SEKGEEFVNEMGTMARIHHVNVVRLIGFCADGFRRALVYEYLP  338

Query  862   NNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQN  686
             N+SL++F+ S N KN FLGWE+L  IALG+AKG+EYLHQGCDQ ILHFDIKP NILLD +
Sbjct  339   NDSLQRFISSANAKNVFLGWERLHHIALGVAKGIEYLHQGCDQTILHFDIKPHNILLDND  398

Query  685   FNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLE  506
             FNPKI+DFG AKLCSK KS +SMT  RGT+GYIAPEVFSRNFGNVSYKSDVYSFGML+LE
Sbjct  399   FNPKIADFGLAKLCSKYKSAISMTRVRGTVGYIAPEVFSRNFGNVSYKSDVYSFGMLVLE  458

Query  505   MVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQ  326
             MVGG+K  D T +    Q YFPEWIYN+L  GE++   IE+  D++IAKKL IVGLWCIQ
Sbjct  459   MVGGRKNVDDT-AENGEQVYFPEWIYNLLEEGEDLRFHIEEEGDAEIAKKLAIVGLWCIQ  517

Query  325   WYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKA  215
             W PVDRPS+K V+QMLE   +  S PPNP +ST P + 
Sbjct  518   WNPVDRPSMKTVVQMLEGRGDRLSTPPNPLSSTAPKRT  555



>ref|XP_004306408.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=601

 Score =   538 bits (1387),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 297/606 (49%), Positives = 388/606 (64%), Gaps = 63/606 (10%)
 Frame = -2

Query  1930  DRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             D  +C  R C  +GP I FPFRLK +QP  CGYPGFEL CT   +T L          L+
Sbjct  22    DLQDCTERSCSTDGPPIRFPFRLKGMQPVHCGYPGFELSCTHDNQTLL---------LLE  72

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSC---ST  1580
                  K  ++ ID   +LI +     C+ +   I   S+SPF    + N S+FSC   + 
Sbjct  73    MSSSTKLYVKEIDYRSQLIAVDDEIECYPR--DIFYHSSSPFKL--VGNASLFSCPPSTV  128

Query  1579  HRNITAGSIN----ISPIACLTKPG-HFIYAADSSLYLYSATD------LISCTKMFHVS  1433
               NIT   ++    +SP  C   PG   IYA+ ++ Y Y +        L+SCTK+   S
Sbjct  129   RENITTEFLSCLSRLSP--CHGNPGNQLIYASITTSYRYCSMGSIDRLPLVSCTKVHDYS  186

Query  1432  SVPYSIAQDNTVFS----------LRWTGPSCR----------LKNNSTAEDADDCIAPL  1313
                 +       FS          L W+ PSC+          LKN  T +         
Sbjct  187   GPAVTSNYPEYYFSHSPLYYRALYLYWSKPSCQQCEEMDKLCSLKNEFTNQ---------  237

Query  1312  TKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPA  1133
             T   T  L   K  G    S +++V     Y +Y   K ++E Q++I+ FL++Y+ALKP+
Sbjct  238   TDPQTQCLDVPKAKGSCTLSVILIVTGATIYYVYSSVKREEENQLRIKIFLDEYRALKPS  297

Query  1132  RYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMST  953
             RY+YADIK+IT+ F EKLG+G+YGTV+KG+LS ++ VAVK+LNNS  +  GE+F+NE+ T
Sbjct  298   RYTYADIKRITEHFKEKLGQGAYGTVFKGRLSSELLVAVKILNNS--NEKGEDFINEVGT  355

Query  952   IGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGI  776
             +G IHH+NVVRL+GYCADGF RALVYE+L N  L+ F+ S +++N FLGWEKLQ IALGI
Sbjct  356   MGQIHHVNVVRLIGYCADGFIRALVYEFLPNGPLQNFLSSADNENSFLGWEKLQDIALGI  415

Query  775   AKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTM  596
             AKG+EYLHQGC+Q+ILHFDIKP N+LLD +F PK+SDFG AKLCSK++S VSMTAARGTM
Sbjct  416   AKGIEYLHQGCEQQILHFDIKPHNVLLDHDFTPKVSDFGLAKLCSKDQSEVSMTAARGTM  475

Query  595   GYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILS  416
             GYIAPEV+SRNFGNVSYK+DVYSFG LLLEMVGG+K   +     ++Q YFPEWIYN+L 
Sbjct  476   GYIAPEVYSRNFGNVSYKADVYSFGTLLLEMVGGRKNFKVM-EDSSSQVYFPEWIYNLLE  534

Query  415   RGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPF  239
             +G ++ I +    +  IA+KL IVGLWCIQW+P+DRPS+K V+QMLE E +  +MPPNPF
Sbjct  535   QGNDLRIHVGDEGNVGIARKLAIVGLWCIQWHPIDRPSMKTVVQMLEKEGDNLTMPPNPF  594

Query  238   TSTDPS  221
              ST  S
Sbjct  595   ASTSSS  600



>ref|XP_008232173.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=598

 Score =   537 bits (1384),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 294/590 (50%), Positives = 387/590 (66%), Gaps = 48/590 (8%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             C   +C  +GP I FPFRLK  Q   CGY GF+L CT+  +T LE P    N        
Sbjct  28    CREARCKPDGPAIRFPFRLKGKQSIHCGYHGFDLSCTNDNQTLLEMPSSSSN--------  79

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF---ENLYNFSIFSCS--THR  1574
               F +E I    + I +   +      +   +LS+SP  F    N YN+++FSCS    R
Sbjct  80    --FYVEKIKYTSQEIEMDYHNDIPPGNIFYFSLSSSPLQFVPGHNYYNYTLFSCSYPRER  137

Query  1573  NITAG--SINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
             N+      + +SP + L  P +  YA ++   +     + SCTK+   +S+P      + 
Sbjct  138   NVYTRFCMMQLSP-SDLDNPENGTYAVNTQCSV-DRLPVESCTKLHDYTSIP---DISSL  192

Query  1399  VFSLRWTGPSCR-----------------LKNNSTAEDADDCIA-PLTKLHTGPLRKLKV  1274
                L W+ PSCR                 L +  TAE   +C+  P      G   ++K+
Sbjct  193   PMKLHWSKPSCRHCEEMGKACRSKISEYSLAHVQTAES--ECLDFPEDSSRRGT--RIKI  248

Query  1273  AGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDR  1094
             +   +   L+ V  L+ Y  Y  NK +K  Q++IERFLEDY A KP+RYSYADIK+IT++
Sbjct  249   SVCTVSVALIAVGALIIYHAYSSNKTEKTNQLRIERFLEDYIAQKPSRYSYADIKRITNQ  308

Query  1093  FSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLV  914
             F +KLG+G+YGTV+KGKLS ++ VAVK+LNNS  + +G++F NEM T+G +HH+NVVRLV
Sbjct  309   FKDKLGQGAYGTVFKGKLSSELLVAVKILNNSN-ENNGDDFTNEMGTMGRVHHVNVVRLV  367

Query  913   GYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQ  737
             G+CADGF RALVYE+L N SL+ F+ S ++KN FLGW+KLQ IALGIAKG+EYLHQGCD 
Sbjct  368   GFCADGFIRALVYEFLPNGSLQNFLSSADNKNSFLGWDKLQDIALGIAKGIEYLHQGCDH  427

Query  736   RILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFG  557
             RILHFDIKP NILLDQNF PK+SDFG AKLC+K++S +SMT  RGTMGYIAPEVFSRNFG
Sbjct  428   RILHFDIKPHNILLDQNFTPKVSDFGLAKLCAKDQSAISMTTVRGTMGYIAPEVFSRNFG  487

Query  556   NVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGE  377
             +VSYKSDVYSFG LLLE+VGG+K   +     T + YFPEWIYN+L +G+++ I IE   
Sbjct  488   SVSYKSDVYSFGTLLLEIVGGRKNFKLM-EDSTGEVYFPEWIYNLLEQGDDLRIHIEDEG  546

Query  376   DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
             D+K+AKKL IVGLWC+QW+P+DRP +KVV+QMLE E +  ++PPNPF ST
Sbjct  547   DAKLAKKLAIVGLWCVQWHPIDRPPMKVVVQMLEREGDNLTIPPNPFCST  596



>gb|EYU21049.1| hypothetical protein MIMGU_mgv1a017815mg [Erythranthe guttata]
Length=573

 Score =   535 bits (1378),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 298/595 (50%), Positives = 389/595 (65%), Gaps = 51/595 (9%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             ++C+P +C N+GP I FPFR  + QP  CGYPGF+L C +K            N  L  P
Sbjct  22    DDCMPIRCRNDGPIIRFPFRHTNRQPQHCGYPGFDLFCDNKN-----------NTVLVLP  70

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCST--H  1577
             F V  +++ I+   + + +   + CF + L  LNLSASPF F  + L ++++F+CS    
Sbjct  71    FSVNVIVKKINYVSQRVFVFDQEKCFPKTLTHLNLSASPFRFLIKFLDDYTLFNCSDPPR  130

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
             R+++        + CL       YA DS L + S   L SCTK +   SVP+ I Q+N  
Sbjct  131   RDLSI------VVPCLGDSTCQFYAVDSKLSMESLP-LTSCTKTYDFKSVPWKIFQEND-  182

Query  1396  FSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYR  1217
             F L W+ P+C     S  ED     +   +L  G            GS L  +I+     
Sbjct  183   FYLEWSEPAC-----SVCEDKGKRCSSRKQLIEG-----------FGSILAAIILAAFVY  226

Query  1216  IYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLS  1037
             +Y   +  +E +  I +FL DYKALKP+R+SY+DIK+IT +F++KLGEG YG VYKGKL+
Sbjct  227   LYIRVRTYQENRTMIGKFLRDYKALKPSRFSYSDIKRITHQFNDKLGEGGYGIVYKGKLN  286

Query  1036  GDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNN  857
              ++ VAVKVLNNS  +G+GEEFVNE+STIG IHH+N+VRL+G+CADGF RALVYE+L N 
Sbjct  287   NEIVVAVKVLNNS--NGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNG  344

Query  856   SLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFN  680
             SLEK +F   +++  L WEKL+ IALGIAKG++YLH+GCDQ+ILHFDIKP+N+LLD NFN
Sbjct  345   SLEKSIFQAGSNRITLDWEKLKDIALGIAKGIKYLHEGCDQQILHFDIKPQNVLLDHNFN  404

Query  679   PKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMV  500
             PKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYSFGMLLLEMV
Sbjct  405   PKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMV  464

Query  499   GGKKKSDITGSPETNQDYFPEWIYN-ILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQW  323
             GG+K  D      T+  YFP+WIYN I +    +  QI++  +S IA+KL+IVGLWCIQW
Sbjct  465   GGRKNED-RNVNNTSPVYFPQWIYNHINAEDNPMWAQIDEQGNS-IARKLSIVGLWCIQW  522

Query  322   YPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISE  161
                +RPS+K V+QMLE E    +MPPNPF +T  S       GR + + + II E
Sbjct  523   CLTNRPSMKDVVQMLEGEFNDLTMPPNPFPATTNSID-----GRHYQTQMSIILE  572



>gb|EYU29477.1| hypothetical protein MIMGU_mgv1a003032mg [Erythranthe guttata]
Length=613

 Score =   536 bits (1382),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 302/585 (52%), Positives = 377/585 (64%), Gaps = 55/585 (9%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             C P +C  + P I FPFR +  QP  CGYPGF+L C  K +T L             PF 
Sbjct  24    CTPIRCSKHSPIIRFPFRHQTQQPQRCGYPGFDLNCDHKKDTVL-----------VLPFS  72

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF----ENLYNFSIFSCSTHRN  1571
             V  +++ I+   + I++   + C  Q LP LNLS S F+F      + + +IF CS    
Sbjct  73    VNVVVKEINYTSQTILVHDPENCLPQKLPHLNLSTSSFNFLLDDYLISDSAIFKCSD---  129

Query  1570  ITAGSINISPIACLTKPGHFIYAADS-SLYLYSATDLISCTKMFHVSSVPYSIAQDNTVF  1394
               A       I CL  P +  Y  D+ +  LY    L SCTK+  +S+VP+SI+  N  F
Sbjct  130   --ADKSLYRFIPCLVDPINKYYFVDNHNTRLYP---LNSCTKIHDISAVPWSISDKNG-F  183

Query  1393  SLRWTGPSCRLKN---------NSTAEDADDCI--APLTKLHTGPLRKLKVAGEVLGSFL  1247
              L W+ P+C             NST  D+  CI   P T  H              G FL
Sbjct  184   RLEWSEPTCGHCEAQGKRCSLYNSTRLDSIHCIDKQPTTNHHG------------FGCFL  231

Query  1246  VVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGS  1067
              V+I++     Y   ++ +E Q+KIE+FL DY+ALKP+R+SY+DI +IT +F  KLGEG 
Sbjct  232   AVIILVAFVHQYIRFRIGRENQIKIEKFLHDYRALKPSRFSYSDITRITHQFHYKLGEGG  291

Query  1066  YGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHR  887
             YG VYKGKL+ ++ VAVKVLNNSKG+G  EEFVNE+STIG IHH+NVVRLVG+CADGF R
Sbjct  292   YGVVYKGKLNNEIDVAVKVLNNSKGNG--EEFVNEVSTIGRIHHVNVVRLVGFCADGFQR  349

Query  886   ALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             ALVYE+L N+SLEK +F    K   L WEKL+ IALGIA+G+EYLH+GCDQ+ILHFDIKP
Sbjct  350   ALVYEFLPNDSLEKIIFQAGSKKISLDWEKLKDIALGIARGIEYLHEGCDQQILHFDIKP  409

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
             +NILLD NFNPKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVY
Sbjct  410   QNILLDHNFNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVY  469

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYN-ILSRGEEVEIQIEKGEDSKIAKKL  353
             SFGMLLLEMVGG+K  D      T+  YFP+WIYN I +       QI++ E + IA+KL
Sbjct  470   SFGMLLLEMVGGRKNED-RNVNNTSPVYFPQWIYNHINAEDNPTWAQIDE-EGNSIARKL  527

Query  352   TIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPS  221
             ++VGLWCIQW P DRPS+K V+QMLE +    +MPPNPF +T  S
Sbjct  528   SMVGLWCIQWCPTDRPSMKAVVQMLEGDNGDLTMPPNPFPATTNS  572



>gb|EYU37100.1| hypothetical protein MIMGU_mgv1a023511mg [Erythranthe guttata]
Length=589

 Score =   535 bits (1379),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 301/607 (50%), Positives = 391/607 (64%), Gaps = 61/607 (10%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             ++C P +C  + P I FPFR +  QP  CGYPGF+L C  K            NA L  P
Sbjct  24    DDCTPIRCSKHSPIIRFPFRHQTQQPQHCGYPGFDLNCDHKN-----------NAVLVLP  72

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF----ENLYNFSIFSCSTH  1577
             F V  +++ I+   + I++   + C  Q LP LNLS S F+F      + + +IF CS  
Sbjct  73    FSVNVVVKEINYASQTILVYDPENCLPQKLPHLNLSTSSFNFLLDKYLISDSAIFKCSD-  131

Query  1576  RNITAGSINISPIACLTKP-GHFIYAADSSLYLYSATDLISCTKMFHVSS-VPYSIAQDN  1403
                 A       I CL  P   + + ++++LYL++     SCTK+  +S+ +P+SI+ D 
Sbjct  132   ----ADKSLYRFIPCLIDPINKYYFVSNTNLYLFA-----SCTKIHDISAGIPWSIS-DK  181

Query  1402  TVFSLRWTGPSCRLKN---------NSTAEDADDCIAPL-TKLHTGPLRKLKVAGEVLGS  1253
               F L W+ P+C             NST  D+  CI    T +H G            G 
Sbjct  182   KGFRLGWSEPTCGHCEAQGKRCSLYNSTRLDSIHCIEKQPTIIHHG-----------FGC  230

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             FL V+I++     Y   +  ++  +KIE+FL+DY+ALKP+R+SY+DI +IT +F +KLGE
Sbjct  231   FLAVIILVALVHQYIRFRTGRDNPIKIEKFLQDYRALKPSRFSYSDITRITHQFRDKLGE  290

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G YG VYKGKL+ ++ VAVKVLNNSKG+G  EEFVNE+STIG IHH+N+VRLVG+CADGF
Sbjct  291   GCYGVVYKGKLNNEIDVAVKVLNNSKGNG--EEFVNEVSTIGRIHHVNIVRLVGFCADGF  348

Query  892   HRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
              RALVYE+L N+SLEK +F    K   L WEKL+ IALGIA+G+EYLH+GCDQ+ILHFDI
Sbjct  349   RRALVYEFLPNDSLEKIIFQAGSKKISLDWEKLKDIALGIARGIEYLHEGCDQQILHFDI  408

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP+N+LLD NFNPKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSD
Sbjct  409   KPQNVLLDHNFNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSD  468

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYN-ILSRGEEVEIQIEKGEDSKIAK  359
             VYSFGMLLLEMVGG+K  D       +  YFP+WIYN I +    +  QI++ E + IA+
Sbjct  469   VYSFGMLLLEMVGGRKNED-RNVNNNSPVYFPQWIYNHINAEDNPMWAQIDE-EGNSIAR  526

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPSKAKANKPGRLFTS  182
             KL+IVGLWCIQW P DRPS+KVV+QMLE +    +MPPNPF +T  S        R + +
Sbjct  527   KLSIVGLWCIQWSPTDRPSMKVVVQMLEGDNGDLTMPPNPFPATSNSVG-----ARHYQT  581

Query  181   ALEIISE  161
              + II E
Sbjct  582   EMAIILE  588



>ref|XP_010100008.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB81113.1| putative receptor-like protein kinase [Morus notabilis]
Length=602

 Score =   535 bits (1379),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 302/607 (50%), Positives = 382/607 (63%), Gaps = 55/607 (9%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKH---IQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             C   +CG NGP I FPFRLK     Q  +C YPGF+L C    +TA+  P   + A    
Sbjct  30    CSEARCGENGPPIRFPFRLKDDRLQQNNDCSYPGFDLFCAGN-QTAINLPIMPITA----  84

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRNI  1568
                    +  ID + + + +     C  +LL       S F   +L N    S    RN 
Sbjct  85    -----LFVSKIDYKSQQLQVYSNSNCLPRLL------LSGFDNRSLIN----SPFQLRNR  129

Query  1567  TAGSINISPIACLTKPGHFIYAADSSLYLYSATDL-------ISCTKMFHVSSVPYSIAQ  1409
                S N + + C +  G       S+L++ S +++       + CTKM    SVPY I +
Sbjct  130   GKNSKNYTQLKCTSGSGTC-----STLFIPSNSEIDDYQDGVMFCTKMIEFESVPYQIYK  184

Query  1408  ------DNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFL  1247
                   D +   L W+ P CR            C        T      KVA    GS L
Sbjct  185   LLWRGYDGSNIPLSWSTPDCR----HCEAKGKGCRLKKGSAETECSASRKVATS--GSIL  238

Query  1246  VVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGS  1067
             ++++V  ++ +Y L K  +E   +IE+FLEDY ALKP+RY+YADIKKITD+F + LG+GS
Sbjct  239   LLLVVSSSFYLYYLRKKNRENSRRIEKFLEDYNALKPSRYTYADIKKITDKFKDILGQGS  298

Query  1066  YGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHR  887
             YGTV+KGKLS D+ VAVK+LN+S G+G  EEF+NE+ST+  I+HINVVRLVGYCADGF R
Sbjct  299   YGTVFKGKLSNDIVVAVKILNDSTGNG--EEFINEVSTMVQIYHINVVRLVGYCADGFRR  356

Query  886   ALVYEYLVNNSLEKFV---FSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFD  719
             AL+YE+L N+SLEK++    S   KN  L W+ LQ IALGIAKG+EYLHQGCD+RILHFD
Sbjct  357   ALIYEFLPNDSLEKYISSSVSAGGKNPSLSWKTLQDIALGIAKGIEYLHQGCDKRILHFD  416

Query  718   IKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKS  539
             IKP NILLDQNF PKISDFG AKLCSK++S VSM  ARGT+GYIAPEVFSRNFGNVSYKS
Sbjct  417   IKPHNILLDQNFVPKISDFGLAKLCSKDQSAVSMATARGTLGYIAPEVFSRNFGNVSYKS  476

Query  538   DVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAK  359
             DVYSFGMLLLEMVGG++  + T     +  Y+PEWIYN+L  G++  I IE+  ++ IAK
Sbjct  477   DVYSFGMLLLEMVGGRRNINATDQGNMDGIYYPEWIYNLL-EGDDFRILIEEEGNANIAK  535

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTS-  182
             KL IVGLWCIQW+PV RP++KV+IQMLE E   +MPPNPFTS   S   A +P R   + 
Sbjct  536   KLAIVGLWCIQWHPVGRPTMKVIIQMLEGERELTMPPNPFTSVGQSSTNAEQPTRAAMAL  595

Query  181   ALEIISE  161
              LE+I E
Sbjct  596   ELEVIPE  602



>ref|XP_002262799.3| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=444

 Score =   530 bits (1364),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 266/454 (59%), Positives = 342/454 (75%), Gaps = 27/454 (6%)
 Frame = -2

Query  1468  DLISCTKMFHVSSVPYSIAQD----NTVFSLRWT----------GPSCRLKNNSTAEDAD  1331
             DL SC  +++ +S+ Y +  D     + FSL+W           G  CRLK +++ E   
Sbjct  2     DLSSCRGLYN-ASIGYHVFTDYKFNGSAFSLKWLKSICGSCLRGGHICRLKKSNSREPET  60

Query  1330  DCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDY  1151
             +CI  ++K       +  V G +   FL+++++ + YR+Y  NK ++E ++K++RFLE Y
Sbjct  61    ECIKGVSK-------QTMVTGTIFDFFLLMLVIAMFYRLYSSNKSERENRIKVKRFLEYY  113

Query  1150  KALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEF  971
             +ALKP+RYSYADIK+I ++F + LG+  YGTVYKGKLS +VFVAVK+LNNS+G+G  EEF
Sbjct  114   EALKPSRYSYADIKRIRNQFKDTLGQEGYGTVYKGKLSNEVFVAVKILNNSQGNG--EEF  171

Query  970   VNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQ  794
             +NE++T+G+IHH+N+VRLVG+CAD F RAL+YEYL N SLEKF+FS   KN+ L W+KLQ
Sbjct  172   INEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSRVVKNYSLSWKKLQ  231

Query  793   QIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMT  614
             +IA+GIAKG+EYLHQGCDQRILHFDIKP NILLD NFNPKISDFG AKLCSKE+S VSMT
Sbjct  232   EIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAVSMT  291

Query  613   AARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEW  434
              ARGT+GYIAPEV SRNFGNVSYKSDVYSFGMLLLEMVG +K  D++    T+Q YFPEW
Sbjct  292   VARGTIGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGERKNIDVS-VESTSQVYFPEW  350

Query  433   IYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP-S  257
             IYN L  GEE+ I+IE+  D +IAKKL IVGL CIQWYP+DRPS+K+V+QMLE +    +
Sbjct  351   IYNHLDIGEELYIRIEEKGDVEIAKKLAIVGLSCIQWYPMDRPSMKIVVQMLEGKGGKLT  410

Query  256   MPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             +PPNPF ST P+K   +KP   F   L IISE++
Sbjct  411   IPPNPFASTTPTKTNLSKPRSAFQQELAIISEVE  444



>ref|XP_006380303.1| hypothetical protein POPTR_0007s02250g [Populus trichocarpa]
 gb|ERP58100.1| hypothetical protein POPTR_0007s02250g [Populus trichocarpa]
Length=483

 Score =   531 bits (1367),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 272/496 (55%), Positives = 348/496 (70%), Gaps = 29/496 (6%)
 Frame = -2

Query  1606  NFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSV  1427
             NF+IF+CS +      +I+   IACL+   + + A DS   +     L+SCTKM+ +  V
Sbjct  5     NFTIFNCSLN-----NAISRRRIACLSTHQYDVLAVDSEQSIDGNELLLSCTKMYDLP-V  58

Query  1426  PYSIAQDNTVFSLRW----------TGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLK  1277
             P+ I        L W          TG  CRL+ NS++E   +C   L +   G  ++  
Sbjct  59    PHDI-------RLSWSNPKCGYCEETGKQCRLRKNSSSELETECYG-LPRPKKGARKRNL  110

Query  1276  VAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITD  1097
               G   GS L  V+V+  Y+IY   K ++E Q K+ERFL+DY+A+ P RYS+AD+KK+T+
Sbjct  111   TIGVTTGSILFGVVVIAVYQIYSFRKSEEEYQAKVERFLDDYRAMNPTRYSHADLKKMTN  170

Query  1096  RFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRL  917
             +F ++LG+G+YGTV+KGKL+ ++ VAVKVL+NS     GEEFVNEM T+  IHH+NVVRL
Sbjct  171   QFRDELGQGAYGTVFKGKLTSEIPVAVKVLSNS--SEKGEEFVNEMGTMARIHHVNVVRL  228

Query  916   VGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCD  740
             +G+CADGF RALVYEYL N+SL+KF+ S N +N FLGWE+L  IALG+AKG+EYLHQGCD
Sbjct  229   IGFCADGFRRALVYEYLPNDSLQKFISSANARNVFLGWERLHHIALGVAKGIEYLHQGCD  288

Query  739   QRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNF  560
             Q ILHFDIKP NILLD +FNPKI+DFG AKLCSK KS +SMT ARGT+GYIAPEVFSRNF
Sbjct  289   QTILHFDIKPHNILLDNDFNPKIADFGLAKLCSKYKSAISMTTARGTVGYIAPEVFSRNF  348

Query  559   GNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKG  380
             GNVSYKSDVYSFGM++LEMVGG+K  D T +   +Q YFPEWIYN+L  GE++  QIE+ 
Sbjct  349   GNVSYKSDVYSFGMMVLEMVGGRKNVDDT-AENGDQVYFPEWIYNLLEEGEDLRFQIEEE  407

Query  379   EDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANK  203
              D++IAKKL IVGLWCIQW PVDRPS+K+V+QMLE E +  S PPNP +ST   +     
Sbjct  408   GDAEIAKKLAIVGLWCIQWNPVDRPSMKIVVQMLEGEGDRLSTPPNPLSSTAAKRTNTGM  467

Query  202   PGRLFTSALEIISEMD  155
               R     L  ISE +
Sbjct  468   LRRHLHQELAAISETE  483



>gb|EYU21041.1| hypothetical protein MIMGU_mgv1a003344mg [Erythranthe guttata]
Length=591

 Score =   535 bits (1377),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 299/584 (51%), Positives = 382/584 (65%), Gaps = 54/584 (9%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             ++C P +C  + P I FPFR + +QP  CGYPGF+L C  K            NA L  P
Sbjct  24    DDCTPIRCSKHSPIIRFPFRHQTLQPQHCGYPGFDLNCDHKN-----------NAVLVLP  72

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLY--NFSIFSCSTH  1577
             F V  +++ I+   + I++   + C  Q LP LNLS S F F  +  +  + +IF CS  
Sbjct  73    FSVNVVVKEINYTSQTILVYDPENCLPQKLPHLNLSTSSFHFPLDEFFQSDSAIFICSDD  132

Query  1576  RNITAGSINISPIACLTKPGHFIYAADS-SLYLYSATDLISCTKMFHVSSV-PYSIAQDN  1403
              + +     +    CL  P +  Y  D+ ++ LY  T   SCTK++ +  V P SI+  N
Sbjct  133   ADKS-----LYRFPCLIDPINKYYFVDNDNILLYQLT---SCTKIYDIPRVIPRSISGKN  184

Query  1402  TVFSLRWTGPSCRLKN---------NSTAEDADDCIAPL-TKLHTGPLRKLKVAGEVLGS  1253
               F L W+ PSC             NST  D+  CI    T +H G            G 
Sbjct  185   G-FRLEWSEPSCGHCEAQGKRCSLYNSTRLDSIHCINKQPTTIHHG-----------FGC  232

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             FL V+I++     Y   +  +E Q+KIE+FL+DY+ALKP+R+SY+DI +IT +F +KLGE
Sbjct  233   FLAVIILVAIVYQYIRFRTGRENQIKIEKFLQDYRALKPSRFSYSDITRITHQFRDKLGE  292

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G YG VYKGKL+ ++ VAVKVLNNSKG+G  EEFVNE+STIG IHH+N+VRLVG+CADGF
Sbjct  293   GCYGVVYKGKLNNEIDVAVKVLNNSKGNG--EEFVNEVSTIGRIHHVNIVRLVGFCADGF  350

Query  892   HRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
              RALVYE+L N+SLEK +F    K   L WEKL+ IA GIA+G+EYLH+GCDQ+ILHFDI
Sbjct  351   RRALVYEFLPNDSLEKIIFQAGSKKISLDWEKLKDIAQGIARGIEYLHEGCDQQILHFDI  410

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP+N+LLD NFNPKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSD
Sbjct  411   KPQNVLLDHNFNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSD  470

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYN-ILSRGEEVEIQIEKGEDSKIAK  359
             VYSFGMLLLEMVGG+K  D      T+  YFP+WIYN I +    +  QI++ E + IA+
Sbjct  471   VYSFGMLLLEMVGGRKNED-RNVNNTSLVYFPQWIYNHINTEDNPMWAQIDE-EGNSIAR  528

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTST  230
             KL+IVGLWCIQW P DRPS+KVV+QMLE +    +MPPNPF +T
Sbjct  529   KLSIVGLWCIQWSPTDRPSMKVVVQMLEGDNGDLTMPPNPFPAT  572



>ref|XP_009343243.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Pyrus 
x bretschneideri]
Length=607

 Score =   535 bits (1377),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 293/581 (50%), Positives = 386/581 (66%), Gaps = 36/581 (6%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             C ++GP I FPFRLK  QP +CGY GF+L CT+  +T LE           P    K ++
Sbjct  38    CEHHGPAIRFPFRLKG-QPFQCGYHGFDLSCTNGRQTVLE----------MPSSSNKLIV  86

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENL---YNFSIFSCSTHRNITA--G  1559
             E+I+   + I +   + C  + +    LS+S F F +     N+++FSC +    T   G
Sbjct  87    ETINYASQEIGVYFQNDCPPKDIFNFTLSSSIFQFVHGPFDANYTLFSCPSPLRETDRYG  146

Query  1558  SINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPY-SIAQDNTVFSLRW  1382
              I + P           Y A    Y     +L+SCTK+   +SVPY S  +   +  L+W
Sbjct  147   LIKLCPSGLDNPENQTNYYAGDGQYSIDDRNLVSCTKLRDYTSVPYISSVRAFHLMMLQW  206

Query  1381  TGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLV----  1244
             + PSC          RL   S   +  D     T+  +    + + + E+ G F +    
Sbjct  207   SKPSCGRCEEMGKTCRLNRTSGQYNFTDNQTAETECVSEDSTRGRTSLEISGIFTLSVVV  266

Query  1243  VVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSY  1064
              V+  V YR+Y  NK++K  Q++IERFL+DY A KP+RYSYADIK+IT++F+EKLG+G+Y
Sbjct  267   TVVGTVIYRVYSSNKIEKTNQLRIERFLDDYIAHKPSRYSYADIKRITNQFNEKLGQGAY  326

Query  1063  GTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRA  884
             GTVYKG+LS D+ VAVK+LNNS  +  GE+ +NE+ T+G +HH+NVVRLVG+CADG+  A
Sbjct  327   GTVYKGQLSSDLLVAVKILNNS--NEKGEDLINEVGTMGRVHHVNVVRLVGFCADGYTTA  384

Query  883   LVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPR  707
             LVYEYL N SL+  + S + K+ FLGW+K+ +IALGIAKG+EYLHQGCD RILHFDIKP 
Sbjct  385   LVYEYLPNGSLQNILSSADSKSAFLGWDKVHEIALGIAKGIEYLHQGCDLRILHFDIKPH  444

Query  706   NILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYS  527
             NILLDQNF PK+SDFG AKLCSK++S VSMT  RGT+GYIAPEVFSRNFGNVSYK+DVYS
Sbjct  445   NILLDQNFTPKVSDFGLAKLCSKDQSAVSMTTIRGTIGYIAPEVFSRNFGNVSYKADVYS  504

Query  526   FGMLLLEMVGGKKKSDITGSPET-NQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             FGMLLLEMVGG+K         T +Q YFPEWIYN+L +G+++ I IE G D++ AKKL 
Sbjct  505   FGMLLLEMVGGRKNFKFMEEDSTSSQVYFPEWIYNLLEQGDDLRIHIEDGGDAETAKKLA  564

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
             IVGLWC+QW+P+DRPS+KVVIQMLE E +  ++P NPF ST
Sbjct  565   IVGLWCVQWHPIDRPSMKVVIQMLEGEGDNLTVPANPFRST  605



>gb|EYU21067.1| hypothetical protein MIMGU_mgv1a023848mg [Erythranthe guttata]
Length=599

 Score =   534 bits (1375),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 304/605 (50%), Positives = 396/605 (65%), Gaps = 45/605 (7%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             ++C+   C ++GP I FPFR +  QP  CGYPGF+L C  K            N  L  P
Sbjct  22    DDCMQTSCRDDGPIIRFPFRHQTQQPQHCGYPGFDLNCDHKN-----------NTVLVLP  70

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN-LYNFSIFSCSTHRNI  1568
             F V  ++  I+   + I++   + C  + L  LNLSASPF  +  LY++++F+CS     
Sbjct  71    FSVNVVVNKINYVTQTILVYDHEICLPKKLHDLNLSASPFHVKYYLYDYTLFNCSDPPRR  130

Query  1567  TAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSL  1388
               G+     I CL    + IYA +S   L S   L SCTK     SVP  I Q +  FSL
Sbjct  131   DLGN----AIPCLGDSTYQIYAVNSQTSLDSLP-LTSCTKTSEFKSVPGGIFQKSN-FSL  184

Query  1387  RWTGPSCRLK----------NNSTAEDADDCI--APLTKLHTGPLRKLKVAGEVLGSFLV  1244
              W+ P+C +           N++T++    C+   P T  H    R +K+  E  GS + 
Sbjct  185   EWSEPACSICEDEGKRCSSFNSTTSDPHIRCLDQLPTTNHHGAGARNIKLI-EGFGSIIA  243

Query  1243  VVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSY  1064
              +I+     +Y   ++ +E Q  I +FL DYKALKP+R+SY+DIK+IT +F+EKLGEG Y
Sbjct  244   AIILAAFVYLYIRVRIYRENQTMIGKFLRDYKALKPSRFSYSDIKRITRQFNEKLGEGGY  303

Query  1063  GTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRA  884
             G VYKGKL+ ++ VAVKVLNNS  +G+GEEFVNE+STIG IHH+NVVRL+G+CADGF RA
Sbjct  304   GIVYKGKLNNEIDVAVKVLNNS--NGNGEEFVNEVSTIGRIHHVNVVRLLGFCADGFRRA  361

Query  883   LVYEYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPR  707
             LVYE+L N SLEK +F   +++  L WEKL+ IALGIAKG+EYLH+GCDQ+ILHFDIKP+
Sbjct  362   LVYEFLPNGSLEKSIFQAGSNRITLDWEKLKDIALGIAKGIEYLHEGCDQQILHFDIKPQ  421

Query  706   NILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYS  527
             N+LLD N NPKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYS
Sbjct  422   NVLLDHNLNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYS  481

Query  526   FGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYN-ILSRGEEVEIQIEKGEDSKIAKKLT  350
             FGMLLLEMVGG+K  D      T+Q YFP+WIYN I +    +  QI++ E + IA+KL+
Sbjct  482   FGMLLLEMVGGRKNED-RNVNNTSQVYFPQWIYNHINAEDNPMWAQIDE-EGNSIARKLS  539

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPF-TSTDPSKAKANKPGRLFTSAL  176
             I+GLWCIQW P DRPS+K V+QMLE E +  +MPPNPF  +T+P        G+ + + +
Sbjct  540   IIGLWCIQWCPTDRPSMKAVVQMLEGECDDLTMPPNPFPATTNPID------GKHYQTQM  593

Query  175   EIISE  161
              II E
Sbjct  594   SIILE  598



>gb|EYU21073.1| hypothetical protein MIMGU_mgv1a003869mg [Erythranthe guttata]
Length=559

 Score =   532 bits (1370),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 292/575 (51%), Positives = 376/575 (65%), Gaps = 47/575 (8%)
 Frame = -2

Query  1915  LPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPV  1736
             + + C  + P I FPFR +  QP  CGYPGF+L C  K            N  L  PF V
Sbjct  1     MKKGCSKHSPIIRFPFRHQTQQPQHCGYPGFDLNCDHKN-----------NTVLVLPFSV  49

Query  1735  KFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNF----SIFSCSTHR  1574
               +++ I+   + I++   + C  Q LP LNLS S F F  ++  N+    +IF CS   
Sbjct  50    NVVVKEINYASQTILVYDPENCLPQKLPHLNLSTSSFHFLLDDFDNYKSDSAIFKCSDDA  109

Query  1573  NITAGSINISPIACLTKPGHFIYAADS-SLYLYSATDLISCTKMFHVSSV-PYSIAQDNT  1400
             + +        I CL  P +  Y  D+ ++YLY+   L SCTK+  +S+V P+SI+ D  
Sbjct  110   DTSLYRF----IPCLIDPINKYYIVDNDNIYLYT---LASCTKIHDISAVIPWSIS-DKK  161

Query  1399  VFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTY  1220
              F L W+ P+C    +  A+     +   T+L +             G FL V+I++   
Sbjct  162   GFRLEWSEPTC---GHCEAQGKRCSLFNSTRLDS------------FGCFLAVIILVALV  206

Query  1219  RIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKL  1040
               Y   +  +E Q+KIE+FL+DY+ALKP+R+SY+DI +IT +F  KLGEG YG VYKGKL
Sbjct  207   YQYIRFRTGRENQIKIEKFLQDYRALKPSRFSYSDITRITHQFRNKLGEGCYGVVYKGKL  266

Query  1039  SGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVN  860
             + ++ VAVKVLNNSKG+G  EEFVNE+STIG IHH+N+VRLVG+CADGF RALVYE+L N
Sbjct  267   NNEIDVAVKVLNNSKGNG--EEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEFLPN  324

Query  859   NSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNF  683
             +SLEK +F    K   L WEKL+ IALGIA+G+EYLH+GCDQ+ILHFDIKP+N+LLD NF
Sbjct  325   DSLEKIIFQAGSKKISLDWEKLKDIALGIARGIEYLHEGCDQQILHFDIKPQNVLLDHNF  384

Query  682   NPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEM  503
             NPKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYSFGMLLLEM
Sbjct  385   NPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEM  444

Query  502   VGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQW  323
             VGG+K  D      T+  YFP+WIYN ++  +         E + IA+KL+IVGLWCIQW
Sbjct  445   VGGRKNED-RNVNNTSPVYFPQWIYNHINAEDNPMWAQMDEEGNSIARKLSIVGLWCIQW  503

Query  322   YPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPS  221
              P DRPS+KVV+QMLE +    +MPPNPF +T  S
Sbjct  504   CPTDRPSMKVVVQMLEGDNGDLTMPPNPFPATTNS  538



>gb|EYU40245.1| hypothetical protein MIMGU_mgv1a021311mg, partial [Erythranthe 
guttata]
Length=538

 Score =   531 bits (1367),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 298/597 (50%), Positives = 385/597 (64%), Gaps = 69/597 (12%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             ++C+  +C N+GP I FPFR  + QP  CGYPGF+L C  K  T L  PF          
Sbjct  3     DDCMQTRCRNDGPIIRFPFRHTNRQPQHCGYPGFDLFCDHKNNTVLVLPF----------  52

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCST--H  1577
                     S++                  LP+LNLSASPF F  + L ++++F+CS    
Sbjct  53    --------SVN------------------LPLLNLSASPFRFLIKFLDDYTLFNCSDPPG  86

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
             R+++        + CL       YA DS L + S   L SCTK +   SVP+ I Q+N  
Sbjct  87    RDLSI------VVPCLGDSTCQFYAVDSKLSMESLP-LTSCTKTYEFKSVPWKIFQEND-  138

Query  1396  FSLRWTGPSCRLKNNSTAED-ADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTY  1220
             F L W+ P+C     S  ED    C +  +      ++K  + G   GS L  +I+    
Sbjct  139   FYLEWSEPAC-----SVCEDKGKRCSSYNSTTSDRHIQKQLIEG--FGSILAAIILAAFV  191

Query  1219  RIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKL  1040
              +Y   +  +E +  I  FL DYKALKP+R+SY+DIK+IT +FSEKLGEG YG VYKGKL
Sbjct  192   YLYIRVRTYRENRTMIGMFLRDYKALKPSRFSYSDIKRITHQFSEKLGEGGYGIVYKGKL  251

Query  1039  SGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVN  860
             + ++ VAVKVLNNS  +G+GEEFVNE+STIG IHH+N+VRL+G+CADGF RALVYE+L N
Sbjct  252   NNEIVVAVKVLNNS--NGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPN  309

Query  859   NSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNF  683
              SLEK +F   +++  L WEKL+ IALGIAKG+EYLH+GCDQ+ILHFDIKP+N+LLD N 
Sbjct  310   GSLEKSIFQAGSNRITLDWEKLKDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLLDHNL  369

Query  682   NPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEM  503
             NPKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYSFGMLLLEM
Sbjct  370   NPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEM  429

Query  502   VGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQW  323
             VGG+K  D      T+Q YFP+WIYN ++  E+  +  +  E + IA+KL+IVGLWCIQW
Sbjct  430   VGGRKNED-HNVDNTSQVYFPQWIYNHIN-AEDNPLWAKNEEGNSIARKLSIVGLWCIQW  487

Query  322   YPVDRPSIKVVIQMLEAE-EPPSMPPNPF-TSTDPSKAKANKPGRLFTSALEIISEM  158
              P DRPS+K V+QMLE E +  +MPPNPF  +T+P        G+ + + + II E+
Sbjct  488   CPTDRPSMKAVVQMLEGECDDLTMPPNPFPATTNPID------GKHYQTQMSIILEV  538



>ref|XP_007161520.1| hypothetical protein PHAVU_001G076200g [Phaseolus vulgaris]
 gb|ESW33514.1| hypothetical protein PHAVU_001G076200g [Phaseolus vulgaris]
Length=594

 Score =   533 bits (1372),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 292/601 (49%), Positives = 393/601 (65%), Gaps = 54/601 (9%)
 Frame = -2

Query  1906  KCGNNGPEISFPFRLKH-IQPPECGYP-GFELLCTDKGETALENPFPLLNATLQPPFPVK  1733
             KCG     I FPF L++ +     GYP GF LLCTD  ET L+           P  P+K
Sbjct  30    KCGR--VHIQFPFYLRNSVLNHTTGYPRGFGLLCTDADETVLD----------LPSVPIK  77

Query  1732  FLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPFSFENLY--NFSIFSCSTHRNITA  1562
               +++ID + + I +     CF  +L+ + N S SPF F++    N S F C++      
Sbjct  78    LFVKNIDYKSQQIQLYDPQNCFPRELIKLGNSSISPFKFQSFQDRNVSFFRCNSMS----  133

Query  1561  GSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQD-NTVFSLR  1385
                   PI  L     F+            +++ISCTK+  V SV +S+  +   +    
Sbjct  134   -----CPILQLGSESDFL-----------DSEIISCTKLSDVYSVQWSVNDEFKNIVVAE  177

