BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22716_g2_i3 len=257 path=[5844:0-170 7900:171-256]

Length=257
                                                                      Score     E

emb|CAK18868.1|  type II homeodomain-leucine zipper protein precu...    115   9e-31   Phillyrea latifolia
ref|XP_006388580.1|  hypothetical protein POPTR_0149s00220g             116   3e-30   
emb|CDP10158.1|  unnamed protein product                                119   4e-30   
ref|XP_006429896.1|  hypothetical protein CICLE_v10013382mg             118   4e-30   
emb|CBI30005.3|  unnamed protein product                                117   4e-30   
gb|EPS66266.1|  hypothetical protein M569_08512                         114   5e-30   
ref|XP_002275747.1|  PREDICTED: homeobox-leucine zipper protein H...    118   6e-30   Vitis vinifera
ref|XP_008240912.1|  PREDICTED: homeobox-leucine zipper protein H...    119   7e-30   
gb|KDO70901.1|  hypothetical protein CISIN_1g019530mg                   118   8e-30   
gb|KHN41711.1|  Homeobox-leucine zipper protein HAT14                   115   8e-30   
ref|XP_010111372.1|  Homeobox-leucine zipper protein HAT14              118   9e-30   
ref|XP_006492845.1|  PREDICTED: homeobox-leucine zipper protein H...    118   9e-30   
ref|XP_007029022.1|  Homeobox from                                      118   1e-29   
ref|XP_003533912.1|  PREDICTED: homeobox-leucine zipper protein H...    117   1e-29   
ref|XP_011075258.1|  PREDICTED: homeobox-leucine zipper protein H...    117   1e-29   
ref|XP_008392143.1|  PREDICTED: homeobox-leucine zipper protein H...    117   1e-29   
ref|XP_004303339.1|  PREDICTED: homeobox-leucine zipper protein H...    117   1e-29   
ref|XP_007202315.1|  hypothetical protein PRUPE_ppa008075mg             117   2e-29   
ref|XP_002322729.2|  hypothetical protein POPTR_0016s05890g             117   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_008387219.1|  PREDICTED: homeobox-leucine zipper protein H...    117   2e-29   
ref|XP_004497887.1|  PREDICTED: homeobox-leucine zipper protein H...    117   2e-29   
ref|XP_009369435.1|  PREDICTED: homeobox-leucine zipper protein H...    117   2e-29   
ref|XP_010036498.1|  PREDICTED: homeobox-leucine zipper protein H...    117   2e-29   
gb|KGN59289.1|  hypothetical protein Csa_3G800720                       117   2e-29   
ref|XP_004161505.1|  PREDICTED: LOW QUALITY PROTEIN: homeobox-leu...    114   2e-29   
ref|XP_004136729.1|  PREDICTED: homeobox-leucine zipper protein H...    117   2e-29   
ref|XP_007145700.1|  hypothetical protein PHAVU_007G260900g             117   2e-29   
ref|XP_008443033.1|  PREDICTED: homeobox-leucine zipper protein H...    117   3e-29   
ref|XP_003518045.1|  PREDICTED: homeobox-leucine zipper protein H...    117   3e-29   
ref|XP_010257490.1|  PREDICTED: homeobox-leucine zipper protein H...    117   3e-29   
ref|XP_010257489.1|  PREDICTED: homeobox-leucine zipper protein H...    117   3e-29   
ref|XP_002309297.2|  hypothetical protein POPTR_0006s20820g             115   5e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011005283.1|  PREDICTED: homeobox-leucine zipper protein H...    115   7e-29   
gb|KEH41728.1|  homeobox associated leucine zipper protein              115   8e-29   
ref|XP_002534537.1|  Homeobox-leucine zipper protein HAT14, putative    115   8e-29   Ricinus communis
ref|XP_010265939.1|  PREDICTED: homeobox-leucine zipper protein H...    115   8e-29   
ref|XP_011005284.1|  PREDICTED: homeobox-leucine zipper protein H...    115   9e-29   
ref|XP_008351552.1|  PREDICTED: homeobox-leucine zipper protein H...    114   1e-28   
emb|CBI32169.3|  unnamed protein product                                115   1e-28   
ref|XP_010672636.1|  PREDICTED: homeobox-leucine zipper protein H...    115   1e-28   
ref|XP_009604043.1|  PREDICTED: homeobox-leucine zipper protein H...    115   2e-28   
ref|XP_009604991.1|  PREDICTED: homeobox-leucine zipper protein H...    113   2e-28   
ref|XP_009604044.1|  PREDICTED: homeobox-leucine zipper protein H...    114   2e-28   
ref|XP_010557949.1|  PREDICTED: homeobox-leucine zipper protein H...    114   2e-28   
ref|XP_002268178.1|  PREDICTED: homeobox-leucine zipper protein H...    115   2e-28   Vitis vinifera
ref|XP_009798791.1|  PREDICTED: homeobox-leucine zipper protein H...    114   2e-28   
ref|XP_011002298.1|  PREDICTED: homeobox-leucine zipper protein H...    115   2e-28   
ref|XP_009798790.1|  PREDICTED: homeobox-leucine zipper protein H...    114   2e-28   
ref|XP_004229348.1|  PREDICTED: homeobox-leucine zipper protein H...    114   2e-28   
ref|XP_009604990.1|  PREDICTED: homeobox-leucine zipper protein H...    114   2e-28   
ref|XP_004493598.1|  PREDICTED: homeobox-leucine zipper protein H...    114   2e-28   
ref|XP_003546861.1|  PREDICTED: homeobox-leucine zipper protein H...    114   2e-28   
ref|XP_009604989.1|  PREDICTED: homeobox-leucine zipper protein H...    114   3e-28   
ref|XP_009604988.1|  PREDICTED: homeobox-leucine zipper protein H...    114   3e-28   
ref|XP_006369464.1|  hypothetical protein POPTR_0001s23680g             114   3e-28   
gb|KDP20388.1|  hypothetical protein JCGZ_05271                         114   3e-28   
ref|XP_006849539.1|  hypothetical protein AMTR_s00024p00164620          113   3e-28   
ref|XP_006359162.1|  PREDICTED: homeobox-leucine zipper protein H...    114   4e-28   
gb|ABK95369.1|  unknown                                                 114   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_009766178.1|  PREDICTED: homeobox-leucine zipper protein H...    114   4e-28   
ref|XP_010534362.1|  PREDICTED: homeobox-leucine zipper protein H...    113   4e-28   
ref|XP_009766179.1|  PREDICTED: homeobox-leucine zipper protein H...    114   4e-28   
gb|KHG29622.1|  Homeobox-leucine zipper HAT14 -like protein             115   4e-28   
ref|XP_007149086.1|  hypothetical protein PHAVU_005G040000g             114   5e-28   
ref|XP_003625279.1|  Homeobox-leucine zipper protein HOX27              112   5e-28   
ref|XP_010095880.1|  Homeobox-leucine zipper protein HAT14              114   5e-28   
ref|XP_002314223.2|  hypothetical protein POPTR_0009s02850g             114   6e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006351350.1|  PREDICTED: homeobox-leucine zipper protein H...    113   6e-28   
ref|XP_011041997.1|  PREDICTED: homeobox-leucine zipper protein H...    114   6e-28   
gb|KDP24642.1|  hypothetical protein JCGZ_25558                         113   6e-28   
ref|XP_009766177.1|  PREDICTED: homeobox-leucine zipper protein H...    113   6e-28   
ref|XP_003531416.1|  PREDICTED: homeobox-leucine zipper protein H...    113   7e-28   
gb|AFN53636.1|  putative homeobox-leucine zipper protein                111   9e-28   
ref|XP_011087051.1|  PREDICTED: homeobox-leucine zipper protein H...    113   9e-28   
ref|XP_011087055.1|  PREDICTED: homeobox-leucine zipper protein H...    113   9e-28   
ref|XP_004249289.1|  PREDICTED: homeobox-leucine zipper protein H...    112   1e-27   
emb|CDP07685.1|  unnamed protein product                                112   1e-27   
ref|XP_002512174.1|  homeobox protein, putative                         112   1e-27   Ricinus communis
ref|XP_003520539.1|  PREDICTED: homeobox-leucine zipper protein H...    111   2e-27   
ref|XP_003553433.1|  PREDICTED: homeobox-leucine zipper protein H...    111   2e-27   
ref|XP_011093390.1|  PREDICTED: homeobox-leucine zipper protein H...    112   2e-27   
gb|KHG07072.1|  Homeobox-leucine zipper HAT14 -like protein             109   2e-27   
gb|AAA56900.1|  homeobox protein                                        108   3e-27   Arabidopsis thaliana [mouse-ear cress]
gb|EPS58259.1|  hypothetical protein M569_16556                         107   3e-27   
gb|EYU27113.1|  hypothetical protein MIMGU_mgv1a024862mg                109   3e-27   
gb|AAZ23784.2|  type II homeodomain-leucine zipper protein              111   4e-27   Medicago sativa [alfalfa]
gb|ADI50270.1|  type II homeodomain-leucine zipper protein              110   5e-27   
ref|XP_003574599.1|  PREDICTED: homeobox-leucine zipper protein H...    110   5e-27   
ref|XP_010917267.1|  PREDICTED: homeobox-leucine zipper protein H...    111   5e-27   
dbj|BAB09805.1|  unnamed protein product                                108   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004488485.1|  PREDICTED: homeobox-leucine zipper protein H...    110   8e-27   
ref|XP_003595805.1|  Homeobox-leucine zipper protein HAT14              110   8e-27   
ref|XP_002873274.1|  homeobox-leucine zipper protein 14                 110   1e-26   
gb|KDO46060.1|  hypothetical protein CISIN_1g015772mg                   110   1e-26   
ref|XP_006482812.1|  PREDICTED: homeobox-leucine zipper protein H...    110   1e-26   
ref|XP_009617361.1|  PREDICTED: homeobox-leucine zipper protein H...    110   1e-26   
gb|AAO64814.1|  At5g06710                                               109   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452611.1|  PREDICTED: homeobox-leucine zipper protein H...    109   1e-26   
ref|NP_196289.2|  homeobox-leucine zipper protein HAT14                 109   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006439024.1|  hypothetical protein CICLE_v10033853mg             110   1e-26   
ref|XP_010491249.1|  PREDICTED: homeobox-leucine zipper protein H...    109   1e-26   
ref|XP_006482813.1|  PREDICTED: homeobox-leucine zipper protein H...    110   1e-26   
ref|XP_010423311.1|  PREDICTED: homeobox-leucine zipper protein H...    109   2e-26   
sp|A2YW03.2|HOX27_ORYSI  RecName: Full=Homeobox-leucine zipper pr...    109   2e-26   Oryza sativa Indica Group [Indian rice]
gb|ACF81452.1|  unknown                                                 109   2e-26   Zea mays [maize]
ref|XP_008789293.1|  PREDICTED: homeobox-leucine zipper protein H...    109   2e-26   
ref|XP_006399145.1|  hypothetical protein EUTSA_v10014027mg             109   2e-26   
ref|XP_010680788.1|  PREDICTED: homeobox-leucine zipper protein H...    108   2e-26   
gb|ABQ57289.1|  hox27                                                   105   2e-26   
sp|A2Z1U1.1|HOX11_ORYSI  RecName: Full=Homeobox-leucine zipper pr...    108   2e-26   Oryza sativa Indica Group [Indian rice]
sp|Q6YPD0.1|HOX27_ORYSJ  RecName: Full=Homeobox-leucine zipper pr...    109   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009767401.1|  PREDICTED: homeobox-leucine zipper protein H...    109   2e-26   
gb|EEC83694.1|  hypothetical protein OsI_29510                          108   2e-26   Oryza sativa Indica Group [Indian rice]
sp|Q67UE2.1|HOX11_ORYSJ  RecName: Full=Homeobox-leucine zipper pr...    108   2e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ44923.1|  hypothetical protein OsJ_29564                          108   2e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EYU44531.1|  hypothetical protein MIMGU_mgv1a011545mg                108   2e-26   
ref|XP_009417663.1|  PREDICTED: homeobox-leucine zipper protein H...    108   2e-26   
ref|XP_002445614.1|  hypothetical protein SORBIDRAFT_07g022620          109   3e-26   Sorghum bicolor [broomcorn]
ref|XP_002462469.1|  hypothetical protein SORBIDRAFT_02g026150          108   3e-26   Sorghum bicolor [broomcorn]
gb|KFK25083.1|  hypothetical protein AALP_AA8G063800                    108   3e-26   
ref|XP_003576587.1|  PREDICTED: homeobox-leucine zipper protein H...    108   4e-26   
ref|XP_004956965.1|  PREDICTED: homeobox-leucine zipper protein H...    108   4e-26   
ref|XP_004135907.1|  PREDICTED: homeobox-leucine zipper protein H...    107   5e-26   
emb|CDX98948.1|  BnaC09g48870D                                          108   5e-26   
ref|NP_001132562.1|  uncharacterized protein LOC100194027               107   5e-26   Zea mays [maize]
ref|XP_008461247.1|  PREDICTED: homeobox-leucine zipper protein H...    107   6e-26   
ref|XP_009130954.1|  PREDICTED: homeobox-leucine zipper protein H...    107   6e-26   
emb|CDY55775.1|  BnaA03g55490D                                          107   6e-26   
ref|XP_008791862.1|  PREDICTED: homeobox-leucine zipper protein H...    108   6e-26   
emb|CDX81016.1|  BnaC03g02700D                                          106   7e-26   
ref|XP_006288124.1|  hypothetical protein CARUB_v10001356mg             107   7e-26   
ref|XP_009122282.1|  PREDICTED: homeobox-leucine zipper protein H...    107   7e-26   
gb|KHG27543.1|  Homeobox-leucine zipper HAT22 -like protein             107   7e-26   
ref|XP_007047635.1|  Homeodomain-leucine zipper protein HD4             106   8e-26   
ref|XP_004166691.1|  PREDICTED: homeobox-leucine zipper protein H...    107   1e-25   
ref|NP_195493.1|  homeobox-leucine zipper protein HAT22                 105   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138531.1|  PREDICTED: homeobox-leucine zipper protein H...    105   2e-25   
ref|XP_010531317.1|  PREDICTED: LOW QUALITY PROTEIN: homeobox-leu...    105   2e-25   
ref|XP_002530591.1|  homeobox protein, putative                         105   2e-25   Ricinus communis
gb|KDP32129.1|  hypothetical protein JCGZ_12590                         105   2e-25   
ref|XP_006284261.1|  hypothetical protein CARUB_v10005427mg             105   2e-25   
ref|XP_002868963.1|  homeobox-leucine zipper protein 22                 105   2e-25   
ref|XP_008664503.1|  PREDICTED: homeobox-leucine zipper protein H...    107   2e-25   
tpg|DAA48378.1|  TPA: putative homeobox DNA-binding and leucine z...    105   2e-25   
ref|XP_010555437.1|  PREDICTED: homeobox-leucine zipper protein H...    105   2e-25   
emb|CDP02649.1|  unnamed protein product                                105   2e-25   
ref|XP_010028050.1|  PREDICTED: homeobox-leucine zipper protein H...    105   2e-25   
ref|XP_009408401.1|  PREDICTED: homeobox-leucine zipper protein H...    105   2e-25   
gb|ACL27275.1|  homeodomain leucine-zipper 1                            105   3e-25   Capsicum annuum
emb|CDX69330.1|  BnaC01g01230D                                          105   3e-25   
ref|XP_009392044.1|  PREDICTED: homeobox-leucine zipper protein H...    105   3e-25   
ref|XP_010432030.1|  PREDICTED: homeobox-leucine zipper protein H...    105   3e-25   
ref|XP_010245638.1|  PREDICTED: homeobox-leucine zipper protein H...    105   4e-25   
ref|XP_010936202.1|  PREDICTED: homeobox-leucine zipper protein H...    104   4e-25   
ref|XP_006661294.1|  PREDICTED: homeobox-leucine zipper protein H...    105   4e-25   
ref|XP_010446622.1|  PREDICTED: homeobox-leucine zipper protein H...    104   5e-25   
ref|XP_004170148.1|  PREDICTED: homeobox-leucine zipper protein H...    104   5e-25   
ref|XP_007218156.1|  hypothetical protein PRUPE_ppa007421mg             105   5e-25   
ref|XP_009592889.1|  PREDICTED: homeobox-leucine zipper protein H...    104   5e-25   
ref|XP_008440442.1|  PREDICTED: homeobox-leucine zipper protein H...    104   5e-25   
ref|XP_004143421.1|  PREDICTED: homeobox-leucine zipper protein H...    104   5e-25   
