BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22712_g2_i2 len=2995 path=[1:0-629 7656:630-1658 8685:1659-2108
2128:2109-2134 11026:2135-2219 2239:2220-2247 11287:2248-2293
9654:2294-2378 2398:2379-2414 10316:2415-2603 9268:2604-2994]

Length=2995
                                                                      Score     E

ref|XP_011087754.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1104   0.0      
emb|CDO97548.1|  unnamed protein product                               1101   0.0      
ref|XP_009800012.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1092   0.0      
ref|XP_006349377.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1086   0.0      
ref|XP_009621865.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1082   0.0      
ref|XP_004230495.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1073   0.0      
ref|XP_011092347.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1071   0.0      
ref|XP_010314775.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1068   0.0      
ref|XP_004299942.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1033   0.0      
ref|XP_011005207.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1031   0.0      
ref|XP_002270419.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1028   0.0      Vitis vinifera
gb|EYU26541.1|  hypothetical protein MIMGU_mgv1a001773mg               1025   0.0      
ref|XP_010657695.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1023   0.0      
ref|XP_010657699.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1018   0.0      
ref|XP_002298172.1|  phosphatidylinositol-4-phosphate 5-kinase fa...   1012   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007225243.1|  hypothetical protein PRUPE_ppa001726mg            1002   0.0      
ref|XP_008218794.1|  PREDICTED: phosphatidylinositol 4-phosphate ...   1001   0.0      
ref|XP_006471081.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    999   0.0      
ref|XP_010030104.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    998   0.0      
ref|XP_006431885.1|  hypothetical protein CICLE_v10000342mg             998   0.0      
ref|XP_002529289.1|  phosphatidylinositol-4-phosphate 5-kinase, p...    995   0.0      Ricinus communis
ref|XP_011006535.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    990   0.0      
ref|XP_010030102.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    989   0.0      
ref|XP_008339353.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    989   0.0      
gb|KDP38876.1|  hypothetical protein JCGZ_05033                         988   0.0      
gb|KHN48102.1|  Phosphatidylinositol-4-phosphate 5-kinase 7             986   0.0      
ref|XP_006585224.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    983   0.0      
ref|XP_006580229.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    983   0.0      
ref|XP_011006533.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    983   0.0      
ref|XP_006597317.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    980   0.0      
gb|KHN06500.1|  Phosphatidylinositol-4-phosphate 5-kinase 7             979   0.0      
ref|XP_003531303.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    979   0.0      
ref|XP_008449413.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    977   0.0      
ref|XP_010533934.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    976   0.0      
gb|KHG21070.1|  Phosphatidylinositol-4-phosphate 5-kinase 8             976   0.0      
ref|XP_008449410.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    976   0.0      
ref|XP_007148509.1|  hypothetical protein PHAVU_006G214700g             976   0.0      
gb|KHG13183.1|  Phosphatidylinositol-4-phosphate 5-kinase 8 -like...    974   0.0      
ref|XP_007148510.1|  hypothetical protein PHAVU_006G214700g             973   0.0      
gb|KHN33459.1|  Phosphatidylinositol-4-phosphate 5-kinase 8             968   0.0      
ref|XP_010681797.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    967   0.0      
ref|XP_007159587.1|  hypothetical protein PHAVU_002G250000g             967   0.0      
ref|XP_010103902.1|  Phosphatidylinositol-4-phosphate 5-kinase 8        966   0.0      
ref|XP_006585481.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    963   0.0      
ref|XP_010547556.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    962   0.0      
ref|XP_007041490.1|  Phosphatidylinositol-4-phosphate 5-kinase fa...    959   0.0      
gb|KEH20716.1|  phosphatidylinositol-4-phosphate 5-kinase family ...    952   0.0      
ref|XP_004504180.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    951   0.0      
ref|XP_003629980.1|  Phosphatidylinositol-4-phosphate 5-kinase          951   0.0      
ref|XP_009355209.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    951   0.0      
ref|XP_004504179.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    948   0.0      
ref|XP_009355207.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    943   0.0      
gb|KCW57068.1|  hypothetical protein EUGRSUZ_I02724                     942   0.0      
emb|CDY40487.1|  BnaC09g14450D                                          941   0.0      
ref|XP_009113176.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    939   0.0      
emb|CDY12865.1|  BnaA09g14090D                                          938   0.0      
gb|AAG51639.1|AC018908_5  putative phosphatidylinositol-4-phospha...    936   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006385216.1|  hypothetical protein POPTR_0003s01350g             934   0.0      
ref|NP_176286.2|  phosphatidylinositol-4-phosphate 5-kinase 8           934   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185275.1|  phosphatidylinositol-4-phosphate 5-kinase 8        933   0.0      
ref|XP_006306825.1|  hypothetical protein CARUB_v10008368mg             932   0.0      
ref|XP_002886578.1|  phosphatidylinositol-4-phosphate 5-kinase fa...    929   0.0      
ref|XP_006417406.1|  hypothetical protein EUTSA_v10006872mg             928   0.0      
ref|XP_010475976.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    927   0.0      
ref|XP_010418032.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    926   0.0      
ref|NP_172559.2|  1-phosphatidylinositol-4-phosphate 5-kinase           924   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892608.1|  phosphatidylinositol-4-phosphate 5-kinase fa...    924   0.0      
ref|XP_010430074.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    924   0.0      
ref|XP_010458463.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    924   0.0      
ref|XP_006300768.1|  hypothetical protein CARUB_v10019843mg             924   0.0      
gb|AAB65487.1|  phosphatidylinositol-4-phosphate 5-kinase isolog;...    923   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118220.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    921   0.0      
ref|XP_009118218.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    921   0.0      
ref|XP_010473269.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    921   0.0      
ref|XP_010473268.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    920   0.0      
ref|XP_008378836.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    919   0.0      
emb|CDY19330.1|  BnaC05g08390D                                          914   0.0      
ref|XP_010916562.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    914   0.0      
ref|XP_009148427.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    912   0.0      
ref|XP_006830189.1|  hypothetical protein AMTR_s00173p00020990          912   0.0      
ref|XP_009148428.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    911   0.0      
emb|CDX97920.1|  BnaA06g06710D                                          909   0.0      
ref|XP_008802074.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    906   0.0      
ref|XP_004140232.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    854   0.0      
ref|XP_006392102.1|  hypothetical protein EUTSA_v10023316mg             848   0.0      
ref|XP_008352855.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    842   0.0      
ref|XP_008802078.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    840   0.0      
gb|KHG21071.1|  Phosphatidylinositol-4-phosphate 5-kinase 8             837   0.0      
ref|XP_009390891.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    840   0.0      
ref|XP_009390248.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    841   0.0      
ref|XP_009390893.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    839   0.0      
emb|CDY34670.1|  BnaC08g42290D                                          831   0.0      
emb|CDY34857.1|  BnaA09g47830D                                          827   0.0      
ref|XP_009355210.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    820   0.0      
gb|KEH20717.1|  phosphatidylinositol-4-phosphate 5-kinase family ...    819   0.0      
gb|KEH20718.1|  phosphatidylinositol-4-phosphate 5-kinase family ...    818   0.0      
ref|XP_008802077.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    808   0.0      
ref|XP_010501421.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    802   0.0      
ref|XP_006392101.1|  hypothetical protein EUTSA_v10023316mg             797   0.0      
gb|KHN26677.1|  Phosphatidylinositol-4-phosphate 5-kinase 8             788   0.0      
ref|XP_011006537.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    777   0.0      
ref|XP_011006536.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    777   0.0      
gb|EEE59762.1|  hypothetical protein OsJ_12252                          776   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008802079.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    773   0.0      
ref|NP_001051005.1|  Os03g0701800                                       776   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982061.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    775   0.0      
gb|EEC76018.1|  hypothetical protein OsI_13176                          775   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010231168.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    771   0.0      
gb|EMS61702.1|  Phosphatidylinositol-4-phosphate 5-kinase 1             770   0.0      
sp|Q6EX42.2|PI5K1_ORYSJ  RecName: Full=Phosphatidylinositol 4-pho...    768   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650453.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    764   0.0      
ref|XP_009355211.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    753   0.0      
emb|CBI23815.3|  unnamed protein product                                739   0.0      
gb|KDP29195.1|  hypothetical protein JCGZ_16584                         745   0.0      
ref|XP_002265706.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    742   0.0      Vitis vinifera
ref|XP_007027475.1|  Phosphatidyl inositol monophosphate 5 kinase...    740   0.0      
ref|XP_004304485.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    739   0.0      
ref|XP_002519450.1|  phosphatidylinositol-4-phosphate 5-kinase, p...    739   0.0      Ricinus communis
ref|XP_007203243.1|  hypothetical protein PRUPE_ppa001465mg             738   0.0      
ref|XP_010475979.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    731   0.0      
ref|XP_006471083.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    728   0.0      