Query  1384  WTGPSC--------RLK-NNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIV  1232
             WT P+C        + K  N T  + +  + P   L T  +  L  AG + G  LV+++ 
Sbjct  178   WTNPNCSSCAAKGSKCKYKNGTQTEIECFVCPSNGLPTSTI-ILIAAGGIGGFILVLLLA  236

Query  1231  LVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVY  1052
              V + +Y   KMK E+Q +IE+FLEDY+A+KP R++YADIK+IT+ FSE LGEG++G V+
Sbjct  237   KVLFHVYEHYKMKGEDQARIEKFLEDYRAMKPTRFTYADIKRITNGFSESLGEGAHGAVF  296

Query  1051  KGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYE  872
             KG LS D+ VAVK+LN++ GDG  ++F NE+ T+G IHH+NVVRL+G+CADGFHRALVY+
Sbjct  297   KGILSRDILVAVKILNDAVGDG--KDFTNEVGTMGKIHHVNVVRLLGFCADGFHRALVYD  354

Query  871   YLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILL  695
             +  N SL++F+  P++K+ FLGWEKLQQIALG+AKG+EYLH GCD RILHFDI P N+L+
Sbjct  355   FFPNGSLQRFLVPPDNKDVFLGWEKLQQIALGVAKGIEYLHLGCDHRILHFDINPHNVLI  414

Query  694   DQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGML  515
             D +FNPKI+DFG AKLC K +S VS+TAARGT+GYIAPEVFSRNFGNVSYKSD+YS+GML
Sbjct  415   DDHFNPKITDFGLAKLCPKNQSTVSVTAARGTLGYIAPEVFSRNFGNVSYKSDIYSYGML  474

Query  514   LLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLW  335
             LLEMVGG+K ++++   E+ Q  +PEWI+N++    +VE+ IEK ED K+A+KL I+GLW
Sbjct  475   LLEMVGGRKNTNMS-VEESFQVLYPEWIHNLV-EARDVEVTIEKEEDVKVARKLAIIGLW  532

Query  334   CIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEM  158
             CIQW PVDRPS+K+V+QMLE + E    PP PF  T  SK  A  P R     LEII EM
Sbjct  533   CIQWNPVDRPSMKIVVQMLEGDGEKLIAPPTPFDKTGSSKTNAVVPTRHQNFELEIIHEM  592

Query  157   D  155
             +
Sbjct  593   E  593



>gb|EYU21057.1| hypothetical protein MIMGU_mgv1a024072mg [Erythranthe guttata]
Length=600

 Score =   533 bits (1372),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 297/581 (51%), Positives = 384/581 (66%), Gaps = 37/581 (6%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             ++C+   C ++GP I FPFR K+ QP  CGYPGF+L C  K +T L             P
Sbjct  22    DDCMQTSCRDDGPIIRFPFRCKNQQPRHCGYPGFDLYCDHKNDTVL-----------VLP  70

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN-LYNFSIFSCSTH-RN  1571
             F V  ++  I+   + I++   + C  + L  LNLSASPF  +  LY++++F+CS   R 
Sbjct  71    FSVNVVVNEINYVTQTILVYDHEICLPKKLHDLNLSASPFHGKYYLYDYTLFNCSDPPRR  130

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFS  1391
                G++    I CL    + IYA DS + L S   L SCTK     SVP  I + +  FS
Sbjct  131   DHLGNV----IPCLGDSTYQIYAVDSEMPLDSLP-LTSCTKTSEFKSVPGGIFRKSN-FS  184

Query  1390  LRWTGPSCRLK----------NNSTAEDADDCI--APLTKLHTGPLRKLKVAGEVLGSFL  1247
             L W+ P+C +           N++T++    C+   P T  H    R +K+  E  GS +
Sbjct  185   LEWSEPACSICEDEGKRCSSFNSTTSDPHIRCLDQLPTTNHHGAGARNIKLI-EGFGSII  243

Query  1246  VVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGS  1067
               +I+     +Y   ++ +E Q  I +FL DYKALKP+R+SY+DIK+IT +F+EKLGEG 
Sbjct  244   AAIILAAFVYLYIRVRIYRENQTMIGKFLRDYKALKPSRFSYSDIKRITRQFNEKLGEGG  303

Query  1066  YGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHR  887
             YG VYKGKL+ ++ VAVKVLNNS  +G+GEEFVNE+STIG IHH+N+VRL+G+CADGF R
Sbjct  304   YGIVYKGKLNNEIDVAVKVLNNS--NGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFRR  361

Query  886   ALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKP  710
             ALVYE+L N SLEK +F        L WEKL+ IALG+AKG+EYLH+GCDQ+ILHFDIKP
Sbjct  362   ALVYEFLPNGSLEKSIFQAGSNRINLDWEKLKDIALGVAKGIEYLHEGCDQQILHFDIKP  421

Query  709   RNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVY  530
             +N+LLD N NPKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVY
Sbjct  422   QNVLLDHNLNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVVSRTFGRVSYKSDVY  481

Query  529   SFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             SFGMLLLEMVGG+K  D      T+Q YFP+WIYN ++  +         E + IA+KL+
Sbjct  482   SFGMLLLEMVGGRKNED-RNVNNTSQVYFPQWIYNHINVEDNPMWAPIDEERNSIARKLS  540

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
             IVGLWCIQW P D PS+KVV+QMLE E +  +MPPNPF +T
Sbjct  541   IVGLWCIQWCPTDHPSMKVVVQMLEGECDDLTMPPNPFPAT  581



>gb|KCW89168.1| hypothetical protein EUGRSUZ_A01481 [Eucalyptus grandis]
Length=767

 Score =   538 bits (1387),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 294/612 (48%), Positives = 393/612 (64%), Gaps = 41/612 (7%)
 Frame = -2

Query  1954  TLGYGYSYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPF  1775
             T   G+   R+ C PR   ++G  + FPF L+    PECGYPGF+L C   G+TAL  P 
Sbjct  183   TKDLGHVPTRDRC-PRGGCSHGLPVHFPFWLEGSHGPECGYPGFKLFCNQDGQTALSVP-  240

Query  1774  PLLNATLQPPFPVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNL----SASPFSFENL  1610
                NA+L        +++ ID   + +++     C   ++L + +L    S  P+ ++N 
Sbjct  241   ---NASL--------VVKDIDYVSQFVVLHDPTNCLPFRILDLNHLGFYASKYPYPYDNS  289

Query  1609  YNFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSS  1430
             YN+++F C            ++   CL  PG +   A  S        L+ C K+  ++S
Sbjct  290   YNYTLFKCPP-----PDRTYLTKADCLIMPGSYKVYAVESYRSIGDLPLVYCEKIGSLNS  344

Query  1429  VPYSIAQDNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRK-----LKVAGE  1265
             +P +I          W  P CR       +D   C    + +   P  +     LK+   
Sbjct  345   LPNAIEYMIPDARFDWKEPDCR----KCTKDGWLCGWDGSNITCNPPPRGHPAILKLEIT  400

Query  1264  VLGSFLVVVIVLVTYRIYRLNKMKKEE--QVKIERFLEDYKALKPARYSYADIKKITDRF  1091
                   ++++V++    Y LN+ ++++  Q+K+E FL DY+ALKP RYSY DIK+IT+ F
Sbjct  401   GGVVGPLLLLVVLIGLGYVLNERRRDKAFQLKVESFLHDYEALKPTRYSYNDIKRITNDF  460

Query  1090  SEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVG  911
              EKLG+G+YGTVYKGKLS ++FVAVK+L+NS G+G  EEF+NE+ST+G IHH+NVVR+VG
Sbjct  461   EEKLGQGAYGTVYKGKLSNEIFVAVKMLDNSFGNG--EEFINEVSTMGRIHHVNVVRMVG  518

Query  910   YCADGFHRALVYEYLVNNSLEKFVFSPND--KNFLGWEKLQQIALGIAKGVEYLHQGCDQ  737
             +CADGF RALVYE+L N SLEKF+F   D    FL W +L  IALG+AKG+EYLHQGCD 
Sbjct  519   FCADGFRRALVYEFLANESLEKFIFQGEDTLDPFLSWGRLHDIALGVAKGIEYLHQGCDH  578

Query  736   RILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFG  557
             +ILHFDIKP NILLD NFNPKI+DFG AKLCSKE+S VSMTAARGTMGYIAPE FSRNFG
Sbjct  579   KILHFDIKPHNILLDDNFNPKIADFGLAKLCSKEQSAVSMTAARGTMGYIAPEDFSRNFG  638

Query  556   NVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGE  377
             +VS KSDVYSFGMLLLEMVGG+K  D+      +Q YFP+W+YN L++GEE+EI+I +  
Sbjct  639   SVSSKSDVYSFGMLLLEMVGGRKNVDVNAK-NMSQMYFPQWVYNHLNKGEEIEIRIREDS  697

Query  376   DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPG  197
             D KIA+KL I+GLWCI WYP DRP +KVV+QMLE EE P +P NPF S+   +A   +  
Sbjct  698   DHKIARKLAIIGLWCIHWYPADRPPVKVVVQMLEGEECPVIPKNPFVSSGSGEAGTMR--  755

Query  196   RLFTSALEIISE  161
              L+ + LE+I E
Sbjct  756   GLWNTNLEVIEE  767



>ref|XP_009335040.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=595

 Score =   532 bits (1371),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 291/584 (50%), Positives = 385/584 (66%), Gaps = 54/584 (9%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             C ++GP I FPFRLK  QP +CGY GF+L CT+  +T LE           P    K ++
Sbjct  38    CEHHGPAIRFPFRLKG-QPFQCGYHGFDLSCTNGRQTVLE----------MPSSSNKLIV  86

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENL---YNFSIFSCSTHRNITAGSI  1553
             E+I+   + I +   + C  + +   NLS+S F F +     ++++FSC +      G I
Sbjct  87    ETINYASQEIGVYFQNDCPPKDIFNFNLSSSIFQFVHGPFDASYTLFSCPSLLETDDGLI  146

Query  1552  NISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPY-SIAQDNTVFSLRWTG  1376
              + P           Y A    Y     +L+SCTK+   +SVPY S  +   +  L+W+ 
Sbjct  147   KLCPSGLDNPENQTNYYAVDGQYSIDHMNLVSCTKLRDYTSVPYISSVRAFQLMMLQWSK  206

Query  1375  PSC----------RLK---------NNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
             PSC          RLK         +N TAE   +C++       G   +  +   V+G+
Sbjct  207   PSCGRCEEMGKTCRLKRTIGQYNFTDNQTAET--ECVS-----EDGTRGRTSLEISVVGT  259

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
              +        Y +Y  NK++K  Q++IERFL+DY A KP+RYS ADIK+IT++F+EKLG+
Sbjct  260   LI--------YLVYSSNKIEKTNQLRIERFLDDYIAHKPSRYSNADIKRITNQFNEKLGQ  311

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G+YGTVYKG+LS D+ VAVK+LNNS  +  GE+ +NE+ T+G +HH+NVVRLVG+CADG+
Sbjct  312   GAYGTVYKGQLSSDLLVAVKILNNS--NEKGEDLINEVGTMGRVHHVNVVRLVGFCADGY  369

Query  892   HRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
               ALVYEYL N SL+  + S + K+ FLGW+KL +IALGIAKG+EYLHQGCD RILHFDI
Sbjct  370   TTALVYEYLPNGSLQNILSSADSKSAFLGWDKLHEIALGIAKGIEYLHQGCDLRILHFDI  429

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP NILLDQNF PK+SDFG AKLCS+++S VSMT  RGT+GYIAPEVFS+NFGNVSYKSD
Sbjct  430   KPHNILLDQNFTPKVSDFGLAKLCSRDQSAVSMTTIRGTIGYIAPEVFSKNFGNVSYKSD  489

Query  535   VYSFGMLLLEMVGGKKKSDITGSPET-NQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAK  359
             VYSFGMLLLEMVGG+K         T +Q YFPEWIYN+L +G+++ I IE G D++ AK
Sbjct  490   VYSFGMLLLEMVGGRKNFKFMEEDSTSSQVYFPEWIYNLLEQGDDLRIHIEDGGDAETAK  549

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
             KL IVGLWC+QW+P+DRPS+KVVIQMLE E +  ++P NPF ST
Sbjct  550   KLAIVGLWCVQWHPIDRPSMKVVIQMLEGEGDNLTVPANPFRST  593



>gb|EYU40252.1| hypothetical protein MIMGU_mgv1a024546mg [Erythranthe guttata]
Length=545

 Score =   529 bits (1363),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 302/594 (51%), Positives = 386/594 (65%), Gaps = 77/594 (13%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             ++C+P  C  +GP I FPFR K+ QP  CGYPGF+L C  K +T L             P
Sbjct  22    DDCMPTSCRKHGPTIQFPFRRKNQQPERCGYPGFDLFCDYKNDTVL-----------VLP  70

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCSTHRN  1571
             F V  +++ I+   + + +   + CF Q LP LNLSASPF F  + L N ++F+CS    
Sbjct  71    FSVNVIVKKINYASQRVDVYDQEQCFPQKLPHLNLSASPFHFLIKFLENCTLFNCSDPPV  130

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFS  1391
                 ++    I CL    +  YA  S + L S   L SCTK + + S P+ + ++N  FS
Sbjct  131   RDFRTL----IPCLGDSTYQSYAVHSKMPLESLP-LTSCTKTYELKSFPWELIREND-FS  184

Query  1390  LRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIY  1211
             L W+ P+C                  TK                 SF   V + +  RIY
Sbjct  185   LGWSEPAC------------------TK-----------------SF---VYLYIRVRIY  206

Query  1210  RLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGD  1031
             R      E +  I +FL DYKALKP+R+SY+DIK+IT +F+EKLGEG YG VYKGKL+ +
Sbjct  207   R------ENRTMIGKFLRDYKALKPSRFSYSDIKRITHQFNEKLGEGGYGIVYKGKLNNE  260

Query  1030  VFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSL  851
             + VAVKVLNNSKG+G  EEFVNE+STIG IHH+N+VRL+G+CADGF RALVYE+L N SL
Sbjct  261   IDVAVKVLNNSKGNG--EEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNGSL  318

Query  850   EKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPK  674
             EK +F   +++  L WEKL+ IALGIAKG+EYLH+GCDQ+ILHFDIKP+N+LLD N NPK
Sbjct  319   EKSIFQAGSNRITLDWEKLKDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLLDHNLNPK  378

Query  673   ISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGG  494
             I DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYSFGMLLLEMVGG
Sbjct  379   ICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGG  438

Query  493   KKKSDITGSPETNQDYFPEWIYN-ILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYP  317
             +K  D   +  T+Q YFP+WIYN I +    +  QI++ E + IA+KL+IVGLWCIQW P
Sbjct  439   RKNEDHNVN-NTSQVYFPQWIYNHINAEDNPMWAQIDE-EGNSIARKLSIVGLWCIQWCP  496

Query  316   VDRPSIKVVIQMLEAE-EPPSMPPNPF-TSTDPSKAKANKPGRLFTSALEIISE  161
              DRPS+KVV+QMLE E +  +MPPNPF  +T+P        G+ + + + II E
Sbjct  497   TDRPSMKVVVQMLEGECDDLTMPPNPFPATTNPID------GKHYQTQMSIILE  544



>gb|AES59881.2| receptor-like kinase [Medicago truncatula]
Length=620

 Score =   532 bits (1370),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 292/615 (47%), Positives = 394/615 (64%), Gaps = 56/615 (9%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPE--CGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKF  1730
             CGN    I FPF++K+  P    CGYPGF+L C+   ET +E            P  VK 
Sbjct  30    CGNQ--VIKFPFQIKNHNPNPSFCGYPGFDLFCSSNKETMIE-----------LPHKVKL  76

Query  1729  LIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFS--------FENLYNFSIFSCSTHR  1574
              +++ID  ++ I +S   GC       LNLS+S F         ++ + ++  F+CS   
Sbjct  77    KVKNIDYTNQTIELSDPQGCLYIQFHNLNLSSSHFKQVSDTRYFYDKVDSYHFFNCSLL-  135

Query  1573  NITAGSINISPIACLTKPGHFIYA--ADSSLYLYSATDLISCTKMFHVS----SVPYSIA  1412
              I    ++   + CL+      YA  A   +  +    L  CTKM++VS    S   +I 
Sbjct  136   -IRDDDMDSYLVPCLSTSTSQTYAIPAYEPIKFFP---LTFCTKMYNVSVMGPSYSGTIP  191

Query  1411  QDNTVFSLRWTGPSCR----------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEV  1262
             + N    L+W+ P+C+           KN ++     +        + G    L   G +
Sbjct  192   KKN-FLRLKWSEPNCKHCESEGKRCDWKNTTSNSTNKEVYCFAKNNNKGSSTTLVNTGSI  250

Query  1261  LGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
             LGS   V++    Y IY     KKE+Q  IE+FLEDY+ALKP RYSY +IK+IT+ F +K
Sbjct  251   LGSLFFVLLTGAIYHIYDSYIQKKEKQAIIEKFLEDYRALKPTRYSYEEIKRITNNFGDK  310

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             LG+G+YGTVY+G +S ++ VAVK+LN S+G+G  ++F+NE+ T+G IHH+N+VRLVG+CA
Sbjct  311   LGQGAYGTVYRGSISKEIIVAVKILNVSQGNG--QDFLNEVGTMGRIHHVNIVRLVGFCA  368

Query  901   DGFHRALVYEYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILH  725
             DGF RAL+YE+L N SL+KF+ SP N KNFLGW+KL +IALGIAKGVEYLHQGCDQRI+H
Sbjct  369   DGFKRALIYEFLPNGSLQKFINSPENKKNFLGWKKLHEIALGIAKGVEYLHQGCDQRIVH  428

Query  724   FDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSY  545
             FDIKP+N+LLD NF PKISDFG AKLCS+++SIVSMTAARGT+GYIAPEVFSRNFGNVSY
Sbjct  429   FDIKPQNVLLDHNFIPKISDFGLAKLCSRDQSIVSMTAARGTLGYIAPEVFSRNFGNVSY  488

Query  544   KSDVYSFGMLLLEMVGGKKKSDITGSPETNQD--YFPEWIYNILSRGEEVEIQIEKGEDS  371
             KSDVYS+GM+LLE +GGKK   IT   E N    Y+PEWIYN++   EE+ IQ++   D 
Sbjct  489   KSDVYSYGMMLLETIGGKK---ITEDLEENSSHVYYPEWIYNLIDDQEEMRIQVDDEGDE  545

Query  370   KIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST--DPSKAKANKP  200
             KIA+K+ IVGLWCIQW+ + RP++++V+QMLE + +   +PPNPF S    P +    K 
Sbjct  546   KIARKMAIVGLWCIQWHAMHRPTMQMVVQMLEGDVDKTPIPPNPFASQSRQPRRNGGAKI  605

Query  199   GRLFTSALEIISEMD  155
              R  T  L++I E+D
Sbjct  606   TRQLTQELDVIQELD  620



>ref|XP_009782477.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=608

 Score =   531 bits (1369),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 299/588 (51%), Positives = 390/588 (66%), Gaps = 51/588 (9%)
 Frame = -2

Query  1930  DRNE-CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATL  1754
             DR E C    C N+GP I FPFRL++ QP  CGYPGFEL C ++ +T LE          
Sbjct  32    DRLEGCEDSWCKNDGPIIHFPFRLRN-QPKHCGYPGFELQCNNQKDTILE----------  80

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYN-FSIFSCSTH  1577
               PF V F++E ID   + I +   + C +  L  LNLS S  +F+N+ +  ++F+CS  
Sbjct  81    -LPFSVHFIVEEIDYISQQIHLYDPNECIIAKLSKLNLSQS--NFKNVEDPTALFNCSVP  137

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ--DN  1403
              +          + CL   G+ +YA   ++ L+       CTK   +   PYS +   +N
Sbjct  138   YDYGI------VVPCLGSSGYQVYAVSPTILLHLFLTG-PCTK---IHQYPYSQSTFLEN  187

Query  1402  TVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKL-----------HTGPLRKLKVAGEVLG  1256
              +  L W  P C    N  +   D      TKL             G  ++  VAG +LG
Sbjct  188   RL-QLNWPVPLC---GNCESNGMDCGFMDRTKLLETHCFNRTMTQKGITKQPLVAGVILG  243

Query  1255  SFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLG  1076
             + LV +I+   +++Y  +K +K+ +V++E+FLEDYKA++P RYSYADIKKITD F+EKLG
Sbjct  244   AALVCIIIFSFHQLYLSSKNEKDSRVRLEKFLEDYKAIRPTRYSYADIKKITDGFNEKLG  303

Query  1075  EGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADG  896
             EGSYGTVYKGKLS +++VAVKVL +SKG G  EEF+NE+ TIG IHH+NVVRLVG+CADG
Sbjct  304   EGSYGTVYKGKLSREIYVAVKVLRDSKGKG--EEFINEIGTIGRIHHVNVVRLVGFCADG  361

Query  895   FHRALVYEYLVNNSLEKFVF----SPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRIL  728
             F RAL+YEYL N+SLE+F+     S N  + + W KLQ IALG A+G+EYLHQGC+Q+IL
Sbjct  362   FRRALIYEYLPNDSLERFILPMSSSTNSVSVISWNKLQHIALGTARGIEYLHQGCNQQIL  421

Query  727   HFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVS  548
             HFDIKP+NILLD N NPKI DFG AKLCSKEKS V+MTAARGT+GYIAPEV SRNFG VS
Sbjct  422   HFDIKPQNILLDHNLNPKICDFGLAKLCSKEKSAVTMTAARGTIGYIAPEVLSRNFGKVS  481

Query  547   YKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSK  368
             +KSD+YSFGMLLLEMVGG+ KS+ + +   N+    EWIY  L +GEE++I+IE+  D  
Sbjct  482   HKSDIYSFGMLLLEMVGGRIKSN-SKTNNHNKISSLEWIYGDLEKGEELKIRIEEEGDGT  540

Query  367   IAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTD  227
             I +KL IVGLWCIQW+P DRPSIK V+QMLE +    ++ PNPF +T+
Sbjct  541   IVRKLAIVGLWCIQWHPNDRPSIKEVVQMLEGDGSHLNLSPNPFMATN  588



>ref|XP_003589630.1| Kinase R-like protein [Medicago truncatula]
Length=611

 Score =   531 bits (1367),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 291/606 (48%), Positives = 393/606 (65%), Gaps = 47/606 (8%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPE--CGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKF  1730
             CGN    I FPF++K+  P    CGYPGF+L C+   ET +E            P  VK 
Sbjct  30    CGNQ--VIKFPFQIKNHNPNPSFCGYPGFDLFCSSNKETMIE-----------LPHKVKL  76

Query  1729  LIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFS--------FENLYNFSIFSCSTHR  1574
              +++ID  ++ I +S   GC       LNLS+S F         ++ + ++  F+CS   
Sbjct  77    KVKNIDYTNQTIELSDPQGCLYIQFHNLNLSSSHFKQVSDTRYFYDKVDSYHFFNCSLL-  135

Query  1573  NITAGSINISPIACLTKPGHFIYA--ADSSLYLYSATDLISCTKMFHVS----SVPYSIA  1412
              I    ++   + CL+      YA  A   +  +    L  CTKM++VS    S   +I 
Sbjct  136   -IRDDDMDSYLVPCLSTSTSQTYAIPAYEPIKFFP---LTFCTKMYNVSVMGPSYSGTIP  191

Query  1411  QDNTVFSLRWTGPSCR-LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVI  1235
             + N    L+W+ P+C+  ++     D  +  +  T        K    G +LGS   V++
Sbjct  192   KKN-FLRLKWSEPNCKHCESEGKRCDWKNTTSNSTNKEVYCFAKNNNKGSILGSLFFVLL  250

Query  1234  VLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTV  1055
                 Y IY     KKE+Q  IE+FLEDY+ALKP RYSY +IK+IT+ F +KLG+G+YGTV
Sbjct  251   TGAIYHIYDSYIQKKEKQAIIEKFLEDYRALKPTRYSYEEIKRITNNFGDKLGQGAYGTV  310

Query  1054  YKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVY  875
             Y+G +S ++ VAVK+LN S+G+G  ++F+NE+ T+G IHH+N+VRLVG+CADGF RAL+Y
Sbjct  311   YRGSISKEIIVAVKILNVSQGNG--QDFLNEVGTMGRIHHVNIVRLVGFCADGFKRALIY  368

Query  874   EYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
             E+L N SL+KF+ SP N KNFLGW+KL +IALGIAKGVEYLHQGCDQRI+HFDIKP+N+L
Sbjct  369   EFLPNGSLQKFINSPENKKNFLGWKKLHEIALGIAKGVEYLHQGCDQRIVHFDIKPQNVL  428

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LD NF PKISDFG AKLCS+++SIVSMTAARGT+GYIAPEVFSRNFGNVSYKSDVYS+GM
Sbjct  429   LDHNFIPKISDFGLAKLCSRDQSIVSMTAARGTLGYIAPEVFSRNFGNVSYKSDVYSYGM  488

Query  517   LLLEMVGGKKKSDITGSPETNQD--YFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIV  344
             +LLE +GGKK   IT   E N    Y+PEWIYN++   EE+ IQ++   D KIA+K+ IV
Sbjct  489   MLLETIGGKK---ITEDLEENSSHVYYPEWIYNLIDDQEEMRIQVDDEGDEKIARKMAIV  545

Query  343   GLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST--DPSKAKANKPGRLFTSALE  173
             GLWCIQW+ + RP++++V+QMLE + +   +PPNPF S    P +    K  R  T  L+
Sbjct  546   GLWCIQWHAMHRPTMQMVVQMLEGDVDKTPIPPNPFASQSRQPRRNGGAKITRQLTQELD  605

Query  172   IISEMD  155
             +I E+D
Sbjct  606   VIQELD  611



>gb|AES59891.2| receptor-like kinase [Medicago truncatula]
Length=607

 Score =   530 bits (1366),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 289/609 (47%), Positives = 390/609 (64%), Gaps = 58/609 (10%)
 Frame = -2

Query  1906  KCGNNGPEISFPFRLKHIQPPEC--GYPGFELLCTDKGETALENPFPLLNATLQPPFPVK  1733
             +CGN    I FPF +K+  P     GYP FEL C+   ET +E            P+ VK
Sbjct  32    RCGNQVI-IKFPFHIKNQNPNPSLYGYPDFELFCSSNNETMIE-----------LPYKVK  79

Query  1732  FLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF-----ENLYNFSIFSCSTHRNI  1568
               +++ID + + I +     C  + +  LNLS S F++     E+  +   F+CS    +
Sbjct  80    LNVKNIDYKHQTIELFDPQSCLYKHIHNLNLSESHFNYVKYDYEDFVDHHFFNCSL---L  136

Query  1567  TAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVF-S  1391
                 IN   + CL+     IY   SS  +     L  CTKMF+VS +  S +  N  F  
Sbjct  137   NRDDINSYLVPCLSTSTSQIYVILSSESI-DYLPLSFCTKMFNVSLISISRSVPNQKFLR  195

Query  1390  LRWTGPSCR----------LKNNSTAEDAD-DCIAPLTKLHTGPLRKLKVAGEVLGSFLV  1244
             L W+ P+C+           KN ++  + + DC A   K            G +LGS   
Sbjct  196   LMWSEPNCKHCESKGNRCGWKNTTSTTNKEVDCFAKNHK------------GSILGSLFF  243

Query  1243  VVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSY  1064
             V++    Y +Y    + K +Q  IE+FLEDY+ALKP RYSY +IK+IT+ FS+KLG+G+Y
Sbjct  244   VLLTGAVYHVYDSYILNKAKQAIIEKFLEDYRALKPTRYSYVEIKRITNNFSDKLGQGAY  303

Query  1063  GTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRA  884
             GTVY+G +S ++ VAVK+LN S+G+G  ++F+NE+ TIG  HH+N+VRLVG+CADGF RA
Sbjct  304   GTVYRGSISKEIIVAVKILNFSQGNG--QDFLNEVGTIGRTHHVNIVRLVGFCADGFKRA  361

Query  883   LVYEYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPR  707
             L+YE+L N SL+KF+ SP N KNFLGW+KL +IALGIAKGVEYLHQGCDQRILHFDIKP+
Sbjct  362   LIYEFLPNGSLQKFINSPENKKNFLGWKKLHEIALGIAKGVEYLHQGCDQRILHFDIKPQ  421

Query  706   NILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYS  527
             N+LLD NF PKISDFG AKLCS+++S+VSMTAARGT+GYIAPEVFSRNFGNVSYKSDVYS
Sbjct  422   NVLLDHNFIPKISDFGLAKLCSRDQSVVSMTAARGTLGYIAPEVFSRNFGNVSYKSDVYS  481

Query  526   FGMLLLEMVGGKKKSDITGSPETNQD--YFPEWIYNILSRGEEVEIQIEKGEDSKIAKKL  353
             +GM+LLE +GGKK   IT   E N    Y+PEWIY ++   EE+ I ++   D K+A+K+
Sbjct  482   YGMMLLETIGGKK---ITEDLEENSSHVYYPEWIYKLIDDEEEMRIHVDDEGDEKVARKM  538

Query  352   TIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST--DPSKAKANKPGRLFTS  182
              IVGLWCIQW+ +DRP++++V+QMLE + +   +PPNPF S    P +       R  T 
Sbjct  539   AIVGLWCIQWHAMDRPTMQMVVQMLEGDVDKTPIPPNPFASQSRQPRRNGGVAITRQLTQ  598

Query  181   ALEIISEMD  155
              L++I E++
Sbjct  599   ELDVIQELE  607



>gb|EYU40244.1| hypothetical protein MIMGU_mgv1a019217mg, partial [Erythranthe 
guttata]
Length=510

 Score =   526 bits (1356),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 281/567 (50%), Positives = 366/567 (65%), Gaps = 60/567 (11%)
 Frame = -2

Query  1915  LPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPV  1736
             +P +C  + P I FPFR + +QP  CGYPGF+L C  K +T L             PF V
Sbjct  1     MPIRCSKHSPIIRFPFRHQTLQPQHCGYPGFDLNCDHKKDTVL-----------VLPFSV  49

Query  1735  KFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRNITAGS  1556
               +++ I+   + I++   + C  Q LP LNLS S F+F   +++ I  C+ ++   A  
Sbjct  50    NVVVKEINYASQTILVYDPE-CLPQKLPHLNLSTSSFNFLLDHDYLISDCAIYKCSDADK  108

Query  1555  INISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTG  1376
              ++    CL  P +  Y  ++        +L SCTK+  +  VP+SI+  N  F L W+ 
Sbjct  109   -SLYRFPCLIDPINKYYIVNT------IQELTSCTKIHDILDVPWSISDKNG-FRLEWSE  160

Query  1375  PSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKM  1196
             P+C                                    G FL V+I++     Y   + 
Sbjct  161   PTC-----------------------------------FGCFLAVIILVALVHQYIRFRT  185

Query  1195  KKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAV  1016
              +E Q+K+E+FL+DY+ALKP+R+SY+DI +IT +F +KLGEG YG VYKGKL+ ++ VAV
Sbjct  186   GRENQIKVEKFLQDYRALKPSRFSYSDITRITHQFRDKLGEGGYGVVYKGKLNNEIDVAV  245

Query  1015  KVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVF  836
             KVLNNSKG+G  EEFVNE+STIG IHH+N+VRLVG+CADGF RALVYE+L N+SLEK +F
Sbjct  246   KVLNNSKGNG--EEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEFLRNDSLEKIIF  303

Query  835   SPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFG  659
                 K   L WEKL+ IALGIA+G+EYLH+GCDQ+ILHFDIKP+N+LLD NFNPKI DFG
Sbjct  304   QAGSKKISLDWEKLKDIALGIARGIEYLHEGCDQQILHFDIKPQNVLLDHNFNPKICDFG  363

Query  658   QAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSD  479
              AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYSFGMLLLEMVGG+K  D
Sbjct  364   LAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKNED  423

Query  478   ITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSI  299
                   T+  YFP+WIYN ++  +    +    E + IA+KL+IVGLWCIQW P DRPS+
Sbjct  424   -RNVNNTSPVYFPQWIYNHINAEDNPMWEQIDEEGNSIARKLSIVGLWCIQWCPTDRPSM  482

Query  298   KVVIQMLEAEEPP-SMPPNPFTSTDPS  221
             KVV+QMLE +    +MPPNPF +T  S
Sbjct  483   KVVVQMLEGDNGDLTMPPNPFPATTNS  509



>ref|XP_009629970.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Nicotiana 
tomentosiformis]
Length=607

 Score =   529 bits (1363),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 309/615 (50%), Positives = 392/615 (64%), Gaps = 61/615 (10%)
 Frame = -2

Query  1930  DRNE-CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATL  1754
             DR E C    C N+GP I FPFRL++ QP  CGYPGFEL C ++ +T LE          
Sbjct  31    DRLEGCEDSWCKNDGPIIHFPFRLRN-QPKHCGYPGFELQCNNQNDTILE----------  79

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFS-FENLYNFSIFSCSTH  1577
               P  V  ++E ID   + I +   + C +  L  LNLS S F  FEN     +F+CS  
Sbjct  80    -LPLSVPLIVEEIDYVSQQIHLYDPNECIIAKLSKLNLSQSNFKIFEN--PTVLFNCS--  134

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSS---LYLYSATDLISCTKMFHVSSVPYSIAQD  1406
               I     N+ P  CL    + ++A  S+   LY  S      CTK FH      S   +
Sbjct  135   --IPYDYGNVVP--CLGSSRYQVHAVSSTMSLLYFLSG----PCTK-FHQYPYSQSTFLE  185

Query  1405  NTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKL-----------HTGPLRKLKVAGEVL  1259
             N +  L W  P C    N  ++  D      TKL             G  ++  +AG +L
Sbjct  186   NRL-QLNWPIPLC---GNCESKGMDCGFVDKTKLLETHCFNRTMTQKGITKQPLLAGVIL  241

Query  1258  GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
             G+ LV +IV   Y++Y  +K +++ +V +E+FLEDYKA++P RYSYADIKKIT  F+EKL
Sbjct  242   GTALVCIIVFSLYQLYLSSKNERDSRVILEKFLEDYKAIRPTRYSYADIKKITVDFNEKL  301

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             GEGSYGTVYKGKLS +++VAVKVL +SKG G  EEF+NE+ TIG IHH+NVVRLVG+CAD
Sbjct  302   GEGSYGTVYKGKLSREIYVAVKVLRDSKGKG--EEFINEIGTIGRIHHVNVVRLVGFCAD  359

Query  898   GFHRALVYEYLVNNSLEKFVF----SPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRI  731
             GF RAL+YEYL N+SLE+F+     S N  + + W KLQ IALG A+G+EYLHQGCDQ+I
Sbjct  360   GFRRALIYEYLPNDSLERFILPMSSSTNSVSLISWNKLQHIALGTARGIEYLHQGCDQQI  419

Query  730   LHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNV  551
             LHFDIKP+NILLD N NPKI DFG AKLCSKEKS V+MTAARGT+GYIAPEV SRNFG V
Sbjct  420   LHFDIKPQNILLDHNLNPKICDFGLAKLCSKEKSAVTMTAARGTIGYIAPEVLSRNFGKV  479

Query  550   SYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFP--EWIYNILSRGEEVEIQIEKGE  377
             S+KSD+YSFGMLLLEMVGG+ K   T S   N       EWIY  L +GEE++I+IE+  
Sbjct  480   SHKSDIYSFGMLLLEMVGGRIK---TNSKTNNHSKVSSLEWIYRDLEKGEELQIRIEEEG  536

Query  376   DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKP  200
             D  I +KL IVGLWCIQW+P DRPSIK V+QMLE +    ++ PNPF +T+ S   ++  
Sbjct  537   DGTIVRKLAIVGLWCIQWHPNDRPSIKEVVQMLEGDGSHLNLSPNPFMATNMSNFNSSP-  595

Query  199   GRLFTSALEIISEMD  155
                 T  L++I E++
Sbjct  596   ---HTEDLDVILEIE  607



>ref|XP_004498292.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Cicer arietinum]
Length=613

 Score =   529 bits (1363),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 284/608 (47%), Positives = 387/608 (64%), Gaps = 50/608 (8%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQP---PECGYPGFE--LLCTDKGETALENPFPLLNATLQPPFP  1739
             CGN    I FPF++K+  P   P C YP F+  L C+   ET +E            P  
Sbjct  31    CGNQ--VIKFPFQIKNHYPTISPLCSYPAFDFDLFCSSNNETMIE-----------LPHK  77

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF------ENLYNFSIFSCSTH  1577
             +K  +++I+ + + I +     C  + +  LNLS S F +      + + N+  F+CS  
Sbjct  78    IKLYVKNINYKHQTIQLYDPQNCLYKQIHNLNLSTSHFKYLKNNHDDFVDNYHFFNCSV-  136

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
               +    + +  ++CL+     IYA  SS  L     L  CTKMF+VS   +    D  +
Sbjct  137   --LIRNELYLYLVSCLSTSTSQIYAIPSST-LVDNLPLTFCTKMFNVSFNSFGFVPDKNI  193

Query  1396  FSLRWTGPSC--------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVV  1241
               L W+ P+C        R   N+TA     C     K   G    L   G +LGS   +
Sbjct  194   IRLMWSEPNCKHCESKGKRCGLNNTASKEVYC---FHKNKQGSSTALVTTGSILGSLFFI  250

Query  1240  VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYG  1061
             ++    Y IY    +KKE++  IE+FL+DY+ALKP RYSY +IK+IT+ F +KLG+G+YG
Sbjct  251   LLTGAIYHIYDSYILKKEKEAIIEKFLKDYRALKPTRYSYIEIKRITNNFGDKLGQGAYG  310

Query  1060  TVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRAL  881
              VYKG +S +  VAVK+LN S G+G  ++F+NE+ T+G IHH+N+VRL+G+CADGF RAL
Sbjct  311   NVYKGNISKEFIVAVKILNVSLGNG--QDFLNEVGTMGRIHHVNIVRLIGFCADGFKRAL  368

Query  880   VYEYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRN  704
             +YE+L N SL+KF+ SP N KNFLGW+KL ++ALGIAKG+EYLHQGCDQRILHFDIKP+N
Sbjct  369   IYEFLPNGSLQKFINSPENKKNFLGWKKLHEVALGIAKGIEYLHQGCDQRILHFDIKPQN  428

Query  703   ILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSF  524
             +LLD NF PKI DFG AKLCS+++S+VSMTAARGT+GYIAPEVFSRNFG VSYKSDVYS+
Sbjct  429   VLLDHNFIPKICDFGLAKLCSRDQSVVSMTAARGTLGYIAPEVFSRNFGKVSYKSDVYSY  488

Query  523   GMLLLEMVGGKKKSDITGSPETNQD--YFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             GM+LLE +GG+K   IT   E N    ++PEWIYN+L   +E+ I ++  ED+K+A+K+ 
Sbjct  489   GMMLLETIGGRK---ITEDLEENTSHVHYPEWIYNLLDDQDEMRIHVDDEEDAKVARKMA  545

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTD--PSKAKANKPGRLFTSA  179
              VGLWCIQW+ +DRPS+++VIQM E + +   +PPNPF S    P +  A    R  T  
Sbjct  546   TVGLWCIQWHAMDRPSMQMVIQMFEGDVDKTPIPPNPFASQTRRPRRNGAIATTRQLTQD  605

Query  178   LEIISEMD  155
             L+II E+D
Sbjct  606   LDIIEEVD  613



>gb|EYU21079.1| hypothetical protein MIMGU_mgv1a023647mg [Erythranthe guttata]
Length=569

 Score =   526 bits (1356),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 296/598 (49%), Positives = 381/598 (64%), Gaps = 61/598 (10%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             ++C+P +C NNGP I FPFR  + QP  CGYPGF+L C  K            N  L  P
Sbjct  22    DDCMPIRCRNNGPIIRFPFRHTNRQPQRCGYPGFDLFCDHKN-----------NTLLVLP  70

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCS--TH  1577
             F V  +++ I+   + +++   + CF Q LP+LNLSASPF F  + L N+++F+CS  + 
Sbjct  71    FSVNVIVKKINYVSQRVLVYDQEKCFPQKLPLLNLSASPFRFLIKFLDNYTLFNCSDPSR  130

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
             R+++        + CL       YA DS L + S   L SCTK +   SVP+ I Q+N  
Sbjct  131   RDLSI------VVPCLGDSTCQFYAVDSKLSMESLP-LTSCTKTYEFKSVPWKIFQEND-  182

Query  1396  FSLRWTGPSCRLKNNSTAEDADDCIAPL--TKLHTGPLRKLKVAGE--VLGSFLVVVIVL  1229
             F L W+ P+      S  ED     +    T       RK  + GE    GS LV +I+ 
Sbjct  183   FYLEWSEPA-----YSVCEDKGKRCSSYNSTTSDRRTRRKQLIEGEYFCFGSILVAIILA  237

Query  1228  VTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYK  1049
                 +Y   +  +E +  I +FL DYKALKP+R+SY+DIK+IT +FSEKLGEG YG VYK
Sbjct  238   AFVYLYIRVRTYRENRTMIGKFLRDYKALKPSRFSYSDIKRITHQFSEKLGEGGYGIVYK  297

Query  1048  GKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEY  869
             GKL+ ++ VAVKVLNNS  +G+GEEFVNE+STIG IHH+N+VRL+G+CADGF RALVY +
Sbjct  298   GKLNNEIVVAVKVLNNS--NGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYAF  355

Query  868   LVNNSLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQ  689
             L N SLEK +F                     K +EYLH+GCD+RIL FDIKP+N+LLD 
Sbjct  356   LPNGSLEKSIFQ-----------------AACKSIEYLHEGCDRRILQFDIKPQNVLLDH  398

Query  688   NFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLL  509
             N NPKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYSFGMLLL
Sbjct  399   NLNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLL  458

Query  508   EMVGGKKKSDITGSPETNQDYFPEWIYNILSRGE-EVEIQIEKGEDSKIAKKLTIVGLWC  332
             EMVGG+K  D      T+Q YFP+WIYN ++ G+     QI++G  + IA+KL++VGLWC
Sbjct  459   EMVGGRKNED-RNVNHTSQVYFPQWIYNHINAGDNNFWSQIDEG--NSIARKLSMVGLWC  515

Query  331   IQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISE  161
             IQW P DRPS+KVV+QMLE E +  +MPPNPF +T  S       GR + + + II E
Sbjct  516   IQWCPTDRPSMKVVVQMLEGEFDDLTMPPNPFPATTNS-----IDGRHYQTEMSIILE  568



>ref|XP_003589651.1| Kinase R-like protein [Medicago truncatula]
 gb|AES59902.1| receptor-like kinase [Medicago truncatula]
Length=616

 Score =   527 bits (1358),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 288/608 (47%), Positives = 390/608 (64%), Gaps = 56/608 (9%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPEC--GYPGFELLCTDKGETALENPFPLLNATLQPPFPVKF  1730
             CGN    I FPF +K+  P     GYP FEL C+   ET +E            P+ VK 
Sbjct  40    CGNQ--VIKFPFHIKNQNPNPSLHGYPDFELFCSSNNETMIE-----------LPYKVKL  86

Query  1729  LIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF-----ENLYNFSIFSCSTHRNIT  1565
              +++ID + + I +     C  + +  LNLS S F++     ++  +   F+CS    + 
Sbjct  87    NVKNIDYKHQTIELFDPQSCLYKHIHNLNLSESHFNYLKHDYDDFVDHHFFNCSL---LN  143

