BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22718_g2_i3 len=556 path=[3154:0-245 3400:246-371 3526:372-555]

Length=556
                                                                      Score     E

ref|XP_009614702.1|  PREDICTED: uncharacterized protein LOC104107570  99.8    4e-23   
ref|XP_009792127.1|  PREDICTED: uncharacterized protein LOC104239...  97.1    5e-22   
ref|XP_009759264.1|  PREDICTED: uncharacterized protein LOC104211838  92.0    3e-20   
ref|XP_009605593.1|  PREDICTED: uncharacterized protein LOC104100126  90.5    1e-19   
ref|XP_009792128.1|  PREDICTED: uncharacterized protein LOC104239...  90.1    2e-19   
ref|XP_010317214.1|  PREDICTED: uncharacterized protein LOC104645973  87.4    3e-18   
ref|XP_006346994.1|  PREDICTED: uncharacterized protein LOC102604509  85.1    1e-17   
ref|XP_010550389.1|  PREDICTED: uncharacterized protein LOC104821276  82.4    2e-16   
ref|XP_002521599.1|  conserved hypothetical protein                   81.6    3e-16   Ricinus communis
ref|XP_008441122.1|  PREDICTED: uncharacterized protein LOC103485350  80.9    5e-16   
ref|XP_004287902.1|  PREDICTED: uncharacterized protein LOC101303361  80.9    5e-16   
ref|XP_007156938.1|  hypothetical protein PHAVU_002G029900g           80.5    9e-16   
ref|XP_010316357.1|  PREDICTED: uncharacterized protein LOC101257926  79.3    2e-15   
ref|XP_006425685.1|  hypothetical protein CICLE_v10026748mg           79.7    2e-15   
ref|XP_007204141.1|  hypothetical protein PRUPE_ppa022555mg           79.0    2e-15   
ref|XP_003611987.1|  hypothetical protein MTR_5g020060                78.6    3e-15   
ref|XP_008352469.1|  PREDICTED: uncharacterized protein LOC103415969  77.0    2e-14   
ref|XP_007046953.1|  Uncharacterized protein TCM_000398               76.6    2e-14   
ref|XP_003537584.1|  PREDICTED: uncharacterized protein LOC100819278  76.3    2e-14   
gb|KGN48825.1|  hypothetical protein Csa_6G502630                     75.1    8e-14   
ref|XP_004512041.1|  PREDICTED: uncharacterized protein LOC101500608  74.7    1e-13   
gb|EYU40157.1|  hypothetical protein MIMGU_mgv1a016129mg              74.3    1e-13   
gb|ACU23592.1|  unknown                                               73.9    2e-13   Glycine max [soybeans]
ref|XP_008363102.1|  PREDICTED: uncharacterized protein LOC103426802  73.9    2e-13   
ref|XP_010113494.1|  hypothetical protein L484_026829                 73.9    2e-13   
gb|KHG01548.1|  Nitric oxide synthase, inducible                      73.9    2e-13   
ref|XP_008338094.1|  PREDICTED: uncharacterized protein LOC103401159  72.8    2e-13   
ref|XP_006393873.1|  hypothetical protein EUTSA_v10005154mg           70.9    2e-12   
gb|AAW33981.1|  unknown                                               70.9    2e-12   Ammopiptanthus mongolicus
ref|NP_201479.1|  uncharacterized protein                             70.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287901.1|  PREDICTED: uncharacterized protein LOC101303064  71.2    2e-12   
ref|XP_009103486.1|  PREDICTED: uncharacterized protein LOC103829566  70.5    2e-12   
ref|XP_002466547.1|  hypothetical protein SORBIDRAFT_01g009730        71.6    2e-12   Sorghum bicolor [broomcorn]
ref|XP_002267045.3|  PREDICTED: uncharacterized protein LOC100256467  70.9    3e-12   Vitis vinifera
emb|CDY54166.1|  BnaC07g48560D                                        70.1    4e-12   
ref|XP_009371588.1|  PREDICTED: uncharacterized protein LOC103960823  70.5    4e-12   
ref|XP_010679715.1|  PREDICTED: uncharacterized protein LOC104895017  70.1    4e-12   
emb|CDY72100.1|  BnaCnng75970D                                        69.7    4e-12   
emb|CDY53845.1|  BnaA07g37400D                                        68.9    4e-12   
ref|XP_010254863.1|  PREDICTED: uncharacterized protein LOC104595...  70.9    5e-12   
ref|XP_010254861.1|  PREDICTED: uncharacterized protein LOC104595...  70.9    5e-12   
gb|KFK28361.1|  late embryogenesis abundant protein                   69.7    6e-12   
gb|KDP23195.1|  hypothetical protein JCGZ_00340                       69.3    8e-12   
gb|EPS61945.1|  hypothetical protein M569_12849                       67.8    9e-12   
ref|XP_006281688.1|  hypothetical protein CARUB_v10027836mg           68.6    9e-12   
ref|XP_004986269.1|  PREDICTED: uncharacterized protein LOC101767727  69.3    1e-11   
ref|XP_011099606.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.6    1e-11   
ref|XP_008790362.1|  PREDICTED: uncharacterized protein LOC103707...  68.2    2e-11   
ref|XP_002866738.1|  hypothetical protein ARALYDRAFT_496922           68.2    2e-11   
dbj|BAJ85260.1|  predicted protein                                    68.2    3e-11   
gb|EMS67882.1|  hypothetical protein TRIUR3_31296                     68.2    3e-11   
gb|ABV32166.1|  UFG2                                                  68.2    3e-11   
ref|XP_003560456.1|  PREDICTED: uncharacterized protein LOC100827223  67.0    7e-11   
ref|XP_010464881.1|  PREDICTED: uncharacterized protein LOC104745368  65.9    1e-10   
ref|XP_008644548.1|  PREDICTED: uncharacterized protein LOC103625926  66.2    1e-10   
emb|CDY49840.1|  BnaC02g43990D                                        65.1    2e-10   
gb|KCW56778.1|  hypothetical protein EUGRSUZ_I02450                   65.1    2e-10   
ref|XP_010484587.1|  PREDICTED: uncharacterized protein LOC104762889  64.3    4e-10   
ref|XP_010444731.1|  PREDICTED: uncharacterized protein LOC104727353  64.3    5e-10   
ref|XP_010910611.1|  PREDICTED: uncharacterized protein LOC105036553  64.3    5e-10   
ref|NP_001051116.1|  Os03g0723400                                     64.7    5e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAX95683.1|  hypothetical protein                                  63.5    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009130551.1|  PREDICTED: uncharacterized protein LOC103855334  63.5    8e-10   
ref|XP_006650516.1|  PREDICTED: uncharacterized protein LOC102720220  62.8    2e-09   
ref|XP_006856019.1|  hypothetical protein AMTR_s00059p00050970        62.0    4e-09   
ref|XP_007202748.1|  hypothetical protein PRUPE_ppa013228mg           58.2    7e-08   
ref|XP_008241670.1|  PREDICTED: uncharacterized protein LOC103340081  57.4    1e-07   
ref|XP_008363103.1|  PREDICTED: uncharacterized protein LOC103426803  55.5    5e-07   
gb|KHN41981.1|  hypothetical protein glysoja_003721                   52.8    1e-06   
ref|XP_004143513.1|  PREDICTED: uncharacterized protein LOC101219972  51.6    1e-05   
ref|XP_009803792.1|  PREDICTED: uncharacterized protein LOC104249111  50.1    1e-05   
gb|KHN13449.1|  hypothetical protein glysoja_050057                   51.2    1e-05   
ref|XP_006599384.1|  PREDICTED: uncharacterized protein LOC102663424  51.2    2e-05   
ref|XP_004170738.1|  PREDICTED: uncharacterized protein LOC101224142  51.2    2e-05   
gb|ABA54809.1|  late embryogenesis abundant protein                   52.0    2e-05   Picea mariana [black spruce]
gb|ADE76277.1|  unknown                                               50.8    4e-05   
gb|ABA54810.1|  late embryogenesis abundant protein                   50.8    5e-05   Picea abies
gb|AAB01558.1|  late embryogenesis abundant protein                   50.8    5e-05   Picea glauca
gb|ABA54793.1|  late embryogenesis abundant protein                   50.8    5e-05   Picea glauca
emb|CAN74537.1|  hypothetical protein VITISV_023717                   50.4    3e-04   Vitis vinifera
ref|XP_008790361.1|  PREDICTED: uncharacterized protein LOC103707...  48.9    3e-04   
emb|CAN71097.1|  hypothetical protein VITISV_041500                   49.3    5e-04   Vitis vinifera