emb|CBI30171.3|  unnamed protein product                                736   0.0      
ref|XP_008779141.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    736   0.0      
ref|XP_010098819.1|  Phosphatidylinositol-4-phosphate 5-kinase 9        736   0.0      
ref|XP_008241370.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    734   0.0      
ref|XP_010458464.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    727   0.0      
ref|XP_009347972.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    733   0.0      
ref|XP_006493544.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    732   0.0      
ref|XP_010267271.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    732   0.0      
ref|XP_006428473.1|  hypothetical protein CICLE_v10011083mg             729   0.0      
ref|XP_008387525.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    729   0.0      
ref|XP_011094578.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    729   0.0      
gb|KHG10636.1|  Phosphatidylinositol-4-phosphate 5-kinase 9 -like...    728   0.0      
gb|KEH42149.1|  phosphatidylinositol-4-phosphate 5-kinase family ...    727   0.0      
ref|XP_011018813.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    727   0.0      
ref|XP_007144386.1|  hypothetical protein PHAVU_007G152000g             726   0.0      
ref|XP_010696315.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    726   0.0      
gb|EAY88067.1|  hypothetical protein OsI_09497                          725   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_008779154.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    724   0.0      
ref|XP_010916564.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    717   0.0      
ref|XP_010940540.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    723   0.0      
ref|XP_003535198.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    723   0.0      
ref|NP_001048560.1|  Os02g0822500                                       722   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97709.1|  predicted protein                                      721   0.0      
ref|XP_009385683.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    720   0.0      
ref|XP_006648146.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    719   0.0      
ref|XP_010243193.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    719   0.0      
gb|ACH90428.1|  phosphatidylinositol phoshate kinase                    722   0.0      Physcomitrella patens
gb|EMS63007.1|  Phosphatidylinositol-4-phosphate 5-kinase 9             718   0.0      
ref|XP_007162796.1|  hypothetical protein PHAVU_001G181400g             717   0.0      
ref|XP_008442735.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    718   0.0      
ref|XP_004137849.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    718   0.0      
ref|XP_008787445.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    717   0.0      
ref|XP_003542542.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    717   0.0      
ref|XP_003570442.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    717   0.0      
ref|XP_006381373.1|  phosphatidylinositol-4-phosphate 5-kinase fa...    717   0.0      
ref|XP_004161258.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    717   0.0      
gb|EMT07835.1|  Phosphatidylinositol-4-phosphate 5-kinase 9             716   0.0      
ref|XP_001758268.1|  predicted protein                                  714   0.0      
ref|XP_008802080.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    708   0.0      
gb|KHN18690.1|  Phosphatidylinositol-4-phosphate 5-kinase 9             715   0.0      
ref|XP_006299081.1|  hypothetical protein CARUB_v10015222mg             714   0.0      
ref|XP_003521419.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    713   0.0      
ref|XP_006648147.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    713   0.0      
ref|XP_010050436.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    712   0.0      
ref|XP_011077292.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    712   0.0      
ref|XP_009793190.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    712   0.0      
ref|XP_006407623.1|  hypothetical protein EUTSA_v10020082mg             709   0.0      
ref|XP_004982696.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    709   0.0      
ref|XP_008644741.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    708   0.0      
ref|XP_006354393.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    707   0.0      
ref|NP_187603.1|  phosphatidyl inositol monophosphate 5 kinase          706   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009620729.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    705   0.0      
gb|AAM53300.1|  putative phosphatidylinositol-4-phosphate 5-kinase      705   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009797891.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    705   0.0      
emb|CDP15295.1|  unnamed protein product                                705   0.0      
ref|XP_008643631.1|  PREDICTED: LOC100281652 isoform X1                 704   0.0      
gb|EYU41591.1|  hypothetical protein MIMGU_mgv1a001420mg                704   0.0      
ref|XP_010464651.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    704   0.0      
ref|XP_010558195.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    704   0.0      
ref|XP_004246603.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    704   0.0      
ref|NP_001148043.1|  LOC100281652                                       703   0.0      Zea mays [maize]
ref|XP_010486568.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    703   0.0      
ref|XP_002993810.1|  hypothetical protein SELMODRAFT_449229             703   0.0      
ref|XP_010478747.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    702   0.0      
ref|XP_002967980.1|  hypothetical protein SELMODRAFT_88573              701   0.0      
ref|XP_002884763.1|  PIP5K9                                             702   0.0      
ref|XP_010543450.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    702   0.0      
gb|ACH90427.1|  phosphatidylinositol phoshate kinase                    705   0.0      Physcomitrella patens
ref|XP_004966576.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    700   0.0      
ref|XP_002963939.1|  hypothetical protein SELMODRAFT_230263             698   0.0      
emb|CDY54607.1|  BnaA05g28620D                                          699   0.0      
ref|XP_009146887.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    699   0.0      
ref|XP_001781776.1|  predicted protein                                  694   0.0      
ref|XP_006493547.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    692   0.0      
emb|CDY41570.1|  BnaC05g43070D                                          695   0.0      
ref|XP_003560277.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    694   0.0      
ref|XP_009611134.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    694   0.0      
ref|XP_002993971.1|  hypothetical protein SELMODRAFT_449262             692   0.0      
ref|XP_006428472.1|  hypothetical protein CICLE_v10011083mg             689   0.0      
ref|XP_008664788.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    691   0.0      
ref|XP_006349524.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    684   0.0      
gb|EPS72854.1|  hypothetical protein M569_01903                         673   0.0      
tpg|DAA49412.1|  TPA: putative phosphatidylinositol-4-phosphate 5...    680   0.0      
emb|CAD27794.1|  phosphatidylinositol-4-phosphate 5-kinase              672   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EYU38576.1|  hypothetical protein MIMGU_mgv1a025592mg                654   0.0      
ref|XP_004249584.2|  PREDICTED: phosphatidylinositol 4-phosphate ...    647   0.0      
ref|XP_002986315.1|  hypothetical protein SELMODRAFT_124004             635   0.0      
gb|KCW57070.1|  hypothetical protein EUGRSUZ_I02724                     623   0.0      
ref|XP_007041491.1|  Phosphatidylinositol-4-phosphate 5-kinase fa...    624   0.0      
ref|XP_004516597.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    618   0.0      
gb|EMS63245.1|  Phosphatidylinositol-4-phosphate 5-kinase 9             616   0.0      
ref|XP_010312349.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    617   0.0      
gb|KCW57069.1|  hypothetical protein EUGRSUZ_I02724                     597   0.0      
ref|XP_007027478.1|  Phosphatidyl inositol monophosphate 5 kinase...    595   0.0      
ref|XP_007027477.1|  Phosphatidyl inositol monophosphate 5 kinase...    595   0.0      
gb|EMS64982.1|  Phosphatidylinositol-4-phosphate 5-kinase 9             603   0.0      
ref|XP_006471084.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    587   0.0      
ref|XP_010926458.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    589   0.0      
emb|CAN81224.1|  hypothetical protein VITISV_027824                     583   0.0      Vitis vinifera
gb|EMT21401.1|  Phosphatidylinositol-4-phosphate 5-kinase 9             585   0.0      
ref|XP_008782272.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    584   0.0      
ref|XP_009408132.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    578   0.0      
gb|KCW89328.1|  hypothetical protein EUGRSUZ_A01618                     577   0.0      
ref|XP_004142482.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    579   0.0      
ref|XP_006494071.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    578   0.0      
gb|KDO58858.1|  hypothetical protein CISIN_1g004035mg                   578   0.0      
ref|XP_008375376.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    577   0.0      
ref|XP_010547360.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    573   0.0      
ref|XP_011020411.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    575   0.0      
ref|XP_010645598.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    575   0.0      
ref|XP_010926980.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    575   0.0      
ref|XP_004250336.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    575   0.0      
ref|XP_010269395.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    573   0.0      
gb|KDP32752.1|  hypothetical protein JCGZ_12044                         574   0.0      
ref|XP_002304802.1|  phosphatidylinositol-4-phosphate 5-kinase fa...    573   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006847787.1|  hypothetical protein AMTR_s00162p00082010          575   0.0      
ref|XP_004169495.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    572   0.0      
ref|XP_010557867.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    570   0.0      
ref|XP_011000574.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    573   0.0      
ref|XP_011014126.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    572   0.0      
ref|XP_010922254.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    572   0.0      
ref|XP_010242826.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    565   0.0      
ref|XP_004307106.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    570   0.0      
ref|XP_006351873.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    572   0.0      
ref|XP_010067728.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    570   0.0      