Query  1564  AGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLR  1385
                ++   ++CL      IYA  SS  +     L  CTKMF+VS  P      +    L 
Sbjct  144   RDWMDSYSVSCLRTSTSQIYAIPSSTNI-EDLPLSFCTKMFNVSFKP------SDSLRLT  196

Query  1384  WTGPSCR----------LKNNSTAEDAD--DCIAPLTKLHTGPLRKLKVAGEVLGSFLVV  1241
             W+ P+C+           KN ++  D    DC+    K   G  + L   G +LGS   +
Sbjct  197   WSEPNCKHCESKGKICGWKNTTSNSDNKEVDCVPKNKK---GSSKALVNTGSILGSLFFI  253

Query  1240  VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYG  1061
             +++   + IY    ++KE+Q  IE+FLEDY+ALKP RYSY +IK+IT+ F + LG+G+YG
Sbjct  254   LLIGGVFHIYDSYILRKEKQAIIEKFLEDYRALKPTRYSYVEIKRITNNFGDMLGQGAYG  313

Query  1060  TVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRAL  881
             TVYKG +S +  VAVK+LN S+G+G  ++F+NE+ T+G IHH+N+VRL+G+CADGF RAL
Sbjct  314   TVYKGSISKEFSVAVKILNVSQGNG--QDFLNEVGTMGRIHHVNIVRLIGFCADGFKRAL  371

Query  880   VYEYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRN  704
             +YE+L N SL+KF+ SP N KNFLGW+KL +IALGIAKG+EYLHQGCDQRILHFDIKP+N
Sbjct  372   IYEFLPNGSLQKFINSPDNKKNFLGWKKLHEIALGIAKGIEYLHQGCDQRILHFDIKPQN  431

Query  703   ILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSF  524
             +LLD NF PKI DFG AKLCS+++SIVSMTAARGT+GYIAPEVFSRNFGNVS+KSDVYS+
Sbjct  432   VLLDHNFIPKICDFGLAKLCSRDQSIVSMTAARGTLGYIAPEVFSRNFGNVSFKSDVYSY  491

Query  523   GMLLLEMVGGKKKSDITGSPETNQD--YFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLT  350
             GM+LLE +GGKK   IT   E N    Y+PEWIYN++   EE+ I ++   D KIA+K+ 
Sbjct  492   GMMLLETIGGKK---ITEDLEENSSHVYYPEWIYNLIDDEEEMRIHVDDEGDEKIARKMA  548

Query  349   IVGLWCIQWYPVDRPSIKVVIQMLEAEEPPS-MPPNPFTSTD--PSKAKANKPGRLFTSA  179
             IVGLWCIQW+ +DRPS+++V+QMLE +E  + +PPNPF S    P K  A          
Sbjct  549   IVGLWCIQWHAMDRPSMQMVVQMLEGDEDKTPIPPNPFASQSRRPRKNSAIATTGHLAQD  608

Query  178   LEIISEMD  155
             L++I E+D
Sbjct  609   LDVIHELD  616



>gb|EYU40249.1| hypothetical protein MIMGU_mgv1a0233662mg, partial [Erythranthe 
guttata]
Length=560

 Score =   525 bits (1353),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 293/579 (51%), Positives = 382/579 (66%), Gaps = 50/579 (9%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             ++C P +C  + P I FPFR +  QP  CGYPG +L C  K            NA L  P
Sbjct  20    DDCTPIRCSKHSPIIRFPFRHQTQQPQHCGYPGIDLNCDHKN-----------NAVLVLP  68

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNF----SIFSCS  1583
             F V  +++ I+   + +++   + C  Q LP LNLS S F+F  ++  N+    +IF CS
Sbjct  69    FSVNVVVKEINYTSQRMLVYDPENCLPQKLPHLNLSTSSFNFLLDDFDNYKSDYAIFKCS  128

Query  1582  THRNITAGSINISPIACLTKPGHFIYAAD-SSLYLYSATDLISCTKMFHVSSV-PYSIAQ  1409
                   A       I CL  P +  Y  D  ++ LY   +L SCTK+  +  V P+SI+ 
Sbjct  129   D-----ADKSLYRFIPCLIDPINKYYFVDKDNILLY---ELTSCTKIHDIPPVIPWSISD  180

Query  1408  DNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFL-VVVIV  1232
              N  F L W+ PSCR   +  A+     +   T+L +             G FL V+++V
Sbjct  181   KNG-FRLGWSEPSCR---HCEAQGKRCSLYNSTRLDS------------FGCFLAVIILV  224

Query  1231  LVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVY  1052
              V Y+  R  +  +E Q+KIE+FL+DY+ALKP+R+SY+DI ++T +F +KLGEG YG VY
Sbjct  225   AVVYQYIRF-RTGRENQIKIEKFLQDYRALKPSRFSYSDITRMTHQFRDKLGEGCYGVVY  283

Query  1051  KGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYE  872
             KGKL+ ++ VAVKVLNNSKG+G  EEFVNE+STIG IHH+N+VRLVG+CADGF RALVYE
Sbjct  284   KGKLNNEIDVAVKVLNNSKGNG--EEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYE  341

Query  871   YLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILL  695
             +L N+SLEK +F P ++K  L WEKL+ I  GIA+G+EYLH+GCDQ+IL+FDIKP+N+LL
Sbjct  342   FLPNDSLEKIIFQPASNKISLDWEKLKDIVQGIARGIEYLHEGCDQQILNFDIKPQNVLL  401

Query  694   DQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGML  515
             D NFNPKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYSFGML
Sbjct  402   DHNFNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGML  461

Query  514   LLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLW  335
             LLEMVGG+K  D      T+  YFP+WIYN ++  +    +    E + IA+KL+IVGLW
Sbjct  462   LLEMVGGRKNED-RNVNNTSPVYFPQWIYNHINAEDNPLWEQIDEEGNSIARKLSIVGLW  520

Query  334   CIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPS  221
             CIQW P DRPS+KVV+QMLE +    +MPPNPF +T  S
Sbjct  521   CIQWCPTDRPSMKVVVQMLEGDNGDLTMPPNPFPATSNS  559



>ref|XP_006374119.1| hypothetical protein POPTR_0015s020001g, partial [Populus trichocarpa]
 gb|ERP51916.1| hypothetical protein POPTR_0015s020001g, partial [Populus trichocarpa]
Length=500

 Score =   523 bits (1347),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 277/508 (55%), Positives = 343/508 (68%), Gaps = 44/508 (9%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             C   +C N+GP I FPF L+  QP  C YPGFEL CTD+ ET            LQ P  
Sbjct  24    CQEARCKNDGPAIRFPFSLREKQPDNCSYPGFELSCTDRRET-----------LLQLPNS  72

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY--NFSIFSCSTHRNIT  1565
             VK  +  ID   +LII S  D C    L   NLS SPF F ++   +++ F+C++ +  T
Sbjct  73    VKLYVNKIDYASQLIIASDPDQCLPGQLRHFNLSTSPFKFGDMEQDDYAFFNCTSWKGDT  132

Query  1564  AGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLR  1385
             +       +ACL+ PG+ I+A  SS YL   +DL SCTKM+++SS+P  I   N +  L 
Sbjct  133   S-----RQLACLSGPGYDIFAYFSS-YLIGYSDLTSCTKMYNLSSIPGEIFWQNNILHLN  186

Query  1384  WTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVI  1235
             W+GP C          R KNNS     +    P +K         +VA   +GS L++++
Sbjct  187   WSGPECVHCEAHGKFCRSKNNSAGLGTECYDKPKSK---------EVA--TVGSVLLLLV  235

Query  1234  VLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTV  1055
                 +R+Y  +K  KE Q +IE FL DYKA KP RY+YADIK+IT+ F +KLG+G+YGTV
Sbjct  236   FFAAFRVYSSDKAAKENQKRIENFLADYKAFKPTRYTYADIKRITNEFKDKLGQGAYGTV  295

Query  1054  YKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVY  875
             +KG+LS ++FVAVK+LNNS G+G  EEFVNE+ T+G IHH+NV+RLVGYCADGF RALVY
Sbjct  296   FKGQLSDEIFVAVKILNNSTGNG--EEFVNEVGTMGKIHHVNVIRLVGYCADGFRRALVY  353

Query  874   EYLVNNSLEKFVFSPN-DKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
             +YL N SLEKF+ S + D + L WEKLQ IALG+AKG+EYLHQGCDQRILHFDIKP NIL
Sbjct  354   DYLSNESLEKFISSEHGDASALSWEKLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNIL  413

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LD NFNPKISDFG AKLCSK++S VSMT ARGT+GYIAPEVFSRNFGNVSYKSDVY FGM
Sbjct  414   LDDNFNPKISDFGLAKLCSKDQSAVSMTTARGTLGYIAPEVFSRNFGNVSYKSDVYGFGM  473

Query  517   LLLEMVGGKKKSDITGSPETNQDYFPEW  434
             +LLEMVGG+K  D       NQ YFPEW
Sbjct  474   VLLEMVGGRKTID-DKIENNNQIYFPEW  500



>ref|XP_003589648.1| Receptor serine/threonine kinase [Medicago truncatula]
Length=1129

 Score =   543 bits (1400),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 296/605 (49%), Positives = 393/605 (65%), Gaps = 51/605 (8%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CGN    I FPFR+K+ Q P CGY GFEL CT   ET +E            P  VK  +
Sbjct  33    CGNQ--VIKFPFRIKNRQSPMCGYSGFELFCTSNNETIIE-----------LPHKVKLNV  79

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF-----ENLYNFSIFSCSTHRNITAG  1559
             ++ID + + I +S    C  + +  LNLS S F++     ++  ++   +CS    +   
Sbjct  80    KNIDYKHQTIQLSDPQSCLYKHIHNLNLSESHFNYLKHDYDDFVDYHFINCSL---LIRD  136

Query  1558  SINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWT  1379
              I+   + CL+      YA  SS  +  +  L  CTKMF+VS+        N++  L W+
Sbjct  137   DIDSYLVPCLSTSTSQTYAI-SSFTVIDSFPLSLCTKMFNVSTNVIDFLDKNSL-RLMWS  194

Query  1378  GPSCR----------LKN---NSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVV  1238
              PSC+           KN   NST ++ D C     K   G  + L   G +LGS   ++
Sbjct  195   EPSCKHCESKGKICGWKNTVGNSTNKEVD-CFPKKKK---GSSKALVNTGSILGSLFFIL  250

Query  1237  IVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGT  1058
             ++   Y IY    +KKE+Q  +E+FLEDY+ LKP RYSY +IK+IT+ F + LG+G+YGT
Sbjct  251   LIGGIYHIYDSYILKKEKQAIVEKFLEDYRVLKPTRYSYVEIKRITNNFGDMLGQGAYGT  310

Query  1057  VYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALV  878
             VYKG +S +  VAVK+LN S+G+G  ++F+NE+ T+  IHH+N+VRLVG+CADGF RAL+
Sbjct  311   VYKGSISKEFSVAVKILNVSQGNG--QDFLNEVGTMSRIHHVNIVRLVGFCADGFKRALI  368

Query  877   YEYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNI  701
             YEYL N SL+KF+ SP N KNFLGW+KL +IALGIAKG+EYLHQGCDQRILHFDIKP+N+
Sbjct  369   YEYLPNGSLQKFINSPDNKKNFLGWKKLHEIALGIAKGIEYLHQGCDQRILHFDIKPQNV  428

Query  700   LLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFG  521
             LLD NF PKISDFG AKLCS+++SIVSMTAARGT+GYIAPEVFSRNFGNVSYKSDVYS+G
Sbjct  429   LLDHNFIPKISDFGLAKLCSRDQSIVSMTAARGTLGYIAPEVFSRNFGNVSYKSDVYSYG  488

Query  520   MLLLEMVGGKKKSDITGSPETNQD--YFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTI  347
             M+LLE +GG+K   IT   E N    Y+PEWIYN++   EE++I I+   D KIA+K+ I
Sbjct  489   MMLLETIGGRK---ITEDLEENSSHVYYPEWIYNLIDDEEEMKIHIDDEGDEKIARKMAI  545

Query  346   VGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPF--TSTDPSKAKANKPGRLFTSAL  176
             VGLWCIQW+ +DRPS+++V+QMLE   +   +PPNPF   S  P +  A    R  T  L
Sbjct  546   VGLWCIQWHAMDRPSMQMVVQMLEENIDKTPIPPNPFDSQSRQPRRTDATATTRQVTHNL  605

Query  175   EIISE  161
             ++ S 
Sbjct  606   DVNSH  610


 Score =   239 bits (611),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 146/371 (39%), Positives = 198/371 (53%), Gaps = 80/371 (22%)
 Frame = -2

Query  1303  HTGPLRKLKVAGEVLGSFLV----VVIVL----VTYRIYRLNKMKKEEQVKIERFLEDYK  1148
             H  P+  L  + +V  S L+    V+ VL    + + IY+           IE FL    
Sbjct  610   HRSPVCSLFPSKKVCSSLLIFLDAVIFVLGASFIGFLIYKTRPKHLSMYNGIESFLRRDN  669

Query  1147  ALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFV  968
             ++ P RY + DI KIT     KLG G YG +                    G       +
Sbjct  670   SIMPIRYFFKDINKIT-----KLGSGGYGKII-------------------GQNQVRRSI  705

Query  967   NEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSP-NDKNFLGWEKLQQ  791
             NE++TIG IHH+NVV+L+G+  +G   AL+YE++ N  LEK++FS   + N+LG      
Sbjct  706   NEIATIGRIHHLNVVQLIGFYVEGSKHALIYEFMPNGLLEKYIFSHIEESNYLG------  759

Query  790   IALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTA  611
                     +EYLH GC+ +ILHFDIKP NILLD+NFNPK+SDFG A+LC    SIVS+TA
Sbjct  760   --------IEYLHNGCNMKILHFDIKPHNILLDENFNPKVSDFGLARLCPTGNSIVSLTA  811

Query  610   ARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWI  431
             AR T+GY+APE+F RN G +SYK+DVYSFGMLL+E+          GS            
Sbjct  812   ARRTIGYMAPELFYRNVGTISYKADVYSFGMLLMEI----------GS------------  849

Query  430   YNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMP  251
                      + I+ +  ++ K+AKK+    LWCIQ  P DRPS+  V++MLE E+     
Sbjct  850   ---------ISIENDTDQEMKLAKKMMTAALWCIQTKPEDRPSMDKVLEMLEEEDGDLQI  900

Query  250   PNP--FTSTDP  224
             PN   F   DP
Sbjct  901   PNKPYFCPQDP  911



>ref|XP_008363247.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=506

 Score =   523 bits (1346),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 274/476 (58%), Positives = 347/476 (73%), Gaps = 22/476 (5%)
 Frame = -2

Query  1540  IACLTKPGHFIYAADSSLYL-YSATDLISCTKMFHVSSVPYSIAQDN-TVFSLRWTGPSC  1367
             + CL  PG  IYA DS   L +   DL SC+KM+ V SVP+     N  V    W+ P+C
Sbjct  39    VPCLGDPGSRIYAVDSDTSLKFLIPDLRSCSKMYDVLSVPFGKWVGNGDVLQFNWSKPNC  98

Query  1366  ----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYR  1217
                       R K N  A    +C     + +T    KL V G +LGS L+V++++  YR
Sbjct  99    TECEAEGKRCRWKKNG-ANGEIECQHVRKQSNTW---KLVVTGGILGSLLLVLLMIAAYR  154

Query  1216  IYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLS  1037
             +Y  ++ +KE +++IERFLEDYKALKP+RY YADI++IT++F +KLG+G+YGTV+KGKLS
Sbjct  155   VYSADRKEKESRLRIERFLEDYKALKPSRYLYADIRRITNQFKDKLGQGAYGTVFKGKLS  214

Query  1036  GDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNN  857
              + F+AVK+LN+SKGDG  EEFVNE+ T+G IHH+NV RLVG+CADG+ RALVYE+  N 
Sbjct  215   SEFFIAVKLLNSSKGDG--EEFVNEVRTMGQIHHVNVARLVGFCADGYVRALVYEFFPNG  272

Query  856   SLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFN  680
             SL+ F+ S + KN FLGW+KLQ IALGIAKG++YLHQGCDQRILHFDIKP NILLDQNF 
Sbjct  273   SLQDFISSADSKNSFLGWDKLQDIALGIAKGIDYLHQGCDQRILHFDIKPHNILLDQNFT  332

Query  679   PKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMV  500
             PKISDFG AKLCSK++S+VSMT ARGTMGYIAPEVFSRNFGNVSYK+DVYSFGMLL+EMV
Sbjct  333   PKISDFGLAKLCSKDQSMVSMTTARGTMGYIAPEVFSRNFGNVSYKADVYSFGMLLIEMV  392

Query  499   GGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWY  320
             GG+K    T    TN+ Y+P+WIYN+L  G+++ I I +  D KI KKL IVGLWCIQW+
Sbjct  393   GGRKNIGSTIENTTNEIYYPQWIYNLLEEGDDLRIHIGEEGDGKIPKKLAIVGLWCIQWH  452

Query  319   PVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             PVDR ++K+ +QMLE E E  +MPPNPF  T P+    + P R     LE I+E++
Sbjct  453   PVDRLAMKIAVQMLEGEGESLTMPPNPFVPTGPTTRNGSIPARRL--ELEAIAELE  506



>ref|XP_003589640.1| Kinase R-like protein [Medicago truncatula]
Length=642

 Score =   526 bits (1355),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 291/632 (46%), Positives = 393/632 (62%), Gaps = 69/632 (11%)
 Frame = -2

Query  1906  KCGNNGPEISFPFRLKHIQPPEC--GYPGFELLCTDKGETALENPFPLLNATLQPPFPVK  1733
             +CGN    I FPF +K+  P     GYP FEL C+   ET +E            P+ VK
Sbjct  32    RCGNQVI-IKFPFHIKNQNPNPSLYGYPDFELFCSSNNETMIE-----------LPYKVK  79

Query  1732  FLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF-----ENLYNFSIFSCSTHRNI  1568
               +++ID + + I +     C  + +  LNLS S F++     E+  +   F+CS    +
Sbjct  80    LNVKNIDYKHQTIELFDPQSCLYKHIHNLNLSESHFNYVKYDYEDFVDHHFFNCSL---L  136

Query  1567  TAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVF-S  1391
                 IN   + CL+     IY   SS  +     L  CTKMF+VS +  S +  N  F  
Sbjct  137   NRDDINSYLVPCLSTSTSQIYVILSSESI-DYLPLSFCTKMFNVSLISISRSVPNQKFLR  195

Query  1390  LRWTGPSCR----------LKNNSTAEDAD-DCIAPLTK---------------------  1307
             L W+ P+C+           KN ++  + + DC A   K                     
Sbjct  196   LMWSEPNCKHCESKGNRCGWKNTTSTTNKEVDCFAKNHKGSILGSMFFILLTAAVYHIYD  255

Query  1306  --LHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPA  1133
               +  G    L   G +LGS   V++    Y +Y    + K +Q  IE+FLEDY+ALKP 
Sbjct  256   SYILKGSSTALVNTGSILGSLFFVLLTGAVYHVYDSYILNKAKQAIIEKFLEDYRALKPT  315

Query  1132  RYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMST  953
             RYSY +IK+IT+ FS+KLG+G+YGTVY+G +S ++ VAVK+LN S+G+G  ++F+NE+ T
Sbjct  316   RYSYVEIKRITNNFSDKLGQGAYGTVYRGSISKEIIVAVKILNFSQGNG--QDFLNEVGT  373

Query  952   IGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGI  776
             IG  HH+N+VRLVG+CADGF RAL+YE+L N SL+KF+ SP N KNFLGW+KL +IALGI
Sbjct  374   IGRTHHVNIVRLVGFCADGFKRALIYEFLPNGSLQKFINSPENKKNFLGWKKLHEIALGI  433

Query  775   AKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTM  596
             AKGVEYLHQGCDQRILHFDIKP+N+LLD NF PKISDFG AKLCS+++S+VSMTAARGT+
Sbjct  434   AKGVEYLHQGCDQRILHFDIKPQNVLLDHNFIPKISDFGLAKLCSRDQSVVSMTAARGTL  493

Query  595   GYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQD--YFPEWIYNI  422
             GYIAPEVFSRNFGNVSYKSDVYS+GM+LLE +GGKK   IT   E N    Y+PEWIY +
Sbjct  494   GYIAPEVFSRNFGNVSYKSDVYSYGMMLLETIGGKK---ITEDLEENSSHVYYPEWIYKL  550

Query  421   LSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPN  245
             +   EE+ I ++   D K+A+K+ IVGLWCIQW+ +DRP++++V+QMLE + +   +PPN
Sbjct  551   IDDEEEMRIHVDDEGDEKVARKMAIVGLWCIQWHAMDRPTMQMVVQMLEGDVDKTPIPPN  610

Query  244   PFTST--DPSKAKANKPGRLFTSALEIISEMD  155
             PF S    P +       R  T  L++I E++
Sbjct  611   PFASQSRQPRRNGGVAITRQLTQELDVIQELE  642



>gb|EYU37097.1| hypothetical protein MIMGU_mgv1a021978mg [Erythranthe guttata]
Length=553

 Score =   523 bits (1346),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 286/564 (51%), Positives = 371/564 (66%), Gaps = 47/564 (8%)
 Frame = -2

Query  1930  DRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             + ++C+P +C N+GP I FPFR  + QP  CG PGF+L C  K            N  L 
Sbjct  20    NNDDCMPIRCRNDGPIIRFPFRHTNRQPQHCGCPGFDLFCDHKN-----------NTVLV  68

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCSTH  1577
              PF V  +++ I+   + + +   + CF Q LP LN  ASPF F  ++L ++++F+C+  
Sbjct  69    LPFSVNVIVKKINYISQRVFVFDQENCFPQKLPHLNFPASPFRFLTKSLDDYTLFNCTNP  128

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
                  G +    I CL    +  YA DS L + S   L SCTK +   SVP+ I  +N  
Sbjct  129   SRRDLGIV----IPCLGDSTYQFYAVDSKLSMESLP-LTSCTKTYEFKSVPWKIFHEND-  182

Query  1396  FSLRWTGPSCRL----------KNNSTAEDADDCIAPL-TKLHTGPLRKLKVAGEVLGSF  1250
             F L W+ P+C +           N++T++    C+  L T  H G            GS 
Sbjct  183   FYLEWSEPACSVCEDQGKRCSSYNSTTSDRHIQCLDQLPTTNHHG-----------FGSV  231

Query  1249  LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEG  1070
             LV +I+     +Y   K  +E +  I +FL DYKALKP+R+SY+DIK+IT +FSEKLGEG
Sbjct  232   LVAIILAAFVYLYIRVKTYRENRTMIGKFLRDYKALKPSRFSYSDIKRITHQFSEKLGEG  291

Query  1069  SYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFH  890
              YG VYKGKL+ ++ VAVKVLNNS  +G+GEEFVNE+STIG IHH+N+VRL+G+CADGF 
Sbjct  292   GYGIVYKGKLNNEIVVAVKVLNNS--NGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFR  349

Query  889   RALVYEYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIK  713
             RALVYE+L N SLEK +F   +++  L WEKL+ IALGIAKG+EYLH+GCDQ+ILHFDIK
Sbjct  350   RALVYEFLPNGSLEKSIFQAGSNRITLDWEKLKDIALGIAKGIEYLHEGCDQQILHFDIK  409

Query  712   PRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDV  533
             P+N+LLD N  PKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDV
Sbjct  410   PQNVLLDHNLYPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDV  469

Query  532   YSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYN-ILSRGEEVEIQIEKGEDSKIAKK  356
             YSFGMLLLEMVGG+K +D      T+Q YFP+WIYN I +    +  QI++  +S IA+K
Sbjct  470   YSFGMLLLEMVGGRKNAD-HNVNNTSQVYFPQWIYNHINAEDNPMWAQIDEQGNS-IARK  527

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQ  284
             L+IVGLWCIQW   DRPS+K V+Q
Sbjct  528   LSIVGLWCIQWCLTDRPSMKAVVQ  551



>ref|XP_010942306.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Elaeis 
guineensis]
Length=634

 Score =   525 bits (1352),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 303/622 (49%), Positives = 384/622 (62%), Gaps = 52/622 (8%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             +++C   +C  +GPEI FPFR +   P  CGYPGFEL C    ET ++ P          
Sbjct  22    KDDCPSSRCSLDGPEIRFPFR-RSDYPEHCGYPGFELACRGN-ETVIKLPS-------SG  72

Query  1747  PFPVKFLIESIDCEDRLIIISRVDG--CFLQLLPILNLSASPFSFENL------YNFSIF  1592
              FP+ F+       D    I R++   C   ++  L++S SPF + +        N+++ 
Sbjct  73    DFPIAFI-------DYATQIIRLESKLCPASIVWNLDVSNSPFHYYDFDMADEHENYTLL  125

Query  1591  SCSTHRNITAGSI---NIS---PIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSS  1430
             +CST  ++ A      NI     I CL    + I A  S   L       +  K   V+S
Sbjct  126   NCSTANSVAATDTPNYNIGYYEEIQCLGASDNQIIAMPSYRDLADVPKYCTPIKTIRVTS  185

Query  1429  VPYSIAQDNTVFSLRWTGPSCR---------LKNNSTAEDADDCIAPLTKL----HTGPL  1289
               +S+ ++     L W  P C            +NST+ +      P   L    H G  
Sbjct  186   QLFSMLEEYDFILLTWESPRCADCEIEGGTCQPHNSTSHEIMCSYQPQRNLPPDHHGGGC  245

Query  1288  RKLKVAGEVLGSFLVVVIVLVTYRIYRL----NKMKKEEQVKIERFLEDYKALKPARYSY  1121
              K  + G +LG+ +++V   +  ++        K +KE Q+K+E+FLEDYKALKP RYSY
Sbjct  246   EKCLILGAILGTLVLLVTTAIAIKVRHSWLLKRKKEKENQLKVEKFLEDYKALKPMRYSY  305

Query  1120  ADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSI  941
             ADIKK+T++F  KLGEG YG+V+KG L   V +AVK+L  S G  +GE+FVNE+ TIG I
Sbjct  306   ADIKKMTNQFKTKLGEGGYGSVFKGFLPNGVPIAVKILVRSMG-SNGEDFVNEVCTIGRI  364

Query  940   HHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGV  764
             HHINVVRL+G+CADGF RAL+YE++ N SL KF+FS + +N  LGW+KL  IA+GIA+G+
Sbjct  365   HHINVVRLLGFCADGFKRALIYEFMPNESLAKFIFSVDGRNTVLGWDKLHNIAIGIARGI  424

Query  763   EYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIA  584
             EYLHQGCDQRILHFDIKP NILLD NF PKISDFG AKLCSKEKSIVSMT ARGT GYIA
Sbjct  425   EYLHQGCDQRILHFDIKPHNILLDNNFCPKISDFGLAKLCSKEKSIVSMTGARGTAGYIA  484

Query  583   PEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEE  404
             PEV SRNFGNVSYKSDVYSFGMLLLEMVGG+K  D T    T+Q YFPEWIYN LS+ EE
Sbjct  485   PEVCSRNFGNVSYKSDVYSFGMLLLEMVGGRKNMDAT-VENTSQVYFPEWIYNRLSQ-EE  542

Query  403   VEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTD  227
             + + I + +D+ IA+KLTIV LWCIQWYPVDRPS+  V+QMLE   E   MPPNPFTS  
Sbjct  543   LGLHIIEEKDASIARKLTIVALWCIQWYPVDRPSMTSVVQMLEGSMENLVMPPNPFTSAG  602

Query  226   PSKAKANKPGRLFTSALEIISE  161
             P         R   + L  I E
Sbjct  603   PPNTSVALFDRRVNTNLTTIPE  624



>ref|XP_009796757.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nicotiana sylvestris]
Length=603

 Score =   523 bits (1346),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 295/578 (51%), Positives = 375/578 (65%), Gaps = 41/578 (7%)
 Frame = -2

Query  1921  ECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPF  1742
             +C   +CG++GP + FPFRL+H QP  CGYPGFEL C  K +T L     L N+      
Sbjct  26    DCKESRCGSDGPSLHFPFRLQH-QPEYCGYPGFELFCDSKNKTIL----TLSNS------  74

Query  1741  PVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENL----YNFSIFSCSTHR  1574
              V+  +E ID   + I +   + C +  L  LNLS SPF   +      ++S+F CS   
Sbjct  75    -VRLSVEEIDYMFQQIRLYDPERCLILKLVHLNLSTSPFFLTDEPYSPADYSVFKCS---  130

Query  1573  NITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVF  1394
              ITAG     P A   K    IY++ S   L  AT    C K+  + SVPYS+   N   
Sbjct  131   GITAGYWGQQPCAS-DKAIVGIYSSWSLDELPPAT----CKKILEIPSVPYSMG--NNYL  183

Query  1393  SLRWTGPSCRLK---------NNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVV  1241
              LRW+ P C             N T +    C+        G L +  +AG VLG  L+ 
Sbjct  184   QLRWSNPKCSYCEGLGKDCGFKNYTKQLRTQCLDRPYTTKAGKLEEPLIAGGVLGLILLG  243

Query  1240  VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYG  1061
             +I+L  Y  Y  +K+++E Q ++E+FLEDY+AL+P RY+YAD+KK+T+ F E+LGEG+YG
Sbjct  244   IIMLALYEFYSSSKIERENQARVEKFLEDYRALRPTRYTYADLKKVTNLFQERLGEGAYG  303

Query  1060  TVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRAL  881
              VYKG LS ++ VAVKVLN+S G+G  EEF+NE++ +G IHH NVVRLVGYCADGF  AL
Sbjct  304   VVYKGTLSNEIHVAVKVLNDSIGNG--EEFINEVAAMGKIHHFNVVRLVGYCADGFRNAL  361

Query  880   VYEYLVNNSLEKFVF--SPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPR  707
             VYEYL N +L+K +F  S  D+  L W+KLQ IA+GI KG+EYLHQGCDQ+ILHFDIKP+
Sbjct  362   VYEYLPNQTLDKLIFPASSKDRIILNWKKLQDIAMGIGKGLEYLHQGCDQQILHFDIKPQ  421

Query  706   NILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYS  527
             NILLD N NPKISDFG AKLCSKEKS+V+MT ARGTMGYIAPEV S NFG  S+KSDVYS
Sbjct  422   NILLDHNLNPKISDFGLAKLCSKEKSVVTMTEARGTMGYIAPEVLSSNFGKASHKSDVYS  481

Query  526   FGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTI  347
             FGM+L EMVGG+K  D   S   +Q  FPEWI+  L+ GEE++I+IE+ +D  I +KL I
Sbjct  482   FGMMLHEMVGGRKNFDAKAS--NSQVNFPEWIHQQLNEGEELKIRIEEDDDIIIVRKLAI  539

Query  346   VGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTS  233
             +GLWCIQW   DRPSIKVV QMLE +      P PFT+
Sbjct  540   IGLWCIQWNATDRPSIKVVTQMLEGDGSNLTIPPPFTA  577



>gb|AES59899.2| receptor-like kinase [Medicago truncatula]
Length=1120

 Score =   539 bits (1389),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 295/605 (49%), Positives = 392/605 (65%), Gaps = 60/605 (10%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CGN    I FPFR+K+ Q P CGY GFEL CT   ET +E            P  VK  +
Sbjct  33    CGNQ--VIKFPFRIKNRQSPMCGYSGFELFCTSNNETIIE-----------LPHKVKLNV  79

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF-----ENLYNFSIFSCSTHRNITAG  1559
             ++ID + + I +S    C  + +  LNLS S F++     ++  ++   +CS    +   
Sbjct  80    KNIDYKHQTIQLSDPQSCLYKHIHNLNLSESHFNYLKHDYDDFVDYHFINCSL---LIRD  136

Query  1558  SINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWT  1379
              I+   + CL+      YA  SS  +  +  L  CTKMF+VS+        N++  L W+
Sbjct  137   DIDSYLVPCLSTSTSQTYAI-SSFTVIDSFPLSLCTKMFNVSTNVIDFLDKNSL-RLMWS  194

Query  1378  GPSCR----------LKN---NSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVV  1238
              PSC+           KN   NST ++ D C          P +K    G +LGS   ++
Sbjct  195   EPSCKHCESKGKICGWKNTVGNSTNKEVD-CF---------PKKK---KGSILGSLFFIL  241

Query  1237  IVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGT  1058
             ++   Y IY    +KKE+Q  +E+FLEDY+ LKP RYSY +IK+IT+ F + LG+G+YGT
Sbjct  242   LIGGIYHIYDSYILKKEKQAIVEKFLEDYRVLKPTRYSYVEIKRITNNFGDMLGQGAYGT  301

Query  1057  VYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALV  878
             VYKG +S +  VAVK+LN S+G+G  ++F+NE+ T+  IHH+N+VRLVG+CADGF RAL+
Sbjct  302   VYKGSISKEFSVAVKILNVSQGNG--QDFLNEVGTMSRIHHVNIVRLVGFCADGFKRALI  359

Query  877   YEYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNI  701
             YEYL N SL+KF+ SP N KNFLGW+KL +IALGIAKG+EYLHQGCDQRILHFDIKP+N+
Sbjct  360   YEYLPNGSLQKFINSPDNKKNFLGWKKLHEIALGIAKGIEYLHQGCDQRILHFDIKPQNV  419

Query  700   LLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFG  521
             LLD NF PKISDFG AKLCS+++SIVSMTAARGT+GYIAPEVFSRNFGNVSYKSDVYS+G
Sbjct  420   LLDHNFIPKISDFGLAKLCSRDQSIVSMTAARGTLGYIAPEVFSRNFGNVSYKSDVYSYG  479

Query  520   MLLLEMVGGKKKSDITGSPETNQD--YFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTI  347
             M+LLE +GG+K   IT   E N    Y+PEWIYN++   EE++I I+   D KIA+K+ I
Sbjct  480   MMLLETIGGRK---ITEDLEENSSHVYYPEWIYNLIDDEEEMKIHIDDEGDEKIARKMAI  536

Query  346   VGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPF--TSTDPSKAKANKPGRLFTSAL  176
             VGLWCIQW+ +DRPS+++V+QMLE   +   +PPNPF   S  P +  A    R  T  L
Sbjct  537   VGLWCIQWHAMDRPSMQMVVQMLEENIDKTPIPPNPFDSQSRQPRRTDATATTRQVTHNL  596

Query  175   EIISE  161
             ++ S 
Sbjct  597   DVNSH  601


 Score =   239 bits (611),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 146/371 (39%), Positives = 198/371 (53%), Gaps = 80/371 (22%)
 Frame = -2

Query  1303  HTGPLRKLKVAGEVLGSFLV----VVIVL----VTYRIYRLNKMKKEEQVKIERFLEDYK  1148
             H  P+  L  + +V  S L+    V+ VL    + + IY+           IE FL    
Sbjct  601   HRSPVCSLFPSKKVCSSLLIFLDAVIFVLGASFIGFLIYKTRPKHLSMYNGIESFLRRDN  660

Query  1147  ALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFV  968
             ++ P RY + DI KIT     KLG G YG +                    G       +
Sbjct  661   SIMPIRYFFKDINKIT-----KLGSGGYGKII-------------------GQNQVRRSI  696

Query  967   NEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSP-NDKNFLGWEKLQQ  791
             NE++TIG IHH+NVV+L+G+  +G   AL+YE++ N  LEK++FS   + N+LG      
Sbjct  697   NEIATIGRIHHLNVVQLIGFYVEGSKHALIYEFMPNGLLEKYIFSHIEESNYLG------  750

Query  790   IALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTA  611
                     +EYLH GC+ +ILHFDIKP NILLD+NFNPK+SDFG A+LC    SIVS+TA
Sbjct  751   --------IEYLHNGCNMKILHFDIKPHNILLDENFNPKVSDFGLARLCPTGNSIVSLTA  802

Query  610   ARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWI  431
             AR T+GY+APE+F RN G +SYK+DVYSFGMLL+E+          GS            
Sbjct  803   ARRTIGYMAPELFYRNVGTISYKADVYSFGMLLMEI----------GS------------  840

Query  430   YNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMP  251
                      + I+ +  ++ K+AKK+    LWCIQ  P DRPS+  V++MLE E+     
Sbjct  841   ---------ISIENDTDQEMKLAKKMMTAALWCIQTKPEDRPSMDKVLEMLEEEDGDLQI  891

Query  250   PNP--FTSTDP  224
             PN   F   DP
Sbjct  892   PNKPYFCPQDP  902



>gb|EYU32415.1| hypothetical protein MIMGU_mgv1a021939mg [Erythranthe guttata]
Length=581

 Score =   521 bits (1342),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 285/576 (49%), Positives = 374/576 (65%), Gaps = 40/576 (7%)
 Frame = -2

Query  1921  ECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPF  1742
             +C P +C  + P I FPFR +  QP  CGYPGF+L C  K +T            L  PF
Sbjct  25    DCTPIRCSKHSPIIRFPFRHQTQQPQHCGYPGFDLNCDHKNDT-----------ILVLPF  73

Query  1741  PVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN------LYNFSIFSCST  1580
              V  +++ I+   + I++   + C  Q LP LNLS S F+F        + + +I++CS 
Sbjct  74    SVNVVVKEINYASQTILVYDPENCLPQKLPHLNLSTSSFNFHIKHDDYLMSDAAIYTCSD  133

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSV-PYSIAQDN  1403
                  A       + CL  P +  Y  ++        +L SCTK+  +  V P+SI   N
Sbjct  134   -----ADKSLYRFVPCLIDPINKYYIFNN------IQELTSCTKIHDIPRVIPWSITDKN  182

Query  1402  TVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVT  1223
               F L W+ P+C    +  A+     +   T+L +  +  + +     G FL V+I++  
Sbjct  183   G-FRLGWSEPTC---GHCEAQGKRCSLYNSTRLDS--IHCIDIIHHGFGCFLAVIILVAL  236

Query  1222  YRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGK  1043
             +  Y   +  +E Q+KIE+FL+DY+ALKP+R+SY+DI +IT +F +KLGEG YG VYKGK
Sbjct  237   FYQYIRFRTGRENQIKIEKFLQDYRALKPSRFSYSDITRITHQFRDKLGEGCYGVVYKGK  296

Query  1042  LSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLV  863
             L+ ++ VAVKVLNNSKG+G  EEFVNE+STIG IHH+N+VRLVG+CADGF RALVYE+L 
Sbjct  297   LNNEIDVAVKVLNNSKGNG--EEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEFLP  354

Query  862   NNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQN  686
             N+SLEK +F    K   L WE L+ IALGIA+G+EYLH+GCDQ+ILHFDIKP+N+LLD N
Sbjct  355   NDSLEKIIFQAGSKKISLDWETLKDIALGIARGIEYLHEGCDQQILHFDIKPQNVLLDHN  414

Query  685   FNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLE  506
             FNPKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG  S KSDVYSFGMLLLE
Sbjct  415   FNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRGSCKSDVYSFGMLLLE  474

Query  505   MVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQ  326
             MVGG+K  D   +  T+  YFP+WIYN ++  +    +    E S IA+KL+IVGLWCIQ
Sbjct  475   MVGGRKNEDRIVN-NTSPVYFPQWIYNHINAEDNSMWEQIDEEGSIIARKLSIVGLWCIQ  533

Query  325   WYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPS  221
             WYP DRPS+KVV+QMLE +    +MP NPF +T  S
Sbjct  534   WYPTDRPSMKVVVQMLEGDNGDLTMPSNPFPATTNS  569



>ref|XP_009335043.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At5g24080 [Pyrus x bretschneideri]
 ref|XP_009335046.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At5g24080 [Pyrus x bretschneideri]
Length=780

 Score =   528 bits (1359),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 291/586 (50%), Positives = 385/586 (66%), Gaps = 46/586 (8%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             C ++GP I FPFRLK  QP + GY GF+L CT+  +T LE           P    K ++
Sbjct  211   CEHHGPAIRFPFRLKG-QPFQSGYHGFDLSCTNGRQTVLE----------MPSSSNKLIV  259

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF---ENLYNFSIFSCSTHRNITAGS-  1556
             E+I+   + I +   + C  + +   NLS+S F F    +  N+++FSC +    T    
Sbjct  260   ETINYASQEIGVYFQNDCPPKDIFNFNLSSSIFQFVHGPSDANYTLFSCPSPLRKTGRYC  319

Query  1555  -INISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVP-YSIAQDNTVFSLRW  1382
              I + P           Y A          +L+SCTK+   +SVP  S  + +    L+W
Sbjct  320   FIKLCPSGLDNPENQTNYYAVDGRCSIDDMNLVSCTKLRDYTSVPDISSVRASGPMMLQW  379

Query  1381  TGPSC-------------------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL  1259
             + PSC                      +N TAE   +C++  +   T     L+++G   
Sbjct  380   SKPSCGRCEEMGKTCILKRTIGQYNFTDNQTAET--ECVSEDS---TRGRTSLEISGIFT  434

Query  1258  GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
              S +V V+  + YR+Y  NK++K  Q++IERFL+DY A KP+RYSYADIK+IT++F+EKL
Sbjct  435   LSVVVTVVGTLIYRVYSSNKIEKTNQLRIERFLDDYIAHKPSRYSYADIKRITNQFNEKL  494

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             G+G+YGTVYKG+LS D+ VAVK+LNNS  +  GE+ +NE+ T+G +HH+NVVRLVG+CAD
Sbjct  495   GQGAYGTVYKGQLSSDLLVAVKILNNS--NEKGEDLINEVGTMGRVHHVNVVRLVGFCAD  552

Query  898   GFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
             G+  ALVYEYL N SL+  + S + K+ FLGW+KL +IALGIAKG+EYLHQGCD RILHF
Sbjct  553   GYTTALVYEYLPNGSLQNILSSADGKSAFLGWDKLHEIALGIAKGIEYLHQGCDLRILHF  612

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DIKP NIL+DQNF PK+SDFG AKLCSK++S VSMT  RGT+GYIAPEVFSRNFGNVSYK
Sbjct  613   DIKPHNILIDQNFTPKVSDFGLAKLCSKDQSAVSMTTIRGTIGYIAPEVFSRNFGNVSYK  672

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETN-QDYFPEWIYNILSRGEEVEIQIEKGEDSKI  365
             SDVYSFGMLLLEMVGG+K         T+ Q YFPEWIYN+L +G+++ I IE G D++ 
Sbjct  673   SDVYSFGMLLLEMVGGRKNFKFMEEDSTSGQVYFPEWIYNLLEQGDDLRIHIEDGGDAET  732

Query  364   AKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
             AKKL IVGLWC+QW+P+DRP +KVVIQMLE E +  ++P NPF ST
Sbjct  733   AKKLAIVGLWCVQWHPIDRPPMKVVIQMLEGEGDNLTVPANPFRST  778



>ref|XP_010317309.1| PREDICTED: uncharacterized protein LOC101250956 [Solanum lycopersicum]
Length=1134

 Score =   538 bits (1387),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 305/606 (50%), Positives = 384/606 (63%), Gaps = 52/606 (9%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGY-PGFELLCTDKGETALENPFPLLNATLQPPF  1742
             C    C ++GP + FPFRL H QP  CGY PGFEL C  KG+T LE            P 
Sbjct  557   CEDSWCKSDGPNVHFPFRLSH-QPKHCGYDPGFELHCNTKGDTILE-----------LPS  604