>ref|XP_009614702.1| PREDICTED: uncharacterized protein LOC104107570 [Nicotiana tomentosiformis]
Length=129

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 85/141 (60%), Gaps = 22/141 (16%)
 Frame = +1

Query  25   MLTALRLATARTPPPA---SPLPHRLLGR--SHIRLRRAVTTGaagcpdaaaddddMQKV  189
            M+ A+RLAT R  PPA   +PLP+ + GR  S IR R+ VT+                  
Sbjct  1    MINAIRLATIRAQPPAVFSNPLPYHI-GRKSSEIRFRQVVTSSGQPDN------------  47

Query  190  NDTekpppqpaaeqppkVGDTMSS-FGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNT  366
            ++      +PA E   K  DTMSS FG+GYATRSDEEGFGGIYGGN  +E+ EKI  G  
Sbjct  48   SNKMGQTKKPADEAEHKAADTMSSSFGDGYATRSDEEGFGGIYGGN--KEDEEKITHGKA  105

Query  367  PAEYGENQGSEVKEKEKGRHQ  429
            P EY  NQGSEVKEKEK R+Q
Sbjct  106  P-EYDTNQGSEVKEKEKARNQ  125



>ref|XP_009792127.1| PREDICTED: uncharacterized protein LOC104239242 isoform X1 [Nicotiana 
sylvestris]
Length=129

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 86/141 (61%), Gaps = 22/141 (16%)
 Frame = +1

Query  25   MLTALRLATARTPPPA---SPLPHRLLGR--SHIRLRRAVTTGaagcpdaaaddddMQKV  189
            M+ A+RL T R   P+   +PLP+ + GR  S IR R+ VT+                K+
Sbjct  1    MINAIRLTTIRAQSPSVFSNPLPYHI-GRKSSEIRFRQVVTSAGQPDN--------TNKM  51

Query  190  NDTekpppqpaaeqppkVGDTMSS-FGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNT  366
            + T+KP  +   +      DTMSS FG+GYATRSDEEGFGG+YGGN  +E+ EKII G  
Sbjct  52   DQTKKPADEAEHK----AADTMSSSFGDGYATRSDEEGFGGVYGGN--KEDEEKIIHGKA  105

Query  367  PAEYGENQGSEVKEKEKGRHQ  429
            P EY  NQGSEVKEKEK R+Q
Sbjct  106  P-EYDTNQGSEVKEKEKARNQ  125



>ref|XP_009759264.1| PREDICTED: uncharacterized protein LOC104211838 [Nicotiana sylvestris]
Length=125

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 76/141 (54%), Gaps = 22/141 (16%)
 Frame = +1

Query  25   MLTALRLATARTPPPASPLPHRLLG----RSHIRLRRAVTTGaagcpdaaaddddMQKVN  192
            ML ALR AT   P      P   +      S IR R  +T                 K++
Sbjct  1    MLNALRSATKAQPLAVFSNPSHYINICSKSSQIRFRTLLTEAGKQDEI---------KMD  51

Query  193  DTekpppqpaaeqppkVGDTMSSFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPA  372
            +T+KP  +   +      DTMSSFGEGYATRSDEEGFGGIYGGN   E  EKI+ GN P 
Sbjct  52   ETKKPGTETKPK------DTMSSFGEGYATRSDEEGFGGIYGGNQDVE--EKIVHGNAP-  102

Query  373  EYGENQGSEVKEKEKGRHQPH  435
            EY   QGSEVKEKEK R+QP 
Sbjct  103  EYDTKQGSEVKEKEKARNQPQ  123



>ref|XP_009605593.1| PREDICTED: uncharacterized protein LOC104100126 [Nicotiana tomentosiformis]
Length=126

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 50/63 (79%), Gaps = 3/63 (5%)
 Frame = +1

Query  247  DTMSSFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKGRH  426
            DTMSSFGEGYATRSDEEGFGGIYGGN   E  EKI+ GN P EY   QGSEVKEKEK R+
Sbjct  65   DTMSSFGEGYATRSDEEGFGGIYGGNQDVE--EKIVHGNVP-EYDTKQGSEVKEKEKARN  121

Query  427  QPH  435
            QP 
Sbjct  122  QPQ  124



>ref|XP_009792128.1| PREDICTED: uncharacterized protein LOC104239242 isoform X2 [Nicotiana 
sylvestris]
Length=123

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 83/140 (59%), Gaps = 26/140 (19%)
 Frame = +1

Query  25   MLTALRLATARTPPPA---SPLPHRLLGR--SHIRLRRAVTTGaagcpdaaaddddMQKV  189
            M+ A+RL T R   P+   +PLP+ + GR  S IR R+ VT+                K+
Sbjct  1    MINAIRLTTIRAQSPSVFSNPLPYHI-GRKSSEIRFRQVVTSAGQPDN--------TNKM  51

Query  190  NDTekpppqpaaeqppkVGDTMSSFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTP  369
            + T+KP  +          +  ++FG+GYATRSDEEGFGG+YGGN  +E+ EKII G  P
Sbjct  52   DQTKKPADE---------AEHKAAFGDGYATRSDEEGFGGVYGGN--KEDEEKIIHGKAP  100

Query  370  AEYGENQGSEVKEKEKGRHQ  429
             EY  NQGSEVKEKEK R+Q
Sbjct  101  -EYDTNQGSEVKEKEKARNQ  119



>ref|XP_010317214.1| PREDICTED: uncharacterized protein LOC104645973 [Solanum lycopersicum]
Length=135

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 76/142 (54%), Gaps = 23/142 (16%)
 Frame = +1

Query  25   MLTALRLAT-ARTPPP--ASPLPHRLL-GRSHIRLRRAVTTGaagcpdaaaddddMQKVN  192
            M+  ++LA  A+ PP   ++PLP+ +    S IR R+ VT+                   
Sbjct  10   MINTIKLANRAQIPPSVLSNPLPYHIARNNSDIRFRQFVTSAGQP---------------  54

Query  193  DTekpppqpaaeqppkVGDTMSS-FGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTP  369
            D           Q  K  DTMSS +G+ YATRSDEEGFGGIYGGN  +E+ E I  G  P
Sbjct  55   DNNNMDQTNNKPQQDKAADTMSSSYGDAYATRSDEEGFGGIYGGN--KEDEENIEHGKAP  112

Query  370  AEYGENQGSEVKEKEKGRHQPH  435
             EY   QGSEVKEKEK R+QP 
Sbjct  113  -EYETKQGSEVKEKEKARNQPQ  133



>ref|XP_006346994.1| PREDICTED: uncharacterized protein LOC102604509 [Solanum tuberosum]
Length=119

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 75/138 (54%), Gaps = 21/138 (15%)
 Frame = +1

Query  25   MLTALRLATARTPPPASPLPHRLLGRS-HIRLRRAVTTGaagcpdaaaddddMQKVNDTe  201
            M+ A+RLA     PP+  L + +   +  IR R+ VT+      +       M + N   
Sbjct  1    MINAIRLANRAQLPPSDVLSYHIARNNLDIRFRQVVTSAGQPDNN-------MNQTN---  50

Query  202  kpppqpaaeqppkVGDTMSS-FGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEY  378
                     +  K  DTMSS +GE YATRSDEEGFGGIYGGN  +E+ E I  G  P EY
Sbjct  51   ------KKPEQDKATDTMSSSYGEAYATRSDEEGFGGIYGGN--KEDEENIKHGKAP-EY  101

Query  379  GENQGSEVKEKEKGRHQP  432
               QGSEVKEKEK R+QP
Sbjct  102  ETKQGSEVKEKEKARNQP  119



>ref|XP_010550389.1| PREDICTED: uncharacterized protein LOC104821276 [Tarenaya hassleriana]
Length=127

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 75/143 (52%), Gaps = 25/143 (17%)
 Frame = +1