ref|XP_007162339.1|  hypothetical protein PHAVU_001G143500g             105   5e-25   
ref|XP_009133094.1|  PREDICTED: homeobox-leucine zipper protein H...    104   5e-25   
ref|XP_007205679.1|  hypothetical protein PRUPE_ppa009614mg             104   6e-25   
ref|XP_010437184.1|  PREDICTED: homeobox-leucine zipper protein H...    104   6e-25   
ref|XP_009365044.1|  PREDICTED: homeobox-leucine zipper protein H...    105   6e-25   
ref|XP_004231956.1|  PREDICTED: homeobox-leucine zipper protein H...    104   6e-25   
ref|XP_002307302.2|  Homeobox-leucine zipper protein HAT9               103   7e-25   Populus trichocarpa [western balsam poplar]
ref|XP_008350188.1|  PREDICTED: homeobox-leucine zipper protein H...    105   7e-25   
ref|XP_010647310.1|  PREDICTED: homeobox-leucine zipper protein H...    103   8e-25   
ref|XP_006363789.1|  PREDICTED: homeobox-leucine zipper protein H...    103   8e-25   
gb|ABK21195.1|  unknown                                                 104   8e-25   Picea sitchensis
emb|CBI41059.3|  unnamed protein product                                103   9e-25   
gb|ADN88095.1|  homeodomain-leucine zipper protein HD4                  103   9e-25   
gb|KFK30389.1|  hypothetical protein AALP_AA7G254600                    103   9e-25   
ref|XP_011099420.1|  PREDICTED: homeobox-leucine zipper protein H...    103   9e-25   
ref|XP_010647309.1|  PREDICTED: homeobox-leucine zipper protein H...    103   1e-24   
ref|XP_008790281.1|  PREDICTED: homeobox-leucine zipper protein H...    103   1e-24   
ref|XP_002271511.2|  PREDICTED: homeobox-leucine zipper protein H...    103   1e-24   Vitis vinifera
ref|XP_006848871.1|  hypothetical protein AMTR_s00026p00233150          103   1e-24   
ref|XP_009354678.1|  PREDICTED: homeobox-leucine zipper protein H...    104   1e-24   
ref|XP_008375131.1|  PREDICTED: homeobox-leucine zipper protein H...    103   2e-24   
ref|XP_009775231.1|  PREDICTED: homeobox-leucine zipper protein H...    102   2e-24   
ref|XP_004973642.1|  PREDICTED: homeobox-leucine zipper protein H...    103   3e-24   
ref|XP_002310877.2|  hypothetical protein POPTR_0007s14590g             102   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010248307.1|  PREDICTED: homeobox-leucine zipper protein H...    103   3e-24   
ref|XP_011031336.1|  PREDICTED: homeobox-leucine zipper protein H...    102   3e-24   
ref|XP_008245761.1|  PREDICTED: homeobox-leucine zipper protein H...    103   4e-24   
gb|ABK24536.1|  unknown                                                 103   4e-24   Picea sitchensis
ref|XP_008245760.1|  PREDICTED: homeobox-leucine zipper protein H...    103   4e-24   
ref|XP_009354594.1|  PREDICTED: homeobox-leucine zipper protein H...    102   4e-24   
ref|XP_006426160.1|  hypothetical protein CICLE_v10026197mg             102   4e-24   
ref|NP_001280933.1|  homeobox-leucine zipper protein HAT22-like         102   4e-24   
ref|XP_006466408.1|  PREDICTED: homeobox-leucine zipper protein H...    102   4e-24   
ref|XP_003549995.1|  PREDICTED: homeobox-leucine zipper protein H...    102   6e-24   
gb|ACU23516.1|  unknown                                                 102   6e-24   Glycine max [soybeans]
ref|XP_009338969.1|  PREDICTED: homeobox-leucine zipper protein H...    101   6e-24   
gb|KHN13024.1|  Homeobox-leucine zipper protein HAT22                 99.4    7e-24   
ref|XP_010099404.1|  Homeobox-leucine zipper protein HAT22              101   8e-24   
ref|XP_011073661.1|  PREDICTED: homeobox-leucine zipper protein H...    100   1e-23   
ref|XP_004509044.1|  PREDICTED: homeobox-leucine zipper protein H...    100   1e-23   
ref|XP_011073660.1|  PREDICTED: homeobox-leucine zipper protein H...    100   2e-23   
emb|CDP10005.1|  unnamed protein product                                100   2e-23   
gb|ACL27274.1|  homeodomain leucine-zipper 1                            100   2e-23   Nicotiana benthamiana
gb|KHN47559.1|  Homeobox-leucine zipper protein HAT22                   100   2e-23   
ref|XP_009109392.1|  PREDICTED: homeobox-leucine zipper protein H...    100   2e-23   
ref|XP_003539237.1|  PREDICTED: homeobox-leucine zipper protein H...    100   2e-23   
gb|ACU24595.1|  unknown                                                 100   2e-23   Glycine max [soybeans]
gb|KHN36326.1|  Homeobox-leucine zipper protein HAT22                   100   2e-23   
ref|XP_010055469.1|  PREDICTED: homeobox-leucine zipper protein H...    100   2e-23   
gb|KHG24226.1|  Homeobox-leucine zipper HAT22 -like protein             100   2e-23   
ref|XP_010055468.1|  PREDICTED: homeobox-leucine zipper protein H...    100   3e-23   
ref|XP_007156684.1|  hypothetical protein PHAVU_002G008600g             100   3e-23   
emb|CDY60301.1|  BnaAnng16680D                                        99.4    4e-23   
dbj|BAB18169.1|  homeobox-leucine zipper protein                      95.9    4e-23   Zinnia elegans [garden zinnia]
ref|XP_011008396.1|  PREDICTED: homeobox-leucine zipper protein H...  99.8    4e-23   
ref|XP_011008397.1|  PREDICTED: homeobox-leucine zipper protein H...  99.4    4e-23   
ref|XP_002968858.1|  hypothetical protein SELMODRAFT_6792             96.3    5e-23   
emb|CAA64491.1|  homeobox-leucine zipper protein                      99.8    5e-23   Spuriopimpinella brachycarpa
gb|KEH31546.1|  homeobox associated leucine zipper protein            99.0    5e-23   
ref|XP_006368991.1|  homeobox-leucine zipper family protein           99.4    6e-23   
ref|XP_006411852.1|  hypothetical protein EUTSA_v10025923mg           99.0    7e-23   
emb|CAA64152.1|  homeobox-leucine zipper protein                      99.4    7e-23   Spuriopimpinella brachycarpa
gb|ADN88093.1|  homeodomain-leucine zipper protein HD2                99.0    7e-23   
ref|XP_011047615.1|  PREDICTED: homeobox-leucine zipper protein HAT4  99.0    7e-23   
gb|EYU42259.1|  hypothetical protein MIMGU_mgv1a022171mg              99.4    9e-23   
ref|XP_007155789.1|  hypothetical protein PHAVU_003G232000g           98.6    9e-23   
gb|KDP39909.1|  hypothetical protein JCGZ_03440                       98.6    1e-22   
ref|XP_007209368.1|  hypothetical protein PRUPE_ppa008774mg           99.0    1e-22   
ref|XP_009342095.1|  PREDICTED: homeobox-leucine zipper protein H...  98.6    1e-22   
ref|XP_004301172.1|  PREDICTED: homeobox-leucine zipper protein H...  98.6    1e-22   
ref|XP_008345345.1|  PREDICTED: homeobox-leucine zipper protein H...  98.6    1e-22   
ref|XP_007039762.1|  Homeobox-leucine zipper protein 4 / HD-ZIP p...  98.6    1e-22   
ref|XP_008238430.1|  PREDICTED: homeobox-leucine zipper protein HAT4  98.6    1e-22   
gb|KDP41563.1|  hypothetical protein JCGZ_15970                       98.2    1e-22   
gb|KHG14441.1|  Homeobox-leucine zipper HAT4 -like protein            98.6    1e-22   
ref|XP_006440251.1|  hypothetical protein CICLE_v10021374mg           98.2    1e-22   
ref|XP_009589459.1|  PREDICTED: homeobox-leucine zipper protein H...  98.2    1e-22   
ref|XP_006477139.1|  PREDICTED: homeobox-leucine zipper protein H...  98.2    1e-22   
gb|KHN34515.1|  Homeobox-leucine zipper protein HAT4                  95.1    1e-22   
ref|XP_008798887.1|  PREDICTED: homeobox-leucine zipper protein H...  97.8    1e-22   
ref|XP_006359253.1|  PREDICTED: homeobox-leucine zipper protein H...  97.8    1e-22   
gb|AEW08278.1|  hypothetical protein 2_5173_01                        95.1    1e-22   
ref|XP_003517364.1|  PREDICTED: homeobox-leucine zipper protein H...  98.2    1e-22   
gb|EYU19287.1|  hypothetical protein MIMGU_mgv1a010069mg              98.2    1e-22   
gb|AET83222.1|  hypothetical protein                                  94.7    2e-22   
ref|XP_004245792.1|  PREDICTED: homeobox-leucine zipper protein H...  97.8    2e-22   
gb|AET83216.1|  hypothetical protein                                  94.7    2e-22   
ref|XP_004288289.1|  PREDICTED: homeobox-leucine zipper protein H...  97.8    2e-22   
gb|ACJ84212.1|  unknown                                               97.8    2e-22   Medicago truncatula
ref|XP_003611524.1|  Homeobox-leucine zipper protein HOX27            97.8    2e-22   
gb|KHG03387.1|  Homeobox-leucine zipper HAT4 -like protein            97.4    2e-22   
ref|XP_010677086.1|  PREDICTED: homeobox-leucine zipper protein H...  98.2    2e-22   
ref|XP_010677088.1|  PREDICTED: homeobox-leucine zipper protein H...  98.2    2e-22   
ref|XP_010677087.1|  PREDICTED: homeobox-leucine zipper protein H...  98.2    2e-22   
ref|XP_004147222.1|  PREDICTED: homeobox-leucine zipper protein H...  97.4    2e-22   
gb|AAS77208.1|  Hox19                                                 94.0    2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004511712.1|  PREDICTED: homeobox-leucine zipper protein H...  97.4    2e-22   
gb|KEH17820.1|  homeobox associated leucine zipper protein            97.4    3e-22   
ref|XP_009407820.1|  PREDICTED: homeobox-leucine zipper protein H...  97.4    3e-22   
ref|XP_009407821.1|  PREDICTED: homeobox-leucine zipper protein H...  97.4    3e-22   
gb|AFK35012.1|  unknown                                               97.1    3e-22   
ref|XP_010275386.1|  PREDICTED: homeobox-leucine zipper protein HAT4  97.4    3e-22   
ref|XP_003517410.1|  PREDICTED: homeobox-leucine zipper protein HAT4  97.1    3e-22   
gb|ACJ85358.1|  unknown                                               97.1    3e-22   Medicago truncatula
ref|XP_004515372.1|  PREDICTED: homeobox-leucine zipper protein H...  97.1    3e-22   
ref|XP_006583536.1|  PREDICTED: homeobox-leucine zipper protein H...  97.4    3e-22   
ref|XP_002510028.1|  homeobox protein, putative                       97.1    3e-22   Ricinus communis
emb|CAA63222.1|  homeobox-leucine zipper protein                      97.1    3e-22   Glycine max [soybeans]
ref|XP_003530150.1|  PREDICTED: homeobox-leucine zipper protein H...  97.4    3e-22   
ref|XP_010939328.1|  PREDICTED: homeobox-leucine zipper protein H...  97.1    3e-22   
ref|XP_010258803.1|  PREDICTED: homeobox-leucine zipper protein H...  97.1    3e-22   
ref|XP_009415318.1|  PREDICTED: homeobox-leucine zipper protein H...  97.1    3e-22   
gb|ABK25217.1|  unknown                                               97.1    4e-22   Picea sitchensis
ref|XP_007155694.1|  hypothetical protein PHAVU_003G223200g           97.1    4e-22   
ref|XP_010933626.1|  PREDICTED: homeobox-leucine zipper protein HAT4  97.1    4e-22   
ref|XP_009590186.1|  PREDICTED: homeobox-leucine zipper protein H...  97.1    4e-22   
ref|XP_003611347.1|  Homeobox-leucine zipper protein HOX17            97.1    4e-22   
ref|XP_009789655.1|  PREDICTED: homeobox-leucine zipper protein H...  96.7    4e-22   
ref|XP_003524058.1|  PREDICTED: homeobox-leucine zipper protein HAT4  97.1    4e-22   
dbj|BAD26581.1|  HD-ZIP protein                                       93.6    4e-22   
ref|XP_001760385.1|  predicted protein                                94.4    4e-22   
dbj|BAD27255.1|  SlHDL2                                               95.5    4e-22   
sp|Q8GRL4.1|HOX19_ORYSJ  RecName: Full=Homeobox-leucine zipper pr...  96.7    5e-22   
ref|XP_003549927.1|  PREDICTED: homeobox-leucine zipper protein HAT4  96.7    5e-22   
gb|AAA74017.1|  homeobox-leucine zipper protein homolog; Method: ...  94.7    5e-22   
ref|XP_006404745.1|  hypothetical protein EUTSA_v10000281mg           96.7    5e-22   
ref|XP_008448815.1|  PREDICTED: homeobox-leucine zipper protein HAT4  97.1    5e-22   
ref|XP_010104860.1|  Homeobox-leucine zipper protein HAT4             96.7    5e-22   
ref|XP_006385549.1|  homeobox-leucine zipper family protein           96.7    5e-22   
ref|XP_002880460.1|  homeobox-leucine zipper protein 9                96.3    5e-22   
gb|AES90870.2|  homeobox associated leucine zipper protein            96.3    6e-22   
ref|XP_008803829.1|  PREDICTED: homeobox-leucine zipper protein HAT4  96.7    6e-22   
ref|XP_003608673.1|  Homeobox-leucine zipper protein                  96.3    6e-22   
ref|XP_002263193.1|  PREDICTED: homeobox-leucine zipper protein HAT4  96.3    6e-22   
ref|XP_011081291.1|  PREDICTED: homeobox-leucine zipper protein H...  96.3    7e-22   
ref|XP_009388885.1|  PREDICTED: homeobox-leucine zipper protein H...  96.3    7e-22   
gb|AFK42912.1|  unknown                                               95.9    7e-22   
ref|XP_008367712.1|  PREDICTED: homeobox-leucine zipper protein H...  96.3    8e-22   
gb|ACU24403.1|  unknown                                               95.9    8e-22   
ref|XP_009368917.1|  PREDICTED: homeobox-leucine zipper protein HAT4  96.3    8e-22   
emb|CDP09453.1|  unnamed protein product                              96.3    8e-22   
ref|XP_009338549.1|  PREDICTED: homeobox-leucine zipper protein H...  96.3    8e-22   
gb|AAA56907.1|  homeobox protein                                      95.9    9e-22   
ref|XP_004508941.1|  PREDICTED: homeobox-leucine zipper protein H...  95.5    9e-22   
ref|XP_006346880.1|  PREDICTED: homeobox-leucine zipper protein H...  95.5    9e-22   
ref|XP_006358337.1|  PREDICTED: homeobox-leucine zipper protein H...  95.9    9e-22   
ref|XP_004133780.1|  PREDICTED: homeobox-leucine zipper protein H...  95.9    1e-21   
ref|XP_004155192.1|  PREDICTED: homeobox-leucine zipper protein H...  95.9    1e-21   
ref|XP_008796136.1|  PREDICTED: homeobox-leucine zipper protein H...  95.9    1e-21   
ref|NP_001234233.1|  HD-ZIP protein                                   95.9    1e-21   
gb|AAA56908.1|  homeobox protein                                      95.5    1e-21   
ref|NP_179865.1|  homeobox-leucine zipper protein HAT9                95.5    1e-21   
ref|XP_008668090.1|  PREDICTED: homeobox-leucine zipper protein H...  95.9    1e-21   
gb|AHA84136.1|  homeobox-leucine zipper protein HAT4                  95.5    1e-21   
tpg|DAA40223.1|  TPA: putative homeobox DNA-binding and leucine z...  95.9    1e-21   
ref|XP_008437820.1|  PREDICTED: homeobox-leucine zipper protein H...  95.5    1e-21   
ref|XP_009389298.1|  PREDICTED: homeobox-leucine zipper protein H...  95.5    1e-21   
ref|XP_009400697.1|  PREDICTED: homeobox-leucine zipper protein H...  95.5    1e-21   
ref|XP_007052281.1|  Homeobox-leucine zipper protein 4 / HD-ZIP p...  95.5    1e-21   
emb|CAA64221.1|  homeobox-leucine zipper protein                      95.5    1e-21   
ref|XP_007134496.1|  hypothetical protein PHAVU_010G052200g           95.5    2e-21   
gb|EAZ26155.1|  hypothetical protein OsJ_10021                        97.1    2e-21   
ref|XP_011031821.1|  PREDICTED: homeobox-leucine zipper protein H...  95.1    2e-21   
tpg|DAA36573.1|  TPA: putative homeobox DNA-binding and leucine z...  93.6    2e-21   
ref|XP_010469193.1|  PREDICTED: homeobox-leucine zipper protein HAT3  95.5    2e-21   
ref|XP_011017057.1|  PREDICTED: homeobox-leucine zipper protein H...  94.7    2e-21   
ref|XP_006375109.1|  hypothetical protein POPTR_0014s04460g           95.1    2e-21   