Query  1741  PVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRNITA  1562
              V F +E+ID   + I +   D C    LP LNLS S F+ ++     +F+CS       
Sbjct  605   SVHFGVENIDYVSQQIHLYDPDQCIAAKLPKLNLSQSNFTNDDDLTV-LFNCS---EPFP  660

Query  1561  GSINISPIACLTKPGHFIYAADSSLYLYSATDLI---SCTKMFHVSSVPYSIAQ-DNTVF  1394
              S +   + CL   G+ ++A  S+  L    DL+    CTK   +   PYS +     + 
Sbjct  661   ESNDGYLVPCLASSGYQVHAVTSTFDL----DLLLSGPCTK---IHQYPYSDSTFGENML  713

Query  1393  SLRWTGPSCRLKNNSTAEDADDCIAPLTKL------------HTGPLRKLK-VAGEVLGS  1253
              L W  P C    N   +  D      TKL             TG   K   +AG V G+
Sbjct  714   QLNWNVPLC---GNCEFKGMDCGFKDGTKLLETHCFNRKDITRTGNNTKQHLIAGVVSGA  770

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
              LV +IV   Y++Y  ++ K+E +V++E+FL+DYKA++P RYSYADIKK+TD F+EKLGE
Sbjct  771   ALVCIIVFSLYKLYLTSRNKRESRVRLEKFLDDYKAIRPTRYSYADIKKVTDDFNEKLGE  830

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             GSYGTVYKGKLS D++VAVKVL +SKG G  EEF+NE+ TIG IHH+NVVRLVG+CADGF
Sbjct  831   GSYGTVYKGKLSSDIYVAVKVLRDSKGKG--EEFINEIDTIGRIHHVNVVRLVGFCADGF  888

Query  892   HRALVYEYLVNNSLEKFVFSPNDKN----FLGWEKLQQIALGIAKGVEYLHQGCDQRILH  725
              RAL+YEYL N+SLE+F+   +        + W KL  IALG A+G+EYLHQGCDQ+ILH
Sbjct  889   RRALIYEYLPNDSLERFILPVSSSPGSVSLISWHKLHHIALGTARGIEYLHQGCDQQILH  948

Query  724   FDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSY  545
             FDIKP+NILLD N NPKI DFG AKLCSKEKS V+MTAARGT+GYIAPEV SRNFG VS+
Sbjct  949   FDIKPQNILLDHNLNPKICDFGLAKLCSKEKSAVTMTAARGTIGYIAPEVLSRNFGKVSH  1008

Query  544   KSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKI  365
             KSD+YSFGMLLLEMVGG+   D   +  +  +   EWIY  L +GEE++IQIE+  D +I
Sbjct  1009  KSDIYSFGMLLLEMVGGRINMDAKTNNHSKVNSL-EWIYRHLEKGEELKIQIEEEGDGRI  1067

Query  364   AKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPSKAKANKPGRLF  188
              +KL IVGLWCIQW+P+DRPSIK V QMLE +    ++ PNPF +TD  K  A+  G   
Sbjct  1068  VRKLAIVGLWCIQWHPIDRPSIKEVTQMLEGDGSHLNLSPNPFMATDKPKLNASSHGEDL  1127

Query  187   TSALEI  170
                LEI
Sbjct  1128  DVILEI  1133


 Score =   458 bits (1179),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 226/373 (61%), Positives = 283/373 (76%), Gaps = 8/373 (2%)
 Frame = -2

Query  1273  AGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDR  1094
              G VLG+ LV +I  + Y +Y  ++ K+E +V++E+FLEDYKA++P RY+YADIKKITD 
Sbjct  13    VGVVLGTALVCIIAFLRYTLYLTSRNKRESRVRLEKFLEDYKAIRPTRYTYADIKKITDD  72

Query  1093  FSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLV  914
             F+EKLGEGSYGTVYKG+LS +++VAVKVL +SKG G  EE++NE+ TIG IHH+NVV L+
Sbjct  73    FNEKLGEGSYGTVYKGRLSSEIYVAVKVLRDSKGKG--EEYINEIGTIGRIHHVNVVLLL  130

Query  913   GYCADGFHRALVYEYLVNNSLEKFVF----SPNDKNFLGWEKLQQIALGIAKGVEYLHQG  746
             G+CADGF RAL+YEYL N+SLE+F+     S    + + W KLQ IALG A+G+EYLHQG
Sbjct  131   GFCADGFRRALIYEYLPNDSLERFILPVSSSTGSVSVISWNKLQHIALGTARGIEYLHQG  190

Query  745   CDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSR  566
             CDQ+ILHFDIKP+NILLD N NPKI DFG AKLCSKEKS ++MTAARGT+GYIAPEV SR
Sbjct  191   CDQQILHFDIKPQNILLDHNLNPKICDFGLAKLCSKEKSAITMTAARGTIGYIAPEVLSR  250

Query  565   NFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIE  386
             NF  VS+KSD+YSFGMLLLEMVGG+   D   +     +   EWIY  L +GEE +I+IE
Sbjct  251   NFCKVSHKSDIYSFGMLLLEMVGGRINMDAKTNNHCKVNSL-EWIYRHLEKGEESKIRIE  309

Query  385   KGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPSKAKA  209
             +  D+ I +K+ IVGLWCIQW+PVDRPSIK V QMLE +    ++ PNPF +TD  K  A
Sbjct  310   EEGDATIVRKIAIVGLWCIQWHPVDRPSIKEVTQMLEGDGSHLNLSPNPFMATDKPKLNA  369

Query  208   NKPGRLFTSALEI  170
             +  G      LEI
Sbjct  370   SPHGEDLDVILEI  382



>ref|XP_011037049.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X3 [Populus euphratica]
Length=424

 Score =   514 bits (1324),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 249/436 (57%), Positives = 330/436 (76%), Gaps = 17/436 (4%)
 Frame = -2

Query  1447  MFHVSSVPYSIAQD-NTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLR-KLKV  1274
             M+++  +PYS+ Q+ N V ++ W+ P+C            +C + L   HT  +R KL +
Sbjct  1     MYNIYGIPYSMMQEENYVLTMSWSNPTC-------GSSETECYSSLP--HTKDVRRKLLI  51

Query  1273  AGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDR  1094
              G +LG FL  + +   YR    +K ++E Q ++E FL++Y++L P RYSYAD+K+IT++
Sbjct  52    TGVILGFFLFAIAITALYRTCSNDKTQREYQARVEMFLDNYRSLNPTRYSYADLKRITNQ  111

Query  1093  FSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLV  914
             FS++LG+G+YGTV+KGKL+ ++ VAVK+L+NS G G  EEF+NE+ T+ SIHH+NVVRL+
Sbjct  112   FSDELGQGAYGTVFKGKLTNEITVAVKLLSNSIGKG--EEFINEVGTMASIHHVNVVRLI  169

Query  913   GYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQ  737
             G+CADGF RALVYEYL N+SL+KF+ S + +N FLGWE+L ++ALGIAKG+EYLHQGCDQ
Sbjct  170   GFCADGFRRALVYEYLPNDSLQKFISSADSRNHFLGWERLNRVALGIAKGIEYLHQGCDQ  229

Query  736   RILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFG  557
             RILHFDIKP+NILLD  FNPKI+DFG AKLCSK+KS +SMT ARGT+GYIAPEVFSRNFG
Sbjct  230   RILHFDIKPQNILLDNEFNPKIADFGMAKLCSKDKSAISMTTARGTVGYIAPEVFSRNFG  289

Query  556   NVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGE  377
             NVSYKSDVYSFGML+LEMVGG+K  D T +   +Q YFPEWIYN+L + E++   I+  E
Sbjct  290   NVSYKSDVYSFGMLVLEMVGGRKNVDDT-AENGDQIYFPEWIYNLLEKEEDLRFHIDGEE  348

Query  376   DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANK-  203
             D+KIAKKL IVGLWCIQW P +RPS+K V+QMLE E E  + PP+PF+S+ P +  A + 
Sbjct  349   DAKIAKKLAIVGLWCIQWNPAERPSMKTVVQMLEGEGENLTKPPDPFSSSVPKRTSAGRM  408

Query  202   PGRLFTSALEIISEMD  155
             P R     L  ISE++
Sbjct  409   PARRLHQELAAISEIE  424



>ref|XP_011037048.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X2 [Populus euphratica]
Length=426

 Score =   513 bits (1321),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/438 (57%), Positives = 330/438 (75%), Gaps = 19/438 (4%)
 Frame = -2

Query  1447  MFHVSSVPYSIAQD-NTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPL---RKL  1280
             M+++  +PYS+ Q+ N V ++ W+ P+C            +C + L   HT  +   RKL
Sbjct  1     MYNIYGIPYSMMQEENYVLTMSWSNPTC-------GSSETECYSSLP--HTKGIDVRRKL  51

Query  1279  KVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKIT  1100
              + G +LG FL  + +   YR    +K ++E Q ++E FL++Y++L P RYSYAD+K+IT
Sbjct  52    LITGVILGFFLFAIAITALYRTCSNDKTQREYQARVEMFLDNYRSLNPTRYSYADLKRIT  111

Query  1099  DRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVR  920
             ++FS++LG+G+YGTV+KGKL+ ++ VAVK+L+NS G G  EEF+NE+ T+ SIHH+NVVR
Sbjct  112   NQFSDELGQGAYGTVFKGKLTNEITVAVKLLSNSIGKG--EEFINEVGTMASIHHVNVVR  169

Query  919   LVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGC  743
             L+G+CADGF RALVYEYL N+SL+KF+ S + +N FLGWE+L ++ALGIAKG+EYLHQGC
Sbjct  170   LIGFCADGFRRALVYEYLPNDSLQKFISSADSRNHFLGWERLNRVALGIAKGIEYLHQGC  229

Query  742   DQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRN  563
             DQRILHFDIKP+NILLD  FNPKI+DFG AKLCSK+KS +SMT ARGT+GYIAPEVFSRN
Sbjct  230   DQRILHFDIKPQNILLDNEFNPKIADFGMAKLCSKDKSAISMTTARGTVGYIAPEVFSRN  289

Query  562   FGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEK  383
             FGNVSYKSDVYSFGML+LEMVGG+K  D T +   +Q YFPEWIYN+L + E++   I+ 
Sbjct  290   FGNVSYKSDVYSFGMLVLEMVGGRKNVDDT-AENGDQIYFPEWIYNLLEKEEDLRFHIDG  348

Query  382   GEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKAN  206
              ED+KIAKKL IVGLWCIQW P +RPS+K V+QMLE E E  + PP+PF+S+ P +  A 
Sbjct  349   EEDAKIAKKLAIVGLWCIQWNPAERPSMKTVVQMLEGEGENLTKPPDPFSSSVPKRTSAG  408

Query  205   K-PGRLFTSALEIISEMD  155
             + P R     L  ISE++
Sbjct  409   RMPARRLHQELAAISEIE  426



>ref|XP_011037047.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X1 [Populus euphratica]
Length=430

 Score =   513 bits (1320),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 249/438 (57%), Positives = 330/438 (75%), Gaps = 15/438 (3%)
 Frame = -2

Query  1447  MFHVSSVPYSIAQD-NTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTK---LHTGPLRKL  1280
             M+++  +PYS+ Q+ N V ++ W+ P+C      ++E       P TK    +    RKL
Sbjct  1     MYNIYGIPYSMMQEENYVLTMSWSNPTC-----GSSETECYSSLPHTKGMHFYLDVRRKL  55

Query  1279  KVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKIT  1100
              + G +LG FL  + +   YR    +K ++E Q ++E FL++Y++L P RYSYAD+K+IT
Sbjct  56    LITGVILGFFLFAIAITALYRTCSNDKTQREYQARVEMFLDNYRSLNPTRYSYADLKRIT  115

Query  1099  DRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVR  920
             ++FS++LG+G+YGTV+KGKL+ ++ VAVK+L+NS G G  EEF+NE+ T+ SIHH+NVVR
Sbjct  116   NQFSDELGQGAYGTVFKGKLTNEITVAVKLLSNSIGKG--EEFINEVGTMASIHHVNVVR  173

Query  919   LVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGC  743
             L+G+CADGF RALVYEYL N+SL+KF+ S + +N FLGWE+L ++ALGIAKG+EYLHQGC
Sbjct  174   LIGFCADGFRRALVYEYLPNDSLQKFISSADSRNHFLGWERLNRVALGIAKGIEYLHQGC  233

Query  742   DQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRN  563
             DQRILHFDIKP+NILLD  FNPKI+DFG AKLCSK+KS +SMT ARGT+GYIAPEVFSRN
Sbjct  234   DQRILHFDIKPQNILLDNEFNPKIADFGMAKLCSKDKSAISMTTARGTVGYIAPEVFSRN  293

Query  562   FGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEK  383
             FGNVSYKSDVYSFGML+LEMVGG+K  D T +   +Q YFPEWIYN+L + E++   I+ 
Sbjct  294   FGNVSYKSDVYSFGMLVLEMVGGRKNVDDT-AENGDQIYFPEWIYNLLEKEEDLRFHIDG  352

Query  382   GEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKAN  206
              ED+KIAKKL IVGLWCIQW P +RPS+K V+QMLE E E  + PP+PF+S+ P +  A 
Sbjct  353   EEDAKIAKKLAIVGLWCIQWNPAERPSMKTVVQMLEGEGENLTKPPDPFSSSVPKRTSAG  412

Query  205   K-PGRLFTSALEIISEMD  155
             + P R     L  ISE++
Sbjct  413   RMPARRLHQELAAISEIE  430



>ref|XP_010315114.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Solanum lycopersicum]
Length=597

 Score =   517 bits (1332),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 286/601 (48%), Positives = 381/601 (63%), Gaps = 47/601 (8%)
 Frame = -2

Query  1921  ECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPF  1742
             +C   +CG +GP I FPFRL+H QP  CGYPGFEL C  K +T L  P  L+ +      
Sbjct  26    DCSESRCGIDGPSIHFPFRLRH-QPEYCGYPGFELSCDRKNQTILTLPNSLILS------  78

Query  1741  PVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE------NLYNFSIFSCST  1580
                  +  ID   + I +   + C +  +  LNLSASPFSF        L +FS+F CS 
Sbjct  79    -----VGEIDYMSQQISLYDPEDCLILNILHLNLSASPFSFPVHEPYFTLIDFSVFKCS-  132

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
                + A   N  P     K    I+A   +L     T   +C K+  + S+PY      +
Sbjct  133   --GMPADYQNQYPDCASDKA---IFAVSYNLETLPPT---TCKKIHEIPSIPYYTT--TS  182

Query  1399  VFSLRWTGP----------SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSF  1250
             +  L W  P           C  KN            P T    G +++  +AG V+G  
Sbjct  183   LIRLSWFTPMCIYCEGLEMDCGFKNYPKQLTTQCFDRPFTT--KGGVKEPLIAGGVIGLI  240

Query  1249  LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEG  1070
             L+ +I++  Y  Y  +K+++E Q ++E+FLEDY+  +P RY+YADI+K+T++F E LGEG
Sbjct  241   LMGIIMMALYECYSSSKIERENQARVEKFLEDYRDRRPTRYTYADIRKMTNQFQEVLGEG  300

Query  1069  SYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFH  890
             +YG VYKG LS ++ VAVKVL++S  +G+GEEF+NE++ +G IHH+NVVRLVG+CADG  
Sbjct  301   AYGIVYKGTLSNEIHVAVKVLDDS--EGNGEEFINEVAAMGKIHHVNVVRLVGFCADGVR  358

Query  889   RALVYEYLVNNSLEKFVF--SPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
             RALV+EYL N SL+K +F  S  D   L W+KL  IA+GIAKG+EYLHQGCDQ+ILHFDI
Sbjct  359   RALVFEYLPNQSLDKLIFPISIKDNITLTWKKLHDIAIGIAKGLEYLHQGCDQQILHFDI  418

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
             KP+NILLD N NPKISDFG AKLCSKEKS+V+MT ARGTMGYIAPEV S NFG  S+KSD
Sbjct  419   KPQNILLDHNLNPKISDFGLAKLCSKEKSVVTMTEARGTMGYIAPEVLSSNFGKASHKSD  478

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             VYSFGM+LLEMVGG+K  D     +T+Q  FPEWI+  L++G+E++I+IEK +D  I +K
Sbjct  479   VYSFGMMLLEMVGGRKNFD--AKADTSQMNFPEWIHEWLNQGDELKIRIEKDDDVIIVRK  536

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSAL  176
             L ++GLWCIQW  +DRPSIKVV QMLE +      P+P+T+ + ++   + P     S L
Sbjct  537   LAVIGLWCIQWNAIDRPSIKVVTQMLEGDGSNLTVPSPYTTRNTTQVGPSMPELTVISEL  596

Query  175   E  173
             E
Sbjct  597   E  597



>ref|XP_010111690.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC31504.1| putative receptor-like protein kinase [Morus notabilis]
Length=543

 Score =   515 bits (1327),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 290/598 (48%), Positives = 368/598 (62%), Gaps = 84/598 (14%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYP-GFELLCTDKGETALENPFPLLNATLQ  1751
             +N+C   +C ++GP I FPFRLK  QP  C Y   F+L CT +  T L           Q
Sbjct  23    QNDCTETRCSHHGPAIRFPFRLKGSQPQHCSYSQSFDLTCTKENRTLL-----------Q  71

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCSTH  1577
              P   KF +E ID + + I +S    C   L+   NLS+SPF +   +  + ++FSC   
Sbjct  72    LPTLAKFFVEKIDYKLQTIHVSDPGSCLTGLIQNHNLSSSPFQYTINSTMDLTVFSCEA-  130

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
              +IT          CL   GH +Y    S Y     + +SCTKM+ + S+          
Sbjct  131   EDITNQLFLTDLSPCLNTSGHRLYRV-QSWYKIRDVNHVSCTKMYEIFSI----------  179

Query  1396  FSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYR  1217
                                               P   LK   E+L S+           
Sbjct  180   ----------------------------------PYDTLKEETELLLSWSTP--------  197

Query  1216  IYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLS  1037
                 N  K+E Q   ER+   Y+A KPARYSYADIK+IT++FS++LG+G+YGTVYKG+LS
Sbjct  198   ----NCSKREAQG--ERY---YEAFKPARYSYADIKRITNQFSDELGQGAYGTVYKGRLS  248

Query  1036  GDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNN  857
              +V VAVKVL NSKG G  EEF+NE+  IG IHH+NVVR+VG+CAD F RALVYE+L N 
Sbjct  249   DEVCVAVKVLTNSKGKG--EEFINEVRIIGRIHHVNVVRVVGFCADRFRRALVYEFLPNG  306

Query  856   SLEKFVFSPNDK-NFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFN  680
             SL+KF+     K NFL W KL+ IAL IAKG+EYLHQGCDQRILHF IKP NILLD NF 
Sbjct  307   SLQKFISPMESKGNFLNWGKLKDIALDIAKGIEYLHQGCDQRILHFHIKPHNILLDHNFT  366

Query  679   PKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMV  500
             PK+SDF  AKLCSK++S+VSMTAARGTMGYIAPEVFSRNFG+VSYKS+ YSFGMLLLEMV
Sbjct  367   PKVSDFRTAKLCSKDQSVVSMTAARGTMGYIAPEVFSRNFGDVSYKSNDYSFGMLLLEMV  426

Query  499   GGKKKS-DITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQW  323
             G K+++ D++    T + Y PEWIY  L +GE +EI I++ EDSK AK+L +VGLWCIQW
Sbjct  427   GSKRENLDVSLMENTKEFYLPEWIYKHLEQGEHLEIDIKEEEDSKTAKRLAVVGLWCIQW  486

Query  322   YPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAK--ANKPGRLFTSALEIISEMD  155
              PVDRPS+ VV++MLE +E  +MPPNPF +  P++ K   N PGR     L +ISE++
Sbjct  487   QPVDRPSMNVVVKMLEGKEEINMPPNPF-AKGPAQRKNVTNMPGRFVHQELLVISELE  543



>ref|XP_004498413.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Cicer arietinum]
Length=599

 Score =   517 bits (1331),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 292/610 (48%), Positives = 396/610 (65%), Gaps = 58/610 (10%)
 Frame = -2

Query  1924  NECLPR--KCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
             N C+ R  +CG +GP I FPFRLK  +   CGYPGF+L C+   +T L+ P         
Sbjct  26    NGCIGRDLRCGRHGPPIRFPFRLKDTEYG-CGYPGFDLTCSHTNKTLLKIP--------T  76

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGC----FLQLL--PILNLSASPFSFENLYNFSIFS  1589
              P PV   + SID + +L+ +S  + C    FL+LL  PI   S +PF FE         
Sbjct  77    HPHPVILQVTSIDYKLQLLHVSDPENCLSKQFLKLLQSPI---SITPFQFE---------  124

Query  1588  CSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ  1409
              S+  N +   ++ S + C      +I  +D+ L L  + DLI CTK+  +SS  +    
Sbjct  125   -SSDHNDSFTFLHCSSLFCPV----YIEYSDNRL-LDQSFDLIHCTKILDISSSVFLREG  178

Query  1408  DNTVFSLRWTGPSCR----------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL  1259
             +N +  L+W+ P+CR          L NN T ED  +C     + H    + L +A  V 
Sbjct  179   ENDLV-LKWSKPNCRKCEIKGKMCKLNNNGT-EDEIEC---FDRHHKSTKKILLLAAVVF  233

Query  1258  -GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
              GS LV +I+  +  +Y   K+K E++ +IE+FLEDY+   PAR+SYADIK+IT+ F E 
Sbjct  234   FGSILVTLILRASLCLYTHFKLKGEDETRIEKFLEDYRTFNPARFSYADIKRITNNFREV  293

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             +GEG++G V+KGKLS ++ VAVK+LN +  D DG+EF+NE++ +G +HHINVVRL+G+CA
Sbjct  294   IGEGAHGKVFKGKLSNEICVAVKMLNINNTDNDGKEFINEVNAMGKVHHINVVRLLGFCA  353

Query  901   DGFHRALVYEYLVNNSLEKFVFSPND-KNFLGWEKLQQIALGIAKGVEYLHQGCDQRILH  725
             DG +RALVY +  N SL+ F+  P+D  +FLGW+KLQQIA+GIAKG+EYLH  CDQRILH
Sbjct  354   DGCYRALVYNFFRNGSLQNFITPPDDMDHFLGWKKLQQIAIGIAKGIEYLHMSCDQRILH  413

Query  724   FDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSY  545
             FDI P N+LLD++F PKI+DFG AKLC+K KSIVS+T   GT+GYIAPEVFSRNFGNVSY
Sbjct  414   FDINPHNVLLDEDFVPKITDFGLAKLCAKNKSIVSVTTVIGTLGYIAPEVFSRNFGNVSY  473

Query  544   KSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKI  365
             K+D+YS+GMLLLEMVGG+K      S E  Q  +PEWI+N+L  G ++++ IE   D  I
Sbjct  474   KADIYSYGMLLLEMVGGRKNIG-KLSEENFQVLYPEWIHNLL-EGRDMQVNIEGEGDDMI  531

Query  364   AKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSM--PPNPFTSTDPSKAKANKPGRL  191
              KKL IVGLWCIQW+P++RPSIK V+QMLEA++  ++  PPNPF ST  +    + P + 
Sbjct  532   LKKLAIVGLWCIQWHPINRPSIKAVLQMLEAQDEGNLTVPPNPFNST--TSRVGDIPKKY  589

Query  190   FTSALEIISE  161
              T  LE I E
Sbjct  590   STLELEAIHE  599



>ref|XP_008232096.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Prunus mume]
Length=396

 Score =   508 bits (1309),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 251/405 (62%), Positives = 305/405 (75%), Gaps = 10/405 (2%)
 Frame = -2

Query  1366  RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKE  1187
             RL NN    + + C+       T    K    G  LG  +++V+V+  Y +Y  ++ +KE
Sbjct  1     RLNNNGIKSEVE-CVHVSKASQT---TKFVATGATLGLSILLVLVIALYHVYSADRKEKE  56

Query  1186  EQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVL  1007
              ++KIERFLEDYK+LKP+RYSYADIK+IT+ F +KLG+G+YGTVYKGKLS + FVAVKVL
Sbjct  57    NRIKIERFLEDYKSLKPSRYSYADIKRITNEFKDKLGQGAYGTVYKGKLSSEFFVAVKVL  116

Query  1006  NNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPN  827
             NNS G+G  EEFVNE+ T+G IHH+NVVRLVG+CADGF RALVYE+  N SL+ F+ S +
Sbjct  117   NNSTGNG--EEFVNEVGTMGHIHHVNVVRLVGFCADGFRRALVYEFFPNGSLQDFISSAD  174

Query  826   DKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAK  650
              KN FLGWEKL  IA+GIAKG+EYLHQGCDQRILHFDIKP N+LLD NF PKISDFG AK
Sbjct  175   SKNNFLGWEKLHDIAVGIAKGIEYLHQGCDQRILHFDIKPHNVLLDHNFTPKISDFGLAK  234

Query  649   LCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITG  470
             LCSK++SIVSMT ARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGG+K    T 
Sbjct  235   LCSKDQSIVSMTTARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKSIGAT-  293

Query  469   SPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVV  290
             +  TN+ Y+PEWIYN+L   +++ I I    D KI KKL IVGL CIQW+PVDRPS+K  
Sbjct  294   TNNTNEIYYPEWIYNLLEGEDDLRIHIGDDGDGKIPKKLAIVGLRCIQWHPVDRPSMKTA  353

Query  289   IQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             + MLE  +  +MPPNPF S  P+   A+ P R     LE I+E++
Sbjct  354   VHMLEGVDNLTMPPNPFASGGPTTTHASIPARRL--ELEAIAELE  396



>ref|XP_007161512.1| hypothetical protein PHAVU_001G075500g [Phaseolus vulgaris]
 gb|ESW33506.1| hypothetical protein PHAVU_001G075500g [Phaseolus vulgaris]
Length=617

 Score =   516 bits (1330),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 292/628 (46%), Positives = 395/628 (63%), Gaps = 74/628 (12%)
 Frame = -2

Query  1936  SYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNAT  1757
             S  +NEC    CG+  P I FPF+L       C  PG  + C++  ET L +P       
Sbjct  28    SSGQNECSELSCGSEEPLIRFPFQLLQGMKDACDSPGLCVYCSENKETMLVHP-------  80

Query  1756  LQPPFPVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPFSFENLY------NFS  1598
                   VK  + +ID   +L  +   + C   + L + N +  P+   + +      N +
Sbjct  81    -----TVKLRVTNIDYRSQLTYLEDPENCLPKKFLNLYNFTIPPYELYSSHGLVRYNNLN  135

Query  1597  IFSCS----TH-RN---ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMF  1442
              F CS    TH RN   + +GS ++  I C T    ++  +D S+      DL SCTKMF
Sbjct  136   FFDCSLLGLTHLRNSDQLNSGSQDM--IYCPT----YVSNSDESIL---ELDLTSCTKMF  186

Query  1441  HVSSVPYSIAQDNTVFSLRWTGPSCR-----------LKNNSTAEDADDCIAPLTKLHTG  1295
             ++ S   +        +LRW+ PSC             KN+ T  +  DC A   K+H  
Sbjct  187   NIISQASASDLRTNRLNLRWSKPSCSECEAKGNRCKWKKNSKTDIECVDCSAKPRKIHI-  245

Query  1294  PLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYAD  1115
             P   L  A    GS  + + V+  ++I R  + K+E+Q ++++FLEDY+A KPAR++YAD
Sbjct  246   PRSVLFTAA---GSVFLGLAVIAVFKIDRHFRKKEEDQARVDKFLEDYRADKPARFTYAD  302

Query  1114  IKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHH  935
             IK+IT  F EKLGEG++G V++GKLS ++ VAVK+LNN+  +GDG++F+NE+  +G IHH
Sbjct  303   IKRITGGFKEKLGEGAHGAVFRGKLSNEILVAVKILNNT--EGDGKDFINEVGIMGKIHH  360

Query  934   INVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEY  758
             INVVRL+G+CA+G HRALVY    N SL+ F+F P+DK+ FLGWEKLQ IALGIAKG+EY
Sbjct  361   INVVRLLGFCAEGLHRALVYNLFPNGSLQSFIFPPDDKDHFLGWEKLQHIALGIAKGIEY  420

Query  757   LHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPE  578
             LHQGCD+ I+HFDI P N+LLD NF PKISDFG AKLCS+  S+VSMTAARGT+GYIAPE
Sbjct  421   LHQGCDRPIIHFDINPHNVLLDDNFTPKISDFGLAKLCSRNPSLVSMTAARGTLGYIAPE  480

Query  577   VFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDY---FPEWIYNILSRGE  407
             VFSRNFGNVSYKSD+YS+GMLLLEMVGG+K  DI+ +    QD+   +P+WI+N++    
Sbjct  481   VFSRNFGNVSYKSDIYSYGMLLLEMVGGRKNVDISSA----QDFHVLYPDWIHNLVD--G  534

Query  406   EVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP--SMPPNPFTS  233
             ++ + +E  ++ KIAKKL IVGLWCIQW PV+RPSIK V+QMLE  E    ++PPNPF S
Sbjct  535   DIHVHVEDEDEVKIAKKLAIVGLWCIQWQPVNRPSIKSVLQMLETAEENQLTVPPNPFHS  594

Query  232   TDPSKAKANKPGRLFTS----ALEIISE  161
             T  +       GRL ++    ALE I E
Sbjct  595   TTSTAT-----GRLTSTRPPMALEAIQE  617



>ref|XP_008381957.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=489

 Score =   511 bits (1317),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 278/500 (56%), Positives = 353/500 (71%), Gaps = 21/500 (4%)
 Frame = -2

Query  1633  SPFSF---ENLYNFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSA-TD  1466
             SPF+    + + N ++FSC T  ++      +  + CL   G   YA  S     +   +
Sbjct  4     SPFNVSVDDYMSNVTLFSCPT--SVARRDTYVYQVPCLGDRGKKTYAIRSDYDFGTLFQN  61

Query  1465  LISCTKMFHVSSVPYSIAQDNTVFSLRWTGPSCR-LKNNSTAEDADDCIAPLTKLHTGPL  1289
             L SCTKM+ V SVP  IA +  VF  +W+ P+C+        E  ++ I  +        
Sbjct  62    LQSCTKMYDVLSVP--IAYEYYVFRFKWSIPNCKKCGEGKRCEWQNNEIKCIQWRKPSNT  119

Query  1288  RKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIK  1109
              KL V G +LGS L+V++++  YR+Y  ++ +KE +++IERFLEDYKALKP+RYSYADIK
Sbjct  120   WKLVVTGGILGSLLLVLLMIAAYRVYSADRKEKESRLRIERFLEDYKALKPSRYSYADIK  179

Query  1108  KITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHIN  929
             +IT++F +KLGEG+YGTV+KG LS + F+AVKVLN+SKGDG  EEFVNE+ T+G IHH+N
Sbjct  180   RITNQFKDKLGEGAYGTVFKGMLSSEFFIAVKVLNSSKGDG--EEFVNEVRTMGHIHHVN  237

Query  928   VVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLH  752
             V RLVG+CADGF RALVYE+  N SL+ F+ S + KN FLGW+KLQ IALGIAKG+EYLH
Sbjct  238   VARLVGFCADGFVRALVYEFFPNGSLQDFISSADSKNSFLGWDKLQDIALGIAKGIEYLH  297

Query  751   QGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVF  572
             QGCD RILHFDIKP N+LLDQNF PKISDFG AKLCSK++S+VSMT ARGTMGYIAPEVF
Sbjct  298   QGCDLRILHFDIKPHNVLLDQNFTPKISDFGXAKLCSKDQSLVSMTTARGTMGYIAPEVF  357

Query  571   SRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQ  392
             SRNFGNVSYK+DVYSFGMLLLEMVGG+K         TN+ Y+P+WIYN+L  G+++ I 
Sbjct  358   SRNFGNVSYKADVYSFGMLLLEMVGGRKNIGSITDNTTNEIYYPQWIYNLLEEGDDLRIH  417

Query  391   IEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLE-AEEPPSMPPNPFTSTDPSKA  215
             I +  D KI KKL I+GLWCIQW+P DRPS+K  IQMLE   E  SMPPNPF  T  +  
Sbjct  418   IGEEGDGKIPKKLAIIGLWCIQWHPSDRPSMK--IQMLEGGGESLSMPPNPFVPTGSTTR  475

Query  214   KANKPGRLFTSALEIISEMD  155
              A +        LE I+E++
Sbjct  476   NARR------LELEAIAELE  489



>ref|XP_008363397.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=498

 Score =   512 bits (1318),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 278/511 (54%), Positives = 349/511 (68%), Gaps = 34/511 (7%)
 Frame = -2

Query  1633  SPF--SFENLYNFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLI  1460
             SPF  S +++ N ++FSC+T     A         CL  PG  IYA DSS   Y   DL 
Sbjct  4     SPFNVSVDDMSNLTLFSCTTS---VASDPYPYQFPCLGDPGRIIYAVDSS-STYLLEDLF  59

Query  1459  ----SCTKMFHVSSVPYSIAQDNTVFSLRWTGPSC----------RLKNNSTAEDADDCI  1322
                 SC+KM+ V SVP+           +W+ P+C          R KN+ T  +    I
Sbjct  60    QKVQSCSKMYDVLSVPFGSWVGGYNVRFKWSEPNCTVCEAQGKRCRWKNDGTNSE----I  115

Query  1321  APLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKAL  1142
               L         K  V G +LG+ L+V++++  YR++  ++ +KE +++IERFLEDYKAL
Sbjct  116   KCLDWKKPSNTWKKVVTGGILGALLLVLLMIAAYRVHSADRKEKESRLRIERFLEDYKAL  175

Query  1141  KPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNE  962
             KP RYSYADIK+IT++F +KLGEG+YGTV+KG LS + F+AVKVLN+SKGDG  EEFVNE
Sbjct  176   KPTRYSYADIKRITNQFKDKLGEGAYGTVFKGMLSSEFFIAVKVLNSSKGDG--EEFVNE  233

Query  961   MSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIA  785
             + T+G IHH+NV RLVG+CADGF  ALVYE+    SL+ F+ S + KN FLGW+KLQ IA
Sbjct  234   VRTMGHIHHVNVARLVGFCADGFXXALVYEFFPXGSLQDFISSADSKNSFLGWDKLQDIA  293

Query  784   LGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAAR  605
             LGIAKG+EYLHQGCD RILHFDIKP N+LLDQNF PKISDFG AKLCSK++S+VSMT AR
Sbjct  294   LGIAKGIEYLHQGCDLRILHFDIKPHNVLLDQNFTPKISDFGMAKLCSKDQSLVSMTTAR  353

Query  604   GTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYN  425
             GTMGYIAPEVFSRNFGNVSYK+DVYSFGMLLLEMVGG+K         TN+ Y+P+WIYN
Sbjct  354   GTMGYIAPEVFSRNFGNVSYKADVYSFGMLLLEMVGGRKNIGSITDNTTNEIYYPQWIYN  413

Query  424   ILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLE-AEEPPSMPP  248
             +L  G+++ I I +  D KI KKL I+GLWCIQW+P DRPS+K+ +QML    E  SMPP
Sbjct  414   LLEEGDDLRIHIGEEGDGKIPKKLAIIGLWCIQWHPSDRPSMKIXVQMLXGGGESLSMPP  473

Query  247   NPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             NPF  T  +   A          LE I+E++
Sbjct  474   NPFVPTGXTTRNAR------XLELEAIAELE  498



>ref|XP_003549300.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Glycine max]
Length=607

 Score =   515 bits (1327),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 289/615 (47%), Positives = 386/615 (63%), Gaps = 60/615 (10%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             NEC    CG+  P I FPF+L      ECGYPGF L CT K ET L      L++     
Sbjct  26    NECGEWSCGSGQPPIRFPFKLIKGIKDECGYPGFCLYCTQKHETMLA-----LSS-----  75

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPFSFEN---LYNFSIFSCST-  1580
               VK  +  I+ E+  I+++  + C   + L I +    P+ F++       S F+CS+ 
Sbjct  76    --VKLQVSYINYENHEIVLNDPENCLPHKFLQINDSLIHPYKFDDEAKTSKLSFFNCSSV  133

Query  1579  -HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDN  1403
              H+++     ++S    +     ++   D S+    + DL SCTKMF + +   +     
Sbjct  134   EHQHLRNYQQSLSDSQDMISCPIYVSDLDDSVL---SLDLTSCTKMFDIVTPVSAYGMQR  190

Query  1402  TVFSLRWTGPSCR----------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
                 LRW+  +C            KNN    +  DC      +H          G +L  
Sbjct  191   NSLDLRWSEANCSQCKAKGKKCKWKNNRGDIECFDCKDKRKTIHVPKSFIYSAPGSILLG  250

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             F V+V+  + Y      + K+E+Q ++E+FLE+Y+A KPAR++YAD+K+IT  F EKLGE
Sbjct  251   FAVIVVFKIIYHF----RQKQEDQARVEKFLEEYRAEKPARFTYADVKRITGGFKEKLGE  306

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G++G V++GKLS ++ VAVK+LNN+  +G+G+EF+NE+  +G IHHINVVRL+GYCA+G 
Sbjct  307   GAHGAVFRGKLSNEILVAVKILNNT--EGEGKEFINEVEIMGKIHHINVVRLLGYCAEGI  364

Query  892   HRALVYEYLVNNSLEKFVFSPNDK-NFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
             HRALVY +  N SL+ F+F P+DK NFLGWEKLQ IALGIAKG+ YLHQGC+  I+HFDI
Sbjct  365   HRALVYNFFPNGSLQSFIFPPDDKQNFLGWEKLQNIALGIAKGIGYLHQGCNHPIIHFDI  424

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
              P N+LLD NF PKISDFG AKLCSK  S+VSMTAARGT+GYIAPEVFSRNFGNVSYKSD
Sbjct  425   NPHNVLLDDNFTPKISDFGLAKLCSKNPSLVSMTAARGTLGYIAPEVFSRNFGNVSYKSD  484

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             +YS+GMLLLEMVGG+K  D T SPE     +P+W+++++    +V I +E   D KIA+K
Sbjct  485   IYSYGMLLLEMVGGRKNVD-TSSPEDFHVLYPDWMHDLVHG--DVHIHVEDEGDVKIARK  541

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP--SMPPNPF---TSTDPSKAKANKPGRL  191
             L IVGLWCIQW P++RPSIK VIQMLE++E    ++PPNPF   TST PS          
Sbjct  542   LAIVGLWCIQWQPLNRPSIKSVIQMLESKEEDLLTVPPNPFHSSTSTIPSG---------  592

Query  190   FTSA-----LEIISE  161
             FTSA     LE+I E
Sbjct  593   FTSARLPLELEVIQE  607



>ref|XP_010942309.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Elaeis guineensis]
Length=641

 Score =   515 bits (1326),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 297/611 (49%), Positives = 383/611 (63%), Gaps = 60/611 (10%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             +++C   +C  +GPEI FPFR +   P   GYPGFEL C               N  ++ 
Sbjct  22    KDDCPSSRCSLDGPEIRFPFR-RSKDPEHYGYPGFELACRGN------------NTVIKL  68

Query  1747  PFPVKFLIESIDCEDRLI-IISRVDGCFLQLLPILNLSASPFSFENL------YNFSIFS  1589
             P   +F +  ID   +++ ++S+   C   ++  LN+S SPFSF N        N++  +
Sbjct  69    PSSGEFPVAFIDYAGQMLGLVSKF--CPASIVLNLNVSNSPFSFFNYGMEYKPRNYTFLN  126

Query  1588  CSTHRNITAG------SINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSV  1427
             CST  +I         ++    I CL +   +I+A  SS  L       SC  M  +  +
Sbjct  127   CSTANSIRTTDSRYHFTVYYYEIYCLRESDDYIFAVPSSFTLIEIPK--SCMSMKTIQVI  184

Query  1426  --------PYSIAQDNTVFSLRWTGPSCR---------LKNNSTAEDADDCIAPLTKL--  1304
                      Y+   D  V +L+W  P C            +NS++ D      P   L  
Sbjct  185   WPYISYLNNYTSKYDEYVPTLKWESPDCADCETGGGTCRPDNSSSHDIMCSYQPQCNLLP  244

Query  1303  --HTGPLRKLKVAGEVLGSFLVVVIVLVTYRI---YRLNKMK-KEEQVKIERFLEDYKAL  1142
               H G  +K  + G  LG F+++V    T ++   + L + K KE Q+++E+FLEDYKAL
Sbjct  245   DHHGGGCKKRWIIGASLGIFVLLVTTAATIKVGHSWLLKRKKEKENQLQVEKFLEDYKAL  304

Query  1141  KPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNE  962
             KP RYSYADIKK+T++F  KLGEG YG+V+KG L   V +AVK+L  S G  +GE+FVNE
Sbjct  305   KPLRYSYADIKKMTNQFKTKLGEGGYGSVFKGFLPNGVPIAVKILVRSMGS-NGEDFVNE  363

Query  961   MSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIA  785
             + TIG IHH+NVVRL+G+CADGF RAL+YE++ N SL KF+FS + ++  LGW+KL  IA
Sbjct  364   VGTIGRIHHVNVVRLLGFCADGFKRALIYEFMSNESLAKFIFSVDGRSTLLGWDKLHNIA  423

Query  784   LGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAAR  605
             +GIA+G+EYLHQGCDQRILHFDIKP NILLD NF PKISDFG AKLCSKE+SIVSMTAAR
Sbjct  424   IGIARGIEYLHQGCDQRILHFDIKPHNILLDHNFCPKISDFGLAKLCSKEQSIVSMTAAR  483

Query  604   GTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYN  425
             GT GYIAPEV SRNFGNVSYKSDVYSFGMLLLE VGG+K  D T    T+Q YFPEWIYN
Sbjct  484   GTAGYIAPEVCSRNFGNVSYKSDVYSFGMLLLETVGGRKNMDAT-VENTSQVYFPEWIYN  542

Query  424   ILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPP  248
              LS+ +E+ + I +  D+ IA+KL IV LWCIQWYPVDRPS++ V+QML    E   MPP
Sbjct  543   RLSQ-KELGLHIIEERDAIIARKLAIVALWCIQWYPVDRPSMESVVQMLGGSMENLVMPP  601

Query  247   NPFTSTDPSKA  215
             NPFTS  P  A
Sbjct  602   NPFTSAGPPSA  612



>ref|XP_006380300.1| hypothetical protein POPTR_0007s02220g [Populus trichocarpa]
 gb|ERP58097.1| hypothetical protein POPTR_0007s02220g [Populus trichocarpa]
Length=571

 Score =   513 bits (1320),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 282/589 (48%), Positives = 367/589 (62%), Gaps = 54/589 (9%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CGN G  I FPF +K  QP +CGYPGF+L C +KG+  LE            P  VK  I
Sbjct  31    CGNRGLHIRFPFWIKDRQPEQCGYPGFDLSCNEKGDIVLE-----------LPTAVKLYI  79

Query  1723  ESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-NLYNFSIFSCSTHRNITAGSINI  1547
             + IDC++++I  +   GC          S     F+ +  NF+IF+CS +      +I+ 
Sbjct  80    DKIDCKNQVIYATDPHGCLRSHHSNFYSSGFHIRFKMSRDNFTIFNCSLN-----NAISR  134

Query  1546  SPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIA---QDNTVFSLRWTG  1376
               IACL+   + + A DS   +     L+SCTKM+ +  VP  I          S   TG
Sbjct  135   PRIACLSTHQYDVLAVDSEQSIDDNELLLSCTKMYDLP-VPQDIHLSWSSPNCGSCEATG  193