ref|XP_011000430.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    570   0.0      
emb|CAN81212.1|  hypothetical protein VITISV_020918                     568   0.0      Vitis vinifera
ref|XP_010032297.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    570   0.0      
ref|XP_010269394.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    570   0.0      
ref|XP_008803344.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    570   0.0      
ref|XP_008801049.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    570   0.0      
ref|XP_006472714.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    569   0.0      
ref|XP_010460460.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    566   0.0      
ref|XP_006434121.1|  hypothetical protein CICLE_v10000334mg             569   0.0      
ref|XP_002513822.1|  phosphatidylinositol-4-phosphate 5-kinase, p...    568   0.0      Ricinus communis
ref|XP_010246727.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    568   0.0      
ref|XP_002322622.1|  phosphatidylinositol-4-phosphate 5-kinase fa...    568   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010460381.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    566   0.0      
ref|XP_009623462.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    567   0.0      
ref|XP_010916539.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    568   0.0      
gb|EMT30182.1|  Phosphatidylinositol-4-phosphate 5-kinase 9             570   0.0      
ref|XP_002284379.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    566   0.0      Vitis vinifera
ref|XP_006650470.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    564   0.0      
gb|AFQ62613.1|  phosphatidylinositol-4-phosphate 5-kinase               565   0.0      
ref|XP_007218928.1|  hypothetical protein PRUPE_ppa001758mg             564   0.0      
ref|XP_002297738.2|  phosphatidylinositol-4-phosphate 5-kinase fa...    563   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009623693.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    564   0.0      
ref|XP_004290830.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    562   0.0      
ref|XP_010932025.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    564   0.0      
ref|XP_009778560.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    563   0.0      
ref|XP_009782218.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    562   0.0      
ref|XP_008231674.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    562   0.0      
ref|XP_002307416.1|  putative phosphatidylinositol-4-phosphate 5-...    562   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010521233.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    561   0.0      
ref|XP_008348149.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    561   0.0      
ref|XP_002301013.2|  putative phosphatidylinositol-4-phosphate 5-...    562   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007018959.1|  Phosphatidylinositol-4-phosphate 5-kinase 1        560   0.0      
ref|XP_004513747.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    561   0.0      
ref|XP_010276643.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    561   0.0      
ref|XP_009383914.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    561   0.0      
ref|XP_009372761.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    560   0.0      
ref|XP_006300776.1|  hypothetical protein CARUB_v10019857mg             560   0.0      
ref|XP_011091835.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    560   0.0      
ref|XP_009380274.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    561   0.0      
ref|XP_009403987.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    560   0.0      
ref|XP_002890482.1|  ATPIP5K1                                           559   0.0      
ref|XP_009388788.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    560   0.0      
ref|XP_009392742.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    560   0.0      
ref|XP_006306839.1|  hypothetical protein CARUB_v10008382mg             559   0.0      
emb|CDP09551.1|  unnamed protein product                                559   0.0      
ref|XP_011001412.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    560   0.0      
ref|XP_004982037.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    557   0.0      
ref|NP_173617.1|  phosphatidylinositol-4-phosphate 5-kinase 1           558   0.0      
gb|EEC76033.1|  hypothetical protein OsI_13203                          557   0.0      
ref|NP_001051025.1|  Os03g0705300                                       557   0.0      
gb|AAF80332.1|AF157047_1  putative phosphatidylinositol 4-phospha...    559   0.0      
ref|XP_010272887.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    559   0.0      
ref|XP_008782108.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    561   0.0      
gb|KDP29267.1|  hypothetical protein JCGZ_16656                         557   0.0      
ref|XP_009401088.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    558   0.0      
ref|XP_009398944.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    557   0.0      
emb|CDP17283.1|  unnamed protein product                                557   0.0      
ref|XP_010471971.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    556   0.0      
ref|XP_009142731.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    556   0.0      
tpg|DAA41657.1|  TPA: putative phosphatidylinositol-4-phosphate 5...    556   0.0      
gb|EMT23056.1|  Phosphatidylinositol-4-phosphate 5-kinase 9             558   1e-180   
ref|XP_010480589.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    556   1e-180   
ref|XP_010416730.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    555   1e-180   
ref|XP_010459923.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    556   2e-180   
emb|CDX79949.1|  BnaA05g02070D                                          556   2e-180   
gb|KFK38246.1|  hypothetical protein AALP_AA3G088600                    553   3e-180   
ref|XP_009389635.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    555   4e-180   
ref|XP_002267007.3|  PREDICTED: phosphatidylinositol 4-phosphate ...    555   4e-180   
gb|KFK38247.1|  hypothetical protein AALP_AA3G088600                    553   5e-180   
gb|AAB82658.1|  putative phosphatidylinositol-4-phosphate 5-kinase      554   5e-180   
ref|XP_004144365.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    554   8e-180   
ref|XP_010498657.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    554   8e-180   
ref|XP_007133752.1|  hypothetical protein PHAVU_011G206300g             553   1e-179   
ref|XP_007145371.1|  hypothetical protein PHAVU_007G233500g             554   1e-179   
ref|XP_002463320.1|  hypothetical protein SORBIDRAFT_02g041770          554   1e-179   
ref|XP_002513049.1|  phosphatidylinositol-4-phosphate 5-kinase, p...    554   1e-179   
ref|XP_006838377.1|  hypothetical protein AMTR_s00002p00056060          551   2e-179   
ref|XP_006411387.1|  hypothetical protein EUTSA_v10016282mg             553   2e-179   
ref|XP_004157993.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    553   2e-179   
ref|XP_007226998.1|  hypothetical protein PRUPE_ppa001669mg             553   2e-179   
ref|XP_009367354.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    551   3e-179   
ref|XP_002887699.1|  hypothetical protein ARALYDRAFT_476937             552   3e-179   
ref|XP_007028461.1|  Phosphatidyl inositol monophosphate 5 kinase 4     552   3e-179   
ref|XP_009403577.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    552   5e-179   
ref|XP_002464021.1|  hypothetical protein SORBIDRAFT_01g010710          550   5e-179   
ref|XP_008233910.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    552   6e-179   
ref|XP_010517609.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    552   7e-179   
ref|XP_009110161.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    550   7e-179   
gb|KGN51092.1|  hypothetical protein Csa_5G435070                       551   7e-179   
ref|XP_006477597.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    551   1e-178   
ref|XP_008465842.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    550   2e-178   
ref|XP_010938560.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    550   2e-178   
ref|XP_006295648.1|  hypothetical protein CARUB_v10024770mg             551   2e-178   
ref|XP_008455707.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    551   2e-178   
ref|XP_010428859.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    550   2e-178   
ref|NP_181654.1|  phosphatidylinositol-4-phosphate 5-kinase 5           550   3e-178   
gb|KFK36968.1|  hypothetical protein AALP_AA4G195800                    550   3e-178   
ref|XP_002526916.1|  phosphatidylinositol-4-phosphate 5-kinase, p...    550   3e-178   
gb|KGN54717.1|  hypothetical protein Csa_4G432460                       551   3e-178   
ref|XP_010505886.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    550   3e-178   
gb|EYU18633.1|  hypothetical protein MIMGU_mgv1a001627mg                550   3e-178   
gb|AAF86542.1|AC069252_1  F2E2.1                                        549   3e-178   
dbj|BAK05708.1|  predicted protein                                      550   3e-178   
ref|XP_003562530.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    550   3e-178   
ref|XP_009802995.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    549   5e-178   
ref|XP_009133474.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    550   5e-178   
ref|XP_010554770.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    550   5e-178   
ref|XP_006390060.1|  hypothetical protein EUTSA_v10018171mg             549   5e-178   
ref|XP_006348031.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    549   6e-178   
emb|CDY23866.1|  BnaC04g01710D                                          549   6e-178   
ref|XP_008376214.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    549   9e-178   
ref|XP_008465818.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    549   1e-177   
ref|NP_177897.1|  phosphatidylinositol-4-phosphate 5-kinase 2           548   1e-177   
ref|XP_004305686.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    549   1e-177   
ref|XP_002879915.1|  phosphatidylinositol-4-phosphate 5-kinase fa...    548   1e-177   
ref|XP_006421102.1|  hypothetical protein CICLE_v10006414mg             549   1e-177   
ref|XP_011027611.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    549   1e-177   
gb|AES60514.2|  phosphatidylinositol-4-phosphate 5-kinase family ...    548   2e-177   
gb|KFK44304.1|  hypothetical protein AALP_AA1G240400                    545   3e-177   
ref|XP_003518983.2|  PREDICTED: phosphatidylinositol 4-phosphate ...    547   3e-177   
ref|XP_010508746.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    547   3e-177   
ref|XP_008385731.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    547   3e-177   
ref|XP_009389636.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    548   4e-177   
ref|XP_009366991.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    547   5e-177   
ref|XP_006407777.1|  hypothetical protein EUTSA_v10020133mg             546   6e-177   
ref|XP_009777207.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    546   6e-177   