Query  25   MLTALRLATARTPPP-----ASPLPHRLLGRSHIRLRRAVTTGaagcpdaaaddddMQKV  189
            M+ A +  T R+ P      ASP+P R  GR    +R A TT            +  +  
Sbjct  1    MINAFK--TVRSQPSSAAVFASPIPSRF-GRKATAVRFAATTATNQQHADKRKMEKTENP  57

Query  190  NDTekpppqpaaeqppkVGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNT  366
            N+              K GD MS SFGEGYATRS+EEGFGGIYGGN   ++ +K I  N 
Sbjct  58   NE--------------KTGDVMSHSFGEGYATRSEEEGFGGIYGGNQSIQK-DKEIHENH  102

Query  367  PAEYGENQGSEVKEKEKGRHQPH  435
            PA Y + QGSEV EKEK R+Q H
Sbjct  103  PA-YDKTQGSEVSEKEKARNQKH  124



>ref|XP_002521599.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40870.1| conserved hypothetical protein [Ricinus communis]
Length=131

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTG--EEEGEKIIRGNTPAEYGENQGSEVKEK  411
             GD MS SFGEGYATRSDEEGFGGIYGGN    +EE +K I  N PA Y  +QGSEVKEK
Sbjct  62   TGDVMSHSFGEGYATRSDEEGFGGIYGGNQSVVKEETDKEIHENHPA-YDTSQGSEVKEK  120

Query  412  EKGRHQPHHH  441
            EK RHQ + H
Sbjct  121  EKARHQTNAH  130



>ref|XP_008441122.1| PREDICTED: uncharacterized protein LOC103485350 [Cucumis melo]
Length=133

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 79/144 (55%), Gaps = 20/144 (14%)
 Frame = +1

Query  25   MLTALRLATARTPPP---ASPLPHRLL-GRSHIRLRRAVTTGaagcpdaaaddddMQKVN  192
            M+ A+R    RTPPP    SPLP +L      + LR    TG A  PD    D++M +  
Sbjct  1    MINAIRFG--RTPPPIVLTSPLPPQLRRSICSLELRSRQATGFATAPDQNPKDEEMDESQ  58

Query  193  DTekpppqpaaeqppkVGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGE--KIIRGN  363
            +           +  + GD M  SFGEGYATRS+EEGFGG YGGN  +++ E  +  +  
Sbjct  59   N-----------KTKETGDIMCDSFGEGYATRSEEEGFGGTYGGNVLDDDDEEHRNKKSV  107

Query  364  TPAEYGENQGSEVKEKEKGRHQPH  435
               EY  +QGSEVKEKEK RHQ H
Sbjct  108  NEHEYDRSQGSEVKEKEKSRHQAH  131



>ref|XP_004287902.1| PREDICTED: uncharacterized protein LOC101303361 [Fragaria vesca 
subsp. vesca]
Length=125

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 49/68 (72%), Gaps = 5/68 (7%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGN---TGEEEGEKIIRGNTPAEYGENQGSEVKE  408
             GD MS SFGEGYATRSDEEGFGGIY  N     + E +++I  N PA Y + QGSEVKE
Sbjct  56   TGDVMSHSFGEGYATRSDEEGFGGIYSDNQRLPNKVEQDQMIHANNPA-YDKTQGSEVKE  114

Query  409  KEKGRHQP  432
            KEK RHQP
Sbjct  115  KEKARHQP  122



>ref|XP_007156938.1| hypothetical protein PHAVU_002G029900g [Phaseolus vulgaris]
 gb|ESW28932.1| hypothetical protein PHAVU_002G029900g [Phaseolus vulgaris]
Length=127

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 49/65 (75%), Gaps = 4/65 (6%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGG--NTGEEEGEKIIRGNTPAEYGENQGSEVKEKE  414
            GD MS SFGEGYATRSDEEGFGGIYGG  +    E +KII  N PA Y + QGSEVKEKE
Sbjct  59   GDAMSHSFGEGYATRSDEEGFGGIYGGKQSMPNTEKDKIIHENHPA-YDKTQGSEVKEKE  117

Query  415  KGRHQ  429
            K RHQ
Sbjct  118  KARHQ  122



>ref|XP_010316357.1| PREDICTED: uncharacterized protein LOC101257926 [Solanum lycopersicum]
Length=113

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 5/61 (8%)
 Frame = +1

Query  247  DTMSSFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKGRH  426
            +TMSSFGEGYATRSDEEGFGGIYGGN  +E+ EK++ G   +E+   QGSEVKEKEK R+
Sbjct  54   ETMSSFGEGYATRSDEEGFGGIYGGN--QEDEEKVVHG---SEFDNKQGSEVKEKEKARN  108

Query  427  Q  429
            Q
Sbjct  109  Q  109



>ref|XP_006425685.1| hypothetical protein CICLE_v10026748mg [Citrus clementina]
 ref|XP_006466787.1| PREDICTED: uncharacterized protein LOC102624721 [Citrus sinensis]
 gb|ESR38925.1| hypothetical protein CICLE_v10026748mg [Citrus clementina]
 gb|KDO79533.1| hypothetical protein CISIN_1g046060mg [Citrus sinensis]
Length=134

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 5/67 (7%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGN---TGEEEGEKIIRGNTPAEYGENQGSEVKE  408
             GD MS SFGEGYATRSDEEGFGGIYGGN     +++ +K I  N PA + ++QGSEVKE
Sbjct  64   TGDVMSHSFGEGYATRSDEEGFGGIYGGNQFFPNKDDKDKDINENHPA-FDKSQGSEVKE  122

Query  409  KEKGRHQ  429
            KEK RHQ
Sbjct  123  KEKARHQ  129



>ref|XP_007204141.1| hypothetical protein PRUPE_ppa022555mg [Prunus persica]
 gb|EMJ05340.1| hypothetical protein PRUPE_ppa022555mg [Prunus persica]
Length=124

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 4/73 (5%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTG--EEEGEKIIRGNTPAEYGENQGSEVKEK  411
             GD MS SFGEGYATRSDEEGFGG++ GN    + + +++I  N PA Y + QGSEVKEK
Sbjct  52   TGDAMSHSFGEGYATRSDEEGFGGVFSGNQSLPKTQQDQLIHENHPA-YDKTQGSEVKEK  110

Query  412  EKGRHQPHHHPST  450
            EKGRHQ   + ST
Sbjct  111  EKGRHQTQANAST  123



>ref|XP_003611987.1| hypothetical protein MTR_5g020060 [Medicago truncatula]
 gb|AES94945.1| plant/MUD21-2 protein [Medicago truncatula]
Length=126

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 3/63 (5%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            GD MS SFGEGYATRSDEEGFGGIYGGN   ++ +K +  N P +Y + QGSEVKEKEK 
Sbjct  61   GDVMSHSFGEGYATRSDEEGFGGIYGGNQSLQK-DKSVHENHP-DYDKTQGSEVKEKEKA  118

Query  421  RHQ  429
            RHQ
Sbjct  119  RHQ  121



>ref|XP_008352469.1| PREDICTED: uncharacterized protein LOC103415969 [Malus domestica]
Length=136

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 82/144 (57%), Gaps = 25/144 (17%)
 Frame = +1

Query  25   MLTALRLATARTPPPA----SPLPHRLLGR--SHIRLRRAVTTGaagcpdaaaddddMQK  186
            M TA+RL   R  PPA     PLP  L GR  S +R ++A +   +  P++   + D Q+
Sbjct  4    MTTAIRLI--RPQPPAWIFTPPLPSNL-GRKASGVRFKQAASVDVSSEPESENGNMDKQQ  60

Query  187  VNDTekpppqpaaeqppkVGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGE--KIIR  357
               TEK             GD +S SFGEGYA+R D+EGFGGIYGGN    + E  +++ 
Sbjct  61   DKPTEK------------TGDLLSHSFGEGYASRCDDEGFGGIYGGNQSLPKTEHGQLVH  108

Query  358  GNTPAEYGENQGSEVKEKEKGRHQ  429
             N P  Y ++QGSEVKEKEK RHQ
Sbjct  109  ENHPV-YDKSQGSEVKEKEKARHQ  131



>ref|XP_007046953.1| Uncharacterized protein TCM_000398 [Theobroma cacao]
 gb|EOX91110.1| Uncharacterized protein TCM_000398 [Theobroma cacao]
Length=129