Query  1375  PSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKM  1196
               C L+ NS+ E   +CI  + + + G  +K    G   GS +  V+V+  Y+IY   K 
Sbjct  194   KLCGLRKNSSTELETECIG-MHRQNKGARKKNLTIGVTTGSIIFGVLVIAVYQIYSFRKS  252

Query  1195  KKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAV  1016
             ++E Q K+ERFL+DY+A+ P RYS+AD+KK+T++F ++LG+G+YGTV+KGKL+ ++ VAV
Sbjct  253   EEEYQAKVERFLDDYRAMNPTRYSHADLKKMTNQFRDELGQGAYGTVFKGKLTSEIPVAV  312

Query  1015  KVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVF  836
             KVL+NS     GEEFVNEM T+  IHH+NV+RL+G+CADGF RALVYEYL N+SL+KF+ 
Sbjct  313   KVLSNS--SEKGEEFVNEMGTMARIHHVNVIRLIGFCADGFRRALVYEYLPNDSLQKFIS  370

Query  835   SPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFG  659
             S N KN FLGWE+L  IALG AKG+EYLHQ                           DFG
Sbjct  371   SANAKNVFLGWERLHHIALGAAKGIEYLHQ---------------------------DFG  403

Query  658   QAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSD  479
              AKLCSK KS +SMT  RGT+GYIAPEVFSRNFGNVSYKSDVYSFGML+LEMVGG+K  D
Sbjct  404   LAKLCSKYKSAISMTRVRGTVGYIAPEVFSRNFGNVSYKSDVYSFGMLVLEMVGGRKNVD  463

Query  478   ITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSI  299
              T +   +Q YFPEWIYN+L  GE++  QIE+  D++IAKKL IVGLWCIQW PVD PS+
Sbjct  464   DT-AENGDQVYFPEWIYNLLEEGEDLRFQIEEEGDAEIAKKLAIVGLWCIQWNPVDCPSM  522

Query  298   KVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             K+V+QMLE E +  S PPNP +ST   +       R     L  ISE +
Sbjct  523   KIVVQMLEGEGDRLSTPPNPLSSTAAKRTNTGMLRRHLHQELAAISETE  571



>ref|XP_004228892.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Solanum lycopersicum]
Length=588

 Score =   513 bits (1321),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 283/591 (48%), Positives = 375/591 (63%), Gaps = 36/591 (6%)
 Frame = -2

Query  1921  ECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPF  1742
             +C   +CG +GP I FPFRL+H QP  CGYPGFEL C  K +T L  P  L+ +      
Sbjct  26    DCSESRCGIDGPSIHFPFRLRH-QPEYCGYPGFELSCDRKNQTILTLPNSLILS------  78

Query  1741  PVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE------NLYNFSIFSCST  1580
                  +  ID   + I +   + C +  +  LNLSASPFSF        L +FS+F CS 
Sbjct  79    -----VGEIDYMSQQISLYDPEDCLILNILHLNLSASPFSFPVHEPYFTLIDFSVFKCS-  132

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
                + A   N  P     K    I+A   +L     T   +C K+  + S+PY      +
Sbjct  133   --GMPADYQNQYPDCASDKA---IFAVSYNLETLPPT---TCKKIHEIPSIPYYTT--TS  182

Query  1399  VFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTY  1220
             +  L W  P C +       D      P         R     G V+G  L+ +I++  Y
Sbjct  183   LIRLSWFTPMC-IYCEGLEMDCGFKNYPKQLTTQCFDRPFTTKGGVIGLILMGIIMMALY  241

Query  1219  RIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKL  1040
               Y  +K+++E Q ++E+FLEDY+  +P RY+YADI+K+T++F E LGEG+YG VYKG L
Sbjct  242   ECYSSSKIERENQARVEKFLEDYRDRRPTRYTYADIRKMTNQFQEVLGEGAYGIVYKGTL  301

Query  1039  SGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVN  860
             S ++ VAVKVL++S  +G+GEEF+NE++ +G IHH+NVVRLVG+CADG  RALV+EYL N
Sbjct  302   SNEIHVAVKVLDDS--EGNGEEFINEVAAMGKIHHVNVVRLVGFCADGVRRALVFEYLPN  359

Query  859   NSLEKFVF--SPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQN  686
              SL+K +F  S  D   L W+KL  IA+GIAKG+EYLHQGCDQ+ILHFDIKP+NILLD N
Sbjct  360   QSLDKLIFPISIKDNITLTWKKLHDIAIGIAKGLEYLHQGCDQQILHFDIKPQNILLDHN  419

Query  685   FNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLE  506
              NPKISDFG AKLCSKEKS+V+MT ARGTMGYIAPEV S NFG  S+KSDVYSFGM+LLE
Sbjct  420   LNPKISDFGLAKLCSKEKSVVTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLLE  479

Query  505   MVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQ  326
             MVGG+K  D     +T+Q  FPEWI+  L++G+E++I+IEK +D  I +KL ++GLWCIQ
Sbjct  480   MVGGRKNFD--AKADTSQMNFPEWIHEWLNQGDELKIRIEKDDDVIIVRKLAVIGLWCIQ  537

Query  325   WYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALE  173
             W  +DRPSIKVV QMLE +      P+P+T+ + ++   + P     S LE
Sbjct  538   WNAIDRPSIKVVTQMLEGDGSNLTVPSPYTTRNTTQVGPSMPELTVISELE  588



>gb|KEH40384.1| receptor-like kinase [Medicago truncatula]
Length=599

 Score =   513 bits (1321),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 292/601 (49%), Positives = 387/601 (64%), Gaps = 55/601 (9%)
 Frame = -2

Query  1906  KCGNNGPEISFPFRLKHIQPP-ECGYPGFELLCTDKGETALENPFPLLNATLQP-PFPVK  1733
             +CG +GP I FPFRL   +    C Y GF L C+D  +T LE         L P   P++
Sbjct  35    RCGRHGPPIRFPFRLNDRETEYGCSYTGFNLSCSDTQKTLLE---------LHPHSGPIQ  85

Query  1732  FLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPFSFENLYNFSIFSCSTHRNITAGS  1556
               + +ID + + + +S  + C   Q L +L+   SPF         +FS S + N +   
Sbjct  86    LEVTAIDYQLQQLQVSDPENCLPRQFLKLLHSQISPFQ--------LFSRSDY-NYSYTF  136

Query  1555  INISPIACLTKPGHFIYAADSSLYLYS-ATDLISCTKMFHVSSVPYSIAQDNTVFSLRWT  1379
             ++ S ++C   P   +Y ADSS  L +   D I CTK   + S   S+  DN +  + W+
Sbjct  137   MDCSSLSC---P---VYVADSSNTLLALGLDPILCTKTLDILSSSLSLRYDN-ILVMTWS  189

Query  1378  GPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL--GSFLVVVI  1235
              P+C          +LKNN T ED  +C       H  P +K+ +   V+  GS +V +I
Sbjct  190   KPNCSKCEIEGKMCKLKNNGT-EDEIECF----DRHHKPTKKILLYATVVFVGSVMVTLI  244

Query  1234  VLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTV  1055
             +     +Y   K+K E++ +IE+FLEDY+AL PAR+SYADIK+IT+ F E+LGEG++G V
Sbjct  245   IAACLHLYSYFKLKGEDETRIEKFLEDYRALNPARFSYADIKRITNNFREELGEGAHGAV  304

Query  1054  YKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVY  875
             +KGKLS ++ VAVK+L N+  +GDG+EF+NE+  +G IHHINVVRLVG+CADG +RALVY
Sbjct  305   FKGKLSNEILVAVKMLKNT--EGDGKEFINEVKAMGKIHHINVVRLVGFCADGSYRALVY  362

Query  874   EYLVNNSLEKFVFSPND-KNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
              +  N SL+ F+  P+D  +FLGWEKLQQIALGIAKG+EYLH  CDQ+ILHFDI P N+L
Sbjct  363   NFFPNGSLQNFITRPDDMDHFLGWEKLQQIALGIAKGIEYLHMSCDQQILHFDINPHNVL  422

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LD  F PKI+DFG AKLCSK +S VS+TAARGT+GYIAPEVFSRNFGNVSYK+D+YS+GM
Sbjct  423   LDDKFVPKITDFGLAKLCSKNQSKVSVTAARGTLGYIAPEVFSRNFGNVSYKADIYSYGM  482

Query  517   LLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGL  338
             LLLEMVGG+K      S E  Q  +PEWI+N+L  G ++ + IE  ED +I KKL IVGL
Sbjct  483   LLLEMVGGRKNIG-QLSEENIQVLYPEWIHNLL-EGRDIHVNIEGAEDDRILKKLAIVGL  540

Query  337   WCIQWYPVDRPSIKVVIQMLEA--EEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIIS  164
             WCIQW P++RPSI VV++MLEA  EE   +PPNPF ST     +     +  T  LE I 
Sbjct  541   WCIQWNPINRPSITVVLKMLEALEEENLIVPPNPFNSTTSRVVETKT--KFSTLELEAIH  598

Query  163   E  161
             E
Sbjct  599   E  599



>ref|XP_008365003.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=489

 Score =   509 bits (1310),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 277/500 (55%), Positives = 352/500 (70%), Gaps = 21/500 (4%)
 Frame = -2

Query  1633  SPFSF---ENLYNFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSA-TD  1466
             SPF+    + + N ++FSC T  ++      +  + CL   G   YA  S     +   +
Sbjct  4     SPFNVSVDDYMSNVTLFSCPT--SVARRDTYVYQVPCLGDRGKKTYAIRSDYDFGTLFQN  61

Query  1465  LISCTKMFHVSSVPYSIAQDNTVFSLRWTGPSCR-LKNNSTAEDADDCIAPLTKLHTGPL  1289
             L SCTKM+ V SVP  IA +  VF  +W+ P+C+        E  ++ I  +        
Sbjct  62    LQSCTKMYDVLSVP--IAYEYYVFRFKWSIPNCKKCGEGKRCEWQNNEIKCIQWRKPSNT  119

Query  1288  RKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIK  1109
              KL V G +LGS L+V++++  YR+Y  ++ +KE +++IERFLEDYKALKP+RYSYADIK
Sbjct  120   WKLVVTGGILGSLLLVLLMIAAYRVYSADRKEKEIRLRIERFLEDYKALKPSRYSYADIK  179

Query  1108  KITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHIN  929
             +IT++F +KLGEG+YGTV+KG LS + F+AVKV N+SKGDG  EEFVNE+ T+G IHH+N
Sbjct  180   RITNQFKDKLGEGAYGTVFKGMLSSEFFIAVKVXNSSKGDG--EEFVNEVRTMGHIHHVN  237

Query  928   VVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLH  752
             V RLVG+CADGF RALVYE+  N SL+ F+ S + KN FLGW+KLQ IALGIAKG+EYLH
Sbjct  238   VARLVGFCADGFVRALVYEFFPNGSLQDFISSADSKNSFLGWDKLQDIALGIAKGIEYLH  297

Query  751   QGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVF  572
             QGCD RILHFDIKP N+LLDQNF PKISDFG AKLCSK++S+VSMT ARGTMGYIAPEVF
Sbjct  298   QGCDLRILHFDIKPHNVLLDQNFTPKISDFGMAKLCSKDQSLVSMTTARGTMGYIAPEVF  357

Query  571   SRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQ  392
             SRNFGNVSYK+DVYSFGMLLLEMVGG+K         TN+ Y+P+WIYN+L  G+++ I 
Sbjct  358   SRNFGNVSYKADVYSFGMLLLEMVGGRKNIGSITDNTTNEIYYPQWIYNLLEEGDDLRIH  417

Query  391   IEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLE-AEEPPSMPPNPFTSTDPSKA  215
             I +  D KI KKL I+GLWCIQW+P DRPS+K  IQMLE   E  SMPPNPF  T  +  
Sbjct  418   IGEEGDGKIPKKLAIIGLWCIQWHPSDRPSMK--IQMLEGGGESLSMPPNPFVPTGSTTR  475

Query  214   KANKPGRLFTSALEIISEMD  155
              A +        LE I+E++
Sbjct  476   NARR------LELEAIAELE  489



>ref|XP_004307040.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=504

 Score =   509 bits (1311),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 274/512 (54%), Positives = 357/512 (70%), Gaps = 32/512 (6%)
 Frame = -2

Query  1633  SPFSFE--NLYNF-SIFSCSTHRNITAGSINISPIACLTKPGH-FIYAADSSLYLYSATD  1466
             SPF F   ++ NF S+F C    N    S  +  + CL++ G+ +IYA  S+   Y    
Sbjct  6     SPFIFSESSMDNFVSLFDCPA-PNTATDSPRLQ-VPCLSRLGYKYIYAIPSN---YQPPQ  60

Query  1465  LISCTKMFHVSSVPYSIAQDNTVFSLRW-----------TGPSCRLKNNSTAEDADDCIA  1319
                CTKM+ +  VPY +    ++ +  W            G  C LK N   E   +C+ 
Sbjct  61    Y--CTKMYDLP-VPYELLYPLSMDAYFWWSTPNCTECQQMGKKCHLKFNGI-ESEIECVD  116

Query  1318  PLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALK  1139
                   T    KL   G  L +  +++ V V Y +Y  +KM+K+ Q+KIE FLED+KALK
Sbjct  117   FSKPSAT---TKLVATGATLTTIYLLISVGVIYGVYHSDKMEKQNQLKIETFLEDHKALK  173

Query  1138  PARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEM  959
             P+RYSYADIK+IT++F +KLGEG+YGTV+KGKLS ++FVAVKVL N+   GDGEEF+NE+
Sbjct  174   PSRYSYADIKRITNQFEDKLGEGAYGTVFKGKLSSELFVAVKVLKNTNY-GDGEEFLNEV  232

Query  958   STIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIAL  782
              T+G IHH+NVVRLVG+CADGF RALVYE+L N SL+ F+ S ++KN FLGW+KL+ IAL
Sbjct  233   GTMGHIHHVNVVRLVGFCADGFRRALVYEFLPNGSLQDFISSADNKNSFLGWDKLKDIAL  292

Query  781   GIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARG  602
             GIAKG+EYLHQGCDQRILHFDIKP N+LLDQNF PK+SDFG +KLC+K++SIVSMTAARG
Sbjct  293   GIAKGIEYLHQGCDQRILHFDIKPHNVLLDQNFTPKVSDFGMSKLCAKDQSIVSMTAARG  352

Query  601   TMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNI  422
             T+GYIAPEVFSRNFGNVSYKSDVYSFGM+LLE+VGG+K        + ++ Y+PEWIYN+
Sbjct  353   TLGYIAPEVFSRNFGNVSYKSDVYSFGMVLLEIVGGRKNIGDETMDQASEVYYPEWIYNL  412

Query  421   LSRGEEVEIQI-EKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPN  245
             L  GE++ + I E+G + +I K+L IVGLWCIQW+P+DRPS+K V+QML   E  +MPPN
Sbjct  413   LEEGEDLRVHIGEEGLECRIPKELAIVGLWCIQWHPMDRPSMKTVVQMLGGRENLTMPPN  472

Query  244   PFTSTDPSKAKANK--PGRLFTSALEIISEMD  155
             PF +T  ++  AN     R     LE I E++
Sbjct  473   PFAATVTTRTNANTRPAARRLNLELEAIVELE  504



>ref|XP_006368004.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=597

 Score =   512 bits (1319),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 291/609 (48%), Positives = 383/609 (63%), Gaps = 59/609 (10%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             C   +CG +GP I FPFRL H QP  CGYPGFEL C  K  T L  P  L          
Sbjct  27    CSVSRCGRHGPIIHFPFRLHH-QPEYCGYPGFELSCDLKNRTILILPNSL----------  75

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE------NLYNFSIFSCSTH  1577
                ++E ID   + I +S  + C +  L  LNLS SPFSF         ++ S+F+CS  
Sbjct  76    -TLIVEEIDYMSQQIRLSDPERCLILKLLHLNLSESPFSFTVDDPFYTPHDISVFNCS--  132

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
               + A   N+ P     K    +Y +  SL         +C K+  + S  Y     +T+
Sbjct  133   -GMPAYYRNLYPYCASDKAIFAVYYSLDSL------PPATCKKIHEIPSFLY-----DTI  180

Query  1396  FS---LRWTGPSCRLK---------NNSTAEDADDCI-APLTKLHTGPLRKLKVAGEVLG  1256
             +S   L W  P+C             N T +    C   P T    G  +K  +AG V+G
Sbjct  181   YSSIRLSWGNPNCSYCEGLEKDCGFKNYTKQLTTQCFDRPFTTKGGG--KKPLIAGGVIG  238

Query  1255  SFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLG  1076
               L+ +I++  Y  Y  +K+++E Q ++E+FLEDY+  +P RY+YADIKKIT++F E LG
Sbjct  239   LVLLGIIMMAFYECYSSSKIERENQARVEKFLEDYRDRRPTRYTYADIKKITNQFQEILG  298

Query  1075  EGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADG  896
             EG+YG VYKG LS ++ VAVK+LN+S  +G+GEEF+NE++ +G IHH+NVVRLVG+CADG
Sbjct  299   EGAYGIVYKGTLSNEIHVAVKILNDS--EGNGEEFINEVAAMGKIHHVNVVRLVGFCADG  356

Query  895   FHRALVYEYLVNNSLEKFVF--SPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
               RALV+EYL N SL+K +F  S  D   L W+KL  IA+GIAKG+EYLHQGCDQ+ILHF
Sbjct  357   VRRALVFEYLPNQSLDKLIFPSSFKDNITLTWKKLHDIAMGIAKGLEYLHQGCDQQILHF  416

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DIKP+NILLD N NPKISDFG AKLCSKEKS+V+MT ARGTMGYIAPEV S NFG  S+K
Sbjct  417   DIKPQNILLDHNLNPKISDFGLAKLCSKEKSVVTMTEARGTMGYIAPEVLSSNFGKASHK  476

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIA  362
             SDVYSFGM+LLEMVGG+K  D     +T+Q  FPEWI+  L++GEE++I+IE+ +D  I 
Sbjct  477   SDVYSFGMMLLEMVGGRKNFD--AKADTSQMNFPEWIHQRLNQGEELKIRIEEDDDVIIV  534

Query  361   KKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTS  182
             +KL ++GLWCIQW   DRPSIK+V QMLE +      P+PFT+ + +    +      T 
Sbjct  535   RKLAVIGLWCIQWNATDRPSIKIVTQMLEGDVSNLTVPSPFTTRNTTHVGPS------TQ  588

Query  181   ALEIISEMD  155
              L +ISE++
Sbjct  589   ELTVISELE  597



>ref|XP_009772453.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=604

 Score =   512 bits (1319),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 292/582 (50%), Positives = 371/582 (64%), Gaps = 46/582 (8%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             N+C   +C ++GP I FPFRL+H QP  CGYPGFEL CT+             N T+   
Sbjct  25    NDCKESRCNSDGPSIRFPFRLQH-QPQHCGYPGFELSCTN-------------NKTILST  70

Query  1744  FP--VKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN---LYNFSIFSCST  1580
              P  +  ++E ID   + I +     C + LL   N SASPF  ++   L NFSIFS S 
Sbjct  71    LPNSLILIVEDIDYASQEIRLYYPRSCIVNLLH-FNFSASPFLLKHEPFLCNFSIFSPSG  129

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
               N   GS N S     T     I  +DS   L     L+   K+  +SSVP  +  D  
Sbjct  130   ISNGDFGSQNCSA----TSDSGLIALSDSE-NLEDYPTLLDYKKIEEISSVPCDLGYDQP  184

Query  1399  VFSLRWTGP----------SCRLKNNSTAEDADDCI-APLTKLHTGPLRKLKVAGEVLGS  1253
              F + W  P           C  KN S       C   P TK   G  ++  +AG VLG 
Sbjct  185   -FWMSWLNPKCGNCGGLGMDCGFKNYSNQLQGTQCFDKPTTK---GGFKEPLIAGGVLGF  240

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
              L+ +I+L  Y  Y  +K+++E Q ++E+FLEDY+AL+P RY+YA+IKKIT+ F ++LGE
Sbjct  241   LLLGIIMLALYEFYSSSKIERENQARVEKFLEDYRALRPTRYTYAEIKKITNMFHQQLGE  300

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G+YG VYKG LS ++ VAVKVLN+S G+G  EEF+NE++ +G IHH NVVRLVGYCADGF
Sbjct  301   GAYGVVYKGTLSNEIHVAVKVLNDSIGNG--EEFINEVAAMGKIHHFNVVRLVGYCADGF  358

Query  892   HRALVYEYLVNNSLEKFVFSPNDKNF--LGWEKLQQIALGIAKGVEYLHQGCDQRILHFD  719
               ALVYEYL N SL+K +F  + K+   L W+KL  IA+GIAKG+EYLHQGCDQ+ILHFD
Sbjct  359   RNALVYEYLPNQSLDKLIFPASSKDHITLNWKKLHDIAMGIAKGLEYLHQGCDQQILHFD  418

Query  718   IKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKS  539
             IKP+NILLD N NPKI+DFG AKLCSKEKS V+MT ARGTMGYIAPEV S NFG  S+KS
Sbjct  419   IKPQNILLDHNLNPKIADFGLAKLCSKEKSGVTMTEARGTMGYIAPEVLSSNFGKASHKS  478

Query  538   DVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAK  359
             DVYSFGMLLLEMVGG+K  D   +   +Q  F EWI+  ++ GEE++I+IE+ +D  I +
Sbjct  479   DVYSFGMLLLEMVGGRKNFDAKAN--NSQVNFSEWIHQRVNEGEELKIRIEEDDDIIIVR  536

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTS  233
             KL I+G+WCIQW   DRPSIK+V QMLE +      P PFT+
Sbjct  537   KLAIIGVWCIQWNATDRPSIKIVTQMLEGDGSNLTIPPPFTA  578



>gb|KEH40379.1| receptor-like kinase [Medicago truncatula]
Length=599

 Score =   512 bits (1318),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 292/608 (48%), Positives = 385/608 (63%), Gaps = 55/608 (9%)
 Frame = -2

Query  1924  NECLPR--KCGNNGPEISFPFRLKHIQPP-ECGYPGFELLCTDKGETALENPFPLLNATL  1754
             N C  R  +CG +GP I FPFR K  +    C YPGFEL C+D  +T +E P        
Sbjct  27    NGCSGRDFRCGPHGPPIRFPFRFKDREEKYGCSYPGFELTCSDTRKTLIELP--------  78

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPFSFENLYNFSIFSCSTH  1577
                 P++  ++ I  +D+ + IS  + C   QLL +L+   SPF         +F+ S  
Sbjct  79    THSGPIQLEVKRIFYDDQELWISDPENCLPKQLLKLLHSQISPFQ--------LFARSDS  130

Query  1576  RNITAGSINISPIACLTKPGHFIYAADS-SLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
              N    S      + LT P   +Y ADS + +L S  D I CTK   +     S+   N 
Sbjct  131   NN----SYTFMDCSSLTCP---VYFADSGTRFLDSGLDPILCTKTLDIIFSSLSLQYKN-  182

Query  1399  VFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL--G  1256
             +  + W+ P+C          +LKNN T ED  +C       H  P +K+ +   V+  G
Sbjct  183   ILVMTWSKPNCSRCEVEDKMCKLKNNGT-EDEIECF----DRHHKPTKKIILYATVVFVG  237

Query  1255  SFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLG  1076
             S ++ +I+     +Y   K+K E++ +IE+FLEDY+AL PAR+SY DIK+IT+ F E+LG
Sbjct  238   SVMITLIIAACLHLYSYFKLKGEDETRIEKFLEDYRALNPARFSYVDIKRITNNFREELG  297

Query  1075  EGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADG  896
             EG++G V+KGKLS ++ VAVK+L N+  +GDG+EF+NE+  +G IHHINVVRLVG+CADG
Sbjct  298   EGAHGAVFKGKLSNEILVAVKMLKNT--EGDGKEFINEVKAMGKIHHINVVRLVGFCADG  355

Query  895   FHRALVYEYLVNNSLEKFVFSPND-KNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFD  719
              +RALVY +  N SL+ F+  P+D  +FLGWEKLQQIALGIAKG+EYLH  CDQ+ILHFD
Sbjct  356   SYRALVYNFFPNGSLQNFITRPDDMDHFLGWEKLQQIALGIAKGIEYLHMSCDQQILHFD  415

Query  718   IKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKS  539
             I P N+LLD  F PKI+DFG AKLCSK +S VS+TAARG +GYIAPEVFSRNFGNVSYK+
Sbjct  416   INPYNVLLDDKFVPKITDFGLAKLCSKNQSKVSVTAARGALGYIAPEVFSRNFGNVSYKA  475

Query  538   DVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAK  359
             D+YS+GMLLLEMVGG+K      S E  Q  +PEWI+N+L  G ++ + IE  ED +I K
Sbjct  476   DIYSYGMLLLEMVGGRKNIG-QLSEENFQVLYPEWIHNLL-EGRDIHVNIEGAEDDRILK  533

Query  358   KLTIVGLWCIQWYPVDRPSIKVVIQMLEA--EEPPSMPPNPFTSTDPSKAKANKPGRLFT  185
             KL IVGLWCIQW P++RPSI VV++MLEA  EE   +PPNPF ST     +     +  T
Sbjct  534   KLAIVGLWCIQWNPINRPSITVVLKMLEALEEENLIVPPNPFNSTTSRVVETKT--KFST  591

Query  184   SALEIISE  161
               LE I E
Sbjct  592   LELEAIHE  599



>ref|XP_003549304.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Glycine max]
Length=607

 Score =   511 bits (1317),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 282/607 (46%), Positives = 381/607 (63%), Gaps = 44/607 (7%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             NEC    CG+  P I FPF+L      ECGYPGF L CT K ET L      L++     
Sbjct  26    NECGEWSCGSGQPPIRFPFKLIKGIKDECGYPGFCLYCTQKHETMLA-----LSS-----  75

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPFSFEN---LYNFSIFSCST-  1580
               VK  +  I+ E+  I+++  + C   + L I +    P+ F++       S F+CS+ 
Sbjct  76    --VKLQVSYINYENHEIVLNDPENCLPHKFLQINDSLIHPYKFDDEAKTSKLSFFNCSSV  133

Query  1579  -HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDN  1403
              H+++     ++S    +     ++   D S+    + DL SCTKMF + +   +     
Sbjct  134   EHQHLRNYQQSLSDSQDMISCPIYVSDLDDSVL---SLDLTSCTKMFDIVTPVSAYGMQR  190

Query  1402  TVFSLRWTGPSCR----------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
                 LRW+  +C            KNN    +  DC      +H          G +L  
Sbjct  191   NSLDLRWSEANCSQCKAKGKKCKWKNNRGDIECFDCKDKRKTIHVPKSFIYSAPGSILLG  250

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             F V+V+  + Y      + K+E+Q ++E+FLE+Y+A KPAR++YAD+K+IT  F EKLGE
Sbjct  251   FAVIVVFKIIYHF----RQKQEDQARVEKFLEEYRAEKPARFTYADVKRITGGFKEKLGE  306

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G++G V++GKLS ++ VAVK+LNN+  +G+G+EF+NE+  +G IHHINVVRL+GYCA+G 
Sbjct  307   GAHGAVFRGKLSNEILVAVKILNNT--EGEGKEFINEVEIMGKIHHINVVRLLGYCAEGI  364

Query  892   HRALVYEYLVNNSLEKFVFSPNDK-NFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
             HRALVY +  N SL+ F+F P+DK NFLGWEKLQ IALGIAKG+ YLHQGC+  I+HFDI
Sbjct  365   HRALVYNFFPNGSLQSFIFPPDDKQNFLGWEKLQNIALGIAKGIGYLHQGCNHPIIHFDI  424

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
              P N+LLD NF PKISDFG AKLCSK  S+VSMTAARGT+GYIAPEVFSRNFGNVSYKSD
Sbjct  425   NPHNVLLDDNFTPKISDFGLAKLCSKNPSLVSMTAARGTLGYIAPEVFSRNFGNVSYKSD  484

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             +YS+GMLLLEMVGG+K  D T S E     +P+W+++++    +V I +E   D KIA+K
Sbjct  485   IYSYGMLLLEMVGGRKNVD-TSSAEDFHVLYPDWMHDLVHG--DVHIHVEDEGDVKIARK  541

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP--SMPPNPFTSTDPSKAKANKPGRLFTS  182
             L IVGLWCIQW P++RPSIK VIQMLE++E    ++PPNPF S+  +        RL   
Sbjct  542   LAIVGLWCIQWQPLNRPSIKSVIQMLESKEEDLLTVPPNPFHSSTSTIPSGLTSARL-PL  600

Query  181   ALEIISE  161
              LE+I E
Sbjct  601   ELEVIQE  607



>ref|XP_004498440.1| PREDICTED: probable receptor-like protein kinase At5g39030-like 
[Cicer arietinum]
Length=458

 Score =   505 bits (1301),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 259/461 (56%), Positives = 333/461 (72%), Gaps = 13/461 (3%)
 Frame = -2

Query  1567  TAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT-VFS  1391
             TA   + S I CL+  G+ +YA +S+L +   T L  CTK++ +S VP S+   N     
Sbjct  3     TALQSHYSSIKCLSSHGYHVYALNSTLQIKDVT-LSYCTKLYDMSFVPESVIFSNEDQLV  61

Query  1390  LRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIY  1211
             L W   SC  +N    E  ++C   ++K   G  +K  +   ++  F ++++V V Y I 
Sbjct  62    LGWD-TSCGNEN----ETENECSNIVSK-SKGARKKEAILVPIVSCFGILLLVTVLYHIR  115

Query  1210  RLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGD  1031
                +  KE + +IE+FLEDYKALKP RYSY+DIK+IT+ F  +LG+G+YGTVYKGKLS D
Sbjct  116   YTTQKDKENEARIEKFLEDYKALKPTRYSYSDIKRITNNFKNELGQGAYGTVYKGKLSSD  175

Query  1030  VFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSL  851
             ++VAVK+L  S G+G   EF+NE+ T+  IHH+NVV LVG+CADG  RALVYEYL N SL
Sbjct  176   IYVAVKLLKTSTGNG--PEFINEVGTMSQIHHVNVVHLVGFCADGHTRALVYEYLPNGSL  233

Query  850   EKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPK  674
             +KF+ + + KN FL W+KL++IALGIAKG+EYLHQGCDQRILHFDIKP NILLD NF PK
Sbjct  234   QKFISTTDFKNHFLSWDKLREIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDNNFTPK  293

Query  673   ISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGG  494
             ISDFG AKLCSK++S VSMTAARGT+GYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGG
Sbjct  294   ISDFGLAKLCSKDQSAVSMTAARGTIGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGG  353

Query  493   KKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPV  314
             ++  D+     +   YFPEWIYN+L +G+++   IE  + +KIAKKL I GLWCIQW+P+
Sbjct  354   RQNVDVV-EKRSGLGYFPEWIYNLLEQGDDLREHIEVEKYAKIAKKLAIAGLWCIQWHPI  412

Query  313   DRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGR  194
             DRPS++VV+ MLE + +  SMPPNPF S DP+    +  GR
Sbjct  413   DRPSMQVVVHMLEGDGDKLSMPPNPFASADPAIMNVSVIGR  453



>ref|XP_006601167.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Glycine max]
Length=607

 Score =   511 bits (1315),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 288/615 (47%), Positives = 384/615 (62%), Gaps = 60/615 (10%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             NEC    CG+  P I FPF+L      ECGYPGF L CT K ET L      L++     
Sbjct  26    NECGEWSCGSGQPPIRFPFKLIKGIKDECGYPGFCLYCTKKNETMLA-----LSS-----  75

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPFSFEN---LYNFSIFSCST-  1580
               VK  +  I+ E+  I +   + C   + L I +    P+ F++       S F+CS+ 
Sbjct  76    --VKLQVSYINYENHEIGLKDPENCLPHKFLQINDSLIHPYKFDDEAKTSKLSFFNCSSV  133

Query  1579  -HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDN  1403
              H+++     ++S    +     ++   D S+    + DL SCTKMF + +   +     
Sbjct  134   EHQHLRNYQQSLSDSQDMISCPIYVSDLDDSVL---SLDLTSCTKMFDIVTPVSAYGMQR  190

Query  1402  TVFSLRWTGPSCR----------LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGS  1253
                 LRW+  +C            KNN    +  DC      +H          G +L  
Sbjct  191   NSLDLRWSEANCSQCKAKGKKCKWKNNRGDIECFDCKDKRKTIHVPKSFIYSAPGSILLG  250

Query  1252  FLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGE  1073
             F+V+V+  + Y      + K+E+Q ++E+FLE+Y+A KPAR++YAD+K+IT  F EKLGE
Sbjct  251   FVVIVVFKIIYHF----RQKQEDQARVEKFLEEYRAEKPARFTYADVKRITGGFKEKLGE  306

Query  1072  GSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGF  893
             G++G V++GKLS ++ VAVK+LNN+  +G+G+EF+NE+  +G IHHINVVRL+GYCA+G 
Sbjct  307   GAHGAVFRGKLSNEILVAVKILNNT--EGEGKEFINEVEIMGKIHHINVVRLLGYCAEGI  364

Query  892   HRALVYEYLVNNSLEKFVFSPNDK-NFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDI  716
             HRALVY +  N SL+ F+F P+DK NFLGWEKLQ IALGIAKG+ YLHQGC+  I+HFDI
Sbjct  365   HRALVYNFFPNGSLQSFIFPPDDKQNFLGWEKLQNIALGIAKGIGYLHQGCNHPIIHFDI  424

Query  715   KPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSD  536
              P N+LLD NF PKISDFG AKLCSK  S+VSMTAARGT+GYIAPEVFSRNFGNVSYKSD
Sbjct  425   NPHNVLLDDNFTPKISDFGLAKLCSKNPSLVSMTAARGTLGYIAPEVFSRNFGNVSYKSD  484

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             +YS+GMLLLEMVGG+K  D T S E     +P+W+++++    +V I +E   D KIA+K
Sbjct  485   IYSYGMLLLEMVGGRKNVD-TSSAEDFHVLYPDWMHDLVHG--DVHIHVEDEGDVKIARK  541

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP--SMPPNPF---TSTDPSKAKANKPGRL  191
             L IVGLWCIQW P++RPSIK VIQMLE++E    ++PPNPF   TST PS          
Sbjct  542   LAIVGLWCIQWQPLNRPSIKSVIQMLESKEEDLLTVPPNPFHSSTSTIPSG---------  592

Query  190   FTSA-----LEIISE  161
             FTSA     LE+I E
Sbjct  593   FTSARLPLELEVIQE  607



>gb|KEH40317.1| receptor-like kinase [Medicago truncatula]
Length=572

 Score =   509 bits (1310),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 271/570 (48%), Positives = 363/570 (64%), Gaps = 41/570 (7%)
 Frame = -2

Query  1825  FELLCTDKGETALENPFPLLNATLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPIL  1646
             F L C+      +E P          P PVK L+  IDC+ + + +S    C   +    
Sbjct  31    FRLSCSHNKNQIIEFP--------ADPVPVKLLVTDIDCQSQQLYLSHPQNCLSSIFVTH  82

Query  1645  NLSA-SPFSFENLYN-------FSIFSCSTHRNITAGSINISPIA--CLTKPGHFIYAAD  1496
             N S   PFS  +L+N        + F+CS+            P A   L+ P   IY AD
Sbjct  83    NFSLFYPFSLASLFNRPSSVNNVTFFNCSSVGQHLRSWEQTKPGAQDMLSCP---IYVAD  139

Query  1495  SSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTGPSCRLKNNSTAEDADDCIAP  1316
              S  +    DL+ CT+MF    +P  ++  N    L W+  +              C+ P
Sbjct  140   LSESVIE-LDLLRCTRMFD-KVLPIDLSFRNNYLKLNWSEQTFH----------SQCLQP  187

Query  1315  LTKL-HTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALK  1139
               K  HT  +      G ++GS ++VV+  V +R+Y   +MK E+Q ++E FL+DY+A K
Sbjct  188   QIKSKHTSIIAA--TTGAIVGSTILVVLFGVFFRVYLYYRMKGEDQTRLENFLKDYEASK  245

Query  1138  PARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEM  959
             P R+SYADIK+ITD+F EKLGEG++G VYKGKLS  + VAVK+LNN+  +GDG EF+NE+
Sbjct  246   PTRFSYADIKRITDQFKEKLGEGAHGAVYKGKLSSQILVAVKMLNNT--EGDGREFINEV  303

Query  958   STIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIAL  782
              T+G IHH+NVVRL+G+CADGF+RALVY++  N SL+ F+ SP++K+ FLGW+ LQQIAL
Sbjct  304   GTMGKIHHVNVVRLLGFCADGFYRALVYDFFPNGSLQNFISSPDNKDVFLGWDLLQQIAL  363

Query  781   GIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARG  602
             GIA G+EYLHQGCDQRILHFDI P NILLD NF PKISDFG AKLCSK ++IVSMTAARG
Sbjct  364   GIANGIEYLHQGCDQRILHFDINPHNILLDDNFTPKISDFGLAKLCSKNQTIVSMTAARG  423

Query  601   TMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNI  422
             T+GY+APEVFSRNFGNVSYKSD+YS+GMLLLEMVGG+K +      E  Q  +P+WI+ +
Sbjct  424   TLGYMAPEVFSRNFGNVSYKSDIYSYGMLLLEMVGGRKNTKTVTDEENFQVLYPDWIHGL  483

Query  421   LSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPN  245
                G ++ I I++  D +IAKKL IVGLWCIQW+ V RP++K+V+QML  E +   +P N
Sbjct  484   F-EGGDIHIPIDEDGDYRIAKKLAIVGLWCIQWHSVHRPAMKMVVQMLHGELDKLKVPTN  542

Query  244   PFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             PF  +  +   A      F S L++I E++
Sbjct  543   PFNDSSSTNGTAYTATEYFNSELDVIQELE  572



>gb|KEH40353.1| receptor-like kinase [Medicago truncatula]
Length=600

 Score =   510 bits (1313),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 291/616 (47%), Positives = 383/616 (62%), Gaps = 66/616 (11%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLK----HIQPPECGYPGFELLCTDKGETALENPFPLLNA  1760
             +N+C   KCGN   +I FPF LK    H  P      GFEL CTDK ET LE        
Sbjct  26    KNQC-TEKCGN--LKIQFPFYLKNSINHTNPQ-----GFELSCTDKDETVLE--------  69

Query  1759  TLQPPFPVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFE----NLY-NFS  1598
                P  PVK  I+ ID + ++  I     C   QL  + NLS SPF F     N+  N S
Sbjct  70    --FPKIPVKVFIKRIDYKSQMFQIYDPKNCLARQLFKLGNLSVSPFQFHFHEFNIQRNVS  127

Query  1597  IFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYS  1418
              F C +++  +        I      G FI             +L+SC K+  V +V + 
Sbjct  128   FFRCDSNKECS--------IQQRESSGDFI-----------DPELVSCRKVSEVLNVGWM  168

Query  1417  IAQ--DNTVFSL--RWTGPSCRL---------KNNSTAEDADDCIAPLTKLHTGPLRKLK  1277
             I +  D+   SL   W+ P+C             N T     +C    +         L 
Sbjct  169   IEEWEDDVTESLIIEWSKPNCSFCEVQGKKCKWKNGTRNGEVECFVCKSDGIAKSTVLLI  228

Query  1276  VAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITD  1097
              AG ++GS +++++  V  RI R  KMK ++  +IE+FLEDY+ALKP R++YADIK+IT+
Sbjct  229   TAGVIVGSMILLLLANVFLRICRYFKMKGDDIARIEKFLEDYRALKPTRFTYADIKRITN  288

Query  1096  RFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRL  917
              F E LGEG++G+V+KG LS ++ VAVKVLN ++GDG+  +F+NE+ T+G IHH+NVVRL
Sbjct  289   GFKESLGEGAHGSVFKGMLSQEILVAVKVLNETQGDGN--DFINEVGTMGKIHHVNVVRL  346

Query  916   VGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCD  740
             +G+CADGFHRALVY++  N SL+ F+  P +K  FLG EKLQ+IALG+A+G+EYLH GCD
Sbjct  347   LGFCADGFHRALVYDFFPNGSLQNFLAPPENKEVFLGREKLQRIALGVARGIEYLHIGCD  406

Query  739   QRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNF  560
              RILHFDI P N+L+D N +PKI+DFG AKLC K +S VSMTAARGT+GYIAPEVFSRNF
Sbjct  407   HRILHFDINPHNVLIDDNLSPKITDFGLAKLCPKNQSTVSMTAARGTLGYIAPEVFSRNF  466

Query  559   GNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKG  380
             GNVSYKSD+YS+GMLLLEMVGG+K ++   + ET Q  +PEWI+N++  G+EV + IE  
Sbjct  467   GNVSYKSDIYSYGMLLLEMVGGRKNTN-QSAKETFQVLYPEWIHNLIE-GKEVRVNIEDE  524

Query  379   EDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSM-PPNPFTSTDPSKAKANK  203
              D +IAKKL +VGLWCIQW PVDRPS+K V+QMLE +    M PP PF S    +     
Sbjct  525   GDVRIAKKLALVGLWCIQWNPVDRPSMKTVVQMLEGDGEKLMAPPTPFDSIGADRTNEVI  584

Query  202   PGRLFTSALEIISEMD  155
             P RL    LE+I E++
Sbjct  585   PTRLLNFELEVIPEIN  600



>ref|XP_002513563.1| receptor serine/threonine kinase, putative [Ricinus communis]
 gb|EEF48966.1| receptor serine/threonine kinase, putative [Ricinus communis]
Length=378

 Score =   501 bits (1291),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 239/357 (67%), Positives = 294/357 (82%), Gaps = 5/357 (1%)
 Frame = -2

Query  1285  KLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKK  1106
             KL   G  LG FL+VV+    YRIY  ++ ++E Q +IE+FLEDYKALKP RYSYADIK+
Sbjct  12    KLMATGITLGLFLLVVVAFALYRIYNNHQAEEEHQSRIEKFLEDYKALKPTRYSYADIKR  71

Query  1105  ITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINV  926
             IT++F EKLG+G+YGTV+KGKLS ++FVAVK+LNNS G+G  EEF+NE+ T+G+IHHINV
Sbjct  72    ITNQFKEKLGQGAYGTVFKGKLSDEIFVAVKILNNSTGNG--EEFINEVGTMGNIHHINV  129

Query  925   VRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQ  749
             VRL+G+CADGF RALVYEYL N SLEKF+ S + KN  L W+KLQ IA+ IA G++YLHQ
Sbjct  130   VRLIGHCADGFRRALVYEYLPNESLEKFISSGDGKNLSLSWKKLQDIAVSIANGIQYLHQ  189

Query  748   GCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFS  569
             GCD RILHFDIKP NILLD+NFNPKISDFG AKLCSK++S +SMT ARGTMGYIAPEV+S
Sbjct  190   GCDHRILHFDIKPHNILLDENFNPKISDFGLAKLCSKDQSAISMTTARGTMGYIAPEVYS  249

Query  568   RNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQI  389
             RNFGNVSYKSDVYSFGM+LLEMVGG+K +D+T   + NQ YFPE +Y  L  GEE+ I++
Sbjct  250   RNFGNVSYKSDVYSFGMVLLEMVGGRKNNDVTVEND-NQVYFPERVYKQLDEGEELRIRL  308