ref|XP_004140328.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    547   6e-177   
ref|XP_010427549.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    546   8e-177   
ref|XP_004167695.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    546   1e-176   
emb|CDY22511.1|  BnaC03g23210D                                          545   1e-176   
gb|KFK42171.1|  hypothetical protein AALP_AA2G220100                    544   2e-176   
ref|XP_009603152.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    545   2e-176   
ref|XP_003625005.1|  Phosphatidylinositol-4-phosphate 5-kinase          546   2e-176   
ref|XP_006290624.1|  hypothetical protein CARUB_v10016715mg             545   2e-176   
ref|XP_009608671.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    545   3e-176   
ref|XP_008243123.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    545   3e-176   
ref|XP_010504608.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    545   4e-176   
ref|XP_010516300.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    545   4e-176   
emb|CDY35423.1|  BnaA03g19370D                                          544   4e-176   
ref|XP_006594168.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    539   5e-176   
ref|XP_004498693.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    545   5e-176   
ref|NP_001136793.1|  uncharacterized protein LOC100216938               542   5e-176   
ref|XP_004958569.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    545   5e-176   
ref|XP_002876390.1|  predicted protein                                  544   6e-176   
ref|XP_007148930.1|  hypothetical protein PHAVU_005G026200g             543   6e-176   
gb|AFW67876.1|  putative phosphatidylinositol-4-phosphate 5-kinas...    542   8e-176   
ref|XP_009336194.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    544   9e-176   
ref|NP_191255.1|  phosphatidylinositol-4-phosphate 5-kinase 4           544   1e-175   
gb|KFK42170.1|  hypothetical protein AALP_AA2G220100                    541   2e-175   
ref|XP_010312049.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    543   2e-175   
ref|XP_008243124.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    543   2e-175   
ref|XP_006428470.1|  hypothetical protein CICLE_v10011083mg             538   3e-175   
ref|XP_011001289.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    541   4e-175   
ref|XP_003554127.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    542   4e-175   
ref|XP_011015918.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    541   5e-175   
ref|XP_008349867.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    542   5e-175   
ref|XP_004252006.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    541   6e-175   
ref|XP_011074875.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    542   6e-175   
ref|XP_007203358.1|  hypothetical protein PRUPE_ppa020533mg             541   1e-174   
ref|XP_010314011.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    540   1e-174   
ref|XP_006362290.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    540   3e-174   
ref|XP_010063339.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    540   3e-174   
ref|XP_008338823.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    540   3e-174   
ref|XP_004493406.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    540   4e-174   
ref|XP_006576784.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    540   4e-174   
gb|KHN08874.1|  Phosphatidylinositol-4-phosphate 5-kinase 4             539   5e-174   
ref|XP_003546716.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    538   8e-174   
gb|EYU22913.1|  hypothetical protein MIMGU_mgv1a001594mg                539   9e-174   
ref|XP_007162098.1|  hypothetical protein PHAVU_001G123800g             538   2e-173   
ref|XP_011088702.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    538   2e-173   
ref|XP_006830046.1|  hypothetical protein AMTR_s00124p00123790          529   4e-173   
emb|CDY27172.1|  BnaA09g36300D                                          537   4e-173   
gb|EYU23920.1|  hypothetical protein MIMGU_mgv1a001547mg                537   5e-173   
ref|XP_010095887.1|  Phosphatidylinositol-4-phosphate 5-kinase 1        536   6e-173   
ref|XP_009116399.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    536   1e-172   
ref|XP_004500598.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    533   2e-172   
ref|XP_009139057.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    534   5e-172   
gb|KHN37675.1|  Phosphatidylinositol-4-phosphate 5-kinase 6             531   8e-172   
gb|EPS60405.1|  hypothetical protein M569_14398                         531   1e-171   
ref|XP_003590263.1|  Phosphatidylinositol-4-phosphate 5-kinase          534   1e-171   
emb|CDP12435.1|  unnamed protein product                                532   1e-171   
ref|XP_003542821.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    532   2e-171   
ref|XP_011088692.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    533   2e-171   
ref|XP_011097655.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    533   2e-171   
ref|XP_009135011.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    530   2e-171   
ref|XP_010056101.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    532   3e-171   
ref|XP_011075416.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    531   3e-171   
ref|XP_006402928.1|  hypothetical protein EUTSA_v10005792mg             532   8e-171   
ref|XP_009104033.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    531   1e-170   
ref|XP_009393561.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    530   1e-170   
ref|XP_002466607.1|  hypothetical protein SORBIDRAFT_01g010920          516   2e-170   
ref|XP_007159906.1|  hypothetical protein PHAVU_002G277600g             527   5e-170   
ref|XP_009598643.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    528   7e-170   
ref|XP_010670489.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    528   8e-170   
gb|EPS71551.1|  hypothetical protein M569_03208                         528   1e-169   
gb|AET02320.2|  phosphatidylinositol-4-phosphate 5-kinase family ...    526   3e-169   
ref|XP_007137807.1|  hypothetical protein PHAVU_009G157200g             525   5e-169   
ref|XP_010527039.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    526   5e-169   
ref|XP_004511036.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    525   6e-169   
ref|XP_010527040.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    525   1e-168   
ref|XP_010089732.1|  Phosphatidylinositol-4-phosphate 5-kinase 4        523   5e-168   
ref|XP_009790921.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    523   5e-168   
ref|XP_006351416.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    521   7e-167   
dbj|BAA33501.1|  AtPIP5K1                                               517   1e-166   
ref|XP_010237977.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    522   1e-166   
ref|XP_004503007.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    517   3e-166   
ref|XP_003601106.1|  Phosphatidylinositol-4-phosphate 5-kinase          518   3e-166   
emb|CDY38833.1|  BnaC08g20070D                                          517   4e-166   
gb|AES68766.2|  phosphatidylinositol-4-phosphate 5-kinase family ...    518   4e-166   
ref|XP_010312161.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    518   5e-166   
gb|EYU38285.1|  hypothetical protein MIMGU_mgv1a019859mg                516   2e-165   
ref|XP_007137365.1|  hypothetical protein PHAVU_009G121200g             515   2e-165   
ref|XP_003598515.1|  Phosphatidylinositol-4-phosphate 5-kinase          517   3e-165   
gb|KHG19329.1|  Phosphatidylinositol-4-phosphate 5-kinase 6 -like...    513   4e-165   
emb|CBX25294.1|  hypothetical_protein                                   516   5e-165   
ref|NP_001173424.1|  Os03g0356582                                       514   1e-164   
ref|XP_003627844.1|  Phosphatidylinositol-4-phosphate 5-kinase          512   1e-163   
ref|XP_006466181.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    508   7e-163   
ref|XP_006494072.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    508   1e-162   
ref|XP_009623471.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    508   3e-162   
emb|CBX25481.1|  hypothetical_protein                                   509   3e-162   
gb|KDO58713.1|  hypothetical protein CISIN_1g005122mg                   506   4e-162   
gb|EMT08018.1|  Phosphatidylinositol-4-phosphate 5-kinase 1             506   8e-162   
ref|XP_010544414.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    507   1e-161   
emb|CDY14647.1|  BnaC02g24660D                                          506   1e-161   
emb|CBX24435.1|  hypothetical_protein                                   506   4e-161   
emb|CDY64062.1|  BnaA02g36050D                                          504   5e-161   
gb|KDP20546.1|  hypothetical protein JCGZ_04229                         503   6e-161   
ref|XP_009128247.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    504   7e-161   
ref|NP_001066126.1|  Os12g0141100                                       505   2e-160   
ref|XP_009782219.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    503   2e-160   
ref|XP_002325695.2|  hypothetical protein POPTR_0019s01150g             501   7e-160   
ref|XP_006580364.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    499   1e-159   
ref|XP_008665275.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    498   2e-159   
gb|KFK38248.1|  hypothetical protein AALP_AA3G088600                    498   2e-159   
ref|XP_005642726.1|  PIP5K-domain-containing protein                    501   2e-159   
ref|XP_008665274.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    498   2e-159   
emb|CBI19074.3|  unnamed protein product                                501   1e-158   
ref|XP_002988736.1|  hypothetical protein SELMODRAFT_235590             493   1e-157   
ref|XP_011011335.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    489   3e-155   
dbj|BAJ95416.1|  predicted protein                                      484   3e-155   
gb|ADP02215.1|  putative phosphatidylinositol-4-phosphate 5-kinas...    490   4e-155   
ref|XP_008444125.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    490   4e-155   
ref|XP_004150913.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    490   8e-155   
ref|XP_007010967.1|  Phosphatidylinositol-4-phosphate 5-kinase fa...    488   9e-155   
ref|XP_006584672.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    486   3e-154   
ref|XP_010095997.1|  Phosphatidylinositol-4-phosphate 5-kinase 6        484   7e-154   
ref|XP_008376215.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    483   2e-153   
tpg|DAA41656.1|  TPA: putative phosphatidylinositol-4-phosphate 5...    481   4e-153   
ref|XP_008669877.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    486   2e-152   
ref|XP_008347903.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    469   2e-152   
ref|XP_004167586.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    474   2e-152   
ref|XP_010429664.1|  PREDICTED: phosphatidylinositol 4-phosphate ...    475   4e-150   
gb|KEH35650.1|  phosphatidylinositol-4-phosphate 5-kinase family ...    474   5e-150   