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 47/66 (71%), Gaps = 4/66 (6%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEE--EGEKIIRGNTPAEYGENQGSEVKEK  411
             GD MS SFGEGYATRSDEEGFGG YGGN      E +K I  N PA Y + QGSEVKEK
Sbjct  60   TGDVMSHSFGEGYATRSDEEGFGGTYGGNQSNSKIEMDKEIHENHPA-YDKTQGSEVKEK  118

Query  412  EKGRHQ  429
            EK RHQ
Sbjct  119  EKARHQ  124



>ref|XP_003537584.1| PREDICTED: uncharacterized protein LOC100819278 [Glycine max]
Length=114

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 47/63 (75%), Gaps = 9/63 (14%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            GDTMS SFGEGYATRSDEEGFGG+YGGN  + E +       PA Y + QGSEVKEKEK 
Sbjct  56   GDTMSHSFGEGYATRSDEEGFGGVYGGNQSKPEMD-------PA-YDKTQGSEVKEKEKA  107

Query  421  RHQ  429
            RHQ
Sbjct  108  RHQ  110



>gb|KGN48825.1| hypothetical protein Csa_6G502630 [Cucumis sativus]
Length=132

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 80/148 (54%), Gaps = 29/148 (20%)
 Frame = +1

Query  25   MLTALRLATARTPPP---ASPLPHRL--LGRSHIRLRRAVTTGaagcpdaaaddddMQKV  189
            M+ A+R    RTPPP    SPLP +L  +    +  R+A++   A   +        +++
Sbjct  1    MINAIRFG--RTPPPIVLTSPLPPKLRRISSPELPSRQAISFATAPDRNPK-----CEEM  53

Query  190  NDTekpppqpaaeqppkVGDTMS-SFGEGYATRSDEEGFGGIYGG-----NTGEEEGEKI  351
            +D++    +         GD M  SFGEGYATRS+EEGFGG YGG     +  E   +K 
Sbjct  54   DDSQNKTKE--------TGDIMCDSFGEGYATRSEEEGFGGTYGGKYQSIDDDEHMNKKP  105

Query  352  IRGNTPAEYGENQGSEVKEKEKGRHQPH  435
            +  +   EY ++QGSEVKEKEK RHQ H
Sbjct  106  VNQH---EYDKSQGSEVKEKEKSRHQAH  130



>ref|XP_004512041.1| PREDICTED: uncharacterized protein LOC101500608 [Cicer arietinum]
Length=127

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGN--TGEEEGEKIIRGNTPAEYGENQGSEVKEKE  414
            GD MS SFGEGYATR DEEGFGGIYG N      + +K +  N P +Y + QGSEVKEKE
Sbjct  59   GDVMSHSFGEGYATRCDEEGFGGIYGENQSLNTNQKDKSVHENHP-DYDKTQGSEVKEKE  117

Query  415  KGRHQ  429
            KGRHQ
Sbjct  118  KGRHQ  122



>gb|EYU40157.1| hypothetical protein MIMGU_mgv1a016129mg [Erythranthe guttata]
Length=133

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%), Gaps = 9/70 (13%)
 Frame = +1

Query  247  DTMSSFGEGYATRSDEEGFGGIYGGNT--GEEEGEKI-------IRGNTPAEYGENQGSE  399
            DTMSSFGEGYATRSDEEGFGGIYGGN   G+++ EK+       I      E+  +QGSE
Sbjct  58   DTMSSFGEGYATRSDEEGFGGIYGGNQYFGKDKDEKLGNENEGKIVHEDADEFDHSQGSE  117

Query  400  VKEKEKGRHQ  429
            VKEKEK R+Q
Sbjct  118  VKEKEKARNQ  127



>gb|ACU23592.1| unknown [Glycine max]
Length=114

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 9/63 (14%)
 Frame = +1

Query  244  GDTM-SSFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            GDTM  SFGEGYATRSDEEGFGG+YGGN  + E +       PA Y + QGSEVKEKEK 
Sbjct  56   GDTMFHSFGEGYATRSDEEGFGGVYGGNQSKPEMD-------PA-YDKTQGSEVKEKEKA  107

Query  421  RHQ  429
            RHQ
Sbjct  108  RHQ  110



>ref|XP_008363102.1| PREDICTED: uncharacterized protein LOC103426802 [Malus domestica]
Length=128

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTG--EEEGEKIIRGNTPAEYGENQGSEVKEK  411
             GD MS SFGEGYATRSDEEGFGG++  N    + E +++I  N PA Y   QGSEVKEK
Sbjct  56   TGDVMSQSFGEGYATRSDEEGFGGVFSDNQTFPKTEQDQLIHENHPA-YDXTQGSEVKEK  114

Query  412  EKGRHQPHHHPST  450
            EKGR Q   + ST
Sbjct  115  EKGRCQTQANAST  127



>ref|XP_010113494.1| hypothetical protein L484_026829 [Morus notabilis]
 gb|EXC35521.1| hypothetical protein L484_026829 [Morus notabilis]
Length=134

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 48/71 (68%), Gaps = 5/71 (7%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEK---IIRGNTPAEYGENQGSEVKE  408
             GD MS SFGEGYATRSDEEGFGGIYGGN    + EK    I  N P EY + QGSEVKE
Sbjct  64   TGDVMSHSFGEGYATRSDEEGFGGIYGGNQSVPKDEKDRSSIHENHP-EYDKTQGSEVKE  122

Query  409  KEKGRHQPHHH  441
            KEK R Q   H
Sbjct  123  KEKARFQTSAH  133



>gb|KHG01548.1| Nitric oxide synthase, inducible [Gossypium arboreum]
Length=127

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGN--TGEEEGEKIIRGNTPAEYGENQGSEVKEKE  414
            GD MS SFGEGYATRSDEEGFGGIYG N    + +  K I G+ PA Y + QGSEVKEKE
Sbjct  59   GDVMSESFGEGYATRSDEEGFGGIYGENESISDIKKNKEIHGSHPA-YDKTQGSEVKEKE  117

Query  415  KGRHQPH  435
            K R+Q H
Sbjct  118  KARNQTH  124



>ref|XP_008338094.1| PREDICTED: uncharacterized protein LOC103401159 [Malus domestica]
Length=83

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTG--EEEGEKIIRGNTPAEYGENQGSEVKEK  411
             GD MS SFGEGYATRSD+EGFGG++  N    + E +++I  N PA Y + QGSEVKEK
Sbjct  11   TGDVMSQSFGEGYATRSDDEGFGGVFSDNQTLPKTEQDQLIHANHPA-YDKTQGSEVKEK  69

Query  412  EKGRHQPHHHPST  450
            EKGR Q   + ST
Sbjct  70   EKGRCQTQPNAST  82



>ref|XP_006393873.1| hypothetical protein EUTSA_v10005154mg [Eutrema salsugineum]
 gb|ESQ31159.1| hypothetical protein EUTSA_v10005154mg [Eutrema salsugineum]
Length=117

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            GD MS S+GEGYATRSDEEGFGG YGGN   ++ +K I  N P +Y + QGSE KEKEK 
Sbjct  55   GDVMSHSYGEGYATRSDEEGFGGTYGGNQTFQKDKKEINENHP-DYDKTQGSEAKEKEKS  113

Query  421  RHQ  429
            R+Q
Sbjct  114  RNQ  116



>gb|AAW33981.1| unknown [Ammopiptanthus mongolicus]
Length=109

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = +1

Query  244  GDTM-SSFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            GD M   FGEGY TR DEEGFGGIYGGN  +   EK +  N PA Y + QGSEVKEKEK 
Sbjct  45   GDVMFHPFGEGYTTRFDEEGFGGIYGGN--QTRPEKSVHENHPA-YDKTQGSEVKEKEKA  101

Query  421  RHQ  429
            RHQ
Sbjct  102  RHQ  104



>ref|NP_201479.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB08620.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK82502.1| AT5g66780/MUD21_2 [Arabidopsis thaliana]
 gb|AAL62014.1| AT5g66780/MUD21_2 [Arabidopsis thaliana]
 gb|AED98262.1| uncharacterized protein AT5G66780 [Arabidopsis thaliana]
Length=121