ref|XP_010089303.1|  Homeobox-leucine zipper protein HAT3             95.5    2e-21   
gb|AAO19435.1|  HAT4                                                  92.0    2e-21   
gb|AAM18493.1|AF494367_1  HAT4                                        92.4    2e-21   
ref|XP_007157265.1|  hypothetical protein PHAVU_002G056300g           95.1    2e-21   
ref|XP_009788263.1|  PREDICTED: homeobox-leucine zipper protein H...  94.7    2e-21   
dbj|BAA34244.1|  CRHB10                                               94.0    2e-21   
ref|XP_010526695.1|  PREDICTED: homeobox-leucine zipper protein H...  94.7    2e-21   
ref|XP_011089804.1|  PREDICTED: homeobox-leucine zipper protein H...  95.1    2e-21   
ref|XP_010512362.1|  PREDICTED: homeobox-leucine zipper protein H...  95.1    2e-21   
ref|XP_009786815.1|  PREDICTED: homeobox-leucine zipper protein H...  94.7    2e-21   
ref|XP_009386388.1|  PREDICTED: homeobox-leucine zipper protein H...  95.1    2e-21   
ref|XP_010053507.1|  PREDICTED: homeobox-leucine zipper protein H...  94.7    2e-21   
gb|KFK35246.1|  hypothetical protein AALP_AA5G259600                  94.7    2e-21   
ref|XP_002881989.1|  hypothetical protein ARALYDRAFT_483619           94.7    3e-21   
ref|XP_003538994.1|  PREDICTED: homeobox-leucine zipper protein HAT4  94.7    3e-21   
ref|NP_001152336.1|  homeobox-leucine zipper protein ATHB-4           94.0    3e-21   
ref|XP_009140395.1|  PREDICTED: homeobox-leucine zipper protein H...  94.4    3e-21   
ref|XP_010506431.1|  PREDICTED: homeobox-leucine zipper protein A...  94.7    3e-21   
gb|EYU41361.1|  hypothetical protein MIMGU_mgv1a012166mg              94.0    3e-21   
ref|XP_010506430.1|  PREDICTED: homeobox-leucine zipper protein A...  94.7    3e-21   
gb|AFK33736.1|  unknown                                               94.4    3e-21   
ref|XP_006445396.1|  hypothetical protein CICLE_v10021501mg           94.4    3e-21   
ref|XP_006445395.1|  hypothetical protein CICLE_v10021501mg           94.4    3e-21   
ref|XP_006402586.1|  hypothetical protein EUTSA_v10006110mg           94.4    3e-21   
gb|ABZ02301.1|  HAT4                                                  92.8    3e-21   
gb|ABZ02308.1|  HAT4                                                  92.8    3e-21   
ref|XP_009116721.1|  PREDICTED: homeobox-leucine zipper protein HAT3  94.4    4e-21   
ref|XP_010413054.1|  PREDICTED: homeobox-leucine zipper protein A...  94.4    4e-21   
gb|ABZ02304.1|  HAT4                                                  92.8    4e-21   
emb|CDX71814.1|  BnaC08g30600D                                        94.4    4e-21   
ref|XP_010508232.1|  PREDICTED: homeobox-leucine zipper protein A...  94.4    4e-21   
gb|ABZ02319.1|  HAT4                                                  92.8    4e-21   
gb|ABZ02298.1|  HAT4                                                  92.8    4e-21   
ref|XP_009140396.1|  PREDICTED: homeobox-leucine zipper protein H...  93.6    4e-21   
ref|XP_010508231.1|  PREDICTED: homeobox-leucine zipper protein A...  94.4    4e-21   
gb|ABZ02314.1|  HAT4                                                  92.8    4e-21   
gb|ABZ02313.1|  HAT4                                                  92.8    4e-21   
gb|ABZ02323.1|  HAT4                                                  92.4    4e-21   
ref|XP_004241991.1|  PREDICTED: homeobox-leucine zipper protein HAT4  94.4    4e-21   
gb|AAA56904.1|  homeobox protein                                      94.4    4e-21   
gb|EMS51877.1|  Homeobox-leucine zipper protein HOX17                 92.0    4e-21   
gb|AAL57493.1|AF443619_1  homeodomain leucine zipper protein CPHB-3   94.0    4e-21   
ref|XP_010440099.1|  PREDICTED: homeobox-leucine zipper protein HAT4  94.0    4e-21   
ref|XP_002302378.1|  hypothetical protein POPTR_0002s11410g           94.0    4e-21   
gb|KDP28831.1|  hypothetical protein JCGZ_14602                       94.0    4e-21   
emb|CDY41168.1|  BnaA09g38470D                                        94.0    4e-21   
ref|XP_010943413.1|  PREDICTED: homeobox-leucine zipper protein H...  93.6    4e-21   
ref|XP_002960328.1|  hypothetical protein SELMODRAFT_139631           92.4    5e-21   
ref|XP_006858761.1|  hypothetical protein AMTR_s00066p00143040        93.6    5e-21   
ref|XP_004976428.1|  PREDICTED: homeobox-leucine zipper protein H...  93.2    5e-21   
ref|XP_011031929.1|  PREDICTED: homeobox-leucine zipper protein HAT4  94.0    5e-21   
ref|XP_010919661.1|  PREDICTED: homeobox-leucine zipper protein H...  94.0    5e-21   
ref|XP_010434770.1|  PREDICTED: homeobox-leucine zipper protein H...  94.0    5e-21   
ref|XP_002878333.1|  hypothetical protein ARALYDRAFT_486512           94.0    5e-21   
ref|XP_006367464.1|  PREDICTED: homeobox-leucine zipper protein H...  94.0    5e-21   
emb|CAB96199.1|  hypothetical protein                                 94.0    5e-21   
ref|NP_193411.1|  homeobox protein 2                                  93.6    5e-21   
ref|XP_010449718.1|  PREDICTED: homeobox-leucine zipper protein H...  93.6    5e-21   
ref|NP_191598.1|  homeobox-leucine zipper protein HAT3                94.0    5e-21   
gb|KHG24384.1|  Homeobox-leucine zipper HAT3 -like protein            93.6    6e-21   
ref|NP_182018.1|  homeobox-leucine zipper protein ATHB-4              94.0    6e-21   
gb|EYU31909.1|  hypothetical protein MIMGU_mgv1a0106322mg             90.1    6e-21   
ref|XP_006284142.1|  hypothetical protein CARUB_v10005275mg           93.6    7e-21   
emb|CDY64220.1|  BnaAnng19250D                                        92.8    7e-21   
ref|XP_006347941.1|  PREDICTED: homeobox-leucine zipper protein H...  93.6    7e-21   
ref|XP_009387114.1|  PREDICTED: homeobox-leucine zipper protein H...  93.2    8e-21   
ref|XP_009392387.1|  PREDICTED: homeobox-leucine zipper protein H...  93.2    8e-21   
ref|XP_003521080.1|  PREDICTED: homeobox-leucine zipper protein H...  93.2    8e-21   
ref|XP_009142306.1|  PREDICTED: homeobox-leucine zipper protein A...  93.2    8e-21   
ref|XP_006602886.1|  PREDICTED: homeobox-leucine zipper protein H...  93.2    9e-21   
ref|XP_003552501.1|  PREDICTED: homeobox-leucine zipper protein H...  93.2    9e-21   
emb|CBI19344.3|  unnamed protein product                              93.2    9e-21   
ref|XP_003581495.1|  PREDICTED: homeobox-leucine zipper protein H...  92.4    9e-21   
ref|XP_009412281.1|  PREDICTED: homeobox-leucine zipper protein H...  92.8    9e-21   
ref|XP_008343628.1|  PREDICTED: homeobox-leucine zipper protein HAT3  93.6    9e-21   
ref|XP_010538408.1|  PREDICTED: homeobox-leucine zipper protein H...  93.2    9e-21   
emb|CBI16641.3|  unnamed protein product                              92.8    1e-20   
ref|XP_010661380.1|  PREDICTED: homeobox-leucine zipper protein H...  92.8    1e-20   
ref|XP_007018400.1|  HD domain class transcription factor             93.2    1e-20   
ref|XP_010524427.1|  PREDICTED: homeobox-leucine zipper protein H...  92.8    1e-20   
ref|XP_004244560.1|  PREDICTED: homeobox-leucine zipper protein H...  92.8    1e-20   
gb|KHN44561.1|  Homeobox-leucine zipper protein HAT3                  92.0    1e-20   
gb|KFK32790.1|  hypothetical protein AALP_AA6G288600                  92.8    1e-20   
emb|CAN73658.1|  hypothetical protein VITISV_036092                   92.8    1e-20   
sp|Q01I23.1|HOX17_ORYSI  RecName: Full=Homeobox-leucine zipper pr...  92.4    1e-20   
gb|EAZ31543.1|  hypothetical protein OsJ_15683                        92.4    1e-20   
emb|CDY27404.1|  BnaC04g50010D                                        92.8    1e-20   
ref|NP_001053481.1|  Os04g0548700                                     92.4    1e-20   
ref|XP_006652606.1|  PREDICTED: homeobox-leucine zipper protein H...  92.0    1e-20   
ref|XP_010544578.1|  PREDICTED: homeobox-leucine zipper protein H...  92.8    1e-20   
ref|XP_006414304.1|  hypothetical protein EUTSA_v10025903mg           92.4    1e-20   
gb|EMT18359.1|  Homeobox-leucine zipper protein HOX17                 92.0    1e-20   
ref|XP_004149840.1|  PREDICTED: homeobox-leucine zipper protein H...  92.4    1e-20   
ref|XP_008450165.1|  PREDICTED: homeobox-leucine zipper protein H...  92.4    2e-20   
ref|XP_007139620.1|  hypothetical protein PHAVU_008G045100g           92.4    2e-20   
ref|XP_009143078.1|  PREDICTED: homeobox-leucine zipper protein A...  92.4    2e-20   
ref|XP_009590779.1|  PREDICTED: homeobox-leucine zipper protein H...  92.0    2e-20   
ref|XP_009145468.1|  PREDICTED: homeobox-leucine zipper protein HAT4  92.4    2e-20   
gb|ACX37656.1|  homeodomain associated leucine zipper protein         91.7    2e-20   
ref|XP_002283547.1|  PREDICTED: homeobox-leucine zipper protein H...  92.0    2e-20   
ref|XP_009143079.1|  PREDICTED: homeobox-leucine zipper protein A...  92.0    2e-20   
emb|CDP00992.1|  unnamed protein product                              92.0    2e-20   
ref|XP_008785763.1|  PREDICTED: homeobox-leucine zipper protein H...  92.0    2e-20   
ref|XP_004306997.1|  PREDICTED: homeobox-leucine zipper protein H...  92.0    2e-20   
ref|XP_002448285.1|  hypothetical protein SORBIDRAFT_06g024480        91.7    2e-20   
gb|KGN58102.1|  hypothetical protein Csa_3G510960                     92.4    2e-20   
gb|AAA79778.1|  homeodomain protein                                   91.3    2e-20   
emb|CAA79670.1|  HAT4                                                 92.0    2e-20   
gb|KFK22263.1|  hypothetical protein AALP_AAs66747U001700             91.7    3e-20   
ref|XP_010429217.1|  PREDICTED: homeobox-leucine zipper protein H...  91.7    3e-20   
ref|XP_010472279.1|  PREDICTED: homeobox-leucine zipper protein H...  91.7    3e-20   
ref|XP_009619639.1|  PREDICTED: homeobox-leucine zipper protein H...  91.7    3e-20   
ref|XP_008232450.1|  PREDICTED: homeobox-leucine zipper protein HAT3  91.7    3e-20   
ref|XP_002511608.1|  homeobox protein, putative                       91.7    4e-20   
ref|XP_009764264.1|  PREDICTED: homeobox-leucine zipper protein HAT3  91.3    4e-20   
ref|XP_007203138.1|  hypothetical protein PRUPE_ppa024161mg           91.3    4e-20   
ref|XP_009401762.1|  PREDICTED: homeobox-leucine zipper protein HAT4  91.3    4e-20   
gb|ABZ02321.1|  HAT4                                                  89.7    4e-20   
dbj|BAA34237.1|  CRHB3                                                90.1    4e-20   
gb|EPS69011.1|  hypothetical protein M569_05758                       90.1    5e-20   
gb|KHG07341.1|  Homeobox-leucine zipper HAT4 -like protein            91.3    5e-20   
ref|XP_004985118.1|  PREDICTED: homeobox-leucine zipper protein H...  90.9    5e-20   
ref|XP_010317182.1|  PREDICTED: homeobox-leucine zipper protein H...  90.5    6e-20   
ref|XP_010023735.1|  PREDICTED: homeobox-leucine zipper protein A...  90.1    6e-20   
gb|KFK37287.1|  hypothetical protein AALP_AA4G237800                  90.9    6e-20   
gb|KHG16043.1|  Homeobox-leucine zipper protein HAT3                  90.5    6e-20   
ref|XP_003558432.1|  PREDICTED: homeobox-leucine zipper protein H...  90.5    6e-20   
ref|NP_001151083.1|  homeobox-leucine zipper protein HAT14            90.9    7e-20   
ref|XP_006397669.1|  hypothetical protein EUTSA_v10001549mg           90.9    7e-20   
ref|XP_008796968.1|  PREDICTED: homeobox-leucine zipper protein H...  90.5    7e-20   
gb|KHN11572.1|  Homeobox-leucine zipper protein HAT3                  90.1    7e-20   
ref|XP_006837330.1|  hypothetical protein AMTR_s00111p00077850        90.1    7e-20   
gb|KCW60086.1|  hypothetical protein EUGRSUZ_H02817                   90.1    7e-20   
gb|ABQ57279.1|  hox17                                                 88.6    7e-20   
ref|XP_001758141.1|  predicted protein                                88.6    8e-20   
gb|KHG16042.1|  Homeobox-leucine zipper protein HAT3                  90.1    9e-20   
ref|XP_010056406.1|  PREDICTED: homeobox-leucine zipper protein A...  90.5    9e-20   
ref|XP_009612669.1|  PREDICTED: homeobox-leucine zipper protein H...  89.7    1e-19   
gb|KHG28045.1|  Homeobox-leucine zipper ATHB-4 -like protein          90.1    1e-19   
gb|KCW81159.1|  hypothetical protein EUGRSUZ_C02534                   90.1    1e-19   
ref|XP_010058214.1|  PREDICTED: homeobox-leucine zipper protein H...  90.1    1e-19   
gb|EYU39953.1|  hypothetical protein MIMGU_mgv1a024232mg              90.1    1e-19   
ref|XP_004985119.1|  PREDICTED: homeobox-leucine zipper protein H...  89.4    2e-19   
ref|XP_003534468.1|  PREDICTED: homeobox-leucine zipper protein H...  89.0    2e-19   
ref|XP_002301224.1|  HD-ZIP family protein                            89.4    2e-19   
ref|XP_010529979.1|  PREDICTED: homeobox-leucine zipper protein HAT1  89.0    2e-19   
gb|KCW74161.1|  hypothetical protein EUGRSUZ_E02798                   89.0    2e-19   
ref|XP_006294614.1|  hypothetical protein CARUB_v10023652mg           89.4    2e-19   
ref|XP_010413565.1|  PREDICTED: homeobox-leucine zipper protein H...  89.4    2e-19   
ref|XP_006291451.1|  hypothetical protein CARUB_v10017588mg           89.4    2e-19   
ref|XP_009796334.1|  PREDICTED: homeobox-leucine zipper protein H...  88.6    2e-19   
ref|XP_010057133.1|  PREDICTED: homeobox-leucine zipper protein A...  89.4    3e-19   
ref|XP_006854130.1|  hypothetical protein AMTR_s00048p00162580        89.0    3e-19   
ref|XP_004511801.1|  PREDICTED: homeobox-leucine zipper protein H...  88.6    3e-19   
ref|XP_011017320.1|  PREDICTED: homeobox-leucine zipper protein A...  89.0    3e-19   
ref|XP_011017321.1|  PREDICTED: homeobox-leucine zipper protein A...  88.6    4e-19   
ref|XP_010417040.1|  PREDICTED: homeobox-leucine zipper protein H...  88.6    4e-19   
gb|KHG13213.1|  Homeobox-leucine zipper HAT22 -like protein           88.2    4e-19   
ref|XP_002467488.1|  hypothetical protein SORBIDRAFT_01g029000        88.6    5e-19   
gb|KFK31383.1|  hypothetical protein AALP_AA6G104800                  87.8    6e-19   
ref|XP_008220424.1|  PREDICTED: homeobox-leucine zipper protein H...  88.2    7e-19   
emb|CDP06271.1|  unnamed protein product                              87.8    7e-19   
ref|XP_004983649.1|  PREDICTED: homeobox-leucine zipper protein H...  88.2    7e-19   
emb|CDY41046.1|  BnaA09g18250D                                        86.7    8e-19   
gb|AAA56901.1|  homeobox protein                                      86.7    8e-19   
ref|XP_001758259.1|  predicted protein                                85.9    9e-19   
ref|XP_004291006.1|  PREDICTED: homeobox-leucine zipper protein H...  87.0    1e-18   
ref|XP_009361424.1|  PREDICTED: homeobox-leucine zipper protein H...  87.4    1e-18   
ref|XP_009114283.1|  PREDICTED: homeobox-leucine zipper protein H...  87.0    1e-18   
ref|NP_199548.1|  homeobox-leucine zipper protein HAT2                87.0    1e-18   
ref|XP_004983488.1|  PREDICTED: homeobox-leucine zipper protein H...  86.7    1e-18   
ref|XP_008393675.1|  PREDICTED: homeobox-leucine zipper protein H...  87.0    1e-18   