>ref|XP_011087754.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum 
indicum]
 ref|XP_011087755.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum 
indicum]
 ref|XP_011087757.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum 
indicum]
 ref|XP_011087758.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum 
indicum]
 ref|XP_011087759.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum 
indicum]
Length=772

 Score =  1104 bits (2856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/773 (70%), Positives = 625/773 (81%), Gaps = 7/773 (1%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             MEN ER  EK+F NGDVY+G FKG +PHGKGKYT S+GT Y+GDWEEGKMTGKG+IIW S
Sbjct  1     MENEERGCEKIFSNGDVYLGSFKGSIPHGKGKYTWSEGTVYEGDWEEGKMTGKGKIIWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
              ATY+GD    YLHGFGTF  SDGS+Y+G WKMN QHG+GRK+Y NSD+YDGCW+EGVR+
Sbjct  61    QATYEGDFSGAYLHGFGTFIGSDGSIYRGSWKMNSQHGIGRKQYPNSDIYDGCWREGVRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY WS GN+Y G WK G MSGRGVMKW NGDLFDGFW +GLRHGSG YRF+DGSYYF
Sbjct  121   GSGRYAWSVGNVYIGNWKSGKMSGRGVMKWCNGDLFDGFWSNGLRHGSGFYRFSDGSYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGCA-LDKCKIDGHKEIRR-MLSHDSSISKKDAVKPKVKRSISE  1296
             GTWS GLKDG GT YP G   L K   +GHKE ++  LS +SS   +++V P VKRS+SE
Sbjct  181   GTWSKGLKDGPGTFYPAGNKHLRKLNPEGHKEKKKKQLSRNSSYDSEESVIPSVKRSLSE  240