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 50/69 (72%), Gaps = 5/69 (7%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGN-TGEEEGEKIIRGNTPAEYGENQGSEVKEKE  414
             GD MS S+GEGYATRSDEEGFGGIYGGN T ++E E  I  N P +Y + QGSE KEKE
Sbjct  55   TGDVMSHSYGEGYATRSDEEGFGGIYGGNQTLQKENE--IHENHP-DYDKTQGSESKEKE  111

Query  415  KGRHQPHHH  441
            K R+Q   H
Sbjct  112  KARNQTQSH  120



>ref|XP_004287901.1| PREDICTED: uncharacterized protein LOC101303064 [Fragaria vesca 
subsp. vesca]
Length=136

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGN--TGEEEGEKIIRGNTPAEYGENQGSEVKEKE  414
            GD MS SFGEGYATR +++GFGGIYGGN    + + E++I  N  A Y + QGSEVKEKE
Sbjct  67   GDLMSHSFGEGYATRCEDDGFGGIYGGNQTVAKADQEQLIHENHHA-YDKTQGSEVKEKE  125

Query  415  KGRHQ  429
            K RHQ
Sbjct  126  KARHQ  130



>ref|XP_009103486.1| PREDICTED: uncharacterized protein LOC103829566 [Brassica rapa]
Length=117

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            GD MS SFGEGYATRSDEEGFGG YGGN   ++ +  +  N P +Y + QGSE KEKE+G
Sbjct  55   GDVMSHSFGEGYATRSDEEGFGGTYGGNQSFQKHKDEVHENHP-DYDKTQGSEAKEKERG  113

Query  421  RHQ  429
            R+Q
Sbjct  114  RNQ  116



>ref|XP_002466547.1| hypothetical protein SORBIDRAFT_01g009730 [Sorghum bicolor]
 gb|EER93545.1| hypothetical protein SORBIDRAFT_01g009730 [Sorghum bicolor]
Length=176

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEK  417
             GD MS SFGEGY+TRSDEEGFGG+YGGN   E     I  + P EY  +QGSEVKEKEK
Sbjct  106  TGDVMSHSFGEGYSTRSDEEGFGGVYGGNDPVEHPGTEIHPSHP-EYDTSQGSEVKEKEK  164

Query  418  GRH  426
             RH
Sbjct  165  ARH  167



>ref|XP_002267045.3| PREDICTED: uncharacterized protein LOC100256467 [Vitis vinifera]
 emb|CBI17528.3| unnamed protein product [Vitis vinifera]
Length=134

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 44/69 (64%), Gaps = 5/69 (7%)
 Frame = +1

Query  247  DTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKGR  423
            D MS SFG  YATRSDEEGFGGIYGGN    E EK        +Y   QGS+VKEKEK R
Sbjct  62   DEMSTSFGVAYATRSDEEGFGGIYGGNQSLGECEKETAQENHNDYERTQGSDVKEKEKAR  121

Query  424  HQ----PHH  438
            HQ    PHH
Sbjct  122  HQKEKAPHH  130



>emb|CDY54166.1| BnaC07g48560D [Brassica napus]
Length=117

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            GD MS SFGEGYATRSDEEGFGG YGGN   ++    +  N P +Y + QGSE KEKE+G
Sbjct  55   GDVMSHSFGEGYATRSDEEGFGGTYGGNQSFQKHNDEVHENHP-DYDKTQGSEAKEKERG  113

Query  421  RHQ  429
            R+Q
Sbjct  114  RNQ  116



>ref|XP_009371588.1| PREDICTED: uncharacterized protein LOC103960823 [Pyrus x bretschneideri]
Length=136

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 80/144 (56%), Gaps = 25/144 (17%)
 Frame = +1

Query  25   MLTALRLATARTPPPA----SPLPHRLLGR--SHIRLRRAVTTGaagcpdaaaddddMQK  186
            M TA+RL   R  PPA     PLP  L GR  S +R ++A +   +  P++     D Q+
Sbjct  4    MTTAIRLI--RPQPPALIFTPPLPSNL-GRKASGVRFKQAASVDVSSEPESENSSMDKQQ  60

Query  187  VNDTekpppqpaaeqppkVGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGE--KIIR  357
               TEK             GD +S SFGEGYA+R ++EGFGGI GGN    + E  +++ 
Sbjct  61   EKPTEK------------TGDLLSHSFGEGYASRCEDEGFGGISGGNQSLPKMEHGQLVH  108

Query  358  GNTPAEYGENQGSEVKEKEKGRHQ  429
             N PA Y ++QGSEVKEKEK RH 
Sbjct  109  ENHPA-YDKSQGSEVKEKEKARHH  131



>ref|XP_010679715.1| PREDICTED: uncharacterized protein LOC104895017 [Beta vulgaris 
subsp. vulgaris]
Length=132

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +1

Query  259  SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKGRHQ  429
            SFG GYATRSDEEGFGGIYGGN       KII+   PA +   QGSEVKEKEK R+Q
Sbjct  74   SFGAGYATRSDEEGFGGIYGGNDECNTEMKIIKD--PAHHDNTQGSEVKEKEKSRNQ  128



>emb|CDY72100.1| BnaCnng75970D [Brassica napus]
Length=117

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEK  417
             GD MS SFGEGYATRSDEEGFGG YGGN   ++    +  N P +Y + QGSE KEKE+
Sbjct  54   TGDVMSHSFGEGYATRSDEEGFGGTYGGNQSFQKHNDEVHENHP-DYDKTQGSEAKEKER  112

Query  418  GRHQ  429
            GR+Q
Sbjct  113  GRNQ  116



>emb|CDY53845.1| BnaA07g37400D [Brassica napus]
Length=75

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEK  417
             GD MS SFGEGYATRSDEEGFGG YGGN   ++ +  +  N P +Y + QGSE KEKE+
Sbjct  12   YGDVMSHSFGEGYATRSDEEGFGGTYGGNQSFQKHKDEVHENHP-DYDKTQGSEAKEKER  70

Query  418  GRHQ  429
            GR+Q
Sbjct  71   GRNQ  74



>ref|XP_010254863.1| PREDICTED: uncharacterized protein LOC104595702 isoform X2 [Nelumbo 
nucifera]
Length=174

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTP--AEYGENQGSEVKEKE  414
            G  MS SFGEGY+TRSDEEGFGGIYGGN    +   + +   P  +++ + QGSEVKEKE
Sbjct  107  GALMSDSFGEGYSTRSDEEGFGGIYGGNQALPKSV-VDKACNPESSDFDKTQGSEVKEKE  165

Query  415  KGRHQ  429
            KGRHQ
Sbjct  166  KGRHQ  170



>ref|XP_010254861.1| PREDICTED: uncharacterized protein LOC104595702 isoform X1 [Nelumbo 
nucifera]
Length=176

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 3/59 (5%)
 Frame = +1

Query  259  SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTP--AEYGENQGSEVKEKEKGRHQ  429
            SFGEGY+TRSDEEGFGGIYGGN    +   + +   P  +++ + QGSEVKEKEKGRHQ
Sbjct  115  SFGEGYSTRSDEEGFGGIYGGNQALPKSV-VDKACNPESSDFDKTQGSEVKEKEKGRHQ  172



>gb|KFK28361.1| late embryogenesis abundant protein [Arabis alpina]
Length=120

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 5/69 (7%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGN-TGEEEGEKIIRGNTPAEYGENQGSEVKEKE  414
             GD MS SFGEGYATRSDEEGFGG YGGN T +++ E  I  N P +Y + QGSE KEKE
Sbjct  54   TGDVMSHSFGEGYATRSDEEGFGGTYGGNQTLQKDNE--IHENHP-DYDKTQGSEAKEKE  110

Query  415  KGRHQPHHH  441
            K R+Q   H
Sbjct  111  KSRNQTQSH  119



>gb|KDP23195.1| hypothetical protein JCGZ_00340 [Jatropha curcas]
Length=135

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 47/66 (71%), Gaps = 6/66 (9%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGE----KIIRGNTPAEYGENQGSEVKE  408
            GD MS SFG+ YATRSDEEGFGGIYGGN   +  +    K I  N P +Y  +QGSEVKE
Sbjct  67   GDVMSHSFGQAYATRSDEEGFGGIYGGNQSCDNDDDNNGKKIHENHP-DYDRSQGSEVKE  125

Query  409  KEKGRH  426
            KEKGR+
Sbjct  126  KEKGRN  131



>gb|EPS61945.1| hypothetical protein M569_12849, partial [Genlisea aurea]
Length=64