>emb|CAK18868.1| type II homeodomain-leucine zipper protein precursor [Phillyrea 
latifolia]
Length=106

 Score =   115 bits (288),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  18   RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  74



>ref|XP_006388580.1| hypothetical protein POPTR_0149s00220g [Populus trichocarpa]
 gb|ERP47494.1| hypothetical protein POPTR_0149s00220g [Populus trichocarpa]
Length=203

 Score =   116 bits (291),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  85   RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  141



>emb|CDP10158.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK+SQPFYMQLPATTLTMCP
Sbjct  236  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSSQPFYMQLPATTLTMCP  292



>ref|XP_006429896.1| hypothetical protein CICLE_v10013382mg, partial [Citrus clementina]
 gb|ESR43136.1| hypothetical protein CICLE_v10013382mg, partial [Citrus clementina]
Length=283

 Score =   118 bits (295),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  191  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  247



>emb|CBI30005.3| unnamed protein product [Vitis vinifera]
Length=250

 Score =   117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  145  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  201



>gb|EPS66266.1| hypothetical protein M569_08512, partial [Genlisea aurea]
Length=132

 Score =   114 bits (284),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLT+ENRRL+KELQELRALKASQPFYMQLPATTLTMCP
Sbjct  68   RTKLKQTEVDCEYLKRCCETLTDENRRLKKELQELRALKASQPFYMQLPATTLTMCP  124



>ref|XP_002275747.1| PREDICTED: homeobox-leucine zipper protein HOX11 [Vitis vinifera]
Length=331

 Score =   118 bits (296),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  226  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  282



>ref|XP_008240912.1| PREDICTED: homeobox-leucine zipper protein HOX11 [Prunus mume]
Length=351

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  236  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  292



>gb|KDO70901.1| hypothetical protein CISIN_1g019530mg [Citrus sinensis]
Length=339

 Score =   118 bits (296),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  219  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  275



>gb|KHN41711.1| Homeobox-leucine zipper protein HAT14 [Glycine soja]
Length=197

 Score =   115 bits (288),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  89   RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  145



>ref|XP_010111372.1| Homeobox-leucine zipper protein HAT14 [Morus notabilis]
 gb|EXC30850.1| Homeobox-leucine zipper protein HAT14 [Morus notabilis]
Length=372

 Score =   118 bits (296),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  271  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  327



>ref|XP_006492845.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Citrus 
sinensis]
Length=339

 Score =   118 bits (295),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  219  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  275



>ref|XP_007029022.1| Homeobox from [Theobroma cacao]
 gb|EOY09524.1| Homeobox from [Theobroma cacao]
Length=359

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  229  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  285



>ref|XP_003533912.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Glycine 
max]
 gb|KHN35655.1| Homeobox-leucine zipper protein HAT14 [Glycine soja]
Length=327

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK+SQPFYMQLPATTLTMCP
Sbjct  216  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSSQPFYMQLPATTLTMCP  272



>ref|XP_011075258.1| PREDICTED: homeobox-leucine zipper protein HOX11 [Sesamum indicum]
Length=325

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLK+CCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP
Sbjct  231  RTKLKQTEVDCEYLKKCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  287



>ref|XP_008392143.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Malus 
domestica]
Length=313

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  231  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  287



>ref|XP_004303339.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Fragaria 
vesca subsp. vesca]
Length=342

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  222  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  278



>ref|XP_007202315.1| hypothetical protein PRUPE_ppa008075mg [Prunus persica]
 gb|EMJ03514.1| hypothetical protein PRUPE_ppa008075mg [Prunus persica]
Length=346

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLT+ENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  236  RTKLKQTEVDCEYLKRCCETLTDENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  292



>ref|XP_002322729.2| hypothetical protein POPTR_0016s05890g [Populus trichocarpa]
 gb|EEF04490.2| hypothetical protein POPTR_0016s05890g [Populus trichocarpa]
Length=344

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  227  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  283



>ref|XP_008387219.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Malus 
domestica]
Length=340

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQ+LRALK SQPFYMQLPATTLTMCP
Sbjct  239  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQDLRALKTSQPFYMQLPATTLTMCP  295



>ref|XP_004497887.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Cicer 
arietinum]
Length=305

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  211  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  267



>ref|XP_009369435.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Pyrus 
x bretschneideri]
Length=344

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQ+LRALK SQPFYMQLPATTLTMCP
Sbjct  234  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQDLRALKTSQPFYMQLPATTLTMCP  290



>ref|XP_010036498.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Eucalyptus 
grandis]
 gb|KCW48112.1| hypothetical protein EUGRSUZ_K01847 [Eucalyptus grandis]
Length=365

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTE+DCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  251  RTKLKQTEIDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  307



>gb|KGN59289.1| hypothetical protein Csa_3G800720 [Cucumis sativus]
Length=386

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYL+RCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  287  RTKLKQTEVDCEYLRRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  343



>ref|XP_004161505.1| PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein 
HAT14-like [Cucumis sativus]
Length=182

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYL+RCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  83   RTKLKQTEVDCEYLRRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  139



>ref|XP_004136729.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Cucumis 
sativus]
Length=384

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYL+RCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  285  RTKLKQTEVDCEYLRRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  341



>ref|XP_007145700.1| hypothetical protein PHAVU_007G260900g [Phaseolus vulgaris]
 gb|ESW17694.1| hypothetical protein PHAVU_007G260900g [Phaseolus vulgaris]
Length=327

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  209  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  265



>ref|XP_008443033.1| PREDICTED: homeobox-leucine zipper protein HOX11 [Cucumis melo]
Length=379

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYL+RCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  279  RTKLKQTEVDCEYLRRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  335



>ref|XP_003518045.1| PREDICTED: homeobox-leucine zipper protein HAT14 [Glycine max]
Length=329

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  221  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  277



>ref|XP_010257490.1| PREDICTED: homeobox-leucine zipper protein HOX11 isoform X2 [Nelumbo 
nucifera]
Length=352

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK S PFYMQLPATTLTMCP
Sbjct  242  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSHPFYMQLPATTLTMCP  298



>ref|XP_010257489.1| PREDICTED: homeobox-leucine zipper protein HOX11 isoform X1 [Nelumbo 
nucifera]
Length=353

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK S PFYMQLPATTLTMCP
Sbjct  243  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSHPFYMQLPATTLTMCP  299



>ref|XP_002309297.2| hypothetical protein POPTR_0006s20820g [Populus trichocarpa]
 gb|EEE92820.2| hypothetical protein POPTR_0006s20820g [Populus trichocarpa]
Length=294

 Score =   115 bits (288),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLT+ENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  223  RTKLKQTEVDCEYLKRCCETLTKENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  279



>ref|XP_011005283.1| PREDICTED: homeobox-leucine zipper protein HAT14-like isoform 
X1 [Populus euphratica]
Length=313

 Score =   115 bits (288),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLT+ENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  223  RTKLKQTEVDCEYLKRCCETLTKENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  279



>gb|KEH41728.1| homeobox associated leucine zipper protein [Medicago truncatula]
Length=296

 Score =   115 bits (287),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK +QPFYMQLPATTLTMCP
Sbjct  205  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTTQPFYMQLPATTLTMCP  261



>ref|XP_002534537.1| Homeobox-leucine zipper protein HAT14, putative [Ricinus communis]
 gb|EEF27847.1| Homeobox-leucine zipper protein HAT14, putative [Ricinus communis]
Length=368

 Score =   115 bits (289),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE LTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  237  RTKLKQTEVDCEYLKRCCEMLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  293



>ref|XP_010265939.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Nelumbo 
nucifera]
Length=355

 Score =   115 bits (289),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK S PFYMQLPATTLTMCP
Sbjct  245  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSHPFYMQLPATTLTMCP  301



>ref|XP_011005284.1| PREDICTED: homeobox-leucine zipper protein HAT14-like isoform 
X2 [Populus euphratica]
Length=308

 Score =   115 bits (287),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLT+ENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  218  RTKLKQTEVDCEYLKRCCETLTKENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  274



>ref|XP_008351552.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Malus 
domestica]
Length=250

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKR CETLTEENRRLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  143  RTKLKQTEVDCEYLKRRCETLTEENRRLQKELQELRALKTSQPFYMQLPATTLTMCP  199



>emb|CBI32169.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  253  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  309



>ref|XP_010672636.1| PREDICTED: homeobox-leucine zipper protein HOX11 [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK SQP++MQLPATTLTMCP
Sbjct  257  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSQPYFMQLPATTLTMCP  313



>ref|XP_009604043.1| PREDICTED: homeobox-leucine zipper protein HAT14 isoform X1 [Nicotiana 
tomentosiformis]
Length=340

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLK+CCETLTEEN+RLQKELQELRALK+SQPFYMQLPATTLTMCP
Sbjct  236  RTKLKQTEVDCEYLKKCCETLTEENKRLQKELQELRALKSSQPFYMQLPATTLTMCP  292



>ref|XP_009604991.1| PREDICTED: homeobox-leucine zipper protein HOX27-like isoform 
X4 [Nicotiana tomentosiformis]
Length=252

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTE+DCEYLKRCCE LTEENRRLQKELQELRALK+SQPFYMQLPATTLTMCP
Sbjct  137  RTKLKQTELDCEYLKRCCEKLTEENRRLQKELQELRALKSSQPFYMQLPATTLTMCP  193



>ref|XP_009604044.1| PREDICTED: homeobox-leucine zipper protein HAT14 isoform X2 [Nicotiana 
tomentosiformis]
Length=339

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLK+CCETLTEEN+RLQKELQELRALK+SQPFYMQLPATTLTMCP
Sbjct  235  RTKLKQTEVDCEYLKKCCETLTEENKRLQKELQELRALKSSQPFYMQLPATTLTMCP  291



>ref|XP_010557949.1| PREDICTED: homeobox-leucine zipper protein HAT14 [Tarenaya hassleriana]
Length=313

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK S+PFYMQLPATTLTMCP
Sbjct  223  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTSRPFYMQLPATTLTMCP  279



>ref|XP_002268178.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Vitis 
vinifera]
Length=358

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  253  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  309



>ref|XP_009798791.1| PREDICTED: homeobox-leucine zipper protein HAT14-like isoform 
X2 [Nicotiana sylvestris]
Length=337

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLK+CCETLTEEN+RLQKELQELRALK+SQPFYMQLPATTLTMCP
Sbjct  237  RTKLKQTEVDCEYLKKCCETLTEENKRLQKELQELRALKSSQPFYMQLPATTLTMCP  293



>ref|XP_011002298.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Populus 
euphratica]
Length=381

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  251  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  307



>ref|XP_009798790.1| PREDICTED: homeobox-leucine zipper protein HAT14-like isoform 
X1 [Nicotiana sylvestris]
Length=338

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLK+CCETLTEEN+RLQKELQELRALK+SQPFYMQLPATTLTMCP
Sbjct  238  RTKLKQTEVDCEYLKKCCETLTEENKRLQKELQELRALKSSQPFYMQLPATTLTMCP  294



>ref|XP_004229348.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Solanum 
lycopersicum]
Length=365

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLT+ENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  244  RTKLKQTEVDCEYLKRCCETLTDENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  300



>ref|XP_009604990.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform 
X3 [Nicotiana tomentosiformis]
Length=308

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTE+DCEYLKRCCE LTEENRRLQKELQELRALK+SQPFYMQLPATTLTMCP
Sbjct  193  RTKLKQTELDCEYLKRCCEKLTEENRRLQKELQELRALKSSQPFYMQLPATTLTMCP  249



>ref|XP_004493598.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Cicer 
arietinum]
Length=290

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKELQELRALK S+PFYMQLPATTLTMCP
Sbjct  190  RTKLKQTEVDCEYLKRCCESLTEENRRLQKELQELRALKTSKPFYMQLPATTLTMCP  246



>ref|XP_003546861.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Glycine 
max]
Length=384

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  254  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  310



>ref|XP_009604989.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform 
X2 [Nicotiana tomentosiformis]
Length=315

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTE+DCEYLKRCCE LTEENRRLQKELQELRALK+SQPFYMQLPATTLTMCP
Sbjct  200  RTKLKQTELDCEYLKRCCEKLTEENRRLQKELQELRALKSSQPFYMQLPATTLTMCP  256



>ref|XP_009604988.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform 
X1 [Nicotiana tomentosiformis]
Length=316

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTE+DCEYLKRCCE LTEENRRLQKELQELRALK+SQPFYMQLPATTLTMCP
Sbjct  201  RTKLKQTELDCEYLKRCCEKLTEENRRLQKELQELRALKSSQPFYMQLPATTLTMCP  257



>ref|XP_006369464.1| hypothetical protein POPTR_0001s23680g [Populus trichocarpa]
 gb|ERP66033.1| hypothetical protein POPTR_0001s23680g [Populus trichocarpa]
Length=374

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  245  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  301



>gb|KDP20388.1| hypothetical protein JCGZ_05271 [Jatropha curcas]
Length=355

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  238  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  294



>ref|XP_006849539.1| hypothetical protein AMTR_s00024p00164620 [Amborella trichopoda]
 gb|ERN11120.1| hypothetical protein AMTR_s00024p00164620 [Amborella trichopoda]
Length=305

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK + PFYM LPATTLTMCP
Sbjct  210  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTAHPFYMHLPATTLTMCP  266



>ref|XP_006359162.1| PREDICTED: homeobox-leucine zipper protein HOX27-like [Solanum 
tuberosum]
Length=373