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVA  1476
             KI   F R SGR S +  S+  D     S  E++  +  C++S +  DG+ E   N TVA
Sbjct  241   KISSSFRRGSGRFSHKTTSLDDDLGHSNSMREIMTRERPCIISSSCDDGQTEFPDNKTVA  300

Query  1477  YEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLG  1656
             YEREYMQGVLIRERI+++  LSH+S QR K  AK+ +  SC+D+F+G KSYYLML+LQLG
Sbjct  301   YEREYMQGVLIRERIRNISKLSHKSKQRLKV-AKQAKSRSCVDIFEGHKSYYLMLSLQLG  359

Query  1657  IRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNL  1836
             IRY+VGKITP+PMREVR SDFGEQARI+MYFPRKGS+LTPPH S+DFYWKDYCP+VFRNL
Sbjct  360   IRYTVGKITPVPMREVRSSDFGEQARIRMYFPRKGSQLTPPHNSVDFYWKDYCPMVFRNL  419

Query  1837  RRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLP  2016
             R LFKLNAADYMMSIC DDGLREL SPGKSGSIFYLS DD+FVIKTLKKSELKVLLKMLP
Sbjct  420   RELFKLNAADYMMSICGDDGLRELSSPGKSGSIFYLSHDDKFVIKTLKKSELKVLLKMLP  479

Query  2017  SYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRF  2196
              YY HV+ H+NTLITKFFG +RI+L   KKVRFVVMGNMF TEL +H RYDLKGSS GRF
Sbjct  480   HYYDHVQVHDNTLITKFFGAHRIALGHGKKVRFVVMGNMFCTELRIHRRYDLKGSSHGRF  539

Query  2197  TDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRA  2376
             T+KD+I+E TTLKDLDL YE  MD+LLHE+L +QL+LD  FLESQ IIDYSLLLGLHFRA
Sbjct  540   TNKDEIDETTTLKDLDLTYEFHMDRLLHESLFRQLTLDCAFLESQQIIDYSLLLGLHFRA  599

Query  2377  PEHLTALLEPPDSLFKPKSTL----VSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGK  2544
             PEHL +L EP DSL   ++T     V S G + I PR L LVTHEP  VST PGPHIRG 
Sbjct  600   PEHLRSLSEPSDSLDNAETTSALDGVISQGDLLIPPRGLLLVTHEPDSVSTTPGPHIRGS  659

Query  2545  TLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYL  2724
             TL+A S+G++EVDLLLPGTGRLRVQLGVNMPAQAN ++ Q + D +EVELFEVYDVVLYL
Sbjct  660   TLKAYSIGNKEVDLLLPGTGRLRVQLGVNMPAQANHRLTQAKIDSAEVELFEVYDVVLYL  719

Query  2725  GIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA*P  2883
             GIIDILQ YNM+KK+EH  KSL+FDPMSISV+EPKLYSKRFI+FLE+VF   P
Sbjct  720   GIIDILQEYNMKKKMEHACKSLKFDPMSISVVEPKLYSKRFITFLEKVFPRDP  772



>emb|CDO97548.1| unnamed protein product [Coffea canephora]
Length=772

 Score =  1101 bits (2847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/776 (71%), Positives = 631/776 (81%), Gaps = 13/776 (2%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME +ERT EKVF  G VY G FKG+LPHGKGKYT SDGTTY+GDWEEGKMTGKG+I W+S
Sbjct  1     MEASERTLEKVFLCGGVYAGNFKGLLPHGKGKYTWSDGTTYEGDWEEGKMTGKGRISWAS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GATY+GD    YLHGFGTF+ SDGS+Y G W+MN QHG+GRK+YQNSDVYDGCWKEG R+
Sbjct  61    GATYEGDFSGNYLHGFGTFTGSDGSLYTGGWRMNSQHGIGRKQYQNSDVYDGCWKEGKRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY WSN NMY G WK G MSGRGVMKW NGDLFDGFW +GLRHG+GCYRFADG YYF
Sbjct  121   GSGRYAWSNSNMYIGSWKNGKMSGRGVMKWLNGDLFDGFWSNGLRHGTGCYRFADGGYYF  180