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  247  DTMSSFGEGYATRSDEEGFGGIYGGNTG-EEEGEKIIRGNTPAEYGENQGSEVKEKEKGR  423
            DTM+SFGEGY+TRSDEEGFGGIYGGN   ++E       + P E+   QGS+VKE EK R
Sbjct  1    DTMTSFGEGYSTRSDEEGFGGIYGGNQSLKDENAPPSSSSPPEEFDHGQGSQVKETEKSR  60

Query  424  HQ  429
            HQ
Sbjct  61   HQ  62



>ref|XP_006281688.1| hypothetical protein CARUB_v10027836mg [Capsella rubella]
 gb|EOA14586.1| hypothetical protein CARUB_v10027836mg [Capsella rubella]
Length=104

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 5/69 (7%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGN-TGEEEGEKIIRGNTPAEYGENQGSEVKEKE  414
             GD MS SFGEGYATRSDEEGFGG YGGN T +++ E  I  N P +Y + QGSE KEKE
Sbjct  39   TGDVMSHSFGEGYATRSDEEGFGGTYGGNQTLQKDNE--IHENHP-DYDKTQGSEAKEKE  95

Query  415  KGRHQPHHH  441
            K R+Q   H
Sbjct  96   KSRNQTQAH  104



>ref|XP_004986269.1| PREDICTED: uncharacterized protein LOC101767727 [Setaria italica]
Length=169

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEK  417
             GD MS SFGEGY+TRSDEEGFGG+YGG    E     I  + P EY  +QGSEVKEKEK
Sbjct  100  TGDVMSHSFGEGYSTRSDEEGFGGVYGGTDPVEHHGTEIHPSHP-EYDTSQGSEVKEKEK  158

Query  418  GRH  426
             RH
Sbjct  159  ARH  161



>ref|XP_011099606.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105177984 
[Sesamum indicum]
Length=122

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 72/145 (50%), Gaps = 38/145 (26%)
 Frame = +1

Query  25   MLTALRLATARTPPPASPLPHRLLGRSHI--------RLRRAVTTGaagcpdaaaddddM  180
            ML AL+ A A+ P   S  P+ L  ++HI        R  +A T G      + +    M
Sbjct  1    MLNALKSARAQQP---SLFPYTL--QNHIVRRPSGTVRFVQATTAGPKQPDSSDS----M  51

Query  181  QKVNDTekpppqpaaeqppkVGDTMSSFGEGYATRSDEEGFGGIYG--GNTGEEEGEKII  354
             +  D +              GDTM+SFGEGYATRSDEEGFGGIYG  G   ++ G +  
Sbjct  52   DQKQDPKSK-----------TGDTMTSFGEGYATRSDEEGFGGIYGXRGVVKDKNGHE--  98

Query  355  RGNTPAEYGENQGSEVKEKEKGRHQ  429
                  E+   QGSEVKE EK R+Q
Sbjct  99   ------EFDHKQGSEVKETEKARNQ  117



>ref|XP_008790362.1| PREDICTED: uncharacterized protein LOC103707596 isoform X2 [Phoenix 
dactylifera]
Length=126

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 12/69 (17%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRG----NTPAEYGENQGSEVK  405
             GD MS SFGEGY+TRSDEEGFGGIYG N      + I R     N P +Y ++QGSEVK
Sbjct  65   TGDAMSHSFGEGYSTRSDEEGFGGIYGRN------QSISRPGELENHP-DYDKSQGSEVK  117

Query  406  EKEKGRHQP  432
            EKEKGR+QP
Sbjct  118  EKEKGRNQP  126



>ref|XP_002866738.1| hypothetical protein ARALYDRAFT_496922 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42997.1| hypothetical protein ARALYDRAFT_496922 [Arabidopsis lyrata subsp. 
lyrata]
Length=121

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 48/69 (70%), Gaps = 5/69 (7%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGN-TGEEEGEKIIRGNTPAEYGENQGSEVKEKE  414
             GD MS S+GEGYATR DEEGFGG YGGN T ++E E  I  N P +Y + QGSE KEKE
Sbjct  55   TGDVMSHSYGEGYATRCDEEGFGGTYGGNQTLQKENE--IHENHP-DYDKTQGSEAKEKE  111

Query  415  KGRHQPHHH  441
            K R+Q   H
Sbjct  112  KARNQTQSH  120



>dbj|BAJ85260.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            GD M+ SFGEGY+TRSDEEGFGG+YG N         +  N P EY ++QGSEVKEKEK 
Sbjct  103  GDVMTHSFGEGYSTRSDEEGFGGVYGQNDPVLNPGTEMHPNHP-EYDKSQGSEVKEKEKA  161

Query  421  RH  426
            RH
Sbjct  162  RH  163



>gb|EMS67882.1| hypothetical protein TRIUR3_31296 [Triticum urartu]
Length=165

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            GD M+ SFGEGY+TRSDEEGFGG+YG N         +  N P EY ++QGSEVKEKEK 
Sbjct  97   GDVMTHSFGEGYSTRSDEEGFGGVYGQNDPVLNPGTEVHPNHP-EYDKSQGSEVKEKEKA  155

Query  421  RH  426
            RH
Sbjct  156  RH  157



>gb|ABV32166.1| UFG2 [Triticum aestivum]
Length=165

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            GD M+ SFGEGY+TRSDEEGFGG+YG N         +  N P EY ++QGSEVKEKEK 
Sbjct  97   GDVMTHSFGEGYSTRSDEEGFGGVYGQNDPVLNPGTEVHPNHP-EYDKSQGSEVKEKEKA  155

Query  421  RH  426
            RH
Sbjct  156  RH  157



>ref|XP_003560456.1| PREDICTED: uncharacterized protein LOC100827223 [Brachypodium 
distachyon]
Length=161

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 46/68 (68%), Gaps = 12/68 (18%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPA-----EYGENQGSEV  402
            +GD MS SFGEGY+TRSDEEGFGG+YGGN      + +    T A     +Y  +QGSEV
Sbjct  92   LGDVMSHSFGEGYSTRSDEEGFGGVYGGN------DPVFNPGTEAHPSHPDYDTSQGSEV  145

Query  403  KEKEKGRH  426
            KEKEK RH
Sbjct  146  KEKEKARH  153



>ref|XP_010464881.1| PREDICTED: uncharacterized protein LOC104745368 [Camelina sativa]
Length=120

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGN-TGEEEGEKIIRGNTPAEYGENQGSEVKEKE  414
             GD MS SFGEGYATR DEEGFGG YGGN T +++ E  +  N P +Y + QGSE  EKE
Sbjct  54   TGDVMSHSFGEGYATRCDEEGFGGTYGGNQTLQKDNE--VHENHP-DYDKTQGSEANEKE  110

Query  415  KGRHQPHHH  441
            K R+Q   H
Sbjct  111  KARNQTQSH  119



>ref|XP_008644548.1| PREDICTED: uncharacterized protein LOC103625926 [Zea mays]
 gb|AFW67771.1| hypothetical protein ZEAMMB73_462092 [Zea mays]
Length=172

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 4/62 (6%)
 Frame = +1

Query  247  DTMS-SFGEGYATRSDEEGFGGIYGGNTG-EEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            D M+ SFGEGY+TRSDEEGFGG+YGGN   E  G +I   ++  EY  +QGSEVKEKEK 
Sbjct  104  DVMTHSFGEGYSTRSDEEGFGGVYGGNDPVEHPGAEIHPSHS--EYDTSQGSEVKEKEKA  161

Query  421  RH  426
            RH
Sbjct  162  RH  163



>emb|CDY49840.1| BnaC02g43990D [Brassica napus]
Length=121

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 3/63 (5%)
 Frame = +1

Query  247  DTMS-SFGEGYATRSDEEGFGGIYGGN-TGEEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            D MS SFGEGYATRSDEEGFGG YGGN T +++    +  N P +Y + QGSE KEK+K 
Sbjct  59   DVMSHSFGEGYATRSDEEGFGGTYGGNQTFQKDNNDKVHENHP-DYDKTQGSEAKEKQKA  117

Query  421  RHQ  429
            R+Q
Sbjct  118  RNQ  120



>gb|KCW56778.1| hypothetical protein EUGRSUZ_I02450 [Eucalyptus grandis]
Length=124