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLT+ENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  249  RTKLKQTEVDCEYLKRCCETLTDENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  305



>gb|ABK95369.1| unknown [Populus trichocarpa]
Length=374

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  245  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  301



>ref|XP_009766178.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform 
X2 [Nicotiana sylvestris]
Length=341

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTE+DCEYLKRCCETLTEENRRLQKELQELRALK+SQP YMQLPATTLTMCP
Sbjct  234  RTKLKQTELDCEYLKRCCETLTEENRRLQKELQELRALKSSQPLYMQLPATTLTMCP  290



>ref|XP_010534362.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Tarenaya 
hassleriana]
Length=322

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK+S+PFYMQLPATTLT+CP
Sbjct  227  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSSRPFYMQLPATTLTICP  283



>ref|XP_009766179.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform 
X3 [Nicotiana sylvestris]
Length=340

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTE+DCEYLKRCCETLTEENRRLQKELQELRALK+SQP YMQLPATTLTMCP
Sbjct  233  RTKLKQTELDCEYLKRCCETLTEENRRLQKELQELRALKSSQPLYMQLPATTLTMCP  289



>gb|KHG29622.1| Homeobox-leucine zipper HAT14 -like protein [Gossypium arboreum]
Length=543

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETL EEN+RLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  453  RTKLKQTEVDCEYLKRCCETLAEENKRLQKELQELRALKTSQPFYMQLPATTLTMCP  509



>ref|XP_007149086.1| hypothetical protein PHAVU_005G040000g [Phaseolus vulgaris]
 gb|ESW21080.1| hypothetical protein PHAVU_005G040000g [Phaseolus vulgaris]
Length=377

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  247  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  303



>ref|XP_003625279.1| Homeobox-leucine zipper protein HOX27 [Medicago truncatula]
 gb|AES81497.1| homeobox associated leucine zipper protein [Medicago truncatula]
Length=296

 Score =   112 bits (281),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTK KQTEVDCEYLKRCCETLTEEN+RLQKELQELRALK SQPFYMQLPATTLTMCP
Sbjct  211  RTKSKQTEVDCEYLKRCCETLTEENKRLQKELQELRALKTSQPFYMQLPATTLTMCP  267



>ref|XP_010095880.1| Homeobox-leucine zipper protein HAT14 [Morus notabilis]
 gb|EXC42166.1| Homeobox-leucine zipper protein HAT14 [Morus notabilis]
Length=377

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  268  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  324



>ref|XP_002314223.2| hypothetical protein POPTR_0009s02850g [Populus trichocarpa]
 gb|EEE88178.2| hypothetical protein POPTR_0009s02850g [Populus trichocarpa]
Length=383

 Score =   114 bits (284),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S P+YMQLPATTLTMCP
Sbjct  265  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPYYMQLPATTLTMCP  321



>ref|XP_006351350.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Solanum 
tuberosum]
Length=351

 Score =   113 bits (283),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLK+CCETLTEEN+RL KELQELRALK+SQPFYMQLPATTLTMCP
Sbjct  249  RTKLKQTEVDCEYLKKCCETLTEENKRLHKELQELRALKSSQPFYMQLPATTLTMCP  305



>ref|XP_011041997.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Populus 
euphratica]
Length=384

 Score =   114 bits (284),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S P+YMQLPATTLTMCP
Sbjct  265  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPYYMQLPATTLTMCP  321



>gb|KDP24642.1| hypothetical protein JCGZ_25558 [Jatropha curcas]
Length=327

 Score =   113 bits (282),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYL+RCCETLTEENRRLQKELQELRALK SQPFY QLPATTLTMCP
Sbjct  221  RTKLKQTEVDCEYLRRCCETLTEENRRLQKELQELRALKTSQPFYKQLPATTLTMCP  277



>ref|XP_009766177.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform 
X1 [Nicotiana sylvestris]
Length=349

 Score =   113 bits (283),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTE+DCEYLKRCCETLTEENRRLQKELQELRALK+SQP YMQLPATTLTMCP
Sbjct  242  RTKLKQTELDCEYLKRCCETLTEENRRLQKELQELRALKSSQPLYMQLPATTLTMCP  298



>ref|XP_003531416.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Glycine 
max]
Length=377

 Score =   113 bits (283),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  246  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  302



>gb|AFN53636.1| putative homeobox-leucine zipper protein [Linum usitatissimum]
Length=252

 Score =   111 bits (278),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/58 (95%), Positives = 55/58 (95%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKA-SQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK  SQPFYMQ PATTLTMCP
Sbjct  132  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTNSQPFYMQPPATTLTMCP  189



>ref|XP_011087051.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform 
X1 [Sesamum indicum]
Length=364

 Score =   113 bits (282),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETL+EENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  259  RTKLKQTEVDCEYLKRCCETLSEENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  315



>ref|XP_011087055.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform 
X2 [Sesamum indicum]
Length=363

 Score =   113 bits (282),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETL+EENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  258  RTKLKQTEVDCEYLKRCCETLSEENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  314



>ref|XP_004249289.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Solanum 
lycopersicum]
Length=354

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLK+CCETLTEEN+RL KELQELRALK+SQPFYMQLPATTLTMCP
Sbjct  246  RTKLKQTEVDCEYLKKCCETLTEENKRLHKELQELRALKSSQPFYMQLPATTLTMCP  302



>emb|CDP07685.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLT+ENRRL KELQELRALK S PFYMQLPATTLTMCP
Sbjct  209  RTKLKQTEVDCEYLKRCCETLTDENRRLHKELQELRALKTSNPFYMQLPATTLTMCP  265



>ref|XP_002512174.1| homeobox protein, putative [Ricinus communis]
 gb|EEF50208.1| homeobox protein, putative [Ricinus communis]
Length=378

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRAL +S PFYMQ+PATTLTMCP
Sbjct  260  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALTSSNPFYMQVPATTLTMCP  316



>ref|XP_003520539.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Glycine 
max]
Length=288

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKELQELRALK  QPF+MQLPATTLTMCP
Sbjct  179  RTKLKQTEVDCEYLKRCCESLTEENRRLQKELQELRALKTCQPFFMQLPATTLTMCP  235



>ref|XP_003553433.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Glycine 
max]
 gb|KHN45424.1| Homeobox-leucine zipper protein HAT14 [Glycine soja]
Length=292

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKELQELRALK  QPF+MQLPATTLTMCP
Sbjct  178  RTKLKQTEVDCEYLKRCCESLTEENRRLQKELQELRALKTCQPFFMQLPATTLTMCP  234



>ref|XP_011093390.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Sesamum 
indicum]
Length=373

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PFYMQ PATTLTMCP
Sbjct  260  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFYMQSPATTLTMCP  316



>gb|KHG07072.1| Homeobox-leucine zipper HAT14 -like protein [Gossypium arboreum]
Length=218

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTE+DCEYLKRCCETLTEENRRL KE+QELRALK  QPFYMQLPATTLTMCP
Sbjct  145  RTKLKQTELDCEYLKRCCETLTEENRRLHKEVQELRALKTCQPFYMQLPATTLTMCP  201



>gb|AAA56900.1| homeobox protein, partial [Arabidopsis thaliana]
Length=165

 Score =   108 bits (269),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELR LK S PFYMQLPATTLTMCP
Sbjct  70   RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTSTPFYMQLPATTLTMCP  126



>gb|EPS58259.1| hypothetical protein M569_16556, partial [Genlisea aurea]
Length=137

 Score =   107 bits (266),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCC+ LTEENRRLQKEL +LRALK S PFYMQ+PATTLTMCP
Sbjct  75   RTKLKQTEVDCEYLKRCCDALTEENRRLQKELHDLRALKTSAPFYMQIPATTLTMCP  131



>gb|EYU27113.1| hypothetical protein MIMGU_mgv1a024862mg [Erythranthe guttata]
Length=230

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 55/59 (93%), Gaps = 2/59 (3%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKAS--QPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR+LK S   PFYMQLPATTLTMCP
Sbjct  122  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRSLKTSSNNPFYMQLPATTLTMCP  180



>gb|AAZ23784.2| type II homeodomain-leucine zipper protein [Medicago sativa]
Length=340

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PF MQLPATTLTMCP
Sbjct  252  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFNMQLPATTLTMCP  308



>gb|ADI50270.1| type II homeodomain-leucine zipper protein [Medicago sativa]
Length=340

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PF MQLPATTLTMCP
Sbjct  252  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFNMQLPATTLTMCP  308



>ref|XP_003574599.1| PREDICTED: homeobox-leucine zipper protein HOX27-like [Brachypodium 
distachyon]
Length=346

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KEL ELRALK +QPFYM LPATTL+MCP
Sbjct  225  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELSELRALKTAQPFYMHLPATTLSMCP  281



>ref|XP_010917267.1| PREDICTED: homeobox-leucine zipper protein HOX11 [Elaeis guineensis]
Length=366

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKEL ELRALK S PFYM LPATTL+MCP
Sbjct  237  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELRALKTSHPFYMHLPATTLSMCP  293



>dbj|BAB09805.1| unnamed protein product [Arabidopsis thaliana]
Length=225

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELR LK S PFYMQLPATTLTMCP
Sbjct  130  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTSTPFYMQLPATTLTMCP  186



>ref|XP_004488485.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Cicer 
arietinum]
Length=349

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PF MQLPATTLTMCP
Sbjct  241  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFNMQLPATTLTMCP  297



>ref|XP_003595805.1| Homeobox-leucine zipper protein HAT14 [Medicago truncatula]
 gb|AES66056.1| homeobox associated leucine zipper protein [Medicago truncatula]
Length=339

 Score =   110 bits (274),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK S PF MQLPATTLTMCP
Sbjct  251  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKTSNPFNMQLPATTLTMCP  307



>ref|XP_002873274.1| homeobox-leucine zipper protein 14 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49533.1| homeobox-leucine zipper protein 14 [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELR LK S PFYMQLPATTLTMCP
Sbjct  241  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTSTPFYMQLPATTLTMCP  297



>gb|KDO46060.1| hypothetical protein CISIN_1g015772mg [Citrus sinensis]
Length=400

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 55/60 (92%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK---ASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK    + PFYMQLPATTLTMCP
Sbjct  285  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSTAGNNPFYMQLPATTLTMCP  344



>ref|XP_006482812.1| PREDICTED: homeobox-leucine zipper protein HAT14-like isoform 
X1 [Citrus sinensis]
Length=441

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 55/60 (92%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK---ASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK    + PFYMQLPATTLTMCP
Sbjct  326  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSTAGNNPFYMQLPATTLTMCP  385



>ref|XP_009617361.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Nicotiana 
tomentosiformis]
Length=396

 Score =   110 bits (274),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK+S PFYMQLPATTLTMCP
Sbjct  266  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKSSNPFYMQLPATTLTMCP  322



>gb|AAO64814.1| At5g06710 [Arabidopsis thaliana]
Length=336

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELR LK S PFYMQLPATTLTMCP
Sbjct  241  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTSTPFYMQLPATTLTMCP  297



>ref|XP_010452611.1| PREDICTED: homeobox-leucine zipper protein HAT14 [Camelina sativa]
Length=336

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELR LK S PFYMQLPATTLTMCP
Sbjct  240  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTSTPFYMQLPATTLTMCP  296



>ref|NP_196289.2| homeobox-leucine zipper protein HAT14 [Arabidopsis thaliana]
 sp|P46665.3|HAT14_ARATH RecName: Full=Homeobox-leucine zipper protein HAT14; AltName: 
Full=Homeodomain-leucine zipper protein HAT14; Short=HD-ZIP 
protein 14 [Arabidopsis thaliana]
 dbj|BAE99427.1| homeobox protein [Arabidopsis thaliana]
 emb|CAD24012.2| homeodomain-leucine zipper protein HAT14 [Arabidopsis thaliana]
 gb|AED91053.1| homeobox-leucine zipper protein HAT14 [Arabidopsis thaliana]
Length=336

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELR LK S PFYMQLPATTLTMCP
Sbjct  241  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTSTPFYMQLPATTLTMCP  297



>ref|XP_006439024.1| hypothetical protein CICLE_v10033853mg, partial [Citrus clementina]
 gb|ESR52264.1| hypothetical protein CICLE_v10033853mg, partial [Citrus clementina]
Length=411

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 55/60 (92%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK---ASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK    + PFYMQLPATTLTMCP
Sbjct  326  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSTAGNNPFYMQLPATTLTMCP  385



>ref|XP_010491249.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Camelina 
sativa]
Length=338

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELR LK S PFYMQLPATTLTMCP
Sbjct  242  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTSTPFYMQLPATTLTMCP  298



>ref|XP_006482813.1| PREDICTED: homeobox-leucine zipper protein HAT14-like isoform 
X2 [Citrus sinensis]
Length=438

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 55/60 (92%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK---ASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK    + PFYMQLPATTLTMCP
Sbjct  323  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSTAGNNPFYMQLPATTLTMCP  382



>ref|XP_010423311.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Camelina 
sativa]
Length=336

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELR LK S PFYMQLPATTLTMCP
Sbjct  240  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTSTPFYMQLPATTLTMCP  296



>sp|A2YW03.2|HOX27_ORYSI RecName: Full=Homeobox-leucine zipper protein HOX27; AltName: 
Full=HD-ZIP protein HOX27; AltName: Full=Homeodomain transcription 
factor HOX27; AltName: Full=OsHox27 [Oryza sativa Indica 
Group]
Length=354

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KEL ELRALK ++PFYM LPATTL+MCP
Sbjct  225  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELAELRALKTARPFYMHLPATTLSMCP  281



>gb|ACF81452.1| unknown [Zea mays]
 tpg|DAA61707.1| TPA: putative homeobox DNA-binding and leucine zipper domain 
family protein [Zea mays]
 gb|AIB04402.1| HB transcription factor, partial [Zea mays]
Length=333

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKEL ELRALK   PFYM LPATTL+MCP
Sbjct  216  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELSELRALKTVHPFYMHLPATTLSMCP  272



>ref|XP_008789293.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Phoenix 
dactylifera]
Length=389

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKEL ELRALK + PFYM LPATTL+MCP
Sbjct  266  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELRALKTTHPFYMHLPATTLSMCP  322



>ref|XP_006399145.1| hypothetical protein EUTSA_v10014027mg [Eutrema salsugineum]
 gb|ESQ40598.1| hypothetical protein EUTSA_v10014027mg [Eutrema salsugineum]
Length=340

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELRALK S P YMQLPATTLTMCP
Sbjct  241  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRALKTSSPLYMQLPATTLTMCP  297



>ref|XP_010680788.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Beta vulgaris 
subsp. vulgaris]
Length=281

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLK+CCETLT+ENRRLQKELQEL+ALK  QPFYM LPA TLTMCP
Sbjct  177  RTKLKQTEVDCEYLKKCCETLTDENRRLQKELQELKALKMGQPFYMHLPAATLTMCP  233



>gb|ABQ57289.1| hox27, partial [Oryza sativa Indica Group]
Length=131

 Score =   105 bits (261),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KEL ELRALK ++PFYM LPATTL+MCP
Sbjct  21   RTKLKQTEVDCEYLKRCCETLTEENRRLHKELAELRALKTARPFYMHLPATTLSMCP  77



>sp|A2Z1U1.1|HOX11_ORYSI RecName: Full=Homeobox-leucine zipper protein HOX11; AltName: 
Full=HD-ZIP protein HOX11; AltName: Full=Homeodomain transcription 
factor HOX11; AltName: Full=OsHox11 [Oryza sativa Indica 
Group]
 gb|EAZ09302.1| hypothetical protein OsI_31575 [Oryza sativa Indica Group]
Length=276

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKEL ELRALK   PFYM LPATTL+MCP
Sbjct  141  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELRALKTVHPFYMHLPATTLSMCP  197



>sp|Q6YPD0.1|HOX27_ORYSJ RecName: Full=Homeobox-leucine zipper protein HOX27; AltName: 
Full=HD-ZIP protein HOX27; AltName: Full=Homeodomain transcription 
factor HOX27; AltName: Full=OsHox27 [Oryza sativa Japonica 
Group]
 dbj|BAD17827.1| putative homeobox-leucine zipper protein [Oryza sativa Japonica 
Group]
 gb|EEE68830.1| hypothetical protein OsJ_27606 [Oryza sativa Japonica Group]
Length=354