Query  1123  GTWSNGLKDGRGTLYPVG---CALDKCKIDGHKEIR-RMLSHDSSISKKDAVKPKVKRSI  1290
             GTW+ G KDG+GT YP G    A  K   D + E + R+L H SS++ +++V+P V+RS 
Sbjct  181   GTWTKGFKDGQGTFYPAGNKHSARRKSSADKNGEKKKRLLVHSSSVNSENSVRPHVRRSH  240

Query  1291  SEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNIT  1470
             SEKI +   R S + S R  S+  D+AL   S + +  DAS   S  + D ++   G+ +
Sbjct  241   SEKISNTLLRCSSQTSHRTSSLREDSALDDISVD-MSFDAS---SRYSDDDQSGLQGDSS  296

Query  1471  VAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQ  1650
             VA+EREYMQGVLI+ER++S+ GLS +S +R KF AKEV+  SC+D+F+G + YYLMLNLQ
Sbjct  297   VAFEREYMQGVLIKERVRSISGLSLKSKKRYKFHAKEVKSKSCVDIFEGHRRYYLMLNLQ  356

Query  1651  LGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFR  1830
             LGIRY+VGKITP+P REVR SDFGE+ARI+MYFPRKGS+ TPPH SIDFYWKDYCP+VFR
Sbjct  357   LGIRYTVGKITPVPAREVRSSDFGERARIRMYFPRKGSQFTPPHYSIDFYWKDYCPMVFR  416

Query  1831  NLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKM  2010
             NLR +FKLNAA+YMMSIC DDGLREL SPGKSGSIF+LS DDRFVIKTLK+SELKV L+M
Sbjct  417   NLREMFKLNAAEYMMSICGDDGLRELSSPGKSGSIFFLSGDDRFVIKTLKRSELKVFLRM  476

Query  2011  LPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLG  2190
             LP YY+HV  HENTLITKFFG++RI L+  KKVRFVVMGNMF TEL +H RYDLKGSS G
Sbjct  477   LPRYYRHVSQHENTLITKFFGLHRIKLKHGKKVRFVVMGNMFCTELRIHRRYDLKGSSHG  536

Query  2191  RFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHF  2370
             RFT KDKI+EGTTLKDLDL YE  MDKLL E+L KQLSLD +FLESQ IIDYSLLLGLHF
Sbjct  537   RFTKKDKIDEGTTLKDLDLTYEFHMDKLLRESLFKQLSLDCEFLESQQIIDYSLLLGLHF  596

Query  2371  RAPEHLTALLEPPDSLFKPKSTL-----VSSDGGISILPRSLTLVTHEPSIVSTAPGPHI  2535
             RAPEHL ALLEPPDSL KP S       ++S G +SI PR L LVTHEPS VST PGPHI
Sbjct  597   RAPEHLKALLEPPDSLHKPASAQATLGGMTSQGELSIPPRGLLLVTHEPSSVSTEPGPHI  656

Query  2536  RGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVV  2715
             RG TLRA SVGD+EVDLLLPGT RLRVQLGVNMPAQAN KV QD+TD +EVELFEVYDVV
Sbjct  657   RGSTLRAMSVGDKEVDLLLPGTARLRVQLGVNMPAQANLKVLQDKTDSAEVELFEVYDVV  716

Query  2716  LYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA*P  2883
             LYLGIIDILQ YN+RKKLEH  KSL+FDPMSISV+EPKLYS+RFI+FLERVF   P
Sbjct  717   LYLGIIDILQEYNVRKKLEHTCKSLQFDPMSISVVEPKLYSRRFINFLERVFPVAP  772



>ref|XP_009800012.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like [Nicotiana 
sylvestris]
Length=773

 Score =  1092 bits (2823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/775 (71%), Positives = 629/775 (81%), Gaps = 10/775 (1%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME +     KVF NGD Y G FKG+LPHGKGKYT SDG+ YDG WEEGKMTG+G++IW S
Sbjct  1     MEESGSITGKVFLNGDAYGGSFKGILPHGKGKYTWSDGSVYDGCWEEGKMTGEGRLIWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA+Y+GD   GYLHGFG F+ SDGS+Y+G W+MN QHG+GRK+YQNSDVYDGCWKEGVR+
Sbjct  61    GASYEGDFSGGYLHGFGIFNGSDGSIYRGVWRMNTQHGIGRKQYQNSDVYDGCWKEGVRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY WSNGNMY G WK G M GRGVMKWF+GDLFDGFW++GLRHGSGCYRFADGSYYF
Sbjct  121   GSGRYAWSNGNMYIGNWKDGKMCGRGVMKWFDGDLFDGFWLNGLRHGSGCYRFADGSYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGCA---LDKCKIDGHKEIRR-MLSHDSSISKKDAVKPKVKRSI  1290
             G W+ GLKDG G  YP G     L K   D H E R+  LSH SS +  ++VKPKVKRSI
Sbjct  181   GVWTKGLKDGLGMFYPAGSKHRFLGKSS-DRHDEKRKKQLSHTSS-TISESVKPKVKRSI  238

Query  1291  SEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNIT  1470
             SE+      + SG IS R  S   D AL  SS ++L  D+S +LS ++ D K++ L   +
Sbjct  239   SERFSYSLLKGSGSISLRTTSQGEDVALGDSSKDMLACDSSSVLSQSSHDDKSDFLETGS  298

Query  1471  VAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQ  1650
             VAYEREY QGVLI+ERI ++  LS +S QR KF AKEV++ SC+   +GRKSYYLMLNLQ
Sbjct  299   VAYEREYTQGVLIKERIINISRLSRKSKQRIKFHAKEVKRRSCVYFLEGRKSYYLMLNLQ  358

Query  1651  LGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFR  1830
             LGIRYSVGKITP+P+REVRQSDFG+QARIKMYFPRKGS+ TP H SIDFYWKDYCP+VFR
Sbjct  359   LGIRYSVGKITPVPIREVRQSDFGDQARIKMYFPRKGSQFTPSHHSIDFYWKDYCPMVFR  418

Query  1831  NLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKM  2010
              LR LFKL+AA+YMMSIC DDGLREL SPGKSGS+FYLS DDRFVIKTLKKSELKVLLKM
Sbjct  419   YLRELFKLDAAEYMMSICGDDGLRELSSPGKSGSLFYLSRDDRFVIKTLKKSELKVLLKM  478

Query  2011  LPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLG  2190
             LP YY+HVK+H+NTLITK FG++RISL+R KKVRFVVMGNMF TEL +H RYDLKGSS G
Sbjct  479   LPDYYRHVKEHDNTLITKVFGLHRISLKRGKKVRFVVMGNMFCTELRIHRRYDLKGSSHG  538