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 4/64 (6%)
 Frame = +1

Query  247  DTMS-SFGEGYATRSDEEGFGGIYGGNTGEE--EGEKIIRGNTPAEYGENQGSEVKEKEK  417
            D M+ SFGEGYATRSDEEGFGGIY G+      + ++ I    PA Y + QGSE KEKEK
Sbjct  57   DAMAHSFGEGYATRSDEEGFGGIYEGSKSVNNIQVDRDIHAGHPA-YDKAQGSEAKEKEK  115

Query  418  GRHQ  429
             RHQ
Sbjct  116  ARHQ  119



>ref|XP_010484587.1| PREDICTED: uncharacterized protein LOC104762889 [Camelina sativa]
 ref|XP_010484591.1| PREDICTED: uncharacterized protein LOC104762891 [Camelina sativa]
Length=116

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 5/65 (8%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGN-TGEEEGEKIIRGNTPAEYGENQGSEVKEKE  414
             GD MS SFGEGYATRSDEEGFGG YGGN T  ++ E  +  N P +Y + QGSE  +KE
Sbjct  54   TGDVMSHSFGEGYATRSDEEGFGGTYGGNQTLRKDNE--VHENHP-DYDKTQGSEANQKE  110

Query  415  KGRHQ  429
            K R+Q
Sbjct  111  KARNQ  115



>ref|XP_010444731.1| PREDICTED: uncharacterized protein LOC104727353 [Camelina sativa]
Length=120

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGG-NTGEEEGEKIIRGNTPAEYGENQGSEVKEKE  414
             GD MS SFGEGYATRSDEEG GG YGG  T +++ E  +  N P +Y + QGSE KEKE
Sbjct  54   TGDVMSHSFGEGYATRSDEEGVGGTYGGKQTLQKDNE--VHENHP-DYDKTQGSEAKEKE  110

Query  415  KGRHQPHHH  441
            K R+Q   H
Sbjct  111  KARNQTQSH  119



>ref|XP_010910611.1| PREDICTED: uncharacterized protein LOC105036553 [Elaeis guineensis]
Length=122

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 4/62 (6%)
 Frame = +1

Query  247  DTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKGR  423
            D MS SFGEGY+TRS+EEGFGGIYGGN    E  ++   +   +Y ++QGSEVKEKEK R
Sbjct  63   DAMSHSFGEGYSTRSEEEGFGGIYGGNQSISESGEL---DDHLDYDKSQGSEVKEKEKSR  119

Query  424  HQ  429
            +Q
Sbjct  120  NQ  121



>ref|NP_001051116.1| Os03g0723400 [Oryza sativa Japonica Group]
 gb|AAR01634.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF98611.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13030.1| Os03g0723400 [Oryza sativa Japonica Group]
 gb|EEC76095.1| hypothetical protein OsI_13342 [Oryza sativa Indica Group]
 gb|EEE59835.1| hypothetical protein OsJ_12400 [Oryza sativa Japonica Group]
Length=173

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEK  417
             GD M+ SFGEGY+TRSDEEGFGG+YG N         +  + P EY  +QGSEVKEKEK
Sbjct  104  TGDVMTHSFGEGYSTRSDEEGFGGVYGQNDPVFNPGTEVHPSHP-EYDTSQGSEVKEKEK  162

Query  418  GRHQ  429
             RH 
Sbjct  163  ARHH  166



>gb|AAX95683.1| hypothetical protein [Oryza sativa Japonica Group]
Length=103

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEK  417
             GD M+ SFGEGY+TRSDEEGFGG+YG N         +  + P EY  +QGSEVKEKEK
Sbjct  34   TGDVMTHSFGEGYSTRSDEEGFGGVYGQNDPVFNPGTEVHPSHP-EYDTSQGSEVKEKEK  92

Query  418  GRHQ  429
             RH 
Sbjct  93   ARHH  96



>ref|XP_009130551.1| PREDICTED: uncharacterized protein LOC103855334 [Brassica rapa]
 emb|CDY52158.1| BnaA02g34670D [Brassica napus]
Length=119

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = +1

Query  259  SFGEGYATRSDEEGFGGIYGGN-TGEEEGEKIIRGNTPAEYGENQGSEVKEKEKGRHQ  429
            SFGEGYATRSDEEGFGG YGGN T +++    +  N P +Y   QGSE KE+EK R+Q
Sbjct  62   SFGEGYATRSDEEGFGGTYGGNQTFQKDNNDKVHEN-PPDYDTTQGSEAKEEEKVRNQ  118



>ref|XP_006650516.1| PREDICTED: uncharacterized protein LOC102720220 [Oryza brachyantha]
Length=177

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +1

Query  241  VGDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEK  417
             GD M+ SFGEGY+TRSDEEGFGG+YG N         +  + P +Y  +QGSEVKEKEK
Sbjct  108  TGDVMTHSFGEGYSTRSDEEGFGGVYGQNDPVFNPGTEVHPSHP-DYDTSQGSEVKEKEK  166

Query  418  GRH  426
             RH
Sbjct  167  ARH  169



>ref|XP_006856019.1| hypothetical protein AMTR_s00059p00050970 [Amborella trichopoda]
 gb|ERN17486.1| hypothetical protein AMTR_s00059p00050970 [Amborella trichopoda]
Length=176

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 42/61 (69%), Gaps = 7/61 (11%)
 Frame = +1

Query  259  SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRG--NTPAEYGENQGSEVKEKEKGRHQP  432
            SFG GYATRSDEEGFGG         E  KI+    N P E+ ++QGSEVKEKEKGRHQP
Sbjct  121  SFGAGYATRSDEEGFGG----TINPSETLKIVEKEENHP-EFDKSQGSEVKEKEKGRHQP  175

Query  433  H  435
            H
Sbjct  176  H  176



>ref|XP_007202748.1| hypothetical protein PRUPE_ppa013228mg [Prunus persica]
 gb|EMJ03947.1| hypothetical protein PRUPE_ppa013228mg [Prunus persica]
Length=134

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = +1

Query  247  DTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKGR  423
            D++S SFGEGYATR D++GFG +YGG     + E+    N PA   ++QGSEV+EKEK R
Sbjct  71   DSLSHSFGEGYATRCDDDGFGVVYGGIRSVPKTEQ--DDNHPA-VDKSQGSEVQEKEKPR  127

Query  424  HQ  429
            HQ
Sbjct  128  HQ  129



>ref|XP_008241670.1| PREDICTED: uncharacterized protein LOC103340081 [Prunus mume]
Length=129

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 14/69 (20%)
 Frame = +1

Query  247  DTMS-SFGEGYATRSDEEGFGGIYGG-----NTGEEEGEKIIRGNTPAEYGENQGSEVKE  408
            D++S SFGEGYATR D++GFG +YGG      T E+E       N PA   ++QGSEV+E
Sbjct  66   DSLSHSFGEGYATRCDDDGFGVVYGGIRSVRKTEEDE-------NHPA-VDKSQGSEVQE  117

Query  409  KEKGRHQPH  435
            KEK RHQ +
Sbjct  118  KEKARHQTY  126



>ref|XP_008363103.1| PREDICTED: uncharacterized protein LOC103426803 [Malus domestica]
Length=127

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 70/142 (49%), Gaps = 30/142 (21%)
 Frame = +1

Query  25   MLTALRLATARTPPP----ASPLPHRLLGR--SHIRLRRAVTTGaagcpdaaaddddMQK  186
            M+TA+RL   R  PP      PLP    GR  + +R ++A +                  
Sbjct  4    MITAIRLI--RPQPPGLIFTPPLPSNF-GRKATRVRFKQAXSV----------------H  44

Query  187  VNDTekpppqpaaeqppkVGDTM-SSFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGN  363
            V+       +   E   K GD +  SFG GYA+R ++EG+GGIYG  T   E +++   +
Sbjct  45   VSSKNSNMDKQQEEPTLKTGDILLESFGVGYASRCEDEGYGGIYGAIT---EQDQLXHDD  101