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KEL ELRALK ++PFYM LPATTL+MCP
Sbjct  225  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELAELRALKTARPFYMHLPATTLSMCP  281



>ref|XP_009767401.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Nicotiana 
sylvestris]
Length=408

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KELQELRALK+S PFYMQLPATTLTMCP
Sbjct  274  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELRALKSSNPFYMQLPATTLTMCP  330



>gb|EEC83694.1| hypothetical protein OsI_29510 [Oryza sativa Indica Group]
Length=352

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KEL ELRALK ++PFYM LPATTL+MCP
Sbjct  223  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELAELRALKTARPFYMHLPATTLSMCP  279



>sp|Q67UE2.1|HOX11_ORYSJ RecName: Full=Homeobox-leucine zipper protein HOX11; AltName: 
Full=HD-ZIP protein HOX11; AltName: Full=Homeodomain transcription 
factor HOX11; AltName: Full=OsHox11 [Oryza sativa Japonica 
Group]
 dbj|BAD38229.1| putative homeodomain leucine zipper protein CPHB-3 [Oryza sativa 
Japonica Group]
Length=362

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKEL ELRALK   PFYM LPATTL+MCP
Sbjct  228  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELRALKTVHPFYMHLPATTLSMCP  284



>gb|EAZ44923.1| hypothetical protein OsJ_29564 [Oryza sativa Japonica Group]
Length=362

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKEL ELRALK   PFYM LPATTL+MCP
Sbjct  228  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELRALKTVHPFYMHLPATTLSMCP  284



>gb|EYU44531.1| hypothetical protein MIMGU_mgv1a011545mg [Erythranthe guttata]
Length=278

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLTEENRRLQKELQEL+ALK++QP YMQLPA TLTMCP
Sbjct  182  RTKLKQTEVDCEFLKKCCETLTEENRRLQKELQELKALKSAQPLYMQLPAATLTMCP  238



>ref|XP_009417663.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Musa acuminata 
subsp. malaccensis]
Length=351

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCC+TLTEENRRLQKE+ ELRALK S PFYM LPATTL+MCP
Sbjct  236  RTKLKQTEVDCEYLKRCCQTLTEENRRLQKEVAELRALKTSHPFYMHLPATTLSMCP  292



>ref|XP_002445614.1| hypothetical protein SORBIDRAFT_07g022620 [Sorghum bicolor]
 gb|EES15109.1| hypothetical protein SORBIDRAFT_07g022620 [Sorghum bicolor]
Length=377

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KEL ELRALKA+ PF+M+LPATTL+MCP
Sbjct  243  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELAELRALKAAPPFFMRLPATTLSMCP  299



>ref|XP_002462469.1| hypothetical protein SORBIDRAFT_02g026150 [Sorghum bicolor]
 gb|EER98990.1| hypothetical protein SORBIDRAFT_02g026150 [Sorghum bicolor]
Length=369

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKEL ELRALK   PFYM LPATTL+MCP
Sbjct  239  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELRALKTVHPFYMHLPATTLSMCP  295



>gb|KFK25083.1| hypothetical protein AALP_AA8G063800 [Arabis alpina]
Length=329

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 56/58 (97%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK-ASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELRALK +S PFYMQLPATTLTMCP
Sbjct  229  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRALKTSSSPFYMQLPATTLTMCP  286



>ref|XP_003576587.1| PREDICTED: homeobox-leucine zipper protein HOX11 [Brachypodium 
distachyon]
Length=336

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKEL ELRALK   PFYM LPATTL+MCP
Sbjct  227  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELRALKTVHPFYMHLPATTLSMCP  283



>ref|XP_004956965.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Setaria 
italica]
Length=422

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKEL ELRALK   PFYM LPATTL+MCP
Sbjct  296  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELRALKTVHPFYMHLPATTLSMCP  352



>ref|XP_004135907.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Cucumis 
sativus]
 gb|KGN45166.1| hypothetical protein Csa_7G429520 [Cucumis sativus]
Length=326

 Score =   107 bits (268),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK +   YMQLPATTLTMCP
Sbjct  218  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTTNSLYMQLPATTLTMCP  274



>emb|CDX98948.1| BnaC09g48870D [Brassica napus]
Length=339

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELRALK S PF MQLPATTLTMCP
Sbjct  240  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRALKTSSPFCMQLPATTLTMCP  296



>ref|NP_001132562.1| uncharacterized protein LOC100194027 [Zea mays]
 gb|ACG41781.1| homeobox-leucine zipper protein HAT14 [Zea mays]
Length=333

 Score =   107 bits (268),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKEL ELR+LK   PFYM LPATTL+MCP
Sbjct  216  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELSELRSLKTVHPFYMHLPATTLSMCP  272



>ref|XP_008461247.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Cucumis 
melo]
Length=326

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK +   YMQLPATTLTMCP
Sbjct  218  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTTNSLYMQLPATTLTMCP  274



>ref|XP_009130954.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Brassica 
rapa]
Length=322

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLK+CCE+LT+ENRRLQKE++ELRALK S PFYMQ PATTLTMCP
Sbjct  224  RTKLKQTEVDCEYLKKCCESLTDENRRLQKEVKELRALKTSSPFYMQRPATTLTMCP  280



>emb|CDY55775.1| BnaA03g55490D [Brassica napus]
Length=322

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLK+CCE+LT+ENRRLQKE++ELRALK S PFYMQ PATTLTMCP
Sbjct  224  RTKLKQTEVDCEYLKKCCESLTDENRRLQKEVKELRALKTSSPFYMQRPATTLTMCP  280



>ref|XP_008791862.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Phoenix 
dactylifera]
Length=375

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKEL ELRALK S PFY  LPATTL+MCP
Sbjct  226  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELRALKTSHPFYTHLPATTLSMCP  282



>emb|CDX81016.1| BnaC03g02700D [Brassica napus]
Length=260

 Score =   106 bits (265),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLK+CCE+LT+ENRRLQKE++ELRALK S PFYMQ PATTLTMCP
Sbjct  162  RTKLKQTEVDCEYLKKCCESLTDENRRLQKEVKELRALKTSSPFYMQRPATTLTMCP  218



>ref|XP_006288124.1| hypothetical protein CARUB_v10001356mg [Capsella rubella]
 gb|EOA21022.1| hypothetical protein CARUB_v10001356mg [Capsella rubella]
Length=340

 Score =   107 bits (268),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRL+KE++ELR LK S PFYMQLPATTLTMCP
Sbjct  238  RTKLKQTEVDCEYLKRCCESLTEENRRLKKEVKELRTLKTSTPFYMQLPATTLTMCP  294



>ref|XP_009122282.1| PREDICTED: homeobox-leucine zipper protein HAT14 [Brassica rapa]
 emb|CDX70076.1| BnaA10g24250D [Brassica napus]
Length=340

 Score =   107 bits (268),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELRALK S PF MQLPATTLTMCP
Sbjct  241  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRALKTSSPFCMQLPATTLTMCP  297



>gb|KHG27543.1| Homeobox-leucine zipper HAT22 -like protein [Gossypium arboreum]
Length=281

 Score =   107 bits (266),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QPFYM +PA TLTMCP
Sbjct  188  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPFYMHMPAATLTMCP  244



>ref|XP_007047635.1| Homeodomain-leucine zipper protein HD4 [Theobroma cacao]
 gb|EOX91792.1| Homeodomain-leucine zipper protein HD4 [Theobroma cacao]
Length=284

 Score =   106 bits (265),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QPFYM +PA TLTMCP
Sbjct  192  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPFYMHMPAATLTMCP  248



>ref|XP_004166691.1| PREDICTED: homeobox-leucine zipper protein HAT14-like, partial 
[Cucumis sativus]
Length=372

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK +   YMQLPATTLTMCP
Sbjct  264  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKTTNSLYMQLPATTLTMCP  320



>ref|NP_195493.1| homeobox-leucine zipper protein HAT22 [Arabidopsis thaliana]
 sp|P46604.1|HAT22_ARATH RecName: Full=Homeobox-leucine zipper protein HAT22; AltName: 
Full=Homeodomain-leucine zipper protein HAT22; Short=HD-ZIP 
protein 22 [Arabidopsis thaliana]
 gb|AAA56902.1| homeobox protein [Arabidopsis thaliana]
 gb|AAA56903.1| homeobox protein [Arabidopsis thaliana]
 emb|CAB38927.1| homeobox protein HAT22 [Arabidopsis thaliana]
 emb|CAB80444.1| homeobox protein HAT22 [Arabidopsis thaliana]
 emb|CAD29653.1| homeodomain-leucine zipper protein HAT22 [Arabidopsis thaliana]
 gb|AAM65105.1| homeobox protein HAT22 [Arabidopsis thaliana]
 gb|AAN86151.1| putative homeobox protein HAT22 [Arabidopsis thaliana]
 gb|AEE86838.1| homeobox-leucine zipper protein HAT22 [Arabidopsis thaliana]
Length=278

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQ+L+ALK SQPFYM +PA TLTMCP
Sbjct  177  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKLSQPFYMHMPAATLTMCP  233



>ref|XP_009138531.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Brassica 
rapa]
Length=281

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQ+L+ALK SQPFYM +PA TLTMCP
Sbjct  175  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKMSQPFYMHMPAATLTMCP  231



>ref|XP_010531317.1| PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein 
HAT22-like [Tarenaya hassleriana]
Length=282

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QPFYM +PA TLTMCP
Sbjct  172  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPFYMHMPAATLTMCP  228



>ref|XP_002530591.1| homeobox protein, putative [Ricinus communis]
 gb|EEF31771.1| homeobox protein, putative [Ricinus communis]
Length=289

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QPFYM +PA TLTMCP
Sbjct  195  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPFYMHMPAATLTMCP  251



>gb|KDP32129.1| hypothetical protein JCGZ_12590 [Jatropha curcas]
Length=290

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QPFYM +PA TLTMCP
Sbjct  196  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPFYMHMPAATLTMCP  252



>ref|XP_006284261.1| hypothetical protein CARUB_v10005427mg [Capsella rubella]
 gb|EOA17159.1| hypothetical protein CARUB_v10005427mg [Capsella rubella]
Length=285

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQ+L+ALK SQPFYM +PA TLTMCP
Sbjct  178  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKLSQPFYMHMPAATLTMCP  234



>ref|XP_002868963.1| homeobox-leucine zipper protein 22 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45222.1| homeobox-leucine zipper protein 22 [Arabidopsis lyrata subsp. 
lyrata]
Length=283

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQ+L+ALK SQPFYM +PA TLTMCP
Sbjct  177  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKLSQPFYMHMPAATLTMCP  233



>ref|XP_008664503.1| PREDICTED: homeobox-leucine zipper protein HOX27-like [Zea mays]
 tpg|DAA48380.1| TPA: putative homeobox DNA-binding and leucine zipper domain 
family protein [Zea mays]
 gb|AIB04622.1| HB transcription factor, partial [Zea mays]
Length=448

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KEL ELRALK + PF+M+LPATTL+MCP
Sbjct  316  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELAELRALKTAPPFFMRLPATTLSMCP  372



>tpg|DAA48378.1| TPA: putative homeobox DNA-binding and leucine zipper domain 
family protein [Zea mays]
Length=293

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETLTEENRRL KEL ELRALK + PF+M+LPATTL+MCP
Sbjct  161  RTKLKQTEVDCEYLKRCCETLTEENRRLHKELAELRALKTAPPFFMRLPATTLSMCP  217



>ref|XP_010555437.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Tarenaya 
hassleriana]
Length=299

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QPFYM +PA TLTMCP
Sbjct  190  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPFYMHMPAATLTMCP  246



>emb|CDP02649.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QP YMQLPA TLTMCP
Sbjct  186  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPLYMQLPAATLTMCP  242



>ref|XP_010028050.1| PREDICTED: homeobox-leucine zipper protein HAT22 [Eucalyptus 
grandis]
 gb|KCW54711.1| hypothetical protein EUGRSUZ_I00660 [Eucalyptus grandis]
Length=264

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QPFYM +PA TLTMCP
Sbjct  167  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPFYMHMPAATLTMCP  223



>ref|XP_009408401.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Musa acuminata 
subsp. malaccensis]
Length=327

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYL+RCC+TLTEENRRLQKE+ ELRALK S+PFYM +PATTL+MCP
Sbjct  216  RTKLKQTEVDCEYLRRCCQTLTEENRRLQKEVAELRALKTSRPFYMHVPATTLSMCP  272



>gb|ACL27275.1| homeodomain leucine-zipper 1 [Capsicum annuum]
Length=272

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLTEENRRL KELQEL+ALK +QP YMQLPA TLTMCP
Sbjct  179  RTKLKQTEVDCEFLKKCCETLTEENRRLHKELQELKALKIAQPLYMQLPAATLTMCP  235



>emb|CDX69330.1| BnaC01g01230D [Brassica napus]
Length=282

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK SQPFYM +P  TLTMCP
Sbjct  178  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKMSQPFYMHMPRATLTMCP  234



>ref|XP_009392044.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCC+TLTEENRRLQKE+ ELRALK + PF+M LPATTL+MCP
Sbjct  194  RTKLKQTEVDCEYLKRCCQTLTEENRRLQKEVAELRALKTTHPFHMHLPATTLSMCP  250



>ref|XP_010432030.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Camelina 
sativa]
Length=282

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQ+L+ALK +QPFYM +PA TLTMCP
Sbjct  177  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKLAQPFYMHMPAATLTMCP  233



>ref|XP_010245638.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Nelumbo 
nucifera]
Length=282

 Score =   105 bits (261),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QP YMQLPA TLTMCP
Sbjct  189  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPLYMQLPAATLTMCP  245



>ref|XP_010936202.1| PREDICTED: homeobox-leucine zipper protein HOX19-like [Elaeis 
guineensis]
Length=276

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLT+ENRRLQKELQEL+ALK +QP YMQ PA TLTMCP
Sbjct  179  RTKLKQTEVDCEFLKRCCETLTDENRRLQKELQELKALKFAQPLYMQFPAATLTMCP  235



>ref|XP_006661294.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Oryza 
brachyantha]
Length=318

 Score =   105 bits (261),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCETL EE RRLQKEL ELRALK   PFYM LPATTL+MCP
Sbjct  217  RTKLKQTEVDCEYLKRCCETLAEETRRLQKELAELRALKTVHPFYMHLPATTLSMCP  273



>ref|XP_010446622.1| PREDICTED: homeobox-leucine zipper protein HAT22 [Camelina sativa]
Length=282

 Score =   104 bits (260),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQ+L+ALK +QPFYM +PA TLTMCP
Sbjct  177  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKLAQPFYMHMPAATLTMCP  233



>ref|XP_004170148.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Cucumis 
sativus]
Length=264

 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLT+ENRRLQKELQEL+ALK +QP +MQ+PA TLTMCP
Sbjct  167  RTKLKQTEVDCEFLKRCCETLTDENRRLQKELQELKALKLAQPLFMQMPAATLTMCP  223



>ref|XP_007218156.1| hypothetical protein PRUPE_ppa007421mg [Prunus persica]
 gb|EMJ19355.1| hypothetical protein PRUPE_ppa007421mg [Prunus persica]
Length=368

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 53/60 (88%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKA---SQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLTEENRRL KELQELRALK    S PFYMQ PATTLTMCP
Sbjct  261  RTKLKQTEVDCEFLKRCCETLTEENRRLHKELQELRALKTHHHSNPFYMQSPATTLTMCP  320



>ref|XP_009592889.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Nicotiana 
tomentosiformis]
Length=272

 Score =   104 bits (260),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLTEENRRL KELQEL+A+K +QP YMQLPA TLTMCP
Sbjct  180  RTKLKQTEVDCEFLKKCCETLTEENRRLHKELQELKAVKIAQPLYMQLPAATLTMCP  236



>ref|XP_008440442.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Cucumis 
melo]
Length=264

 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLT+ENRRLQKELQEL+ALK +QP +MQ+PA TLTMCP
Sbjct  167  RTKLKQTEVDCEFLKRCCETLTDENRRLQKELQELKALKLAQPLFMQMPAATLTMCP  223