Query  388   EKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPS  221
             ++  D++I KKLTIVGLWCIQW+P+DRPS+K V+QMLE +    +MPPNPF S  P+
Sbjct  309   KEEGDAEIVKKLTIVGLWCIQWHPIDRPSMKSVVQMLEEDVNKLTMPPNPFASRGPT  365



>gb|KEH40373.1| receptor-like kinase [Medicago truncatula]
Length=602

 Score =   509 bits (1312),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 292/607 (48%), Positives = 384/607 (63%), Gaps = 45/607 (7%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             +N C   KCG     I FPF LK+         GFEL CTDKGET LE P      T+Q 
Sbjct  25    KNPC-TEKCGK--VRIQFPFHLKNNTTNHTNPQGFELSCTDKGETMLEIP------TIQ-  74

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
                +K  I+ ID + +   I     C   QLL + NLS SPF F+ L  F      T RN
Sbjct  75    ---LKLFIKRIDYKAQKFQIYDPKNCLARQLLKLGNLSVSPFQFQ-LPEFD-----TRRN  125

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ--DNTV  1397
             I     NIS   C +     I   DSS + +    L+SC K+  V +V + I +  D+  
Sbjct  126   I-----NISFFHCDSNKECPILLRDSS-HDFIDPKLVSCRKVSEVLNVGWMIEEWEDDVA  179

Query  1396  FSL--RWTGPSCRL---------KNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSF  1250
              SL  +W+ P+C             N T     +C    +         L   G ++GS 
Sbjct  180   ESLIMKWSKPNCSFCEVQGKKCKWKNGTRNGEVECFVCKSDGIARSTVLLITTGVIVGSM  239

Query  1249  LVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEG  1070
             +++++     RIYR  KMK ++  +IE FLEDY+A+KP R++YADIK+IT+ F E LGEG
Sbjct  240   ILLLLANGFLRIYRYFKMKGDDITRIENFLEDYRAMKPTRFTYADIKRITNGFKENLGEG  299

Query  1069  SYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFH  890
             ++G V+KG LS ++ VAVKVLN ++GDG+  +F+NE+ T+G IHH NVVRL+G+CADGFH
Sbjct  300   AHGAVFKGMLSQEILVAVKVLNETQGDGN--DFINEVRTMGKIHHFNVVRLLGFCADGFH  357

Query  889   RALVYEYLVNNSLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIK  713
             RALVY++  N SL+KF+  P N+  FLGWEKLQ+IALG+A+G+EYLH GCD RILHFDI 
Sbjct  358   RALVYDFFPNGSLQKFLAPPENNDVFLGWEKLQRIALGVARGIEYLHIGCDHRILHFDIN  417

Query  712   PRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDV  533
             P N+L+D N +PKI+DFG AKLC K +S VS+TAARGT+GYIAPEVFSRNFGNVSYKSD+
Sbjct  418   PHNVLIDDNLSPKITDFGLAKLCPKNQSTVSITAARGTLGYIAPEVFSRNFGNVSYKSDI  477

Query  532   YSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKL  353
             YS+G+LLLEMVGG+K +++ G  ET Q  +PEWI+N++   ++V + IE   D +IAKKL
Sbjct  478   YSYGILLLEMVGGRKNTNVLGE-ETFQVLYPEWIHNLIE-DKDVRVNIEDEGDVRIAKKL  535

Query  352   TIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSM-PPNPFTSTDPSKAKANKPGRLFTSAL  176
              +VGLWCIQW PVDRPS+K V+QMLE +    M PP PF S   ++     P R     L
Sbjct  536   ALVGLWCIQWNPVDRPSMKTVVQMLEGDGVNLMAPPTPFDSIGANRTNQVIPPRHLNFEL  595

Query  175   EIISEMD  155
             E+I E+D
Sbjct  596   EVIPEID  602



>ref|XP_010662834.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=700

 Score =   513 bits (1321),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 264/465 (57%), Positives = 333/465 (72%), Gaps = 20/465 (4%)
 Frame = -2

Query  1510  IYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTGPSC-----------R  1364
             +Y A SS Y  +  +L SC K+F+ +     +      F + W+ P C           R
Sbjct  243   VYVAPSS-YSLAEVNLSSCQKIFNATLPDNYMFDHEREFYMNWSKPMCGNCEAKGNKCQR  301

Query  1363  LKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEE  1184
              KNNST E   +CI    K    P+ K+ +   +LG       + + + +YR NK+K+E 
Sbjct  302   KKNNST-EPEIECIDKPAK--GAPMDKMVLTEAILGFLHFTFGIFIIFIVYRSNKLKREH  358

Query  1183  QVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLN  1004
             +V I++FLEDY+ALKP+RYSYADIKKIT+ F +KLG+G YGTVYKGKLS +VFVAVK+L+
Sbjct  359   RVNIQKFLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGTVYKGKLSNEVFVAVKILD  418

Query  1003  NSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPND  824
             + KG+G  E+F+NE+ T+ +IHH+NVVRL+G+CADG+ RAL+YE+L N SL+KF+FS   
Sbjct  419   DFKGNG--EDFINEVGTMSTIHHVNVVRLLGFCADGYKRALIYEFLPNESLDKFIFSAFG  476

Query  823   KNF-LGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKL  647
              N+ LGW KLQ I +GIAKG+EYLHQGCDQRILH DIKP NILLD NFNPKISDFG AKL
Sbjct  477   NNYSLGWHKLQDIVVGIAKGIEYLHQGCDQRILHLDIKPHNILLDHNFNPKISDFGLAKL  536

Query  646   CSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGS  467
             CSKE+S VSMTAARGTMGYIAPE+ SRNFGNVS KSDVYSFGMLL+EMVGG+K  D T  
Sbjct  537   CSKEQSAVSMTAARGTMGYIAPEMLSRNFGNVSSKSDVYSFGMLLIEMVGGRKNIDAT-V  595

Query  466   PETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVI  287
               T+Q YFPEW+YN L + +EV I+IE   D KIAKKL+I+GLWCIQWYP+DRPS+K+V+
Sbjct  596   ENTSQAYFPEWLYNHLDQEQEVHIRIEDESDIKIAKKLSIIGLWCIQWYPIDRPSMKIVV  655

Query  286   QMLEAEEPP-SMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
              MLE EE    MPPNPFTS   ++    +        L IISE++
Sbjct  656   GMLEGEEGNLVMPPNPFTSMGQTRTSVRRRKTSIQPELTIISEIE  700


 Score = 88.2 bits (217),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 64/215 (30%), Positives = 104/215 (48%), Gaps = 29/215 (13%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             +EC   +C ++GP I FPFRLKH QP  CGYP FEL C+++  T LE P  ++       
Sbjct  25    DECKASRCSHHGPVIRFPFRLKH-QPEHCGYPEFELSCSEEKRTILELPSSVI-------  76

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRNIT  1565
                   ++ I+   + I +   D C  + +  LNL AS F++    +FS F+CS  +   
Sbjct  77    ----LWVKEINYTSQEIFVQYPDDCLPRQILNLNLPASFFTYYT-NDFSFFNCSESK---  128

Query  1564  AGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLR  1385
             A    +  I C     + +Y A  S Y  +  +L SC K+F+ +++P+    +   F ++
Sbjct  129   AEIYELRSIPCSFLSSNPVYVA-PSYYTLAGVNLSSCRKIFN-ATLPFFYINEGE-FWMK  185

Query  1384  WTGP----------SCRLKNNSTAEDADDCIAPLT  1310
             W  P           C+ K N++ E   +C   +T
Sbjct  186   WLKPMCGNCEAKGNKCQRKKNNSREPEINCSEDIT  220



>ref|XP_009609373.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
tomentosiformis]
Length=603

 Score =   509 bits (1310),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 294/583 (50%), Positives = 368/583 (63%), Gaps = 49/583 (8%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             N+C   +C ++GP I FPFRL+H QP  CGYPGFEL CT+             N T+   
Sbjct  25    NDCKESRCNSDGPSIRFPFRLQH-QPQHCGYPGFELSCTN-------------NKTILST  70

Query  1744  FP--VKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN---LYNFSIFSCST  1580
              P  +  ++E ID   + I +     C L LL   N SASPF F +   L NFSIFS S 
Sbjct  71    LPNSLILIVEDIDYASQEITLYCPTSCILNLL-YFNFSASPFLFNDEPLLCNFSIFSPSG  129

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNT  1400
               N   GS + S     + PG    +    L  Y  +      K+  +SSVP     D +
Sbjct  130   ISNSDFGSQDCSAT---SDPGLIALSNLEPLKDYLGSSHYK--KIAEISSVPC----DLS  180

Query  1399  VFSLR--WTGP----------SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLG  1256
              + LR  W  P           C  KN S          P T    G   +  +AG VLG
Sbjct  181   YYPLRMSWLNPKCGDCEGLGMDCGFKNYSNQLGTKCFDRPSTT--KGGFTEPLIAGGVLG  238

Query  1255  SFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLG  1076
               L+ +I+L  +  Y  +K+++E Q ++E+FLEDY+AL+P RY+YA+IKKIT+ F E+LG
Sbjct  239   FLLLGIIMLALHEFYSSSKIERENQARVEKFLEDYRALRPTRYTYAEIKKITNMFHERLG  298

Query  1075  EGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADG  896
             EG+YG VYKG LS ++ VAVKVLN+S G+G  EEF+NE++ +G IHH NV+RLVGYCADG
Sbjct  299   EGAYGVVYKGTLSNEIHVAVKVLNDSIGNG--EEFINEVAAMGKIHHFNVIRLVGYCADG  356

Query  895   FHRALVYEYLVNNSLEKFVFSPNDKNF--LGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
             F  ALVYEYL N SL+K +F    K+   L W+KL  IA+GIAKG+EYLHQGCDQ+ILHF
Sbjct  357   FRNALVYEYLPNQSLDKLIFPARSKDHINLNWKKLHDIAMGIAKGLEYLHQGCDQQILHF  416

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DIKP+NILLD N NPKISDFG AKLCSKEKS+V+MT ARGTMGYIAPEV S NFG  S+K
Sbjct  417   DIKPQNILLDHNLNPKISDFGLAKLCSKEKSVVTMTEARGTMGYIAPEVLSSNFGKASHK  476

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIA  362
             SDVYSFGMLLLEMVGG+K  D   S   +Q  F EWI+  L+ GEE++I+IE+ +D  IA
Sbjct  477   SDVYSFGMLLLEMVGGRKNFDAKAS--NSQVNFSEWIHQRLNEGEELKIRIEEDDDIIIA  534

Query  361   KKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTS  233
             +KL I+GLWCIQW   DRPSIK+V QMLE        P PFT+
Sbjct  535   RKLAIIGLWCIQWNATDRPSIKIVTQMLEGNGSNLTIPPPFTA  577



>ref|XP_010100000.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB81105.1| putative receptor-like protein kinase [Morus notabilis]
Length=595

 Score =   508 bits (1309),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 290/605 (48%), Positives = 378/605 (62%), Gaps = 49/605 (8%)
 Frame = -2

Query  1933  YDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATL  1754
             YDR +     CG     I FPFRL+  QP       F+L CT K ET L  PF       
Sbjct  24    YDRTKS--SWCGKQLTPIKFPFRLRDSQPKSYCRTDFDLFCTSKNETVLHLPF-------  74

Query  1753  QPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLP---ILNLSASPFSFENLY-NFSIFSC  1586
                 P+ F +  ID   + I +   D  + +  P    +NLS+SPF F + + + ++ +C
Sbjct  75    ---VPINFYVSGIDYHSQKIGVYIPDDQWSRKNPGLEFINLSSSPFRFTHGFSHVTLLNC  131

Query  1585  STHRNITAGSINISPIACLTKPG---HFIYAADSSLYLYSATDLISCTKMFHVSSV--PY  1421
              +           SP     +PG   H I    S+ ++      +SC+KM+   S   P 
Sbjct  132   PSQP---------SPSGIPCRPGGHSHSICPVFSNSHIEYYRQFVSCSKMYDFGSPVDPN  182

Query  1420  SIAQDNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVV  1241
              +++    FSL W       K N + ++   C            R  +  G   GSF+++
Sbjct  183   DMSKLMGPFSLTWYYEEQHKKENGSGQEFK-CQN----------RVQQRKGSTAGSFVIL  231

Query  1240  VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYG  1061
             ++V++       +    E +++IE+FLE+Y+  +P+RY+YADIK+IT++F +KLG+G+YG
Sbjct  232   MMVVIAILYAYPSDKDAENRLRIEKFLEEYRVFQPSRYAYADIKRITNKFQKKLGQGAYG  291

Query  1060  TVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRAL  881
             TV+KGKLS D+ VAVKVL+N+   G+  EF+NE++ +G IHH+NV RLVGYCADG  RAL
Sbjct  292   TVFKGKLSNDILVAVKVLDNNT-RGNRVEFINEVAIMGRIHHVNVARLVGYCADGLRRAL  350

Query  880   VYEYLVNNSLEKFVFS--PNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPR  707
             VYE+L N SLEK++ S   N K  L WEKLQQIALGIAKG+EYLHQGCDQRILHFDIKPR
Sbjct  351   VYEFLSNGSLEKYLSSKASNKKCSLSWEKLQQIALGIAKGIEYLHQGCDQRILHFDIKPR  410

Query  706   NILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYS  527
             NILLD+NF PKI+DFG AKLCSK+ SIVSMT ARGT GYIAPEVFSRNFGNVSYKSDVYS
Sbjct  411   NILLDRNFIPKIADFGLAKLCSKDTSIVSMTTARGTKGYIAPEVFSRNFGNVSYKSDVYS  470

Query  526   FGMLLLEMVGGKKKSDITGSPETNQD--YFPEWIYNILSRGEEVEIQIEKGEDSKIAKKL  353
             FGMLLLEMV G  K + +G    N D  Y+PEWIYN+L  G E+ I+I++  D+KIAKKL
Sbjct  471   FGMLLLEMVKGSWKYN-SGWKVENADEIYYPEWIYNMLEEG-ELMIKIQEEPDAKIAKKL  528

Query  352   TIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRL-FTSAL  176
               VGLWCIQW+PV RP++K V+QMLEA E  +MPPNPF S   +      P R+     L
Sbjct  529   AFVGLWCIQWHPVSRPTMKFVVQMLEAGEELTMPPNPFASVGLTNPNNKIPTRVPMAMEL  588

Query  175   EIISE  161
             E I E
Sbjct  589   ETIDE  593



>ref|XP_010102664.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB93846.1| putative receptor-like protein kinase [Morus notabilis]
Length=604

 Score =   508 bits (1308),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 288/595 (48%), Positives = 377/595 (63%), Gaps = 47/595 (8%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CG     I FPFRL+  QP        +L CT K ET L  PF           P+ F +
Sbjct  41    CGKQLIPIKFPFRLRDSQPKSYCRTDLDLFCTSKNETVLHLPF----------VPINFYV  90

Query  1723  ESIDCEDRLIIISRVDGCFLQLLP---ILNLSASPFSFENLY-NFSIFSCSTHRNITAGS  1556
               ID   + I +   D  + +  P    +NLS+SPF F + + + ++ +C +  + +   
Sbjct  91    SGIDYHSQKIGVYIPDDQWSRKNPGLEFINLSSSPFRFTHGFSHVTLLNCPSQPSRSG--  148

Query  1555  INISPIACLTKPG---HFIYAADSSLYLYSATDLISCTKMFHVSSV--PYSIAQDNTVFS  1391
                  I C  +PG   H I A  S+ ++      +SC+KM+   +   P  +++    FS
Sbjct  149   -----IPC--RPGGHSHSICAVFSNSHIEYYRQFVSCSKMYDFGAPVDPNDMSKLMGPFS  201

Query  1390  LRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIY  1211
             L W         N + ++   C            R  +  G   GSF+++++V++     
Sbjct  202   LTWYYEEQHKNENGSGQEFK-CQN----------RVQQRKGSTAGSFVILMMVVIAILYA  250

Query  1210  RLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGD  1031
               +    E +++IE+FLE+Y+  +P+RYSYADIK+IT++F +KLG+G+YGTV+KGKLS D
Sbjct  251   YPSDKDAENRLRIEKFLEEYRVFQPSRYSYADIKRITNKFQKKLGQGAYGTVFKGKLSND  310

Query  1030  VFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSL  851
             + VAVKVL+N+   G+  EF+NE++T+G IHH+NV RLVGYCADG  RALVYE+L N SL
Sbjct  311   ILVAVKVLDNNT-RGNRVEFINEVATMGRIHHVNVARLVGYCADGLRRALVYEFLPNGSL  369

Query  850   EKFVFS--PNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNP  677
             EK++ S   N K  L WEKLQQIALGIAKG+EYLHQGCDQRILHFDIKPRNILLD+NF P
Sbjct  370   EKYLSSKASNKKCSLSWEKLQQIALGIAKGIEYLHQGCDQRILHFDIKPRNILLDRNFIP  429

Query  676   KISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVG  497
             KI+DFG AKLCSK+ SIVSMT ARGT GYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMV 
Sbjct  430   KIADFGLAKLCSKDTSIVSMTTARGTKGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVK  489

Query  496   GKKKSDITGSPETNQD--YFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQW  323
             G  K + +G    N D  Y+PEWIYN+L  G E+ I+I++  DSKIAKKL +VGLWCIQW
Sbjct  490   GSWKYN-SGWKVENADEIYYPEWIYNMLEEG-ELMIKIQEEPDSKIAKKLALVGLWCIQW  547

Query  322   YPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRL-FTSALEIISE  161
             +PV RP++K V+QMLEA E  +MPPNPF S   +      P R+     LE I E
Sbjct  548   HPVSRPTMKFVVQMLEAGEELTMPPNPFASVGLTNPNNKIPTRVPMAMELETIDE  602



>ref|XP_003543974.2| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Glycine max]
Length=614

 Score =   506 bits (1304),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 288/618 (47%), Positives = 384/618 (62%), Gaps = 56/618 (9%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             +NEC    CG   P I FPF+L      EC  PGF L CTDK ET +     +L+     
Sbjct  24    QNECKKLSCGPGQPLIRFPFQLVKGIKDECANPGFCLYCTDKKETMV-----VLST----  74

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGC----FLQL----LPILNLSASPFSFENLYNFSIF  1592
                ++F + +I  E    +++  + C    FLQ+    L    L    F  E   N S F
Sbjct  75    ---IEFRVYTIHYESNFFMLTDPENCLPNKFLQIDNFFLQHNQLELGLFGDERTNNLSFF  131

Query  1591  SCST-----HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSV  1427
             +CS+      R    GS   +    ++ P     + DS L L    DL SCTKMF  +S 
Sbjct  132   NCSSVGLRHLRKQVYGSDFSNQQDMISCPIFVSESYDSVLGL----DLTSCTKMFDTTSP  187

Query  1426  PYSIAQDNTVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLK  1277
               +      +  +RW+          G  C+ KNNS  E   +C+    K    P   + 
Sbjct  188   VTAYDLQLNILIMRWSIPNCTKCEAKGKRCKWKNNSNTEADIECVDCKRKRIHVPQSFIF  247

Query  1276  VAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITD  1097
                   GS L+ ++ +V ++I    + K+E+Q ++ +FLEDY+A KPAR++YAD+K+IT 
Sbjct  248   AT---TGSILLGLVAIVIFKIALYFRQKEEDQARVAKFLEDYRAEKPARFTYADLKRITG  304

Query  1096  RFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRL  917
              F EKLGEG++G V++GKLS ++ VAVK+LNN+  +G+G+EF+NE+  +G IHHINVVRL
Sbjct  305   GFKEKLGEGAHGAVFRGKLSNEILVAVKILNNT--EGEGKEFINEVGIMGKIHHINVVRL  362

Query  916   VGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCD  740
             +G+CA+GFHRALVY    N SL++F+  P+DK+ FLGWEKLQQIALGIAKG+EYLH+GC+
Sbjct  363   LGFCAEGFHRALVYNLFPNGSLQRFIVPPDDKDHFLGWEKLQQIALGIAKGIEYLHEGCN  422

Query  739   QRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNF  560
             Q I+HFDI P N+LLD NF PKISDFG AKLCSK  S+VSMTAARGT+GYIAPEVFS+NF
Sbjct  423   QPIIHFDINPHNVLLDDNFTPKISDFGLAKLCSKNPSLVSMTAARGTLGYIAPEVFSKNF  482

Query  559   GNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDY---FPEWIYNILSRGEEVEIQI  389
             GNVSYKSD+YS+GMLLLEMVGG+K   ++ +    QD+   +P+WI+N++    +V I +
Sbjct  483   GNVSYKSDIYSYGMLLLEMVGGRKNVAMSSA----QDFHVLYPDWIHNLID--GDVHIHV  536

Query  388   EKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLE--AEEPPSMPPNPFTSTDPSKA  215
             E   D KIAKKL IVGLWCIQW PV+RPSIK VIQMLE   E   ++PPNPF ST  +  
Sbjct  537   EDECDIKIAKKLAIVGLWCIQWQPVNRPSIKSVIQMLETGGESQLNVPPNPFQSTTSTIT  596

Query  214   KANKPGRLFTSALEIISE  161
               +         LE+I E
Sbjct  597   GGHTRVTRRPLELEVIQE  614



>gb|EYU21046.1| hypothetical protein MIMGU_mgv1a023761mg [Erythranthe guttata]
Length=553

 Score =   504 bits (1297),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 282/596 (47%), Positives = 377/596 (63%), Gaps = 73/596 (12%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             ++C+P +C  +GP I FPFR K+ QP +CGYPGF+L C  K +T L             P
Sbjct  22    DDCMPTRCRGDGPIILFPFRQKNQQPQQCGYPGFDLYCDHKNDTVL-----------VLP  70

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPI-LNLSASPF---SFENLYNFSIFSCSTH  1577
             F V  +++ ID   + I++   + C  Q LP  LNLSASPF    F +  ++++F+CS  
Sbjct  71    FSVNVVVKEIDYAFQTILVYDQEMCLTQKLPRDLNLSASPFLTNYFTDADDYTLFNCSD-  129

Query  1576  RNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTV  1397
                  G    + I CL    + IYA                    HV++V          
Sbjct  130   ---PPGRDLRTVIPCLGNSNYQIYA--------------------HVTNV----------  156

Query  1396  FSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYR  1217
                       +++    A         +  + T    ++       GS L  ++++    
Sbjct  157   ----------KIETKDAARIIIRHRIVIISVLTNSQTQIITVLSCFGSILAAILLVAFLY  206

Query  1216  IYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLS  1037
             +Y   ++ +E +  I +FL DY ALKP+R+SY+ IK+IT +F+EKLGEG YG VYKGKL+
Sbjct  207   LYIRVRIYRENRTMIGKFLRDYGALKPSRFSYSAIKRITHQFNEKLGEGGYGIVYKGKLN  266

Query  1036  GDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNN  857
              ++ VAVKVLNNSKG+G  EEFVNE+STIG IHH+N+VRL+G+CADGF RALVYE+L N 
Sbjct  267   NEIDVAVKVLNNSKGNG--EEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNG  324

Query  856   SLEKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFN  680
             SLEK +F   +++  L WEKL+ IALGIAKG+EYLH+GCDQ+ILHFDIKP+N+LLD N N
Sbjct  325   SLEKSIFQAGSNRIALDWEKLKDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLLDHNLN  384

Query  679   PKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMV  500
             PKI DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYSFGMLLLEMV
Sbjct  385   PKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMV  444

Query  499   GGKKKSDITGSPETNQDYFPEWIYNILSRGEE-VEIQIEKGEDSKIAKKLTIVGLWCIQW  323
             GG+K  D   +  T+Q YFP+WIYN ++  +  +  QI++ E + IA+KL+IVGLWCIQW
Sbjct  445   GGRKNEDHNAN-NTSQVYFPQWIYNHINVEDNPMWAQIDE-EGNSIARKLSIVGLWCIQW  502

Query  322   YPVDRPSIKVVIQMLEAE-EPPSMPPNPF-TSTDPSKAKANKPGRLFTSALEIISE  161
              P DRPS+KVV+QMLE E +  ++PPNPF  +T+P        G+ + + + II E
Sbjct  503   CPTDRPSMKVVVQMLEGECDDLTLPPNPFPATTNPID------GKHYQTQMSIILE  552



>ref|XP_008347687.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=379

 Score =   497 bits (1280),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 237/373 (64%), Positives = 292/373 (78%), Gaps = 8/373 (2%)
 Frame = -2

Query  1264  VLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSE  1085
             VLGSF +V+I++  +R+Y  ++++K+ Q  IE FLE+Y+AL+P RYSYADIK+IT++F +
Sbjct  12    VLGSFSLVLILVGLHRVYTSDQIEKQRQTMIEEFLENYRALRPTRYSYADIKRITNKFRD  71

Query  1084  KLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYC  905
             KLG+G++GTV+KGKLS ++FVAVK+LNNSKG+G   EF+NE+ T+G IHH+NVVRLVGYC
Sbjct  72    KLGQGTFGTVFKGKLSSEIFVAVKMLNNSKGNGG--EFINEVGTLGQIHHVNVVRLVGYC  129

Query  904   ADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRIL  728
             ADGF RALVYE+  N SL+ F+ S + KN FLGWEKLQ I + IAKG+EYLH GCDQRIL
Sbjct  130   ADGFRRALVYEFAPNGSLQNFISSADSKNYFLGWEKLQHITISIAKGIEYLHHGCDQRIL  189

Query  727   HFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVS  548
             HFD KP N+LLD  FNPKISDFG AKLCSK++S VSMT ARGTMGYIAPEVFSRNFG VS
Sbjct  190   HFDXKPHNVLLDDXFNPKISDFGLAKLCSKDQSAVSMTTARGTMGYIAPEVFSRNFGTVS  249

Query  547   YKSDVYSFGMLLLEMVGGKKKSDITGSPETN--QDYFPEWIYNILSRGEEVEIQIEKGED  374
             YKSDVYSF MLLLEMVGGKK   +   PE N  Q YFPEWIYN+L +G+++ I +E   D
Sbjct  250   YKSDVYSFXMLLLEMVGGKKNVQV---PEENTGQVYFPEWIYNLLEQGDDIRIHVEGEND  306

Query  373   SKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGR  194
             +KIA KL IVGLWCIQWYPVDRPS+K V+QMLE E+   +PPNPF+     +       R
Sbjct  307   AKIATKLAIVGLWCIQWYPVDRPSMKAVVQMLEGEDNVKLPPNPFSPAGSVRNGITMLAR  366

Query  193   LFTSALEIISEMD  155
                  L  ISE++
Sbjct  367   RHRQELPXISELE  379



>ref|XP_007141187.1| hypothetical protein PHAVU_008G174300g [Phaseolus vulgaris]
 gb|ESW13181.1| hypothetical protein PHAVU_008G174300g [Phaseolus vulgaris]
Length=609

 Score =   505 bits (1301),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 282/600 (47%), Positives = 381/600 (64%), Gaps = 43/600 (7%)
 Frame = -2

Query  1936  SYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNAT  1757
             S D NEC    CG N   I FPF+L      EC +PG+ L CT +  T L  P       
Sbjct  30    SSDHNECRELSCGLNQTPIRFPFQLAK-GTHECAHPGYCLYCTQENNTMLLLP-------  81

Query  1756  LQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCST-  1580
                   +KF + +ID E+R I +     C  +     N S + + F      S F CS+ 
Sbjct  82    -----TIKFHVINIDYENRQISLKDPKNCLPKYFLNHNNSFNHYYFTG-SGVSFFDCSSL  135

Query  1579  -HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDN  1403
              +R++     N   +  ++ P   IYA DS   +    DL  C+K+  V++   +I    
Sbjct  136   GYRHLRNQYGNYQDM--ISCP---IYATDSQASILEW-DLTFCSKISDVTAPVSAIEMQQ  189

Query  1402  TVFSLRWTGP----------SCRLKNNSTAE-DADDCI--APLTKLHTGPLRKLKVAGEV  1262
               F L W+ P           C+ KNNST   +  DC     L K  T     +  +  +
Sbjct  190   NEFMLTWSKPVCSACEAEGKRCKWKNNSTELIECLDCSDHKGLHKRITNFRSFIFSSTVI  249

Query  1261  LGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
             +GS +  ++ ++ ++I+R  + K+E+Q ++++FLEDYKA KP R++YAD+K+ITD F EK
Sbjct  250   VGSIVFGLLGIMAFKIFRYFREKEEDQARVDKFLEDYKAEKPTRFTYADVKRITDGFKEK  309

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             LGEG++G V+KGKLS ++ VAVK++NN++GDG+  EF+NE+  +G IHHI+VVRL+G+CA
Sbjct  310   LGEGAHGAVFKGKLSNEILVAVKIINNTEGDGN--EFINEVGIMGKIHHIHVVRLLGFCA  367

Query  901   DGFHRALVYEYLVNNSLEKFVFSPNDK-NFLGWEKLQQIALGIAKGVEYLHQGCDQRILH  725
             +G HRALVY      SL+ F+F P+DK +FLGWEK+Q IALGIAKG+EYLHQGC+  I+H
Sbjct  368   EGIHRALVYNLFPKGSLQSFIFPPDDKEHFLGWEKMQHIALGIAKGIEYLHQGCNHPIIH  427

Query  724   FDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSY  545
             FDI PRN+LLD NF PKISDFG AKLC K  S+VSMTAARGT+GY+APEVFSRNFGNVSY
Sbjct  428   FDINPRNVLLDDNFTPKISDFGLAKLCFKNPSLVSMTAARGTLGYMAPEVFSRNFGNVSY  487

Query  544   KSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKI  365
             KSD+YS+GMLLLEMVGG+K  D++ S E     +P+WI+N++    ++ I IE   D KI
Sbjct  488   KSDIYSYGMLLLEMVGGRKNVDMSSS-ENIHVLYPDWIHNLVDG--DIRIHIEYEGDVKI  544

Query  364   AKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP--SMPPNPFTSTDPSKAKANKPGRL  191
             AKKL IVGLWCIQW+ V+RPSIK VIQMLE +E    ++PPNPF ST  +   A +P  L
Sbjct  545   AKKLAIVGLWCIQWHSVNRPSIKSVIQMLETKEEHQLTVPPNPFHSTTSTLTSARRPLEL  604



>gb|KCW89167.1| hypothetical protein EUGRSUZ_A01480 [Eucalyptus grandis]
Length=402

 Score =   497 bits (1280),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 250/406 (62%), Positives = 306/406 (75%), Gaps = 10/406 (2%)
 Frame = -2

Query  1366  RLKNNSTAEDADDCIAPLTKLHTG--PLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMK  1193
             RL   ST+  A D  A  +  + G  PL     +G V+G FL +V++     +    +  
Sbjct  3     RLDCQSTS--AYDVFAVESYSYVGDLPLVSCMRSGRVVGFFLFLVVLSGLSYVINEKRRD  60

Query  1192  KEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVK  1013
             K  Q+KIE FL DY+ALKP RYSY DIK+IT+ F EKLG+G+YGTVYKGKLS ++FVAVK
Sbjct  61    KAFQLKIESFLHDYEALKPTRYSYNDIKRITNDFEEKLGQGAYGTVYKGKLSNEIFVAVK  120

Query  1012  VLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFS  833
             +L+NS G+G  EEF+NE+ST+G IHH+NVVR+VG+CADGF RALVYE+L N SLEKF+F 
Sbjct  121   MLDNSFGNG--EEFINEVSTMGRIHHVNVVRMVGFCADGFRRALVYEFLPNESLEKFIFQ  178

Query  832   PND--KNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFG  659
               D    FL WE+L  IALG+AKG+EYLHQGCD +ILHFDIKP NILLD NFNPKI+DFG
Sbjct  179   GEDALDPFLSWERLHDIALGVAKGIEYLHQGCDHKILHFDIKPHNILLDNNFNPKIADFG  238

Query  658   QAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSD  479
              AKLCSKE+S VSMTAARGTMGYIAPEVFSRNFG+VS KSDVYSFGMLLLEMVGG+K  D
Sbjct  239   LAKLCSKEQSAVSMTAARGTMGYIAPEVFSRNFGSVSSKSDVYSFGMLLLEMVGGRKNVD  298

Query  478   ITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSI  299
             +  +   +Q YFP+W+YN L++ EE+EI+I +  D KIAKKL IVGLWCI WYP DRP +
Sbjct  299   VN-AKNMSQMYFPQWVYNHLNKDEELEIRIREDGDRKIAKKLAIVGLWCIHWYPADRPPV  357

Query  298   KVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISE  161
             K V+QMLE +E P MP NPF S+    A   + GRL+ + LE+I+E
Sbjct  358   KAVVQMLEGDEYPVMPKNPFVSSGSGDAAIMR-GRLWNTDLEVIAE  402



>ref|XP_008344513.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Malus 
domestica]
Length=523

 Score =   501 bits (1291),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 239/371 (64%), Positives = 298/371 (80%), Gaps = 6/371 (2%)
 Frame = -2

Query  1261  LGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
             LGS ++V++ +  YR+Y  ++ +KE +++IE FLEDYKALKP+RY YADI++IT++F +K
Sbjct  157   LGSLVLVLLTIAAYRVYSADRKEKESRLRIEGFLEDYKALKPSRYLYADIRRITNQFKDK  216

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             LG+G+YGTV+KGKL  + F+AVKVLN+SKGDG  EEFVNE+ T+G IHH+NV RLVG+CA
Sbjct  217   LGQGAYGTVFKGKLYSEFFIAVKVLNSSKGDG--EEFVNEVRTMGQIHHVNVARLVGFCA  274

Query  901   DGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILH  725
             D F RALVYE+  N SL+ F+ S + KN FLGW+KLQ IALGIAKG++YLHQGCDQRILH
Sbjct  275   DRFVRALVYEFFPNGSLQDFISSADCKNSFLGWDKLQDIALGIAKGIDYLHQGCDQRILH  334

Query  724   FDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSY  545
             FDIKP NILLDQNF PKISDFG AKLCSK++S+VSMT ARGTMGYIAPEVFSRNFGNVSY
Sbjct  335   FDIKPHNILLDQNFTPKISDFGLAKLCSKDQSMVSMTTARGTMGYIAPEVFSRNFGNVSY  394

Query  544   KSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKI  365
             K+DVYSFGMLL+EMVGG+K    T    TN+ Y+P+WIYN+L  G+++ I I +  D KI
Sbjct  395   KADVYSFGMLLIEMVGGRKNIGSTIENTTNEIYYPQWIYNLLEEGDDLRIHIGEEGDGKI  454

Query  364   AKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLF  188
              KKL IVGLWCIQW+PVDRP++K V+QMLE E E  +MPPNPF  T P+    + P R  
Sbjct  455   PKKLAIVGLWCIQWHPVDRPAMKTVVQMLEGEGESLTMPPNPFLPTGPTTRNGSIPARRL  514

Query  187   TSALEIISEMD  155
                LE I+E++
Sbjct  515   --ELEAIAELE  523



>ref|XP_008354849.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=616

 Score =   504 bits (1299),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 295/594 (50%), Positives = 384/594 (65%), Gaps = 54/594 (9%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             C    C ++GP I FPFRLK  QP  CGY GF+L CT  G T LE           P   
Sbjct  44    CKVXXCEHHGPAIRFPFRLKG-QPFSCGYHGFDLSCTTDGRTVLE----------MPSSS  92

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN---LYNFSIFSCSTHRNI  1568
              K ++E+I+   + I +   + C    LP    S+S F F +     N ++FSC +    
Sbjct  93    NKXIVETINYASQEIXVYXQNXC----LPKXIFSSSTFQFVHGPFXTNXTLFSCPSPLXE  148

Query  1567  TAGSINISPIAC---LTKPGH--FIYAADSSLYLYSATDLISCTKMFHVSSVP-YSIAQD  1406
             T     I    C      P +  + YA +    +    +L+SCTK    +SVP  S  + 
Sbjct  149   TDXXCXIELSRCPYGXDNPENQTYYYAVBGXCSI-XXMNLVSCTKQLDYTSVPDISXVKX  207

Query  1405  NTVFSLRWTGPSC----------RLK---------NNSTAEDADDCIAPLTKLHTGPLRK  1283
                  L+W+ PSC          RLK         +N T E   +C++  +   T     
Sbjct  208   YXSLXLQWSKPSCXXCEEMGKXCRLKRTIGQYNFTDNQTEET--ECVSEDS---TRGRTS  262

Query  1282  LKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKI  1103
             L+++G    S +V V+  + YR+Y  NK++K  Q++IERFL+DY A KP+RYSYADIK+I
Sbjct  263   LEISGIFTFSVVVTVVGTLIYRVYSSNKIEKTNQLRIERFLDDYIAHKPSRYSYADIKRI  322

Query  1102  TDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVV  923
             T++F+EKLG+G+YGTVYKG+LS D+ VAVK+LNNS  +  GE+F NE+ T+G +HH+NVV
Sbjct  323   TNQFNEKLGQGAYGTVYKGQLSSDLLVAVKILNNS--NEKGEDFJNEVGTMGRVHHVNVV  380

Query  922   RLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQG  746
             R VG+CADG+  ALVYEYL   SL+  + S + K+ FLGW+KL +IALGIAKG+EYLHQG
Sbjct  381   RXVGFCADGYTTALVYEYLPXGSLQNILSSADSKSAFLGWDKLHEIALGIAKGIEYLHQG  440

Query  745   CDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSR  566
             CD RILHFDIKP NILLDQNF PK+SDFG AKLCS+++S VSMT  RGT+GYIAPEVFSR
Sbjct  441   CDLRILHFDIKPHNILLDQNFTPKVSDFGLAKLCSRDQSAVSMTTIRGTIGYIAPEVFSR  500

Query  565   NFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQD-YFPEWIYNILSRGEEVEIQI  389
             NFGNVSYKSDVYSFGMLLLEMVGG+K         T+ + YFPEWIYN+L +G+++ I I
Sbjct  501   NFGNVSYKSDVYSFGMLLLEMVGGRKNFKFMEEDSTSSEVYFPEWIYNLLEQGDDLRIHI  560

Query  388   EKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
             E G D++ AKKL IVGLWC+QW+P+DRPS+K VIQMLE E +  ++P NPF ST
Sbjct  561   EDGGDAETAKKLAIVGLWCVQWHPIDRPSMKXVIQMLEGEGDNLTVPANPFRST  614



>emb|CAN78922.1| hypothetical protein VITISV_024237 [Vitis vinifera]
Length=556

 Score =   502 bits (1293),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 274/595 (46%), Positives = 366/595 (62%), Gaps = 68/595 (11%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             +EC   +C ++GP I FPFRLKH QP  CGYP FEL C+++  T LE            P
Sbjct  25    DECKASRCSHHGPVIRFPFRLKH-QPEHCGYPEFELSCSEEKRTILE-----------LP  72

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFE-NLYNFSIFSCSTHRNI  1568
             +  K  ++ I+   + I +   D C  + +   NLSASPF F  +  +FS F+CS ++  
Sbjct  73    YSGKLWVKEINYASQEIFVHYPDDCLQRQILNFNLSASPFQFTGDTDDFSFFNCSENK--  130

Query  1567  TAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSL  1388
                +  +S I C     + +Y   SS    +  +L SC K+F+ +   Y          +
Sbjct  131   ---TYELSSIPCNFLSSNPVYVT-SSFRSLAKVNLSSCRKIFNPTLPYYHTYGGEYDTFM  186

Query  1387  RWTGP---SCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYR  1217
              W+ P   +C  K N      ++   P  +    P +++     VLG       +L+ + 
Sbjct  187   NWSKPMCGNCEXKGNKCQRKKNNSTEPEIECIDEPAKEV-----VLGFLHFTFGILIIFI  241

Query  1216  IYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLS  1037
             IYR NK+K+E ++ +++FLEDY+AL+P+RYSYADIKKIT+ F +KL              
Sbjct  242   IYRCNKLKREHRINVQKFLEDYRALRPSRYSYADIKKITNNFKDKL--------------  287

Query  1036  GDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNN  857
                   VK+L++ KG+G  EEF+NE+ T+G+IHH+NVVRL+G+CADG+ +A    Y    
Sbjct  288   ------VKILDDFKGNG--EEFINEVRTMGTIHHVNVVRLLGFCADGYKQAFGNNYS---  336

Query  856   SLEKFVFSPNDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNP  677
                           LGW KLQ IA+GIAKG+EYLHQGCDQRILH DIKP NILLD NFNP
Sbjct  337   --------------LGWHKLQDIAIGIAKGIEYLHQGCDQRILHLDIKPHNILLDHNFNP  382

Query  676   KISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVG  497
             KISDFG AKLCSKE+S V MT A+GTMGYIAPE+FSRNFGNVSYK+DVYSFGMLL+EMVG
Sbjct  383   KISDFGLAKLCSKEQSAVFMTTAKGTMGYIAPEMFSRNFGNVSYKADVYSFGMLLIEMVG  442

Query  496   GKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYP  317
             G+K  D T    T+Q YFPEW+YN L + +EV I+IE+  D KIAKKL+I+GLWCIQWYP
Sbjct  443   GRKNIDAT-VENTSQAYFPEWLYNHLDQEQEVHIRIEEESDIKIAKKLSIIGLWCIQWYP  501

Query  316   VDRPSIKVVIQMLEAEEPP-SMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             +DRPS+K+V+ MLE EE    MPPNPFTS   ++    +        L +ISE++
Sbjct  502   IDRPSMKIVVGMLEGEEGNLVMPPNPFTSMGQTRTSVRRRKTSIQPELTVISEIE  556



>ref|XP_008373800.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=397

 Score =   496 bits (1277),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 237/388 (61%), Positives = 293/388 (76%), Gaps = 4/388 (1%)
 Frame = -2

Query  1315  LTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKP  1136
                L +G  RKL      LGSF V+V+V+  YR+Y  N+ +KE Q+KI++FLEDYKA KP
Sbjct  13    FNSLFSGATRKLVATCASLGSFAVLVLVVAAYRVYSSNRKEKESQLKIDKFLEDYKAHKP  72

Query  1135  ARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMS  956
             +RYSYADIK+IT++F +KLG+G+YGTV+KGKLS + FVAVKVLN+S  + +GE+F+ E+ 
Sbjct  73    SRYSYADIKRITNQFQDKLGQGAYGTVFKGKLSSECFVAVKVLNSS--NXNGEDFIKEVG  130

Query  955   TIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALG  779
              +G IHH+NVVRLV +CAD F+ ALVYE+  N SL  F+ S ++ N FLGW+KLQ IAL 
Sbjct  131   MMGXIHHVNVVRLVXFCADXFNXALVYEFFANGSLHXFISSADNNNRFLGWDKLQDIALA  190

Query  778   IAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGT  599
             +AKG+ YLHQ C QRILHFDIKP N+LLD NF PKISDFG AKLCSK++SIVSMT ARGT
Sbjct  191   VAKGIYYLHQECXQRILHFDIKPHNVLLDBNFTPKISDFGLAKLCSKDQSIVSMTTARGT  250

Query  598   MGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNIL  419
             MGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGG+K  D T +  T + Y+PEWIYN+L
Sbjct  251   MGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDXTSAIPT-EIYYPEWIYNLL  309

Query  418   SRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPF  239
               G++    + +  D    KKL IVGLWCIQW+P  RPS K V+QMLE  E  +MPPNPF
Sbjct  310   EEGDDJRXHLGEEGDGXTPKKLAIVGLWCIQWHPAGRPSXKEVVQMLEGGEXLTMPPNPF  369

Query  238   TSTDPSKAKANKPGRLFTSALEIISEMD  155
              ST P++  A  P R     LE I+E++
Sbjct  370   ASTXPARTNAXTPARNLNXQLEAIAELE  397