Query  364  TPAEYGENQGSEVKEKEKGRHQ  429
             PA   ++ GSEVKEKEK RH+
Sbjct  102  HPAN-DKSPGSEVKEKEKARHK  122



>gb|KHN41981.1| hypothetical protein glysoja_003721 [Glycine soja]
Length=51

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 1/33 (3%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEE  339
            GDTMS SFGEGYATRSDEEGFGG+YGGN  + E
Sbjct  15   GDTMSHSFGEGYATRSDEEGFGGVYGGNQSKPE  47



>ref|XP_004143513.1| PREDICTED: uncharacterized protein LOC101219972 [Cucumis sativus]
Length=111

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 21/105 (20%)
 Frame = +1

Query  25   MLTALRLATARTPPP---ASPLPHRL--LGRSHIRLRRAVTTGaagcpdaaaddddMQKV  189
            M+ A+R    RTPPP    SPLP +L  +    +  R+A++   A   +        +++
Sbjct  1    MINAIRFG--RTPPPIVLTSPLPPKLRRISSPELPSRQAISFATAPDRNPK-----CEEM  53

Query  190  NDTekpppqpaaeqppkVGDTMS-SFGEGYATRSDEEGFGGIYGG  321
            +D++    +         GD M  SFGEGYATRS+EEGFGG YGG
Sbjct  54   DDSQNKTKE--------TGDIMCDSFGEGYATRSEEEGFGGTYGG  90



>ref|XP_009803792.1| PREDICTED: uncharacterized protein LOC104249111 [Nicotiana sylvestris]
Length=46

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 2/34 (6%)
 Frame = +1

Query  256  SSFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIR  357
            S+FG+GYATRSDEEGFGGIYGGN  +E+ EK+++
Sbjct  3    SNFGDGYATRSDEEGFGGIYGGN--KEDEEKVVK  34



>gb|KHN13449.1| hypothetical protein glysoja_050057 [Glycine soja]
Length=117

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = +1

Query  259  SFGEGYATRSDEEGFGGIYGG--NTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKGRH  426
            SF EGYA+RSDE+GF G   G  +T + E +K I  N PA Y + Q +EVKEK K RH
Sbjct  61   SFVEGYASRSDEKGFEGASEGKQSTSKVEMDKFIHENHPA-YDKAQRNEVKEKNKTRH  117



>ref|XP_006599384.1| PREDICTED: uncharacterized protein LOC102663424 [Glycine max]
Length=116

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = +1

Query  259  SFGEGYATRSDEEGFGGIYGG--NTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKGRH  426
            SF EGYA+RSDE+GF G   G  +T + E +K I  N PA Y + Q +EVKEK K RH
Sbjct  60   SFVEGYASRSDEKGFEGASEGKQSTSKVEMDKFIHENHPA-YDKAQRNEVKEKNKTRH  116



>ref|XP_004170738.1| PREDICTED: uncharacterized protein LOC101224142 [Cucumis sativus]
Length=121

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 21/105 (20%)
 Frame = +1

Query  25   MLTALRLATARTPPP---ASPLPHRL--LGRSHIRLRRAVTTGaagcpdaaaddddMQKV  189
            M+ A+R    RTPPP    SPLP +L  +    +  R+A++   A   +        +++
Sbjct  1    MINAIRFG--RTPPPIVLTSPLPPKLRRISSPELPSRQAISFATAPDRNPK-----CEEM  53

Query  190  NDTekpppqpaaeqppkVGDTMS-SFGEGYATRSDEEGFGGIYGG  321
            +D++    +         GD M  SFGEGYATRS+EEGFGG YGG
Sbjct  54   DDSQNKTKE--------TGDIMCDSFGEGYATRSEEEGFGGTYGG  90



>gb|ABA54809.1| late embryogenesis abundant protein [Picea mariana]
Length=174

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 11/75 (15%)
 Frame = +1

Query  247  DTMSSFGEGYATRSDEEGFGGIY-----GGNTGEEEGEKII-RGNTP-----AEYGENQG  393
            D   SFG+ Y+TRS +EGFG  Y      G    E  E  + R   P      EY E+QG
Sbjct  81   DMADSFGDAYSTRSSDEGFGQRYTEHIKCGPALSEXAEATVERDADPHVEVRREYDESQG  140

Query  394  SEVKEKEKGRHQPHH  438
            SEV+EKEK RH   H
Sbjct  141  SEVREKEKARHATEH  155



>gb|ADE76277.1| unknown [Picea sitchensis]
Length=175

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 11/75 (15%)
 Frame = +1

Query  247  DTMSSFGEGYATRSDEEGFGGIY-----GGNTGEEEGEKII-RGNTP-----AEYGENQG  393
            D   SFG+ Y+TRS +EGFG  Y      G    E  E  + R   P      EY E+QG
Sbjct  82   DMADSFGDAYSTRSSDEGFGQRYTEHIKCGPALSEGAEATVERDANPHVEVRREYDESQG  141

Query  394  SEVKEKEKGRHQPHH  438
            SEV+EKEK RH   H
Sbjct  142  SEVREKEKARHATEH  156



>gb|ABA54810.1| late embryogenesis abundant protein [Picea abies]
Length=175

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 11/75 (15%)
 Frame = +1

Query  247  DTMSSFGEGYATRSDEEGFGGIY-----GGNTGEEEGEKII-RGNTP-----AEYGENQG  393
            D   SFG+ Y+TRS +EGFG  Y      G    E  E  + R   P      EY E+QG
Sbjct  82   DMADSFGDAYSTRSSDEGFGQRYTEHIKCGPALSEGAEATVERDADPHVEVRREYDESQG  141

Query  394  SEVKEKEKGRHQPHH  438
            SEV+EKEK RH   H
Sbjct  142  SEVREKEKARHATEH  156



>gb|AAB01558.1| late embryogenesis abundant protein [Picea glauca]
Length=175

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 11/75 (15%)
 Frame = +1

Query  247  DTMSSFGEGYATRSDEEGFGGIY-----GGNTGEEEGEKII-RGNTP-----AEYGENQG  393
            D   SFG+ Y+TRS +EGFG  Y      G    E  E  + R   P      EY E+QG
Sbjct  82   DMADSFGDAYSTRSSDEGFGQRYTEHIKCGPALSEGAEATVERDADPHVEVRREYDESQG  141

Query  394  SEVKEKEKGRHQPHH  438
            SEV+EKEK RH   H
Sbjct  142  SEVREKEKARHATEH  156



>gb|ABA54793.1| late embryogenesis abundant protein [Picea glauca]
Length=175

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 11/75 (15%)
 Frame = +1

Query  247  DTMSSFGEGYATRSDEEGFGGIY-----GGNTGEEEGEKII-RGNTP-----AEYGENQG  393
            D   SFG+ Y+TRS +EGFG  Y      G    E  E  + R   P      EY E+QG
Sbjct  82   DMADSFGDAYSTRSSDEGFGQRYTEHIKCGPALSEGAEATVERDADPHVEVRREYDESQG  141

Query  394  SEVKEKEKGRHQPHH  438
            SEV+EKEK RH   H
Sbjct  142  SEVREKEKARHATEH  156



>emb|CAN74537.1| hypothetical protein VITISV_023717 [Vitis vinifera]
Length=893

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  247  DTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEK  348
            D MS SFG  YATRSDEEGFGGIYGGN    E EK
Sbjct  844  DEMSTSFGVAYATRSDEEGFGGIYGGNQSLGECEK  878



>ref|XP_008790361.1| PREDICTED: uncharacterized protein LOC103707596 isoform X1 [Phoenix 
dactylifera]
Length=178

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 39/64 (61%), Gaps = 11/64 (17%)
 Frame = +1

Query  244  GDTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEKIIRGNTPAEYGENQGSEVKEKEKG  420
            GD MS SFGEGY+TRSDEEGFGGIYG N      + I R   P E  EN   E  ++E  
Sbjct  66   GDAMSHSFGEGYSTRSDEEGFGGIYGRN------QSISR---PGEL-ENHPGERSQREGE  115

Query  421  RHQP  432
            R +P
Sbjct  116  RSEP  119



>emb|CAN71097.1| hypothetical protein VITISV_041500 [Vitis vinifera]
Length=334

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  247  DTMS-SFGEGYATRSDEEGFGGIYGGNTGEEEGEK  348
            D MS SFG  YATRSDEEGFGGIYGGN    E EK
Sbjct  62   DEMSTSFGVAYATRSDEEGFGGIYGGNQSLGECEK  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 584140730564