>ref|XP_004143421.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Cucumis 
sativus]
 gb|KGN48647.1| Homeobox-leucine zipper protein [Cucumis sativus]
Length=264

 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLT+ENRRLQKELQEL+ALK +QP +MQ+PA TLTMCP
Sbjct  167  RTKLKQTEVDCEFLKRCCETLTDENRRLQKELQELKALKLAQPLFMQMPAATLTMCP  223



>ref|XP_007162339.1| hypothetical protein PHAVU_001G143500g [Phaseolus vulgaris]
 gb|ESW34333.1| hypothetical protein PHAVU_001G143500g [Phaseolus vulgaris]
Length=337

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEEN+RLQKELQELRALK  +PF+ QLPATTLTMCP
Sbjct  235  RTKLKQTEVDCEYLKRCCESLTEENKRLQKELQELRALKTCEPFFKQLPATTLTMCP  291



>ref|XP_009133094.1| PREDICTED: homeobox-leucine zipper protein HAT22 [Brassica rapa]
 emb|CDY67919.1| BnaA01g34550D [Brassica napus]
Length=282

 Score =   104 bits (260),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQ+L+ALK SQPFYM +P  TLTMCP
Sbjct  178  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKMSQPFYMHIPPATLTMCP  234



>ref|XP_007205679.1| hypothetical protein PRUPE_ppa009614mg [Prunus persica]
 ref|XP_008237058.1| PREDICTED: homeobox-leucine zipper protein HAT22 [Prunus mume]
 gb|EMJ06878.1| hypothetical protein PRUPE_ppa009614mg [Prunus persica]
Length=285

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK SQP YM +PA TLTMCP
Sbjct  192  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLSQPLYMHMPAATLTMCP  248



>ref|XP_010437184.1| PREDICTED: homeobox-leucine zipper protein HAT22 [Camelina sativa]
Length=282

 Score =   104 bits (259),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQ+L+ALK +QPFYM +PA TLTMCP
Sbjct  177  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKLAQPFYMHMPAATLTMCP  233



>ref|XP_009365044.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Pyrus 
x bretschneideri]
Length=368

 Score =   105 bits (261),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 54/60 (90%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKA---SQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLTEENRRL KELQELRALKA   S PFYMQ PATTLT+CP
Sbjct  247  RTKLKQTEVDCEFLKRCCETLTEENRRLNKELQELRALKATHHSNPFYMQSPATTLTLCP  306



>ref|XP_004231956.1| PREDICTED: homeobox-leucine zipper protein HAT22 [Solanum lycopersicum]
Length=268

 Score =   104 bits (259),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRL KELQEL+ALK +QP YMQLPA TLTMCP
Sbjct  175  RTKLKQTEVDCEFLKKCCETLTDENRRLHKELQELKALKIAQPLYMQLPAATLTMCP  231



>ref|XP_002307302.2| Homeobox-leucine zipper protein HAT9 [Populus trichocarpa]
 gb|EEE94298.2| Homeobox-leucine zipper protein HAT9 [Populus trichocarpa]
Length=266

 Score =   103 bits (258),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCE LT+ENRRLQKELQEL+ALK +QPFYM +PA TLTMCP
Sbjct  174  RTKLKQTEVDCEFLKKCCEALTDENRRLQKELQELKALKLAQPFYMHMPAATLTMCP  230



>ref|XP_008350188.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform 
X1 [Malus domestica]
Length=373

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 54/60 (90%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKA---SQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLTEENRRL KELQELRALKA   S PFYMQ PATTLT+CP
Sbjct  252  RTKLKQTEVDCEFLKRCCETLTEENRRLNKELQELRALKATHHSNPFYMQSPATTLTLCP  311



>ref|XP_010647310.1| PREDICTED: homeobox-leucine zipper protein HAT22 isoform X3 [Vitis 
vinifera]
 ref|XP_010647311.1| PREDICTED: homeobox-leucine zipper protein HAT22 isoform X4 [Vitis 
vinifera]
Length=271

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCE+LT+ENRRLQKELQEL+ALK +QP YMQLPA TLTMCP
Sbjct  179  RTKLKQTEVDCEFLKKCCESLTDENRRLQKELQELKALKLAQPLYMQLPAATLTMCP  235



>ref|XP_006363789.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Solanum 
tuberosum]
Length=266

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLTEENRRL KEL EL+ALK +QP YMQLPA TLTMCP
Sbjct  173  RTKLKQTEVDCEFLKKCCETLTEENRRLHKELHELKALKIAQPLYMQLPAATLTMCP  229



>gb|ABK21195.1| unknown [Picea sitchensis]
Length=309

 Score =   104 bits (259),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE+LT+ENRRLQKELQELRALK + P YMQ+PA TLTMCP
Sbjct  220  RTKLKQTEVDCEFLKRCCESLTDENRRLQKELQELRALKLASPLYMQMPAATLTMCP  276



>emb|CBI41059.3| unnamed protein product [Vitis vinifera]
Length=266

 Score =   103 bits (258),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCE+LT+ENRRLQKELQEL+ALK +QP YMQLPA TLTMCP
Sbjct  174  RTKLKQTEVDCEFLKKCCESLTDENRRLQKELQELKALKLAQPLYMQLPAATLTMCP  230



>gb|ADN88095.1| homeodomain-leucine zipper protein HD4 [Gossypium hirsutum]
 gb|KHF97850.1| Homeobox-leucine zipper HAT22 -like protein [Gossypium arboreum]
Length=281

 Score =   103 bits (258),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 55/58 (95%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK-ASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK A+QPFYM +PA TLTMCP
Sbjct  188  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAAQPFYMHMPAATLTMCP  245



>gb|KFK30389.1| hypothetical protein AALP_AA7G254600 [Arabis alpina]
Length=286

 Score =   103 bits (258),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQ+L+AL+ SQPFYM +PA TLTMCP
Sbjct  177  RTKLKQTEVDCEHLKKCCETLTDENRRLQKELQDLKALRLSQPFYMHMPAATLTMCP  233



>ref|XP_011099420.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Sesamum 
indicum]
Length=269

 Score =   103 bits (258),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLTEENRRLQKELQE +ALK +QP YMQLPA TLTMCP
Sbjct  173  RTKLKQTEVDCEFLKKCCETLTEENRRLQKELQEPKALKLTQPLYMQLPAATLTMCP  229



>ref|XP_010647309.1| PREDICTED: homeobox-leucine zipper protein HAT22 isoform X1 [Vitis 
vinifera]
Length=284

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCE+LT+ENRRLQKELQEL+ALK +QP YMQLPA TLTMCP
Sbjct  192  RTKLKQTEVDCEFLKKCCESLTDENRRLQKELQELKALKLAQPLYMQLPAATLTMCP  248



>ref|XP_008790281.1| PREDICTED: homeobox-leucine zipper protein HAT9-like [Phoenix 
dactylifera]
Length=277

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETL +ENRRLQKELQEL+ALK + PFYMQ PA TLTMCP
Sbjct  179  RTKLKQTEVDCEFLKRCCETLRDENRRLQKELQELKALKFAHPFYMQFPAATLTMCP  235



>ref|XP_002271511.2| PREDICTED: homeobox-leucine zipper protein HAT22 isoform X2 [Vitis 
vinifera]
 emb|CAN60988.1| hypothetical protein VITISV_022980 [Vitis vinifera]
Length=283

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCE+LT+ENRRLQKELQEL+ALK +QP YMQLPA TLTMCP
Sbjct  191  RTKLKQTEVDCEFLKKCCESLTDENRRLQKELQELKALKLAQPLYMQLPAATLTMCP  247



>ref|XP_006848871.1| hypothetical protein AMTR_s00026p00233150 [Amborella trichopoda]
 gb|ERN10452.1| hypothetical protein AMTR_s00026p00233150 [Amborella trichopoda]
Length=271

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLT+ENRRLQKELQEL+ALK + P YMQLPA TLTMCP
Sbjct  182  RTKLKQTEVDCEFLKRCCETLTDENRRLQKELQELKALKFASPVYMQLPAATLTMCP  238



>ref|XP_009354678.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Pyrus 
x bretschneideri]
Length=369

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 53/60 (88%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKA---SQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLTEENRRL KELQELRALKA   S PF MQ PATTLTMCP
Sbjct  248  RTKLKQTEVDCEFLKRCCETLTEENRRLNKELQELRALKATHHSNPFSMQSPATTLTMCP  307



>ref|XP_008375131.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Malus 
domestica]
Length=370

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 53/60 (88%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKA---SQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLTEENRRL KELQELRALKA   S PF MQ PATTLTMCP
Sbjct  249  RTKLKQTEVDCEFLKRCCETLTEENRRLNKELQELRALKATHHSNPFSMQSPATTLTMCP  308



>ref|XP_009775231.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Nicotiana 
sylvestris]
Length=264

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CC TLTEENRRL KELQEL+A+K +QP YMQLPA TLTMCP
Sbjct  172  RTKLKQTEVDCEFLKKCCATLTEENRRLHKELQELKAVKIAQPLYMQLPAATLTMCP  228



>ref|XP_004973642.1| PREDICTED: homeobox-leucine zipper protein HOX27-like [Setaria 
italica]
Length=360

 Score =   103 bits (256),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 49/57 (86%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE LTEENRRL KEL ELRALK + PFYM LPATTL+MCP
Sbjct  227  RTKLKQTEVDCEYLKRCCEALTEENRRLHKELAELRALKTAPPFYMHLPATTLSMCP  283



>ref|XP_002310877.2| hypothetical protein POPTR_0007s14590g [Populus trichocarpa]
 gb|EEE91327.2| hypothetical protein POPTR_0007s14590g [Populus trichocarpa]
Length=273

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTE+DCE+LK+CCETLT+ENRRLQKELQ+L++LK +QPFYM +PA TLTMCP
Sbjct  181  RTKLKQTEMDCEFLKKCCETLTDENRRLQKELQDLKSLKMAQPFYMHMPAATLTMCP  237



>ref|XP_010248307.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Nelumbo 
nucifera]
Length=370

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCE+LT+ENRRL+KELQEL+ALK +QP YMQLPA TLTMCP
Sbjct  277  RTKLKQTEVDCEFLKKCCESLTDENRRLKKELQELKALKLAQPLYMQLPAATLTMCP  333



>ref|XP_011031336.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Populus 
euphratica]
Length=273

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTE+DCE+LK+CCETLT+ENRRLQKELQ+L++LK +QPFYM +PA TLTMCP
Sbjct  181  RTKLKQTEMDCEFLKKCCETLTDENRRLQKELQDLKSLKMAQPFYMHMPAATLTMCP  237



>ref|XP_008245761.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform 
X2 [Prunus mume]
Length=367

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 52/60 (87%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKA---SQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLTEENRRL KELQELRALK    S PFY Q PATTLTMCP
Sbjct  257  RTKLKQTEVDCEFLKRCCETLTEENRRLHKELQELRALKTHHHSNPFYTQSPATTLTMCP  316



>gb|ABK24536.1| unknown [Picea sitchensis]
Length=358

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQP-FYMQLPATTLTMCP  1
            RTKLKQTEVDCEYLKRC ETLTEENRRLQK++QELRALK + P FYM LPATTLTMCP
Sbjct  249  RTKLKQTEVDCEYLKRCYETLTEENRRLQKDIQELRALKVAHPSFYMHLPATTLTMCP  306



>ref|XP_008245760.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform 
X1 [Prunus mume]
Length=368

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 52/60 (87%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKA---SQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLTEENRRL KELQELRALK    S PFY Q PATTLTMCP
Sbjct  258  RTKLKQTEVDCEFLKRCCETLTEENRRLHKELQELRALKTHHHSNPFYTQSPATTLTMCP  317



>ref|XP_009354594.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Pyrus 
x bretschneideri]
 ref|XP_009354595.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Pyrus 
x bretschneideri]
Length=289

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKEL EL+ALK SQP YM +PA TLTMCP
Sbjct  196  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELIELKALKLSQPLYMHMPAATLTMCP  252



>ref|XP_006426160.1| hypothetical protein CICLE_v10026197mg [Citrus clementina]
 gb|ESR39400.1| hypothetical protein CICLE_v10026197mg [Citrus clementina]
 gb|KDO78798.1| hypothetical protein CISIN_1g022713mg [Citrus sinensis]
Length=293

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRL KELQEL+ALK +QP YM +PA TLTMCP
Sbjct  200  RTKLKQTEVDCEFLKKCCETLTDENRRLHKELQELKALKLAQPLYMHMPAATLTMCP  256



>ref|NP_001280933.1| homeobox-leucine zipper protein HAT22-like [Malus domestica]
 gb|ADL36706.1| HD domain class transcription factor [Malus domestica]
Length=289

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QP YM +P  TLTMCP
Sbjct  196  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLNQPLYMHMPTATLTMCP  252



>ref|XP_006466408.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Citrus 
sinensis]
Length=293

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRL KELQEL+ALK +QP YM +PA TLTMCP
Sbjct  200  RTKLKQTEVDCEFLKKCCETLTDENRRLHKELQELKALKLAQPLYMHMPAATLTMCP  256



>ref|XP_003549995.1| PREDICTED: homeobox-leucine zipper protein HAT22 [Glycine max]
 gb|KHN01720.1| Homeobox-leucine zipper protein HAT22 [Glycine soja]
Length=312

 Score =   102 bits (253),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QP YM +PA TLTMCP
Sbjct  216  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPLYMPMPAATLTMCP  272



>gb|ACU23516.1| unknown [Glycine max]
Length=312

 Score =   102 bits (253),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QP YM +PA TLTMCP
Sbjct  216  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPLYMPMPAATLTMCP  272



>ref|XP_009338969.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Pyrus 
x bretschneideri]
Length=289

 Score =   101 bits (252),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QP YM +P  TLTMCP
Sbjct  196  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLNQPLYMHMPTATLTMCP  252



>gb|KHN13024.1| Homeobox-leucine zipper protein HAT22 [Glycine soja]
Length=169

 Score = 99.4 bits (246),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRL+KELQEL+ALK +QP YM +PA TLTMCP
Sbjct  76   RTKLKQTEVDCEFLKKCCETLTDENRRLKKELQELKALKLAQPLYMPMPAATLTMCP  132



>ref|XP_010099404.1| Homeobox-leucine zipper protein HAT22 [Morus notabilis]
 gb|EXB78249.1| Homeobox-leucine zipper protein HAT22 [Morus notabilis]
Length=315

 Score =   101 bits (252),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRL KELQEL+ALK +QP YM +PA TLTMCP
Sbjct  218  RTKLKQTEVDCEFLKKCCETLTDENRRLHKELQELKALKLAQPLYMHMPAATLTMCP  274



>ref|XP_011073661.1| PREDICTED: homeobox-leucine zipper protein HAT22-like isoform 
X2 [Sesamum indicum]
Length=242

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQ-PFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +Q P YMQLPA TLTMCP
Sbjct  151  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQTPLYMQLPAATLTMCP  208



>ref|XP_004509044.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Cicer 
arietinum]
Length=288

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKE+QEL+ALK +QP YM +PA TLTMCP
Sbjct  194  RTKLKQTEVDCEFLKKCCETLTDENRRLQKEVQELKALKLTQPLYMPMPAATLTMCP  250



>ref|XP_011073660.1| PREDICTED: homeobox-leucine zipper protein HAT22-like isoform 
X1 [Sesamum indicum]
Length=269

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQ-PFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +Q P YMQLPA TLTMCP
Sbjct  178  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQTPLYMQLPAATLTMCP  235



>emb|CDP10005.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  193  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  250



>gb|ACL27274.1| homeodomain leucine-zipper 1 [Nicotiana benthamiana]
Length=263

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE LK+CCETLTEENRRL KELQEL+A+K +QP YMQ PA TLTMCP
Sbjct  171  RTKLKQTEVDCEILKKCCETLTEENRRLHKELQELKAVKIAQPLYMQRPAATLTMCP  227



>gb|KHN47559.1| Homeobox-leucine zipper protein HAT22 [Glycine soja]
Length=311

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QP YM +PA TL MCP
Sbjct  215  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPLYMPMPAATLAMCP  271



>ref|XP_009109392.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Brassica 
rapa]
Length=270

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQ+L+ALK SQPFYM +P  TL +CP
Sbjct  174  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKMSQPFYMHMPPATLMVCP  230