>ref|XP_007161447.1| hypothetical protein PHAVU_001G069600g [Phaseolus vulgaris]
 gb|ESW33441.1| hypothetical protein PHAVU_001G069600g [Phaseolus vulgaris]
Length=603

 Score =   503 bits (1294),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 286/617 (46%), Positives = 384/617 (62%), Gaps = 56/617 (9%)
 Frame = -2

Query  1936  SYDRNECLPR-KCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNA  1760
             S   NEC     CG N P I FPF+L       CGYP   L CT+  +T L  P      
Sbjct  18    SSAHNECDEELSCGPNQPPIRFPFQLIKEMGEPCGYPRICLSCTENNKTMLALP------  71

Query  1759  TLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLY-----NFSI  1595
                    +K L+  I+   + I ++  + CF             + FE+L+     N S 
Sbjct  72    ------TMKLLVTYINYRYQEIGLTDPENCFSNKFNQTINFIRTYQFESLHDGPHNNLSF  125

Query  1594  FSCST--HRNITA----GSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVS  1433
             F+C++  H ++      GS +   ++C   P +   + +S L L    DL SCTKMF ++
Sbjct  126   FNCTSAEHSHLRNYYEDGSDSQDMVSC---PIYVSNSFESVLQL----DLTSCTKMFDLT  178

Query  1432  SVPYSIAQDNTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRK  1283
             +   SI  +  V  LRW+ P+C            K N+T  D D       ++H      
Sbjct  179   APFASIHWNELV--LRWSKPNCAECKRKGKRCTWKTNNTTGDIDCFECKPKRIHVPKSFI  236

Query  1282  LKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKI  1103
                 G +L   LV+ +    ++     + K+E+Q ++++FLEDY+A KPAR++YAD+K+I
Sbjct  237   FASTGSILLGLLVIAV----FKSILYFRKKQEDQARVDKFLEDYRAEKPARFTYADLKRI  292

Query  1102  TDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVV  923
             T+ F EKLGEG++G V++GKLS ++ VAVK+LN+++GDG+  EF+NE+  +G IHHINVV
Sbjct  293   TNGFKEKLGEGAHGAVFRGKLSSEIPVAVKILNSTEGDGN--EFINEVGIMGKIHHINVV  350

Query  922   RLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQG  746
             RL+G+CADG HRALVY +  N SL+ F+F P DK+ FLGWEKLQ +ALGIAKG++YLHQG
Sbjct  351   RLLGFCADGLHRALVYNFFPNGSLQSFIFLPEDKDHFLGWEKLQHVALGIAKGIQYLHQG  410

Query  745   CDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSR  566
             C+Q I+HFDI P N+LLD NF PKISDFG AKLCSK  S+VSMTAARGT+GYIAPEVFSR
Sbjct  411   CNQPIIHFDINPHNVLLDDNFTPKISDFGLAKLCSKNPSLVSMTAARGTLGYIAPEVFSR  470

Query  565   NFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIE  386
             NFGNVSYKSD+YS+GMLLLEMVGG+K  D++ SP+     +P+WI+N++    +V I +E
Sbjct  471   NFGNVSYKSDIYSYGMLLLEMVGGRKNVDMS-SPQNLHVLYPDWIHNLVDG--DVHIHVE  527

Query  385   KGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSM--PPNPFTSTDPSKAK  212
                D KIAKKL I+GLWCIQW PV+RPSIK VI ML+ EE   +  PPNPF ST  + AK
Sbjct  528   DEGDVKIAKKLAIIGLWCIQWEPVNRPSIKSVIHMLQTEEENQLGVPPNPFHSTTSTTAK  587

Query  211   ANKPGRLFTSALEIISE  161
                  R     LE+I E
Sbjct  588   GLSSTRR-PLQLEVIQE  603



>gb|EYU21042.1| hypothetical protein MIMGU_mgv1a020230mg, partial [Erythranthe 
guttata]
Length=499

 Score =   498 bits (1281),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 291/584 (50%), Positives = 364/584 (62%), Gaps = 96/584 (16%)
 Frame = -2

Query  1894  NGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLIESI  1715
             +GP I FPF+ K+ QP  CGYPGF L C  K +T L             PF V  +++ I
Sbjct  5     HGPTIQFPFKRKNQQPQRCGYPGFNLYCDHKNDTVL-----------VLPFSVNVIVKKI  53

Query  1714  DCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCSTHRNITAGSINISP  1541
             +                  LP LNLSASPF F  + L N+++F+CS       G    + 
Sbjct  54    N-----------------YLPHLNLSASPFRFLIKFLDNYTLFNCSDQ----PGRDFRTL  92

Query  1540  IACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLRWTGPSCRL  1361
             I CL    +  Y  DS + L S   L SCTK + + SVP+ I ++N  FSL W+ P C  
Sbjct  93    IPCLGNSTYQSYVVDSKMPLESLP-LTSCTKTYELKSVPWEIFREND-FSLGWSKPEC--  148

Query  1360  KNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQ  1181
                S  E+ +                                     R    N    +  
Sbjct  149   ---SKCENKNK------------------------------------RCSSFNSTTLDRH  169

Query  1180  VKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNN  1001
                  FL DYKALKP+R+SY+DIK+IT +F+EKLGEG YG VYKGKL+ ++ VAVKVLNN
Sbjct  170   -----FLRDYKALKPSRFSYSDIKRITHQFNEKLGEGGYGIVYKGKLNNEIDVAVKVLNN  224

Query  1000  SKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSP-ND  824
             SKG+G  EEFVNE+STIG IHH+N+VRL+G+CADGF RALVYE+L N SLEK +F   ++
Sbjct  225   SKGNG--EEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNGSLEKSIFQAGSN  282

Query  823   KNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLC  644
             +  L WEKL+ IALGIAKG+EYLH+GCDQ+ILHFDI P+N+LLD N NPKI DFG AKLC
Sbjct  283   RITLDWEKLKVIALGIAKGIEYLHEGCDQQILHFDINPQNVLLDHNLNPKICDFGLAKLC  342

Query  643   SKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSP  464
             SKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYSFGMLLLEMVGG+K  D   + 
Sbjct  343   SKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKNEDHNVN-  401

Query  463   ETNQDYFPEWIYN-ILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVI  287
              T+Q YFP+WIYN I +    +  QI++ E + IA+KL+IVGLWCIQW P DRPS+KVV+
Sbjct  402   NTSQVYFPQWIYNHINAEDNPMWAQIDE-EGNSIARKLSIVGLWCIQWCPADRPSMKVVV  460

Query  286   QMLEAE-EPPSMPPNPFTSTDPSKAKANK-PGRLFTSALEIISE  161
             QMLE E +  +MPPNPF +T      AN   G+ + + + II E
Sbjct  461   QMLEGECDDLTMPPNPFPAT------ANPIDGKHYQTQMSIILE  498



>ref|XP_008354479.1| PREDICTED: probable receptor-like protein kinase At5g39030, partial 
[Malus domestica]
Length=381

 Score =   493 bits (1268),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 241/379 (64%), Positives = 294/379 (78%), Gaps = 11/379 (3%)
 Frame = -2

Query  1285  KLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKK  1106
             KL V G +LGS LV++++   YR+YR ++ +KE Q++IERFLEDYKALKP+RYSYADIK+
Sbjct  12    KLVVTGGILGSVLVLLMI-AAYRVYRADRKEKESQLRIERFLEDYKALKPSRYSYADIKR  70

Query  1105  ITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINV  926
             IT++F +KLGEG+YGTV+KG LS + F+AVKVLN+SKGDG  EEFVNE+ T+G IHH+NV
Sbjct  71    ITNQFKDKLGEGAYGTVFKGMLSSEFFIAVKVLNSSKGDG--EEFVNEVRTMGHIHHVNV  128

Query  925   VRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQ  749
              RLVG+CADGF RALVYE+  N SL+ F+ S + KN FLGW+KLQ IALGIAKG+EYLHQ
Sbjct  129   ARLVGFCADGFVRALVYEFFPNGSLQDFISSADSKNSFLGWDKLQDIALGIAKGIEYLHQ  188

Query  748   GCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFS  569
             GCD RILHFDIKP          PKISDFG AKLCSK++S+VSMT ARGTMGYIAPEVFS
Sbjct  189   GCDLRILHFDIKPXXXXXXXXXXPKISDFGLAKLCSKDQSLVSMTTARGTMGYIAPEVFS  248

Query  568   RNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQI  389
             RNFGNVSYK+DVYSFGMLLLEMVGG+K    T    TN+ Y+P+WIYN+L  G+++ I I
Sbjct  249   RNFGNVSYKADVYSFGMLLLEMVGGRKNIGSTTENTTNEIYYPQWIYNLLEEGDDLRISI  308

Query  388   EKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLE-AEEPPSMPPNPFTSTDPSKAK  212
              + ED KI KKL I+GLWCIQW+P DRPS+K  +QMLE   E   MPPNPF  T P+   
Sbjct  309   RQEEDRKIPKKLAIIGLWCIQWHPSDRPSMKTAVQMLEGGGESLIMPPNPFMPTGPTTRN  368

Query  211   ANKPGRLFTSALEIISEMD  155
             A +        LE I+E++
Sbjct  369   ARR------LELEAIAELE  381



>ref|XP_009356098.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Pyrus 
x bretschneideri]
Length=354

 Score =   491 bits (1265),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 234/362 (65%), Positives = 288/362 (80%), Gaps = 10/362 (3%)
 Frame = -2

Query  1234  VLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTV  1055
             ++  YR+Y  ++ +KE +++IERFLEDYKALKP+RYSYADIK+IT++F +KLGEG+YGTV
Sbjct  1     MIAAYRVYSADRKEKESRLRIERFLEDYKALKPSRYSYADIKRITNQFKDKLGEGAYGTV  60

Query  1054  YKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVY  875
             +KG LS +  +AVKVLN+SKGDG  EEFVNE+ T+G IHH+NV RLVG+CADGF RALVY
Sbjct  61    FKGMLSSEFLIAVKVLNSSKGDG--EEFVNEVRTMGHIHHVNVARLVGFCADGFARALVY  118

Query  874   EYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNIL  698
             E+  N SL+ F+ S + KN FLGW+KLQ IALGIAKG+EYLHQGCD RILHFDIKP N+L
Sbjct  119   EFFPNGSLQDFISSADSKNSFLGWDKLQDIALGIAKGIEYLHQGCDLRILHFDIKPHNVL  178

Query  697   LDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGM  518
             LDQNF PKISDFG AKLCSK++S+VSMT A+GTMGYIAPEVFSRNFGNVSYK+DVYS+GM
Sbjct  179   LDQNFTPKISDFGLAKLCSKDQSLVSMTTAKGTMGYIAPEVFSRNFGNVSYKADVYSYGM  238

Query  517   LLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGL  338
             LLLEMVGG+K         TN+ Y+P+WIYN+L  G+++ I I +  D KI KKL I+GL
Sbjct  239   LLLEMVGGRKNIGSITDNTTNEIYYPQWIYNLLEEGDDLRIHIGEEGDGKIPKKLAIIGL  298

Query  337   WCIQWYPVDRPSIKVVIQMLE-AEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISE  161
             WCIQW+P DRPS+K V+QMLE   E  SMPPNPF  T P+   A +        LE I+E
Sbjct  299   WCIQWHPSDRPSMKTVVQMLEGGGESLSMPPNPFVPTGPTSRNARR------LELEAIAE  352

Query  160   MD  155
             ++
Sbjct  353   LE  354



>ref|XP_007161451.1| hypothetical protein PHAVU_001G070000g [Phaseolus vulgaris]
 gb|ESW33445.1| hypothetical protein PHAVU_001G070000g [Phaseolus vulgaris]
Length=616

 Score =   501 bits (1289),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 286/618 (46%), Positives = 385/618 (62%), Gaps = 58/618 (9%)
 Frame = -2

Query  1936  SYDRNECLPR-KCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNA  1760
             S   NEC     CG N P I FPF+L       CGYP   L CT+  +T L         
Sbjct  31    SSAHNECDKELSCGPNQPPIRFPFQLIKEMGEPCGYPRICLSCTENNQTMLAIR------  84

Query  1759  TLQPPFPVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFENLY-----NFS  1598
                    +K L+  I    ++  ++  + CF  +    +N   S + FE+ Y     N S
Sbjct  85    ------TMKLLVSQISYRRQVFSLTDPENCFSNKFNQTINFIRS-YQFESPYERPHNNLS  137

Query  1597  IFSCSTHRN------ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHV  1436
              F+C++  N         GS +   ++C   P +   + +S L L    DL SCTKMF +
Sbjct  138   FFNCTSAENPHLRHQYEDGSDSQDMVSC---PIYIFNSFESVLQL----DLTSCTKMFDL  190

Query  1435  SSVPYSIAQDNTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLR  1286
             ++   S+  ++ +  LRW  P+C            K NS+  D D       ++H    +
Sbjct  191   TAPIPSL--ESGILYLRWPKPNCAECKGKRNRCTWKTNSSTGDIDCFECKPKRIHVP--K  246

Query  1285  KLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKK  1106
                 A    GS L+ ++V+  ++     + KKE+Q ++E FLEDY+A KPAR++YAD+K+
Sbjct  247   SFIFAST--GSILLGLVVIAVFKSILYFRKKKEDQARVEMFLEDYRAQKPARFTYADLKR  304

Query  1105  ITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINV  926
             IT+ F EKLGEG++G V++GKLS ++ VAVK+LN+++G+G+  EF+NE+  +G IHHIN+
Sbjct  305   ITNGFKEKLGEGAHGAVFRGKLSSEIPVAVKILNSTEGEGN--EFINEVGIMGKIHHINM  362

Query  925   VRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQ  749
             VRL+G+CADG HRALVY +  N SL+ F+F P DK+ FLGWEKLQ +ALGIAKG+EYLHQ
Sbjct  363   VRLLGFCADGPHRALVYNFFPNGSLQSFIFPPEDKDHFLGWEKLQHVALGIAKGIEYLHQ  422

Query  748   GCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFS  569
             GC+  I+HFDI P N+LLD NF PKISDFG AKLCSK  S+VSMTAARGT+GYIAPEVFS
Sbjct  423   GCNHPIIHFDINPHNVLLDHNFTPKISDFGLAKLCSKNPSLVSMTAARGTLGYIAPEVFS  482

Query  568   RNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQI  389
             RNFGNVSYKSD+YS+GMLLLEMVGG+K  D++ SP+  Q  +P+WI+N++    +V I +
Sbjct  483   RNFGNVSYKSDIYSYGMLLLEMVGGRKNVDMS-SPQNFQVLYPDWIHNLVD--GDVHIHV  539

Query  388   EKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSM--PPNPFTSTDPSKA  215
             E  +D KIAKKL I+GLWCIQW PV+RPSIK VI MLE EE   +  PPNPF ST  +  
Sbjct  540   EDEDDVKIAKKLAIIGLWCIQWEPVNRPSIKSVIHMLETEEENQLVVPPNPFHSTTSTTT  599

Query  214   KANKPGRLFTSALEIISE  161
             K     R     LE+I E
Sbjct  600   KGLSSTRR-PLQLEVIQE  616



>gb|KEH40339.1| receptor-like kinase [Medicago truncatula]
Length=613

 Score =   501 bits (1289),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 291/617 (47%), Positives = 385/617 (62%), Gaps = 57/617 (9%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRL-KHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
              +E     CG N P I  PF+L K     +C YP F L CT++ +T +  P         
Sbjct  26    HDESTELSCGTNEPVIRCPFQLVKESSQDQCVYPEFCLYCTNQ-KTMISLP--------T  76

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPF-SFENLYNFSI--FSCST  1580
                PV+F +  ID + ++I  S  D C  ++LP LN S+  F  F+     ++  F+CS+
Sbjct  77    TSGPVQFFVSEIDYKLQIISFSDPDNCLPKMLPKLNTSSFQFYKFDTKLATTVVFFNCSS  136

Query  1579  HR--------NITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVP  1424
              R         +  GS ++     +T P   IYAADS   + +  DL+SCTKMF+ ++  
Sbjct  137   VRKRHLRNYDQLFQGSQDM-----ITCP---IYAADSKDSILTL-DLLSCTKMFNFNA--  185

Query  1423  YSIAQDNTVF---SLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRK  1283
              SI   N      SL W  P+C          R  NN T  D + C     K     ++K
Sbjct  186   -SIVVSNLTLNRLSLSWPNPNCTVCEAKGMKCRWNNNGTKCDIE-CFHCNNKQKKFQIKK  243

Query  1282  LKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKI  1103
               V   + GS L+ ++ +   +IY   + K+E+QV+++RFLEDY+A KPAR+SY+DIK+I
Sbjct  244   YHVLATI-GSILLGLLTIAFIKIYLHFREKEEDQVRVDRFLEDYRAQKPARFSYSDIKRI  302

Query  1102  TDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVV  923
             T  F EKLGEG++GTV+KGKLS ++ VAVK+LNN++G+G   EF+ E+  +G+IHHINVV
Sbjct  303   TSGFKEKLGEGAHGTVFKGKLSSEILVAVKILNNTQGEGI--EFITEVEIMGTIHHINVV  360

Query  922   RLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQG  746
             RL+GYCADG HRALVY      SL+ F+F P+DK+ F+GWEKLQ I+LG+AKG+EYLH+G
Sbjct  361   RLLGYCADGIHRALVYNLFPKGSLQCFIFPPDDKDHFMGWEKLQLISLGVAKGIEYLHEG  420

Query  745   CDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSR  566
             C   ILHFDI P N+LLD  F PKISDFG AKLCSK  S+VSMTAARGT+GY+APEV SR
Sbjct  421   CSHPILHFDINPHNVLLDDTFTPKISDFGLAKLCSKNVSVVSMTAARGTLGYMAPEVLSR  480

Query  565   NFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIE  386
             NFGNVS KSD+YS+GMLLLE+VGG+K  D + S E     +PEWI+N+L    +  I IE
Sbjct  481   NFGNVSRKSDIYSYGMLLLELVGGRKNVD-SLSDENFHVLYPEWIHNLLE--GDTHINIE  537

Query  385   KGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEE--PPSMPPNPFTSTDPSKAK  212
               +D KIAKKL IVGLWCIQW P++RPSIK VIQMLE  +    + PPNPF S+      
Sbjct  538   DEDDIKIAKKLAIVGLWCIQWQPINRPSIKAVIQMLETADYNRLTFPPNPFHSSTSVNTT  597

Query  211   ANKPGRLFTSALEIISE  161
                  R  T  +E+I E
Sbjct  598   GCSLARQ-TFQMEVIQE  613



>ref|XP_008232074.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=435

 Score =   493 bits (1269),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 256/444 (58%), Positives = 322/444 (73%), Gaps = 22/444 (5%)
 Frame = -2

Query  1447  MFHVSSVPYSIAQDNTVFSLR--WTGPSC----------RLKNNSTAEDADDCIAPLTKL  1304
             M+ V SVP+        + LR  W+ P+C          RLK+N    + + C+      
Sbjct  1     MYEVLSVPFPTWDRGYRYILRFKWSKPNCTECEAEGKRCRLKDNGINSEVE-CVHLKKAS  59

Query  1303  HTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYS  1124
              T    +    G  LGS L++V+V+  YR+Y  ++ +KE Q+KIERFL DYKALKP+RYS
Sbjct  60    KT---MEFVATGATLGSSLLLVLVIAVYRVYSADQKEKENQLKIERFLADYKALKPSRYS  116

Query  1123  YADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGS  944
             YADIK+IT++F + LG+G+YGTV+KGKLS + FVAVKVLNNSKG+G  EEFVNE+  +G 
Sbjct  117   YADIKRITNQFKDNLGQGAYGTVFKGKLSSEFFVAVKVLNNSKGNG--EEFVNEVGMMGH  174

Query  943   IHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKG  767
             IHH+NVVRLVG+CADGF RALVYE+  N SL+ F+ S + K+ FLGWEKL  IA+GIAKG
Sbjct  175   IHHVNVVRLVGFCADGFRRALVYEFFPNGSLQDFISSADSKHSFLGWEKLHDIAVGIAKG  234

Query  766   VEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYI  587
             +EYLHQGCDQRILHFDIKP N+LLD NF PKISDFG AKLCSK++S+VSMT ARGT+GYI
Sbjct  235   IEYLHQGCDQRILHFDIKPHNVLLDHNFTPKISDFGLAKLCSKDQSMVSMTTARGTLGYI  294

Query  586   APEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGE  407
             APEVFSRNFG VSYKSDVYSFGMLLLEMVGG+K    + + + N+ Y+PEWIYN+L  G+
Sbjct  295   APEVFSRNFGIVSYKSDVYSFGMLLLEMVGGRKNIG-SSTKDANEIYYPEWIYNLLEGGD  353

Query  406   EVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTD  227
             ++ I I    D KI K L IVGLWCIQW+PVDRPS+++V+ ML   +  +MPPNPF S  
Sbjct  354   DLRIHIGDDGDGKIPKTLAIVGLWCIQWHPVDRPSMQIVVHMLGGGDNLAMPPNPFVSAG  413

Query  226   PSKAKANKPGRLFTSALEIISEMD  155
             P+   A+ P R     LE I E++
Sbjct  414   PTTTHASIPAR--RVELEAIPELE  435



>ref|XP_004498417.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Cicer arietinum]
Length=600

 Score =   499 bits (1284),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 286/615 (47%), Positives = 387/615 (63%), Gaps = 56/615 (9%)
 Frame = -2

Query  1942  GYSYDRNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLN  1763
             G +YD  EC    CG   P I FPF+L       C  P F L CT    T +     L  
Sbjct  21    GSAYD--ECRELSCGLYKPLIRFPFQLIKEPQDHCTNPKFCLYCTQTKNTMIH----LST  74

Query  1762  ATLQPPFPVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPFSF--ENLYNFSIF  1592
              + Q    +KFL+  ID     ++I+  + C   + L + N S  P+    +++     F
Sbjct  75    TSGQ----IKFLVYDIDYHRHKMLITDPENCLPKKFLQLNNSSFLPYKLDPQSMTTKYFF  130

Query  1591  SCST----HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVP  1424
             +CS+    H      ++  S    +T P +   A DS L L    D ISCTKMF +++  
Sbjct  131   NCSSVKKPHLRNYEQTLKESQ-DMITCPIYMFNAYDSVLQL----DFISCTKMFEINAST  185

Query  1423  YSIAQDNTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPL-RKLK  1277
                 +     SL W  P+C          + KNN + +D  +C     K+ T  + R L 
Sbjct  186   TVQGK----LSLSWPNPNCNKCKEKGMKCKWKNNGSNKDEIECFDCKKKVKTIHIPRSLI  241

Query  1276  VAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITD  1097
              A    GS L+ ++++  ++I+   + K+E+QV+++ FLEDY+A KPAR+SYADIK+IT 
Sbjct  242   FAAT--GSILLGLVLISLFKIHLYFRKKEEDQVRVDNFLEDYRAQKPARFSYADIKRITS  299

Query  1096  RFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRL  917
              F EKLGEG++GTV+KGKLS ++ VAVK+LN+++G+G  +EF+NE+  +G IHHINVVRL
Sbjct  300   EFREKLGEGAHGTVFKGKLSTEILVAVKMLNSTQGEG--KEFINEVGIMGKIHHINVVRL  357

Query  916   VGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCD  740
             +G+CADG HRALVY    N SL+ ++F P++K+ FLGWEKLQQI +GIAKG+EYLHQGC+
Sbjct  358   LGFCADGIHRALVYNLFPNGSLQSYIFQPDNKDHFLGWEKLQQIGVGIAKGIEYLHQGCN  417

Query  739   QRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNF  560
               I+HFDI P N+LLD +F PKISDFG AKLCSK  SIVSMTAA+GT+GY+APEV SRNF
Sbjct  418   HPIIHFDINPHNVLLDDSFTPKISDFGLAKLCSKNLSIVSMTAAKGTLGYMAPEVLSRNF  477

Query  559   GNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKG  380
             GNVS KSD+YS+GMLLLEMVGG+K  D++ S ET    +PEWI+N+L    +V I +E  
Sbjct  478   GNVSLKSDIYSYGMLLLEMVGGRKNVDMS-SAETFHVLYPEWIHNLLEG--DVHIHVEDE  534

Query  379   EDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPP--SMPPNPFTSTDPSKAKAN  206
              D+KIAKKL IVGLWCIQW P++RPSIK V+QMLE  E    ++PPNPF ST  ++    
Sbjct  535   GDAKIAKKLAIVGLWCIQWQPINRPSIKAVVQMLETGEDNQLTVPPNPFHSTTLARR---  591

Query  205   KPGRLFTSALEIISE  161
                   T  +E+I E
Sbjct  592   ------TFQMEVIQE  600



>gb|EYU21074.1| hypothetical protein MIMGU_mgv1a024071mg [Erythranthe guttata]
Length=535

 Score =   496 bits (1277),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 290/593 (49%), Positives = 366/593 (62%), Gaps = 85/593 (14%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPP  1745
             ++C+P +C NNGP I FPFR  + QP  CGYPGF+L C +K            N  L  P
Sbjct  22    DDCMPIRCRNNGPIIRFPFRHTNRQPQHCGYPGFDLFCDNKN-----------NTVLVLP  70

Query  1744  FPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSF--ENLYNFSIFSCSTHRN  1571
             F V  +++ I+   + + +   + CF Q L  LNL AS F F  + L N+++F+CS    
Sbjct  71    FSVNVIVKKINYVSQRVFVFDQENCFPQKLTHLNLYASTFRFLIKFLDNYTLFNCSD---  127

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFS  1391
                G    + I CL    +  YA DS L + S   L SCTK +   SVP+ + Q+   F 
Sbjct  128   -PPGRDLRTLIPCLGDSTYQFYAVDSKLSMESLP-LTSCTKTYEFKSVPWRMFQEKD-FY  184

Query  1390  LRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIY  1211
             L W+ P+C     S  ED     +      T   R+++V                  R Y
Sbjct  185   LEWSEPAC-----SVCEDKGKRCSSYNS--TTSDRRIQV------------------RTY  219

Query  1210  RLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGD  1031
             R      E +  I  FL DYKALKP+R+SY DIK+IT +FSEKLGEG YG VYKGKL+ +
Sbjct  220   R------ENRTMIGMFLRDYKALKPSRFSYLDIKRITHQFSEKLGEGGYGIVYKGKLNNE  273

Query  1030  VFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSL  851
             + VAVKVLNNS  +G+GEEFVNE+STIG IHH+NVVRL+G+CADGF RALVYE+L N SL
Sbjct  274   IDVAVKVLNNS--NGNGEEFVNEVSTIGRIHHVNVVRLLGFCADGFRRALVYEFLSNGSL  331

Query  850   EKFVFSP-NDKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPK  674
             EK +F   +++  L WEKL+ IALGIAKG+EYLH+GCDQ+ILHFDIKP+N+LLD N NPK
Sbjct  332   EKSIFQEGSNRITLDWEKLKDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLLDHNLNPK  391

Query  673   ISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGG  494
             I DFG AKLCSKE+S V+MTAARGTMGYIAPEV SR FG VSYKSDVYSFGMLLLEMVGG
Sbjct  392   ICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGG  451

Query  493   KKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPV  314
             +K  D      T+Q YFP+WIYN ++            ED+          LW   W P 
Sbjct  452   RKNED-RNVNNTSQVYFPQWIYNHIN-----------AEDNP---------LW---WCPT  487

Query  313   DRPSIKVVIQMLEAE-EPPSMPPNPF-TSTDPSKAKANKPGRLFTSALEIISE  161
             DRPS+K V+QMLE E +  +MPPNPF  +T+P        G+ + + + II E
Sbjct  488   DRPSMKAVVQMLEGECDDLTMPPNPFPATTNPID------GKHYQTQMSIILE  534



>ref|XP_007161436.1| hypothetical protein PHAVU_001G068500g [Phaseolus vulgaris]
 gb|ESW33430.1| hypothetical protein PHAVU_001G068500g [Phaseolus vulgaris]
Length=612

 Score =   496 bits (1278),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 283/614 (46%), Positives = 378/614 (62%), Gaps = 55/614 (9%)
 Frame = -2

Query  1927  RNECLPR-KCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQ  1751
              NEC     CG N P I FPF+L       CGYP   L CT+  ET L  P         
Sbjct  29    HNECDEEFSCGPNQPPIRFPFQLTEEMNEPCGYPRICLSCTENNETMLALP---------  79

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFEN-----LYNFSIFSC  1586
                 +K L+  ID E + I +   + CF             + FE+      YN S F+C
Sbjct  80    ---TMKLLVTYIDYESQEIDLIDPENCFSNKFNQTINFIRTYQFESPYDGPHYNLSFFNC  136

Query  1585  STHRN------ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVP  1424
             ++  +         GS +   +  ++ P +   + DS L L     L SCTKMF +S+ P
Sbjct  137   TSAEHPHLINYYDDGSDSTQDM--ISCPIYISNSFDSVLRL----GLTSCTKMFDLSA-P  189

Query  1423  YSIAQDNTVFSLRWTGPSC----------RLKNNSTAEDADDCIAPLTKLHTGPLRKLKV  1274
                 Q N +  L W+ P+C            K N+T  D +       ++H      +  
Sbjct  190   IPFIQSNDLV-LIWSKPNCAECKGKGKRCTWKTNTTTGDTECFKCKPKRIHV----PISF  244

Query  1273  AGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDR  1094
                  G+ L+ ++V+  ++     + K+E+Q ++ +FLEDY+A KPAR++YAD+K+IT+ 
Sbjct  245   IFATTGTILLGLLVITVFKTILYFRKKQEDQARVGKFLEDYRAEKPARFTYADLKRITNG  304

Query  1093  FSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLV  914
             F EKLGEG++G V++GKLS ++ VAVK+LN+++G+G+  EF+NE+  +G IHHINVVRL+
Sbjct  305   FKEKLGEGAHGAVFRGKLSSEIAVAVKILNSTEGEGN--EFINEVGIMGKIHHINVVRLL  362

Query  913   GYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQ  737
             G+CADG HRALVY +  N SL+ F+F P DK+ FLGWEKLQ +ALGIAKG+EYLHQGC++
Sbjct  363   GFCADGPHRALVYNFFPNGSLQSFIFPPEDKDHFLGWEKLQHVALGIAKGIEYLHQGCNR  422

Query  736   RILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFG  557
              I+HFDI P N+LLD NF PKISDFG AKLCSK  S+VSMTAARGT+GYIAPEVFSRNFG
Sbjct  423   PIIHFDINPHNVLLDHNFTPKISDFGLAKLCSKNPSLVSMTAARGTLGYIAPEVFSRNFG  482

Query  556   NVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGE  377
             NVSYKSD+YS+GMLLLE VGG+K  D++ SP+     +P+WI+N++    +V I +E   
Sbjct  483   NVSYKSDIYSYGMLLLETVGGRKNVDMS-SPQNFHVLYPDWIHNLVDG--DVHIHVEDEG  539

Query  376   DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSM--PPNPFTSTDPSKAKANK  203
             D KIAKKL I+GLWCIQW PV+RPSIK VI MLE EE   +  PPNPF ST  + AK   
Sbjct  540   DVKIAKKLAIIGLWCIQWEPVNRPSIKSVIHMLETEEENQLVVPPNPFHSTTSTTAKGLS  599

Query  202   PGRLFTSALEIISE  161
               R     LE+I E
Sbjct  600   STRR-PLQLEVIQE  612



>gb|KEH40312.1| receptor-like kinase [Medicago truncatula]
Length=575

 Score =   495 bits (1274),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 273/569 (48%), Positives = 363/569 (64%), Gaps = 36/569 (6%)
 Frame = -2

Query  1825  FELLCTDKGETALENPFPLLNATLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPIL  1646
             F L C+   +  LE P          P   KFLI  IDC+ + +++S    C   L    
Sbjct  31    FRLSCSSNKQQYLEFP--------SKPVSKKFLIRDIDCKLKHLVLSDPQNCLPSLFLTN  82

Query  1645  NLS-----ASPFSFENLYNFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYL  1481
             N S      S FS+ N+  F+  S   H   +    N      L+ P   IYA DS+  +
Sbjct  83    NFSLFYPFQSDFSYNNITFFNCSSVGVHHLKSWDQRNPDVQDMLSCP---IYATDSTESV  139

Query  1480  YSATDLISCTKMFH-VSSVPYSIAQDNTVFSLRWTG---PSCRLKNNSTAEDADDCIAPL  1313
                 DL+SCT+MF+ V  V  S        SL W+    PS  L+ +     +   +  +
Sbjct  140   VEL-DLLSCTRMFNKVLPVTASYYIRYNALSLSWSETAFPSQCLEYDQIHNKSKKNLTSI  198

Query  1312  TKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPA  1133
                       L   G ++GS ++VV++ V  R+Y   + K E+Q+++E FL+DY+A KP 
Sbjct  199   I---------LVTTGAIVGSTMLVVLIGVFIRVYVHFRTKGEDQMRLENFLKDYEASKPT  249

Query  1132  RYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMST  953
             R+SYADIK+ITD+F EKLGEG++G VYKGKLS  + VAVK+L+N+  +GDG EF+NE+ T
Sbjct  250   RFSYADIKRITDQFKEKLGEGAHGAVYKGKLSNQIMVAVKMLSNT--EGDGSEFINEVGT  307

Query  952   IGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGI  776
             +G IHH+NVVRL+G+CADGF+RALVY++  N SL+ F+ SP++K+ FLGW+ LQQIALGI
Sbjct  308   MGKIHHVNVVRLLGFCADGFYRALVYDFFPNGSLQNFISSPDNKDVFLGWDLLQQIALGI  367

Query  775   AKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTM  596
             A G+EYLHQGCD RILHFDI P N+LLD NF PKISDFG AKLCSK  S VSMTAARGT+
Sbjct  368   ANGIEYLHQGCDHRILHFDINPHNVLLDDNFIPKISDFGLAKLCSKNHSTVSMTAARGTL  427

Query  595   GYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSD-ITGSPETNQDYFPEWIYNIL  419
             GY+APEVFSRNFGNVSYKSD+YS+GMLLLEMVGG+K +   TG  E  Q  +P+WI+ +L
Sbjct  428   GYMAPEVFSRNFGNVSYKSDIYSYGMLLLEMVGGRKNTKTTTGGEENFQVLYPDWIHGLL  487

Query  418   SRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNP  242
               G +V I I++  D +IAKKL IVGLWCIQW+ V RPS+K V+QML+ E +   +P NP
Sbjct  488   -EGGDVYIPIDEEGDCRIAKKLAIVGLWCIQWHSVHRPSMKTVVQMLQGEGDKLKVPTNP  546

Query  241   FTSTDPSKAKANKPGRLFTSALEIISEMD  155
             F ++  +    N         L++I E+D
Sbjct  547   FNASVSTNRTVNTVPGCLNVELDVIQELD  575



>ref|XP_003542135.2| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Glycine max]
Length=617

 Score =   496 bits (1276),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 285/612 (47%), Positives = 378/612 (62%), Gaps = 58/612 (9%)
 Frame = -2

Query  1903  CGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKFLI  1724
             CG   P I FPF+L      EC  PGF L CT K ET +     +L+        ++F +
Sbjct  33    CGPGEPLIRFPFQLVKGIKDECANPGFCLYCTKKNETMV-----VLST-------IEFRV  80

Query  1723  ESIDCEDRLIIISRVDGC----FLQL----LPILNLSASPFSFENLYNFSIFSCST----  1580
              SID E     +   + C    FLQ+    L    L       E   N S F+CS+    
Sbjct  81    YSIDYEFNFFRLKDPENCLPNKFLQINNFFLQHNQLELGFPGHEGTNNLSFFNCSSVGYT  140

Query  1579  -HRNITAG--SINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ  1409
               R    G   ++ S    ++ P +   + DS L L    DL SCT+MF + S   +   
Sbjct  141   YLRRFVYGPYCLDFSQQDMISCPIYVSSSYDSVLDL----DLTSCTRMFDLISPAEADDL  196

Query  1408  DNTVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVL  1259
                  ++RW+          G  C+ KNNS  E   +C     K    P   +       
Sbjct  197   QWNSLNMRWSIPNCTKCEAKGKRCKWKNNSNTEGDIECFGYKRKRIHVPQSFIFAT---T  253

Query  1258  GSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKL  1079
             GS  + ++V+V ++I    + K+++Q ++ +FLEDY+A KPAR++YAD+K+IT  F EKL
Sbjct  254   GSIFLGLVVIVVFKIALYFRQKEDDQARVAKFLEDYRAEKPARFTYADLKRITGGFKEKL  313

Query  1078  GEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCAD  899
             GEG++G V++GKLS ++ VAVK+LNN+  +G+G+EF+NE+  +G IHHINVVRL+G+CA+
Sbjct  314   GEGAHGAVFRGKLSNEILVAVKILNNT--EGEGKEFINEVGIMGKIHHINVVRLLGFCAE  371

Query  898   GFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHF  722
             GFHRALVY    N SL++ +  P+DK+ FLGWEKLQQIALGIAKG+EYLHQGC+Q I+HF
Sbjct  372   GFHRALVYNLFPNGSLQRIIVPPDDKDHFLGWEKLQQIALGIAKGIEYLHQGCNQPIIHF  431

Query  721   DIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYK  542
             DI P N+LLD NF PKISDFG AKLCSK  S+VSMTAARGT+GYIAPEVFSRNFGNVSYK
Sbjct  432   DINPHNVLLDDNFTPKISDFGLAKLCSKNPSLVSMTAARGTVGYIAPEVFSRNFGNVSYK  491

Query  541   SDVYSFGMLLLEMVGGKKKSDITGSPETNQDY---FPEWIYNILSRGEEVEIQIEKGEDS  371
             SD+YS+GMLLLEMVGG+K  D++ +    QD+   +P+WI+N++    +V I +E   D 
Sbjct  492   SDIYSYGMLLLEMVGGRKNVDMSSA----QDFHVLYPDWIHNLID--GDVHIHVEDEVDI  545

Query  370   KIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEA--EEPPSMPPNPFTSTDPSKAKANKPG  197
             KIAKKL IVGLWCIQW PV+RPSIK VIQMLE   E   ++PPNPF ST  +    +   
Sbjct  546   KIAKKLAIVGLWCIQWQPVNRPSIKSVIQMLETGEENQLNVPPNPFNSTTSTITSGHTRV  605

Query  196   RLFTSALEIISE  161
                   LE+I E
Sbjct  606   TRRPLELEVIQE  617



>gb|KHN05165.1| Putative receptor-like protein kinase [Glycine soja]
Length=569

 Score =   494 bits (1271),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 276/576 (48%), Positives = 366/576 (64%), Gaps = 48/576 (8%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             +NEC    CG   P I FPF+L      EC  PGF L CTDK ET +     +L+     
Sbjct  11    QNECKKLSCGPGQPLIRFPFQLVKGIKDECANPGFCLYCTDKKETMV-----VLST----  61

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGC----FLQL----LPILNLSASPFSFENLYNFSIF  1592
                ++F + +I  E    +++  + C    FLQ+    L    L    F  E   N S F
Sbjct  62    ---IEFRVYTIHYESNFFMLTDPENCLPNKFLQIDNFFLQHNQLELGLFGDERTNNLSFF  118

Query  1591  SCST-----HRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSV  1427
             +CS+      R    GS   +    ++ P     + DS L L    DL SCTKMF  +S 
Sbjct  119   NCSSVGLRHLRKQVYGSDFSNQQDMISCPIFVSESYDSVLGL----DLTSCTKMFDTTSP  174

Query  1426  PYSIAQDNTVFSLRWT----------GPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLK  1277
               +      +  +RW+          G  C+ KNNS  E   +C+    K    P   + 
Sbjct  175   VTAYDLQLNILIMRWSIPNCTKCEAKGKRCKWKNNSNTEADIECVDCKRKRIHVPQSFIF  234

Query  1276  VAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITD  1097
                   GS L+ ++ +V ++I    + K+E+Q ++ +FLEDY+A KPAR++YAD+K+IT 
Sbjct  235   AT---TGSILLGLVAIVIFKIALYFRQKEEDQARVAKFLEDYRAEKPARFTYADLKRITG  291

Query  1096  RFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRL  917
              F EKLGEG++G V++GKLS ++ VAVK+LNN+  +G+G+EF+NE+  +G IHHINVVRL
Sbjct  292   GFKEKLGEGAHGAVFRGKLSNEILVAVKILNNT--EGEGKEFINEVGIMGKIHHINVVRL  349

Query  916   VGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCD  740
             +G+CA+GFHRALVY    N SL++F+  P+DK+ FLGWEKLQQIALGIAKG+EYLH+GC+
Sbjct  350   LGFCAEGFHRALVYNLFPNGSLQRFIVPPDDKDHFLGWEKLQQIALGIAKGIEYLHEGCN  409

Query  739   QRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNF  560
             Q I+HFDI P N+LLD NF PKISDFG AKLCSK  S+VSMTAARGT+GYIAPEVFSRNF
Sbjct  410   QPIIHFDINPHNVLLDDNFTPKISDFGLAKLCSKNPSLVSMTAARGTLGYIAPEVFSRNF  469

Query  559   GNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKG  380
             GNVSYKSD+YS+GMLLLEMVGG+K   ++ + + +  Y P+WI+N++    +V I +E  
Sbjct  470   GNVSYKSDIYSYGMLLLEMVGGRKNVAMSSAQDFHVLY-PDWIHNLID--GDVHIHVEDE  526

Query  379   EDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEA  272
              D KIAKKL IVGLWCIQW PV+RPSIK VIQMLE 
Sbjct  527   CDIKIAKKLAIVGLWCIQWQPVNRPSIKSVIQMLET  562



>gb|KEH40361.1| receptor-like kinase [Medicago truncatula]
Length=571

 Score =   493 bits (1269),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 275/570 (48%), Positives = 377/570 (66%), Gaps = 41/570 (7%)
 Frame = -2

Query  1825  FELLCTDKGETALENPFPLLNATLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPIL  1646
             F+L CT   +  LE P          P PVK ++  ID  D  I +S    C  QLL   
Sbjct  30    FKLECT-HNKKILELP--------TQPVPVKLILTDIDYTDPRIDLSDPGNCLPQLLLDH  80

Query  1645  NLSAS-PF-----SFENLYNFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLY  1484
             N S+  PF      +    N S F+CS+   + + +         + P +  Y+   S+ 
Sbjct  81    NFSSIFPFKPYLSGYSVSRNISFFNCSSVVQLRSYNQVYEAQNMTSCPIYVAYSDSDSII  140

Query  1483  LYSATDLISCTKMF-HVSSVPYSIAQDNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTK  1307
                 +DL+ C K+F  V+  P S  Q N + SL+W G +  L        A   IA +  
Sbjct  141   ---ESDLVYCIKLFDRVALFPASSIQSN-ILSLKWYGTNFDLGCLKCEHKAMKRIAFII-  195

Query  1306  LHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARY  1127
                     L  AG ++G  L+V+++    RI+R  KMK E+  +IE FL+DYKALKP R+
Sbjct  196   --------LSSAGVIIGLTLLVLMLGAIIRIHRHFKMKGEDHERIENFLKDYKALKPTRF  247

Query  1126  SYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIG  947
             SYADIK+IT++F +K+GEG++G VYKGKLS  + VAVK+LNN+  +GDG+EF+NE+ T+G
Sbjct  248   SYADIKRITNKFKDKIGEGAHGAVYKGKLSSQIQVAVKMLNNA--EGDGKEFINEVGTMG  305

Query  946   SIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAK  770
              IHH+NVVRL+G+CADGFHRALVY++  + SL+KF+  P++K+ FLGW+KLQQIALGIA 
Sbjct  306   KIHHLNVVRLLGFCADGFHRALVYDFFPSGSLQKFISPPSNKDSFLGWDKLQQIALGIAN  365

Query  769   GVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGY  590
             G+EYLHQGCDQRILHFDI P N+L+D N  PKI+DFG AK+CSK +S +SMTAA+GT+GY
Sbjct  366   GIEYLHQGCDQRILHFDINPHNVLIDDNLTPKITDFGLAKMCSKNQSTISMTAAKGTLGY  425

Query  589   IAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRG  410
             +APEVFSRNFGNVSYKSD+YS+GMLLLEMVGG+K S+ T S  + Q  +P+WI++++  G
Sbjct  426   MAPEVFSRNFGNVSYKSDIYSYGMLLLEMVGGRKNSNTTTSEGSPQVLYPDWIHSLV-EG  484

Query  409   EEVEIQI-EKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPF-  239
              +++I I E+ +D +IAKK+ IVGLWCIQW P+ RPS+K V+QML+ E +   +P NPF 
Sbjct  485   GDIQIPIDEEQDDFRIAKKMAIVGLWCIQWQPMHRPSMKTVLQMLQGEGDKLKVPRNPFG  544

Query  238   --TSTDPSKAKANKPGRLFTSALEIISEMD  155
               TST+ + +  +KP  L    LE+I E+D
Sbjct  545   PSTSTNTTASIVSKPMSL---ELEVIKELD  571



>gb|KHM99707.1| Putative receptor-like protein kinase [Glycine soja]
Length=598

 Score =   494 bits (1271),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 282/600 (47%), Positives = 385/600 (64%), Gaps = 61/600 (10%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKH---IQPPECGYP-GFELLCTDKGETALENPFPLLNA  1760
             +N C   KCG     I FPF L++   +      Y  GF+LLCTD  ET LE        
Sbjct  24    KNGCTD-KCGR--VRIQFPFYLRNNSKLNHTTTAYSSGFDLLCTDADETVLE--------  72

Query  1759  TLQPPFPVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPFSFENL--YNFSIFS  1589
                P  P+K  ++SID + + I I     C   +L+ + N S +PF F++    N S F 
Sbjct  73    --LPSVPIKLFVKSIDYKLQQIQIYDPQNCLPRELIKLGNSSVAPFKFQSFGGNNVSFFR  130

Query  1588  CSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ  1409
             C++  +         PI  L   G FI             ++ISCTK+  V SV + +  
Sbjct  131   CNSMSSSC-------PILQLGYEGDFI-----------DPEIISCTKVSDVFSVQWQVNN  172

Query  1408  --DNTVFSLRWTGPSC----------RLKNNSTAEDADDC-IAPLTKLHTGPLRKLKVAG  1268
                N V  + W+ P C          + KN +  E   +C I P  ++ T  +  L  AG
Sbjct  173   YLGNAVV-MEWSKPDCSTCEAQGHKCKYKNGTQGET--ECFICPTNRISTSSV-VLIAAG  228

Query  1267  EVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFS  1088
              ++G  L++V+V     +Y     K E++ ++E+FLEDY+A+KP R++YADIK+IT+ F 
Sbjct  229   GIVGMILLLVVVKALLHLYDHYMTKGEDRARMEKFLEDYRAMKPTRFTYADIKRITNGFR  288

Query  1087  EKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGY  908
             E LGEG++G V+KG LS ++ VAVK+LN++ GDG  ++F+NE+ T+G IHH+NVVRL+G+
Sbjct  289   ESLGEGAHGAVFKGMLSREILVAVKILNDTVGDG--KDFINEVGTMGKIHHVNVVRLLGF  346

Query  907   CADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRI  731
             CADGFHRALVY++  N SL++F+  P++K+ FLGWEKLQQIALG+AKGVEYLH GCDQRI
Sbjct  347   CADGFHRALVYDFFPNGSLQRFLAPPDNKDVFLGWEKLQQIALGVAKGVEYLHLGCDQRI  406

Query  730   LHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNV  551
             LHFDI P NIL+D +F PKI+DFG AKLC K +S VS+TAARGT+GYIAPEVFSRNFGNV
Sbjct  407   LHFDINPHNILIDDHFVPKITDFGLAKLCPKNQSTVSITAARGTLGYIAPEVFSRNFGNV  466

Query  550   SYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDS  371
             SYKSD+YS+GMLLLEMVGG+K ++++ + E+ Q  +PEWI+N+L +  +V++ IE   D 
Sbjct  467   SYKSDIYSYGMLLLEMVGGRKNTNMS-AEESFQVLYPEWIHNLL-KSRDVQVTIEDEGDV  524

Query  370   KIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGR  194
             +IAKKL IVGLWCI+W P+DRPS+K VIQMLE + +    PP PF  T  S+     P R
Sbjct  525   RIAKKLAIVGLWCIEWNPIDRPSMKTVIQMLEGDGDKLIAPPTPFDKTSSSRTSVVAPTR  584



>ref|XP_008245767.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=532

 Score =   491 bits (1265),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 274/536 (51%), Positives = 357/536 (67%), Gaps = 35/536 (7%)
 Frame = -2

Query  1756  LQPPF-PVKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSC--  1586
             L+ PF P K ++  I+     I  +  DGC+ + +   N S   F FE L   ++FSC  
Sbjct  3     LEAPFLPNKLVVSQINYTSHEIEAAPDDGCWPREVFYSNGS---FPFEFLGRATLFSCPP  59

Query  1585  STHRNITAGS---INISPIACLTKPGHFIYAADSSLYLYSATD---LISCTKMFHVSSVP  1424
             S+ R         + +SP      PG+ I+A  SS   Y   D   L+SCTK+   +  P
Sbjct  60    SSVRGDDYSDMCMVRLSPCHG-NNPGNHIFAV-SSHKEYCMIDEMPLVSCTKIDDYTLDP  117

Query  1423  YSIAQ--DNTVFSLRWT----------GPSCRLKNNS---TAEDADDCIAPLTKLHTGPL  1289
                +      +  LRW+          G +C  K N       D  +C+      + G  
Sbjct  118   ADTSDFPLRQLMKLRWSIPVCEHCLEMGKTCGFKMNEFTHQTTDQAECLDVSRGRNLGRR  177

Query  1288  RKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIK  1109
               LK+ G      +++ +       Y  NK +KE Q++IERFL++Y+A+KP+RYSYADIK
Sbjct  178   TTLKMLGISALCLVLIAMGTTICYAYNSNKKEKENQLRIERFLDEYRAMKPSRYSYADIK  237

Query  1108  KITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHIN  929
             +IT +F EKLG+G+YGTV+KGKLS ++ VAVK+LNNS  + +GE+F+NE+ T+  IHH+N
Sbjct  238   RITSQFKEKLGQGAYGTVFKGKLSSELLVAVKILNNS--NENGEDFINEVGTMCQIHHVN  295

Query  928   VVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLH  752
             VVRLVG CADGF  ALVYEYL N SL+ F+ S ++KN F+GW+KLQ IALGIAKG+EYLH
Sbjct  296   VVRLVGICADGFIHALVYEYLPNGSLQNFLSSADNKNSFIGWDKLQDIALGIAKGIEYLH  355

Query  751   QGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVF  572
             QGCDQRILHFDIKP+N+LLDQ+F PK+SDFG AK C+K++S +SMT ARGTMGYIAPE+F
Sbjct  356   QGCDQRILHFDIKPQNVLLDQDFTPKVSDFGLAKFCAKDQSAISMTTARGTMGYIAPEIF  415

Query  571   SRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQ  392
             SRNFGNVSYKSDVYSFG+LLLEMVGG+K   +     T+Q YFPEWIYN+L +G ++ I 
Sbjct  416   SRNFGNVSYKSDVYSFGILLLEMVGGRKNFKVM-EDSTSQVYFPEWIYNLLEQGNDLRIH  474

Query  391   IEKGE-DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
             I   E D  IA+KL IVGLWCIQW+P+DRPS+KVV+QMLE E E  +MPPNPF ST
Sbjct  475   IGDDEGDVTIARKLAIVGLWCIQWHPIDRPSMKVVVQMLEREGENLAMPPNPFAST  530



>ref|XP_004498414.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Cicer arietinum]
Length=605

 Score =   493 bits (1270),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 284/612 (46%), Positives = 387/612 (63%), Gaps = 52/612 (8%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQP  1748
             +N C   KCG+    I FPF LK+    +    GF+L CT++ ET LE  FP +      
Sbjct  25    KNGCTD-KCGS--VHIQFPFNLKNNNTNQTNAHGFDLSCTNEHETVLE--FPTI------  73

Query  1747  PFPVKFLIESIDCEDRLIIISRVDGCFL-QLLPILNLSASPFSFENLYNFSIFSCSTHRN  1571
               P+K  I+ ID   +   I     C   QLL + NLS SPF F + + ++I        
Sbjct  74    --PLKLFIKRIDYISQRFQIYDPKNCLSSQLLKLKNLSVSPFRF-HFHEYNI--------  122

Query  1570  ITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQ---DNT  1400
                   N+S   C +  G  I   D         +L+SC K+  V SV + + +   D+ 
Sbjct  123   ----QRNVSFFRCDSNNGCSILQRDFGGDFIDP-ELVSCRKVSDVMSVGWVVEEWDEDDL  177

Query  1399  VFSL--RWTGPSCRL------------KNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEV  1262
               SL   W+ P+C                 S   + +  + P + +    +  L  AG +
Sbjct  178   TESLIMEWSKPNCSFCEVQGQKCKWKDGGGSRGGEVECFVCPSSGIARSTVL-LITAGVI  236

Query  1261  LGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEK  1082
             +GS L++++V    R+YR  KMK ++  +IE+FLEDY+A+KP R++YADIK+IT+ F E 
Sbjct  237   VGSILLLLLVNGLLRLYRYFKMKGDDLDRIEKFLEDYRAMKPTRFTYADIKRITNGFKES  296

Query  1081  LGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCA  902
             LGEG++GTV+KG LS ++ VAVKVLN ++GDG  ++F+NE+ T+G IHH+NVVRL+G+CA
Sbjct  297   LGEGAHGTVFKGMLSQEILVAVKVLNETQGDG--KDFINEVGTMGKIHHVNVVRLLGFCA  354

Query  901   DGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILH  725
             DGFHRALVY++  N SL+ F+    +K+ FLGWEKLQQIALG+A+G+EYLH GCD RILH
Sbjct  355   DGFHRALVYDFFPNGSLQNFLAPLENKDVFLGWEKLQQIALGVARGIEYLHIGCDHRILH  414

Query  724   FDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSY  545
             FDI P N+L+D N +PKI+DFG AKLC K +S VSMT ARGT+GYIAPEVFSRNFGNVSY
Sbjct  415   FDINPHNVLIDDNLSPKITDFGLAKLCPKNQSTVSMTTARGTLGYIAPEVFSRNFGNVSY  474

Query  544   KSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNIL-SRGEEVEIQIEKGEDSK  368
             KSD+YS+GMLLLEMVGG+K ++++ S ET Q  +PEWI+N++  +   V I +E   D +
Sbjct  475   KSDIYSYGMLLLEMVGGRKNTNMS-SEETFQVLYPEWIHNLIEDKDVHVNINVEDEGDIR  533

Query  367   IAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSM-PPNPFTSTDPSKAKANKPGRL  191
             IAKKL +VGLWCIQW PVDRPS+K V+QMLE E    M PP PF S   +++ A  P R 
Sbjct  534   IAKKLALVGLWCIQWNPVDRPSMKTVVQMLEGEGEKLMAPPTPFDSIGSTRSNAIIPTRH  593

Query  190   FTSALEIISEMD  155
                 LE+I E++
Sbjct  594   LNFELEVIHEVE  605



>ref|XP_003544058.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Glycine max]
Length=623

 Score =   493 bits (1270),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 277/614 (45%), Positives = 394/614 (64%), Gaps = 49/614 (8%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKHIQP--PECGYP-GFELLCTDKGETALENPFPLLNAT  1757
             +N    +KCG     I FPF L++         YP GF LLCT+K +T LE         
Sbjct  35    KNHYCMQKCGR--VHIQFPFYLRNSNKFNHTTDYPTGFGLLCTEKDDTLLE---------  83

Query  1756  LQPPFPVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPFSFENLYNFSIFSCST  1580
               P  P+K  + +ID + + I I     C   QLL + N S SPF F     F  +    
Sbjct  84    -LPSVPIKLFVRNIDYKSQQIEIYDPQNCLPSQLLKLGNASISPFQFSKPKGFYDYE---  139

Query  1579  HRNITAGSINISPIACLTKPGHFIYAADSS--LYLYSATDLISCTKMFHVSSVPYSIAQD  1406
              +++     N+S   C ++    I+  D S  + L+   D++ CTK+  + SV +    +
Sbjct  140   -KDLYDSRTNVSFFRCDSRSLCPIFLLDPSDDVNLF-IPDILYCTKLKDILSVKWYFNME  197

Query  1405  N--TVFSLRWTGPSC----------RLKNNSTAEDADDC-IAPLTKLHTGPLRKLKV--A  1271
             +  +   + W+ P+C          R KN +  E   +C + P  K+   P R + +  A
Sbjct  198   DWDSAVLMEWSKPNCSYCEAQGQKCRWKNGTNGET--ECFVCPTNKI---PTRTVLIIAA  252

Query  1270  GEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRF  1091
             G ++G  L++++    + +Y  +KMK E+Q +IE+FLEDY+A+KP R++YADIK++T+  
Sbjct  253   GGIVGLMLLLLLAKALFHVYCYHKMKGEDQARIEKFLEDYRAMKPTRFTYADIKRMTNGL  312

Query  1090  SEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVG  911
             SE LGEG++G V+KG LS ++ VAVK+LNN+ GDG  ++F+NE+ TIG IHH+NVVRL+G
Sbjct  313   SESLGEGAHGAVFKGMLSREILVAVKILNNAVGDG--KDFMNEVGTIGKIHHVNVVRLLG  370

Query  910   YCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQR  734
             +CA+GFH ALVY++  N SL++F+  P++K+ FLGW+KLQ+IA+G+A+G+EYLH GCDQR
Sbjct  371   FCAEGFHHALVYDFFPNGSLQRFLAPPDNKDVFLGWDKLQRIAMGVARGIEYLHLGCDQR  430

Query  733   ILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGN  554
             ILHFDI P N+LLD++  PKI+DFG AKLC K ++ VSM+AA+GT+GYIAPEVFSR++GN
Sbjct  431   ILHFDINPHNVLLDEDLIPKITDFGLAKLCPKNQNTVSMSAAKGTLGYIAPEVFSRSYGN  490

Query  553   VSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGED  374
             VSYKSD+YS+GMLLLEMVGG+K ++++   E+ Q  +PEWIYN+L  G +  + IE   D
Sbjct  491   VSYKSDIYSYGMLLLEMVGGRKNTNVS-LEESFQVLYPEWIYNLL-EGRDTHVTIENEGD  548

Query  373   SKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPG  197
              K AKKL I+GLWCIQW PVDRPSIK V+QMLE + +    PPNPF +T+ S      P 
Sbjct  549   VKTAKKLAIIGLWCIQWNPVDRPSIKTVVQMLEEDGDKLIAPPNPFGTTNSSGTNVVVPT  608

Query  196   RLFTSALEIISEMD  155
             R     LEII E +
Sbjct  609   RRQNFELEIIHETN  622



>ref|XP_003520047.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Glycine max]
Length=603

 Score =   493 bits (1268),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 284/615 (46%), Positives = 381/615 (62%), Gaps = 65/615 (11%)
 Frame = -2

Query  1924  NECLPRKCGNNGPEISFPFRLKHIQPPECGY--PGFELLCTDKGETALENPFPLLNATLQ  1751
             N+C   KCG  G  I FPF L++ +        PGF+LLCT+  +T +            
Sbjct  26    NQC-TDKCG--GVSIQFPFYLRNSKLNHTAEYPPGFDLLCTENKKTLILE---------L  73

Query  1750  PPFPVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPF-------SFENLYNFSI  1595
             P  P K  +  ID + + I I     C   QLL + + S SPF       +F+   NFS 
Sbjct  74    PNVPTKLAVRKIDYKSQQIQIYDPANCLPSQLLQLSSASISPFQFPSYDYAFKTRRNFSF  133

Query  1594  FSCSTHRNITAGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSV----  1427
             F C +  +         PI  L+          S L +    +++SCTK+  V S     
Sbjct  134   FRCDSMSSSC-------PILLLS----------SYLDVIRFPEILSCTKVKDVLSANWMD  176

Query  1426  PYSIAQDNTVFSLRWTGPSCR----------LKNNSTAEDADDCIAPLTKLHTGPLRKLK  1277
              YS+  D TV ++ W+ P C+           KN++  E   +C    T         L 
Sbjct  177   QYSL-YDPTV-TIEWSKPDCKHCETQNQKCKWKNSTKVET--ECFVCSTNTTPTSTIVLI  232

Query  1276  VAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITD  1097
              AG ++G  L+V+ V     +Y   + K E+Q +IE+FLEDY+A+KP R++YADIK+IT+
Sbjct  233   AAGGIVGLMLLVLTVTCIVCVYHYYEKKGEDQARIEKFLEDYRAMKPTRFTYADIKRITN  292

Query  1096  RFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRL  917
              FSE LGEG++G V+KG LS ++ VAVK+LN++ GDG  ++F+NE+ TIG IHH+NVVRL
Sbjct  293   GFSESLGEGAHGVVFKGMLSREILVAVKILNDTVGDG--KDFINEVGTIGKIHHVNVVRL  350

Query  916   VGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCD  740
             +G+CADGFHRALVY++  N SL++F+  P+ K+ FLGWEKLQQIALG+A+G+EYLH GCD
Sbjct  351   LGFCADGFHRALVYDFFPNGSLQRFLAPPDKKDAFLGWEKLQQIALGVARGIEYLHLGCD  410

Query  739   QRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNF  560
              RILHFDI P N+LLD N  PKI+DFG +KLC K +S VSMTAARGT+GYIAPEVFSRNF
Sbjct  411   HRILHFDINPHNVLLDDNLVPKITDFGLSKLCPKNQSTVSMTAARGTLGYIAPEVFSRNF  470

Query  559   GNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKG  380
             GNVSYKSD+YS+GMLLLEMVGG+K  D   + E+ Q  +PEWI+N+L  G +V+I +E  
Sbjct  471   GNVSYKSDIYSYGMLLLEMVGGRKNID---AEESFQVLYPEWIHNLL-EGRDVQISVEDE  526

Query  379   EDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEA-EEPPSMPPNPFTSTDPSKAKANK  203
              D +IAKKL IVGLWCIQW PV+RPS+K V+QMLE   +    PP PF  +  S+   + 
Sbjct  527   GDVEIAKKLAIVGLWCIQWNPVNRPSMKTVVQMLEGVGDELIAPPTPFDISGSSRTNDDV  586

Query  202   PGRLFTSALEIISEM  158
             P       LE+I E+
Sbjct  587   PTSRQNFKLEVIDEI  601



>ref|XP_007052345.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOX96502.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=600

 Score =   492 bits (1267),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 269/591 (46%), Positives = 368/591 (62%), Gaps = 39/591 (7%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFP  1739
             C    C   GP + FPF LK  QP  CGYPGF L C+ + ET +E            P+ 
Sbjct  27    CPYAACSEEGPSVRFPFWLKDRQPESCGYPGFALSCSKRNETLIE-----------IPYS  75

Query  1738  VKFLIESIDCEDRLIIISRVDGCFLQLLPILNLSASPFSFENLYNFSIFSCSTHRNITAG  1559
              +F++  ID E + I IS   GC  + L  LN+++SPF      +F + +CS+      G
Sbjct  76    GQFVVADIDYEYQNIYISDPKGCMARRLMTLNVTSSPFMISGALHFILLNCSS----ITG  131

Query  1558  SINISPIACLTKPGHFIYAADSSLYL--------YSATDLISCTKMFHVSSVP--YSIAQ  1409
                + P+ CL+   H +YA ++S Y+        +   D+ S  K  H + +P  Y +  
Sbjct  132   RPELLPLDCLSSSNHLVYAVNASTYMSLDLLSSCHFTADVTSSLKFSHKAFMPSFYDLTL  191

Query  1408  DNTV----FSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLRKLKVAGEVLGSFLVV  1241
                +       R  G  CRLK N++ E  +  I  L    + P     +   V    L++
Sbjct  192   GWEIAGCDIGCRVRGGECRLKGNNSLE-VECSIEHLPAYKSSPSEAWNMIIRVSIGILII  250

Query  1240  ---VIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEG  1070
                V + V Y I       ++ + KI+ FLED+++L P RYS+AD++K+T++F +KLG+G
Sbjct  251   PLPVTLTVLYLIRSRRSQAEKIRRKIKIFLEDFRSLHPTRYSFADVQKMTNKFRKKLGQG  310

Query  1069  SYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFH  890
              YG+V+KG+L   V VAVK+L+NSKG+G  E+F NE+S IG IHH+NVVRL GYCAD   
Sbjct  311   GYGSVFKGELENGVPVAVKLLDNSKGNG--EDFTNEISIIGRIHHVNVVRLFGYCADESE  368

Query  889   RALVYEYLVNNSLEKFVFSPN-DKNFLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIK  713
             +ALVYE++ N SL+KF+F  N ++  L W KLQ IA+G+AKG+EYLHQGCDQRILHFDIK
Sbjct  369   QALVYEFMPNKSLDKFIFPANSNRPKLSWGKLQHIAIGVAKGIEYLHQGCDQRILHFDIK  428

Query  712   PRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEV-FSRNFGNVSYKSD  536
             P+NILLD +FNPKISDFG AKL  K++S+VS+TA RGT GYIAPEV FS N GNVSYK+D
Sbjct  429   PQNILLDIDFNPKISDFGLAKLFPKKESVVSITAVRGTTGYIAPEVYFSGNIGNVSYKTD  488

Query  535   VYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKK  356
             VYS+GMLL EMVG K+  D+T    T+Q YFP+W+YN L+ GE++ I+ EK  D  IAKK
Sbjct  489   VYSYGMLLFEMVGSKRNKDLTVG-NTSQVYFPQWVYNRLANGEDLGIKEEKDGDDDIAKK  547

Query  355   LTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKAN  206
             L++V +WC+QW P +RPS+  VIQMLE       +PP+PF S    ++  N
Sbjct  548   LSVVAIWCVQWDPSNRPSMSTVIQMLEGRTRSLPLPPDPFASLSLEESDLN  598



>ref|XP_008232006.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=609

 Score =   491 bits (1264),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 235/360 (65%), Positives = 286/360 (79%), Gaps = 6/360 (2%)
 Frame = -2

Query  1231  LVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVY  1052
             +  YR+Y  ++ +KE Q+KIERFLEDYKALKP+RYSYADIK+IT++F + LG+G+YGTV+
Sbjct  255   IAVYRVYSADQKEKENQLKIERFLEDYKALKPSRYSYADIKRITNQFKDNLGQGAYGTVF  314

Query  1051  KGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYE  872
             KGKLS + FVAVKVLNNSKG+G  EEFVNE+  +G IHH+NVVRLVG+CADGF RALVYE
Sbjct  315   KGKLSSEFFVAVKVLNNSKGNG--EEFVNEVGMMGHIHHVNVVRLVGFCADGFRRALVYE  372

Query  871   YLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILL  695
             +  N SL+ F+ S + K+ FLGWEKL  IA+GIAKG+EYLHQGCD RILHFDIKP N+LL
Sbjct  373   FFPNGSLQDFISSADSKHSFLGWEKLHDIAVGIAKGIEYLHQGCDLRILHFDIKPHNVLL  432

Query  694   DQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGML  515
             D NF PKISDFG AKLCSK++SIVSMT ARGTMGYIAPEVFSRNFG VSYKSDVYSFGML
Sbjct  433   DHNFTPKISDFGLAKLCSKDQSIVSMTTARGTMGYIAPEVFSRNFGIVSYKSDVYSFGML  492

Query  514   LLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLW  335
             LLEMVGG+K    + + + N+ Y+PEWIYN+L  G+++ I I    D KI K L IVGLW
Sbjct  493   LLEMVGGRKNIG-SSTKDANEIYYPEWIYNLLEGGDDLRIHIGDDGDGKIPKTLAIVGLW  551

Query  334   CIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEMD  155
             CIQW+PVDRPS+++V+ ML   +  +MPPNPF S  P+   A+ P R     LE I E++
Sbjct  552   CIQWHPVDRPSMQIVVHMLGGGDNLAMPPNPFVSAGPTTTHASIPAR--RVELEAIPELE  609


 Score =   360 bits (924),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 196/242 (81%), Gaps = 2/242 (1%)
 Frame = -2

Query  952  IGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGI  776
            +G IHH+NVVRLVG+CADGF RALVYE+  N SL+ F+ S + KN FLGWEKL  IA+GI
Sbjct  1    MGHIHHVNVVRLVGFCADGFRRALVYEFFPNGSLQDFISSADSKNSFLGWEKLHDIAVGI  60

Query  775  AKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTM  596
            AKG+EYLHQGCDQRILHFDIKP N+LLD NF PKISDFG AKLCSK++SIVSMT ARGTM
Sbjct  61   AKGIEYLHQGCDQRILHFDIKPHNVLLDHNFTPKISDFGLAKLCSKDQSIVSMTTARGTM  120

Query  595  GYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILS  416
            GYIAPEVFSRNFG VSYKSDVYSFGMLLLEMVGGKK    + + + N+ Y+PEWIYN+L 
Sbjct  121  GYIAPEVFSRNFGIVSYKSDVYSFGMLLLEMVGGKKNIG-SSTKDANEIYYPEWIYNLLE  179

Query  415  RGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFT  236
             G+++ I I    D KI K L IVGLWCIQW+PVDRPS+++V+ ML   +  +MPPNPF 
Sbjct  180  GGDDLRIHIGDDGDGKIPKTLAIVGLWCIQWHPVDRPSMQIVVHMLGGGDNLAMPPNPFV  239

Query  235  ST  230
            S 
Sbjct  240  SA  241



>gb|KHN23637.1| Putative receptor-like protein kinase [Glycine soja]
Length=591

 Score =   489 bits (1260),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 276/601 (46%), Positives = 376/601 (63%), Gaps = 55/601 (9%)
 Frame = -2

Query  1909  RKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNATLQPPFPVKF  1730
              KCG    E  F  R  ++      +PGF+L C DK ET LE           P  P+K 
Sbjct  29    EKCGRVHIEFPFYLRNNNLSHTTGHHPGFDLFCNDKDETVLE----------LPAVPIKL  78

Query  1729  LIESIDCEDRLIIISRVDGCFLQL-LPILNLSASPFSFE----NLYNFSIFSCSTHRNIT  1565
              ++ ID + + I I   + C  ++ L + N S  PF F+    + ++ S F C++     
Sbjct  79    FVKKIDYKSQQIQIYDPENCLPKVFLKLGNYSIYPFKFQSDFSDKHDVSFFFCNS-----  133

Query  1564  AGSINISPIACLTKPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIAQDNTVFSLR  1385
                     I+C      ++   D         +LISCTK+  V SV +   ++     L+
Sbjct  134   --------ISCPIWRLSYLPWIDP--------ELISCTKVEDVLSVEWLDGEEIINSILK  177

Query  1384  WTGPSC--------RLKNNSTAEDADDC-IAPLTKLHTGPLRKLKVAGEVLGSFLVVVIV  1232
             W+ P+C        + K  +  +D  +C I P     T  +  +   G +L  FL++V  
Sbjct  178   WSKPNCNQCEAQGQKCKWKNGTQDETECFICPTNAFPTSTIVLIAAVGLML--FLLLVKA  235

Query  1231  LVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSEKLGEGSYGTVY  1052
             L  + +Y   K+K+E+Q +IE+FLEDY A+KP R++YADIK+IT+ FSE LGEG++G V+
Sbjct  236   L--FYMYGYYKIKEEDQARIEKFLEDYAAMKPTRFTYADIKRITNGFSESLGEGAHGKVF  293

Query  1051  KGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYCADGFHRALVYE  872
             KG LS  + VAVK+LN++ GDG  ++F+NE+  IG IHHINVVRL+G+CADGFHRALVY+
Sbjct  294   KGMLSQQILVAVKILNDTVGDG--KDFINEVGIIGKIHHINVVRLLGFCADGFHRALVYD  351

Query  871   YLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQRILHFDIKPRNILL  695
             +  N SLEKF+  P++ + FLGWEKLQQIALG+A G+EYLH GCD RILHFDI P N+LL
Sbjct  352   FFPNGSLEKFLAPPDNNDVFLGWEKLQQIALGVATGIEYLHLGCDHRILHFDINPHNVLL  411

Query  694   DQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGML  515
             D +F P I+DFG AKLC K +S VSMTAARGT+GYIAPEVFSRNFGNVSYKSD+YS+GML
Sbjct  412   DDHFLPIITDFGLAKLCPKNQSTVSMTAARGTLGYIAPEVFSRNFGNVSYKSDIYSYGML  471

Query  514   LLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSKIAKKLTIVGLW  335
             LLEMVGG+K ++++   E  Q  +PEWI+N+L  G + ++ IE   D +IAKKL IVGL 
Sbjct  472   LLEMVGGRKNTNMSAE-EIFQVLYPEWIHNLL-EGRDFQVTIEDEGDVQIAKKLAIVGLR  529

Query  334   CIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPGRLFTSALEIISEM  158
             CIQW P DRPS+K V+QML+ + +    PP PF  T  S+  A  P R     LE+I E+
Sbjct  530   CIQWNPRDRPSMKTVVQMLKGDGDDLIAPPTPFDITGSSRTNALVPTRRQNFELEVIHEI  589

Query  157   D  155
             +
Sbjct  590   E  590



>gb|KEH40391.1| receptor-like kinase [Medicago truncatula]
Length=574

 Score =   488 bits (1257),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 273/569 (48%), Positives = 369/569 (65%), Gaps = 35/569 (6%)
 Frame = -2

Query  1825  FELLCTDKGETALENPFPLLNATLQPPFPVKFLIESIDCEDRLIIISRVDGCFLQLLPIL  1646
             F L CT+     +E P          P P+KF I  I+ E R I +S    C  QLL   
Sbjct  29    FNLNCTNNNMKIIEIP--------TYPVPIKFNISDINYELRTIKLSDPGNCLPQLLLDR  80

Query  1645  NLSAS-PF------SFENLYNFSIFSCSTHRNITAGSINISPIACLTKPGHFIYAADSSL  1487
             N S++ PF       F   ++ S F+CS+   +   S  +            IY  DS  
Sbjct  81    NFSSNFPFKDYHSYEFPRQFDVSFFNCSSVVQLIRSSNLMQHHGTQDIISCPIYVVDSDQ  140

Query  1486  YLYSATD-LISCTKMFHVSS--VPYSIAQDNTVFSLRWTGPSCRLKNNSTAEDADDCIAP  1316
                  +D L+ CTK+F   S    YSI QDN +  L W+G +  +           C+  
Sbjct  141   ETIVESDVLVYCTKLFDRVSPFSAYSI-QDNRLL-LTWSGTNFDI----------GCLKC  188

Query  1315  LTKLHTGPLRKLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKP  1136
               K     L  L  AG ++GS L+++++    RIYR  KMK E+ V+IE FL+DYKALKP
Sbjct  189   KHKSKKTTLVILFSAGGIIGSTLLLLVLGTIVRIYRYFKMKGEDHVRIENFLKDYKALKP  248

Query  1135  ARYSYADIKKITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMS  956
              R+SYADIK+IT++F +K+GEG++G VYKGKLS  + VAVK+LNN+  +GDG+EF+NE+ 
Sbjct  249   TRFSYADIKRITNKFKDKIGEGAHGAVYKGKLSSQILVAVKMLNNT--EGDGKEFINEVG  306

Query  955   TIGSIHHINVVRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALG  779
             T+G IHH+NVVRL+G+CADGF+R LVY+   + SL+KF+  PN+K+ FLGW+ LQQIALG
Sbjct  307   TMGKIHHLNVVRLLGFCADGFYRGLVYDLFPSGSLQKFLSPPNNKDAFLGWDTLQQIALG  366

Query  778   IAKGVEYLHQGCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGT  599
             IA G+EYLHQGCDQRILHFDI P N+LLD+NF PKI+DFG AK+CSK +S VSMTAA+GT
Sbjct  367   IANGIEYLHQGCDQRILHFDINPHNVLLDENFTPKITDFGLAKMCSKNRSTVSMTAAKGT  426

Query  598   MGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNIL  419
             +GY+APEVFSRNFGNVSYKSD+YS+GMLLLEMV G+K ++ T   E  Q  +P+WI+++L
Sbjct  427   LGYMAPEVFSRNFGNVSYKSDIYSYGMLLLEMVAGRKNTNTTTGEENLQVLYPDWIHDLL  486

Query  418   SRGEEVEIQIEKGEDSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNP  242
               G +++I I++  D +I KK+ IVGL CIQW P+ RPS+K VIQML+ + +   +P NP
Sbjct  487   -EGGDIQIPIDEEGDFRIPKKMAIVGLRCIQWQPMHRPSMKTVIQMLQGDGDKLKVPSNP  545

Query  241   FTSTDPSKAKANKPGRLFTSALEIISEMD  155
             F  T  + + A+   +     LE+I E+D
Sbjct  546   FGPTTSTNSTASTVTKRINFELEVIQELD  574



>ref|XP_008245710.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=399

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 242/414 (58%), Positives = 306/414 (74%), Gaps = 21/414 (5%)
 Frame = -2

Query  1465  LISCTKMFHVSSVPYSIAQDNTVFSLRWTGPSCRLKNNSTAEDADDCIAPLTKLHTGPLR  1286
             L+SC K+   +S    I  D     L W+ PSC           + C      L    L+
Sbjct  3     LVSCIKVHDYTSDLAYIHDDMGELLLHWSIPSC-----------EHCKG--RNLRRTNLK  49

Query  1285  KLKVAGEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKK  1106
              L ++   L   L+ +   + Y +Y  NK +KE Q++IERFL++Y+A+KP+RYSYADIK+
Sbjct  50    ILGISALCL--VLIAMGTTICY-VYNSNKKEKENQLRIERFLDEYRAMKPSRYSYADIKR  106

Query  1105  ITDRFSEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINV  926
             IT +F EKLG+G+YGTV+KGKLS ++ VAVK+LNNS  + +GE+F+NE+ T+  IHH+NV
Sbjct  107   ITSQFKEKLGQGAYGTVFKGKLSSELLVAVKMLNNS--NENGEDFINEVGTMCQIHHVNV  164

Query  925   VRLVGYCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQ  749
             VRLVG CADGF  ALVYEYL N SL+ F+ S ++KN F+GW+KLQ IALGIAKG+EYLHQ
Sbjct  165   VRLVGICADGFIHALVYEYLPNGSLQNFLSSADNKNSFIGWDKLQDIALGIAKGIEYLHQ  224

Query  748   GCDQRILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFS  569
             GCDQRILHFDIKP+N+LLDQ+F PK+SDFG AK C+K++S +SMT ARGTMGYIAPE+FS
Sbjct  225   GCDQRILHFDIKPQNVLLDQDFTPKVSDFGLAKFCAKDQSAISMTTARGTMGYIAPEIFS  284

Query  568   RNFGNVSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQI  389
             RNFGNVSYKSDVYSFG+LLLEMVGG+K   +     T+Q YFPEWIYN+L +G ++ I I
Sbjct  285   RNFGNVSYKSDVYSFGILLLEMVGGRKNFKVM-EDSTSQVYFPEWIYNLLEQGNDLRIHI  343

Query  388   EKGE-DSKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAEEPPSMPPNPFTST  230
                E D  IA+KL IVGLWCIQW+P DRPS+KVV+QMLE E   +MPPNPF ST
Sbjct  344   GDDEADVTIARKLAIVGLWCIQWHPTDRPSMKVVVQMLEREGNLAMPPNPFAST  397



>ref|XP_006374065.1| hypothetical protein POPTR_0015s00230g, partial [Populus trichocarpa]
 gb|ERP51862.1| hypothetical protein POPTR_0015s00230g, partial [Populus trichocarpa]
Length=401

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 238/347 (69%), Positives = 286/347 (82%), Gaps = 5/347 (1%)
 Frame = -2

Query  1264  VLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRFSE  1085
              +GS ++++I+   YR+Y  +K  K+ Q +IE FL DYKALKPARY+YADIK+IT+ F E
Sbjct  58    TVGSAILLLILFALYRVYSSDKAAKQHQKRIEIFLADYKALKPARYTYADIKRITNDFKE  117

Query  1084  KLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVGYC  905
             KLG+G+YGTV+KGKLS ++FVAVK+LNNS G+G  EEFVNE+ T+G IHH+N+VRLVGYC
Sbjct  118   KLGQGAYGTVFKGKLSNEIFVAVKILNNSTGNG--EEFVNEVGTMGRIHHVNIVRLVGYC  175

Query  904   ADGFHRALVYEYLVNNSLEKFVFSPNDKNF-LGWEKLQQIALGIAKGVEYLHQGCDQRIL  728
             ADGF RALVY+YL N SLEKFV S + K   L WEKLQ IALGIA+G+EYLHQGCDQRIL
Sbjct  176   ADGFRRALVYDYLPNESLEKFVSSEHGKTCPLSWEKLQDIALGIARGIEYLHQGCDQRIL  235

Query  727   HFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGNVS  548
             HFDIKP NILLD NF+PKISDFG AKLCSK++S VSMT ARGTMGYIAPEVFSRNFGNVS
Sbjct  236   HFDIKPHNILLDDNFSPKISDFGLAKLCSKDQSAVSMTTARGTMGYIAPEVFSRNFGNVS  295

Query  547   YKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGEDSK  368
              KSDVYS+GM+LLEMVGG+K  D      T Q YFPEW+YN L  GEE+ I++EK  D++
Sbjct  296   SKSDVYSYGMVLLEMVGGRKTVDKEVENNT-QIYFPEWVYNSLDNGEELIIRVEKEGDAQ  354

Query  367   IAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTST  230
             IAKKLTIVGLWCIQW+PV+RPS+  V+QMLE E +  +MPP+PF+S 
Sbjct  355   IAKKLTIVGLWCIQWHPVERPSMNTVVQMLEGEGDKLTMPPSPFSSA  401


 Score = 62.0 bits (149),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  1918  CLPRKCGNNGPEISFPFRLKHIQPPECGYPGFELLCTDKGETALENPFPLLNA  1760
             C   +C  +GP I FPFR+K  QP  CGYPGF+L CTD+ ET LE    L  A
Sbjct  2     CQEARCKKHGPVIRFPFRIKGKQPDYCGYPGFDLSCTDRKETLLEPACGLCGA  54



>ref|XP_003555056.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Glycine max]
Length=599

 Score =   488 bits (1257),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 281/601 (47%), Positives = 385/601 (64%), Gaps = 62/601 (10%)
 Frame = -2

Query  1927  RNECLPRKCGNNGPEISFPFRLKH---IQPPECGYP-GFELLCTDKGETALENPFPLLNA  1760
             +N C   KCG     I FPF L++   +      Y  GF+LLCTD  ET LE        
Sbjct  24    KNGCTD-KCGR--VRIQFPFYLRNNSKLNHTTTAYSSGFDLLCTDADETVLE--------  72

Query  1759  TLQPPFPVKFLIESIDCEDRLIIISRVDGCF-LQLLPILNLSASPFSFENL--YNFSIFS  1589
                P  P+K  ++SID + + I I     C   +L+ + N S +PF F++    N S F 
Sbjct  73    --LPSVPIKLFVKSIDYKLQQIQIYDPQNCLPRELIKLGNSSVAPFKFQSFGGNNVSFFR  130

Query  1588  CSTHRNITAGSINISPIACLT-KPGHFIYAADSSLYLYSATDLISCTKMFHVSSVPYSIA  1412
             C++  +         PI  L    G FI             ++ISCTK+  V SV + + 
Sbjct  131   CNSMSSSC-------PILQLGYDEGDFI-----------DPEIISCTKVSDVFSVQWQVN  172

Query  1411  Q--DNTVFSLRWTGPSC----------RLKNNSTAEDADDC-IAPLTKLHTGPLRKLKVA  1271
                 N V  + W+ P C          + KN +  E   +C I P  ++ T  +  L  A
Sbjct  173   NYLGNAVV-MEWSKPDCSTCEAQGHKCKYKNGTQGET--ECFICPTNRISTSSV-VLIAA  228

Query  1270  GEVLGSFLVVVIVLVTYRIYRLNKMKKEEQVKIERFLEDYKALKPARYSYADIKKITDRF  1091
             G ++G  L++V+V     +Y     K E++ ++E+FLEDY+A+KP R++YADIK+IT+ F
Sbjct  229   GGIVGMILLLVVVKALLHLYDHYMTKGEDRARMEKFLEDYRAMKPTRFTYADIKRITNGF  288

Query  1090  SEKLGEGSYGTVYKGKLSGDVFVAVKVLNNSKGDGDGEEFVNEMSTIGSIHHINVVRLVG  911
              E LGEG++G V+KG LS ++ VAVK+LN++ GDG  ++F+NE+ T+G IHH+NVVRL+G
Sbjct  289   RESLGEGAHGAVFKGMLSREILVAVKILNDTVGDG--KDFINEVGTMGKIHHVNVVRLLG  346

Query  910   YCADGFHRALVYEYLVNNSLEKFVFSPNDKN-FLGWEKLQQIALGIAKGVEYLHQGCDQR  734
             +CADGFHRALVY++  N SL++F+  P++K+ FLGWEKLQQIALG+AKGVEYLH GCDQR
Sbjct  347   FCADGFHRALVYDFFPNGSLQRFLAPPDNKDVFLGWEKLQQIALGVAKGVEYLHLGCDQR  406

Query  733   ILHFDIKPRNILLDQNFNPKISDFGQAKLCSKEKSIVSMTAARGTMGYIAPEVFSRNFGN  554
             I+HFDI P NIL+D +F PKI+DFG AKLC K +S VS+TAARGT+GYIAPEVFSRNFGN
Sbjct  407   IIHFDINPHNILIDDHFVPKITDFGLAKLCPKNQSTVSITAARGTLGYIAPEVFSRNFGN  466

Query  553   VSYKSDVYSFGMLLLEMVGGKKKSDITGSPETNQDYFPEWIYNILSRGEEVEIQIEKGED  374
             VSYKSD+YS+GMLLLEMVGG+K ++++ + E+ Q  +PEWI+N+L +  +V++ IE   D
Sbjct  467   VSYKSDIYSYGMLLLEMVGGRKNTNMS-AEESFQVLYPEWIHNLL-KSRDVQVTIEDEGD  524

Query  373   SKIAKKLTIVGLWCIQWYPVDRPSIKVVIQMLEAE-EPPSMPPNPFTSTDPSKAKANKPG  197
              +IAKKL IVGLWCI+W P+DRPS+K VIQMLE + +    PP PF  T  S+     P 
Sbjct  525   VRIAKKLAIVGLWCIEWNPIDRPSMKTVIQMLEGDGDKLIAPPTPFDKTSSSRTSVVAPT  584

Query  196   R  194
             R
Sbjct  585   R  585



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5810760867264