>ref|XP_003539237.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Glycine 
max]
Length=283

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRL+KELQEL+ALK +QP YM +PA TLTMCP
Sbjct  190  RTKLKQTEVDCEFLKKCCETLTDENRRLKKELQELKALKLAQPLYMPMPAATLTMCP  246



>gb|ACU24595.1| unknown [Glycine max]
Length=283

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRL+KELQEL+ALK +QP YM +PA TLTMCP
Sbjct  190  RTKLKQTEVDCEFLKKCCETLTDENRRLKKELQELKALKLAQPLYMPMPAATLTMCP  246



>gb|KHN36326.1| Homeobox-leucine zipper protein HAT22 [Glycine soja]
Length=283

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRL+KELQEL+ALK +QP YM +PA TLTMCP
Sbjct  190  RTKLKQTEVDCEFLKKCCETLTDENRRLKKELQELKALKLAQPLYMPMPAATLTMCP  246



>ref|XP_010055469.1| PREDICTED: homeobox-leucine zipper protein HAT4-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW71941.1| hypothetical protein EUGRSUZ_E00400 [Eucalyptus grandis]
Length=312

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE+QELRALK S  FYM L P TTLTMCP
Sbjct  202  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVQELRALKLSPQFYMHLSPPTTLTMCP  259



>gb|KHG24226.1| Homeobox-leucine zipper HAT22 -like protein [Gossypium arboreum]
Length=287

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK-ASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LKRCCETLT ENRRLQKELQELR+LK A+QPF M +PA TLTMCP
Sbjct  193  RTKLKQTEVDCEFLKRCCETLTNENRRLQKELQELRSLKTAAQPFCMNMPAATLTMCP  250



>ref|XP_010055468.1| PREDICTED: homeobox-leucine zipper protein HAT4-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW71942.1| hypothetical protein EUGRSUZ_E00400 [Eucalyptus grandis]
Length=318

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE+LTEENRRLQKE+QELRALK S  FYM L P TTLTMCP
Sbjct  208  RTKLKQTEVDCEYLKRCCESLTEENRRLQKEVQELRALKLSPQFYMHLSPPTTLTMCP  265



>ref|XP_007156684.1| hypothetical protein PHAVU_002G008600g [Phaseolus vulgaris]
 gb|ESW28678.1| hypothetical protein PHAVU_002G008600g [Phaseolus vulgaris]
Length=292

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRL+KELQEL+ALK +QP YM +PA TLTMCP
Sbjct  199  RTKLKQTEVDCEFLKKCCETLTDENRRLKKELQELKALKLTQPLYMPMPAATLTMCP  255



>emb|CDY60301.1| BnaAnng16680D [Brassica napus]
Length=270

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQT+VDCE+LK+CCETLT+ENRRLQKELQ+L+ALK SQPFYM +P  TL +CP
Sbjct  174  RTKLKQTDVDCEFLKKCCETLTDENRRLQKELQDLKALKMSQPFYMHMPPATLMVCP  230



>dbj|BAB18169.1| homeobox-leucine zipper protein [Zinnia elegans]
Length=110

 Score = 95.9 bits (237),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKELQEL+ALK S  FYMQ+ P TTLTMCP
Sbjct  10   RTKLKQTEVDCEFLKRCCENLTEENRRLQKELQELKALKLSPQFYMQMAPPTTLTMCP  67



>ref|XP_011008396.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Populus 
euphratica]
Length=292

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCE L +EN RLQKELQEL+ALK +QPFYM +PA TLTMCP
Sbjct  200  RTKLKQTEVDCEFLKKCCEALKDENGRLQKELQELKALKLAQPFYMHMPAATLTMCP  256



>ref|XP_011008397.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Populus 
euphratica]
Length=292

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCE L +EN RLQKELQEL+ALK +QPFYM +PA TLTMCP
Sbjct  200  RTKLKQTEVDCEFLKKCCEALKDENGRLQKELQELKALKLAQPFYMHMPAATLTMCP  256



>ref|XP_002968858.1| hypothetical protein SELMODRAFT_6792, partial [Selaginella moellendorffii]
 ref|XP_002974113.1| hypothetical protein SELMODRAFT_6791, partial [Selaginella moellendorffii]
 gb|EFJ25068.1| hypothetical protein SELMODRAFT_6791, partial [Selaginella moellendorffii]
 gb|EFJ29974.1| hypothetical protein SELMODRAFT_6792, partial [Selaginella moellendorffii]
Length=140

 Score = 96.3 bits (238),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 52/63 (83%), Gaps = 6/63 (10%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKA------SQPFYMQLPATTLT  10
            RTKLKQTE+DCE LKRCCETLTEENRRLQKELQELRA+K       SQ FYM LPA TLT
Sbjct  66   RTKLKQTEIDCELLKRCCETLTEENRRLQKELQELRAIKVPPPCVISQDFYMPLPAATLT  125

Query  9    MCP  1
            MCP
Sbjct  126  MCP  128



>emb|CAA64491.1| homeobox-leucine zipper protein [Spuriopimpinella brachycarpa]
Length=318

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCC+TLTEENR+LQKE+QELRALK+S  FYMQ+ P TTLTMCP
Sbjct  203  RTKLKQTEVDCEFLKRCCQTLTEENRKLQKEVQELRALKSSPQFYMQMTPPTTLTMCP  260



>gb|KEH31546.1| homeobox associated leucine zipper protein [Medicago truncatula]
Length=271

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLTEENRRLQKE+QEL+ALK  +P YM +PA TLTMCP
Sbjct  178  RTKLKQTEVDCEFLKKCCETLTEENRRLQKEVQELKALKLVKPLYMPMPAATLTMCP  234



>ref|XP_006368991.1| homeobox-leucine zipper family protein [Populus trichocarpa]
 gb|ERP65560.1| homeobox-leucine zipper family protein [Populus trichocarpa]
Length=302

 Score = 99.4 bits (246),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  189  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  246



>ref|XP_006411852.1| hypothetical protein EUTSA_v10025923mg [Eutrema salsugineum]
 gb|ESQ53305.1| hypothetical protein EUTSA_v10025923mg [Eutrema salsugineum]
Length=284

 Score = 99.0 bits (245),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE LK+CCETLT+ENRRLQKELQ+L+ALK   PFYM +PA TLTMCP
Sbjct  178  RTKLKQTEVDCELLKKCCETLTDENRRLQKELQDLKALKMPPPFYMHMPAATLTMCP  234



>emb|CAA64152.1| homeobox-leucine zipper protein [Spuriopimpinella brachycarpa]
Length=319

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCC+TLTEENR+LQKE+QELRALK+S  FYMQ+ P TTLTMCP
Sbjct  204  RTKLKQTEVDCEFLKRCCQTLTEENRKLQKEVQELRALKSSPQFYMQMTPPTTLTMCP  261



>gb|ADN88093.1| homeodomain-leucine zipper protein HD2 [Gossypium hirsutum]
Length=300

 Score = 99.0 bits (245),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  192  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  249



>ref|XP_011047615.1| PREDICTED: homeobox-leucine zipper protein HAT4 [Populus euphratica]
Length=303

 Score = 99.0 bits (245),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  189  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  246



>gb|EYU42259.1| hypothetical protein MIMGU_mgv1a022171mg [Erythranthe guttata]
Length=412

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 2/58 (3%)
 Frame = -3

Query  168  TKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALK--ASQPFYMQLPATTLTMCP  1
            TKLKQTEVDCEYLKRCCETLT ENRRL KE+QELRALK  ++ PFY QLPATTLTMCP
Sbjct  298  TKLKQTEVDCEYLKRCCETLTVENRRLHKEVQELRALKTTSNNPFYTQLPATTLTMCP  355



>ref|XP_007155789.1| hypothetical protein PHAVU_003G232000g [Phaseolus vulgaris]
 gb|ESW27783.1| hypothetical protein PHAVU_003G232000g [Phaseolus vulgaris]
Length=299

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKELQEL+ALK +QP YM + A TLTMCP
Sbjct  205  RTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALKLAQPLYMPMSAATLTMCP  261



>gb|KDP39909.1| hypothetical protein JCGZ_03440 [Jatropha curcas]
Length=293

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  181  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  238



>ref|XP_007209368.1| hypothetical protein PRUPE_ppa008774mg [Prunus persica]
 gb|EMJ10567.1| hypothetical protein PRUPE_ppa008774mg [Prunus persica]
Length=319

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  201  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  258



>ref|XP_009342095.1| PREDICTED: homeobox-leucine zipper protein HAT4-like [Pyrus x 
bretschneideri]
 ref|XP_009350888.1| PREDICTED: homeobox-leucine zipper protein HAT4-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009350889.1| PREDICTED: homeobox-leucine zipper protein HAT4-like isoform 
X2 [Pyrus x bretschneideri]
Length=311

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  197  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  254



>ref|XP_004301172.1| PREDICTED: homeobox-leucine zipper protein HAT4-like [Fragaria 
vesca subsp. vesca]
Length=317

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  194  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  251



>ref|XP_008345345.1| PREDICTED: homeobox-leucine zipper protein HAT4-like [Malus domestica]
 ref|XP_008363788.1| PREDICTED: homeobox-leucine zipper protein HAT4-like [Malus domestica]
Length=310

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  201  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  258



>ref|XP_007039762.1| Homeobox-leucine zipper protein 4 / HD-ZIP protein [Theobroma 
cacao]
 gb|EOY24263.1| Homeobox-leucine zipper protein 4 / HD-ZIP protein [Theobroma 
cacao]
Length=300

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  190  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  247



>ref|XP_008238430.1| PREDICTED: homeobox-leucine zipper protein HAT4 [Prunus mume]
Length=311

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  197  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  254



>gb|KDP41563.1| hypothetical protein JCGZ_15970 [Jatropha curcas]
Length=271

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE LK+CCETLTEEN+RLQKELQEL++LK + P YMQLPA TLTMCP
Sbjct  173  RTKLKQTEVDCELLKKCCETLTEENKRLQKELQELKSLKLTAPLYMQLPAATLTMCP  229



>gb|KHG14441.1| Homeobox-leucine zipper HAT4 -like protein [Gossypium arboreum]
Length=290

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  178  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMNPPTTLTMCP  235



>ref|XP_006440251.1| hypothetical protein CICLE_v10021374mg [Citrus clementina]
 gb|ESR53491.1| hypothetical protein CICLE_v10021374mg [Citrus clementina]
Length=299

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  185  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  242



>ref|XP_009589459.1| PREDICTED: homeobox-leucine zipper protein HAT4-like [Nicotiana 
tomentosiformis]
Length=288

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  188  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  245



>ref|XP_006477139.1| PREDICTED: homeobox-leucine zipper protein HAT4-like [Citrus 
sinensis]
Length=299

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  185  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  242



>gb|KHN34515.1| Homeobox-leucine zipper protein HAT4 [Glycine soja]
Length=126

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCEYLKRCCE LTEENRRLQKE+QELRALK S   YMQ+ P TTLTMCP
Sbjct  15   RTKLKQTEVDCEYLKRCCENLTEENRRLQKEVQELRALKLSPQLYMQMNPPTTLTMCP  72



>ref|XP_008798887.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Phoenix 
dactylifera]
Length=262

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTE DCE LKRCCETL++ENRRL+KEL ELRALK++ P YMQ PA  LTMCP
Sbjct  170  RTKLKQTEFDCEVLKRCCETLSDENRRLKKELHELRALKSASPLYMQFPAAALTMCP  226



>ref|XP_006359253.1| PREDICTED: homeobox-leucine zipper protein HAT4-like [Solanum 
tuberosum]
Length=276

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  178  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  235



>gb|AEW08278.1| hypothetical protein 2_5173_01, partial [Pinus radiata]
 gb|AFG58027.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58028.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58029.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58030.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58031.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58032.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58033.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58034.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58035.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58036.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58037.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58038.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58039.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58040.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58041.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
 gb|AFG58042.1| hypothetical protein 2_5173_01, partial [Pinus taeda]
Length=133

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 54/65 (83%), Gaps = 8/65 (12%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKAS-QP-------FYMQLPATT  16
            RTKLKQTEVDCE LKRCCE LTEENRRLQKELQELRALKA+ QP       +YM LPATT
Sbjct  44   RTKLKQTEVDCEVLKRCCENLTEENRRLQKELQELRALKAAPQPCVIGQDNYYMPLPATT  103

Query  15   LTMCP  1
            LTMCP
Sbjct  104  LTMCP  108



>ref|XP_003517364.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Glycine 
max]
Length=283

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETL +ENRRL+KELQEL+ALK +QP YM +PA TLTMCP
Sbjct  190  RTKLKQTEVDCEFLKKCCETLKDENRRLKKELQELKALKLAQPLYMPMPAATLTMCP  246



>gb|EYU19287.1| hypothetical protein MIMGU_mgv1a010069mg [Erythranthe guttata]
Length=323

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  203  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  260



>gb|AET83222.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83233.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83250.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83254.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83257.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
Length=123

 Score = 94.7 bits (234),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 54/65 (83%), Gaps = 8/65 (12%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKAS-QP-------FYMQLPATT  16
            RTKLKQTEVDCE LKRCCE LTEENRRLQKELQELRALKA+ QP       +YM LPATT
Sbjct  39   RTKLKQTEVDCEVLKRCCENLTEENRRLQKELQELRALKAAPQPCVIGQDNYYMPLPATT  98

Query  15   LTMCP  1
            LTMCP
Sbjct  99   LTMCP  103



>ref|XP_004245792.1| PREDICTED: homeobox-leucine zipper protein HAT4-like [Solanum 
lycopersicum]
Length=280

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQL-PATTLTMCP  1
            RTKLKQTEVDCE+LKRCCE LTEENRRLQKE+QELRALK S  FYMQ+ P TTLTMCP
Sbjct  182  RTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCP  239



>gb|AET83216.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83217.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83218.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83219.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83220.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83221.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83223.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83224.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83225.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83226.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83227.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83228.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83229.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83230.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83231.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83232.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83234.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83235.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83236.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83237.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83238.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83239.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83240.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83241.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83242.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83243.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83244.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83245.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83246.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83247.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83248.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83249.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83251.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83252.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83253.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83255.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83256.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83258.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83259.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83260.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83261.1| hypothetical protein, partial [Pinus contorta var. bolanderi]
 gb|AET83262.1| hypothetical protein, partial [Pinus contorta var. murrayana]
 gb|AET83263.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83264.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83265.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83266.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83267.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83268.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83269.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83270.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83271.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83272.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83273.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83274.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83275.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83276.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83277.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83278.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83279.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83280.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83281.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83282.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83283.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83284.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83285.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83286.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83287.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83288.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83289.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83290.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83291.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83292.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83293.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83294.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83295.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83296.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83297.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83298.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83299.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83300.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83301.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83302.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83303.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83304.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83305.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83306.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83307.1| hypothetical protein, partial [Pinus contorta subsp. contorta]
 gb|AET83308.1| hypothetical protein, partial [Pinus contorta var. murrayana]
Length=123

 Score = 94.7 bits (234),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 54/65 (83%), Gaps = 8/65 (12%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKAS-QP-------FYMQLPATT  16
            RTKLKQTEVDCE LKRCCE LTEENRRLQKELQELRALKA+ QP       +YM LPATT
Sbjct  39   RTKLKQTEVDCEVLKRCCENLTEENRRLQKELQELRALKAAPQPCVMGQDNYYMPLPATT  98

Query  15   LTMCP  1
            LTMCP
Sbjct  99   LTMCP  103



>ref|XP_004288289.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Fragaria 
vesca subsp. vesca]
Length=277

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 53/59 (90%), Gaps = 2/59 (3%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKAS--QPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRLQKE+QEL+ALK S  QP +M +PA TLTMCP
Sbjct  181  RTKLKQTEVDCEFLKKCCETLTDENRRLQKEVQELKALKLSQQQPLFMHMPAATLTMCP  239



>gb|ACJ84212.1| unknown [Medicago truncatula]
Length=269

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKASQPFYMQLPATTLTMCP  1
            RTKLKQTEVDCE+LK+CCETLT+ENRRL+KELQEL++LK +QP YM +PA TL++CP
Sbjct  173  RTKLKQTEVDCEFLKKCCETLTDENRRLKKELQELKSLKVAQPLYMPMPAATLSICP  229



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507510111836