Query  2191  RFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHF  2370
             RFT KD+I+E TTLKDLDL YE  MDKLL E L KQLSLD +FLESQ+IIDYSLLLGLHF
Sbjct  539   RFTKKDRIDETTTLKDLDLKYEFHMDKLLREALFKQLSLDCRFLESQNIIDYSLLLGLHF  598

Query  2371  RAPEHLTALLEPPDSL----FKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIR  2538
             RAPE+L +LL+PPDSL      P+     S G +SI PR L LVTHEPS VST PGPHIR
Sbjct  599   RAPENLISLLQPPDSLDNVETNPEHEGGISQGELSIPPRGLILVTHEPSSVSTTPGPHIR  658

Query  2539  GKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVL  2718
             G TLRA SVGD+EVDLL+PGTGRLRVQLGVNMPAQAN+K+ QDET   +VELFEVYDVVL
Sbjct  659   GSTLRAMSVGDKEVDLLVPGTGRLRVQLGVNMPAQANQKLMQDETASVQVELFEVYDVVL  718

Query  2719  YLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA*P  2883
             YLGIIDILQ YNM+KKLEH YKSL+FDPMS+SVIEPKLYSKRFI+FLE+VF   P
Sbjct  719   YLGIIDILQEYNMKKKLEHTYKSLQFDPMSVSVIEPKLYSKRFINFLEKVFPVEP  773



>ref|XP_006349377.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006349378.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006349379.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X3 [Solanum tuberosum]
Length=774

 Score =  1086 bits (2808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/775 (70%), Positives = 623/775 (80%), Gaps = 9/775 (1%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++    E V  NGD Y+G FKGV PHGKGKYT SDG+ YDG WEEGKM+G+G+ +W S
Sbjct  1     MEDSGSITEMVLSNGDAYVGSFKGVFPHGKGKYTWSDGSVYDGCWEEGKMSGEGRFVWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA+Y+GD   GYLHGFG FS SDGS+Y+G W+MN QHG+GRK+YQNSD+YDGCWKEGVR+
Sbjct  61    GASYEGDFSGGYLHGFGIFSGSDGSIYRGVWRMNTQHGIGRKQYQNSDIYDGCWKEGVRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY WSNGNMY G WK G M GRGVMKWF+GDLFDG W++GLRHGSGCYRFADGSYYF
Sbjct  121   GSGRYAWSNGNMYIGNWKDGKMCGRGVMKWFDGDLFDGCWLNGLRHGSGCYRFADGSYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGCA---LDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSIS  1293
             G W+ GLKDG G  YP G     L KC  D + E R+      S S  ++VKPKVKRS S
Sbjct  181   GVWTKGLKDGHGMFYPAGSKHRFLKKCS-DRYDEKRKRRLSHISSSNSESVKPKVKRSFS  239

Query  1294  EKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
             E+I     R SG IS+R  S+  D AL  SS +++  D+S +LS ++ D + E L   +V
Sbjct  240   ERISYSLLRSSGSISQRTTSLREDIALGDSSRDMMTCDSSSVLSQSSLDDRTEFLETGSV  299

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
             AYEREY QGVLI+ERI ++  LS +S QR KF AKEV++ SC+D  +GRKSYYLMLNLQL
Sbjct  300   AYEREYTQGVLIKERIVNISRLSRKSKQRCKFHAKEVKRKSCVDFLEGRKSYYLMLNLQL  359

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRYSVGKITP+P+REVRQSDFG QARIKMYFPRKGS+ TP H S+DFYWKDYCP+VFR 
Sbjct  360   GIRYSVGKITPVPIREVRQSDFGNQARIKMYFPRKGSQFTPSHHSLDFYWKDYCPMVFRY  419

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR LFKL+AADYMMSIC DDGLREL SPGKSGS+FYLS DDRFVIKTLKKSELKVLLKML
Sbjct  420   LRELFKLDAADYMMSICGDDGLRELSSPGKSGSLFYLSRDDRFVIKTLKKSELKVLLKML  479

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YYKHVK+H+NTLITK FGV+RISL+R KKVRFVVMGNMF TEL +H RYDLKGSS GR
Sbjct  480   PDYYKHVKEHDNTLITKVFGVHRISLKRGKKVRFVVMGNMFCTELRIHRRYDLKGSSHGR  539

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             FT KD+I+E TTLKDLDL YE  MDKLL E L KQLSLD +FLESQ+IIDYSLLLGLHFR
Sbjct  540   FTKKDRIDETTTLKDLDLTYEFHMDKLLREALFKQLSLDCRFLESQNIIDYSLLLGLHFR  599

Query  2374  APEHLTALLEPPDSLFKPKSTLVSSDGGI-----SILPRSLTLVTHEPSIVSTAPGPHIR  2538
             APE+L +LLEPPDSL + ++     +GGI     SI PR L LVTHEPS V+  PGPH+R
Sbjct  600   APENLMSLLEPPDSLHRVETDPDHIEGGISQGELSIPPRGLLLVTHEPSSVNDTPGPHVR  659

Query  2539  GKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVL  2718
             G TLRA SVGD+EVDLLLPGTGRLRVQLGVNMPAQ N+KV QDE    +VELFEVYDVVL
Sbjct  660   GSTLRAMSVGDQEVDLLLPGTGRLRVQLGVNMPAQVNQKVMQDEAASVQVELFEVYDVVL  719

Query  2719  YLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA*P  2883
             YLGIIDILQ YNM+KKLEH YKSL+FDPMSIS IEPK+YSKRF+SFLE+VF   P
Sbjct  720   YLGIIDILQEYNMKKKLEHSYKSLQFDPMSISAIEPKIYSKRFLSFLEKVFPVEP  774



>ref|XP_009621865.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like [Nicotiana 
tomentosiformis]
 ref|XP_009621870.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like [Nicotiana 
tomentosiformis]
 ref|XP_009621878.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like [Nicotiana 
tomentosiformis]
Length=772

 Score =  1082 bits (2799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/775 (71%), Positives = 628/775 (81%), Gaps = 11/775 (1%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++    EKVF NGD Y+G FKG+LPHGKGKYT SDG+ YDG WEEGKMTG+G++IW S
Sbjct  1     MEDSGSITEKVFSNGDAYVGSFKGILPHGKGKYTWSDGSVYDGCWEEGKMTGEGRLIWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA+Y+GD   GYLHGFG F+ SDGS+Y+G W+MN QHG+GRK+YQNSDVYDGCWKEGVR+
Sbjct  61    GASYEGDFSGGYLHGFGIFNGSDGSIYRGVWRMNTQHGIGRKQYQNSDVYDGCWKEGVRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY WSNGNMY G WK G M GRGVMKWF+GDLFDGFW++GLRHGSGCYRFADGSYYF
Sbjct  121   GSGRYAWSNGNMYIGNWKDGKMCGRGVMKWFDGDLFDGFWLNGLRHGSGCYRFADGSYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGCA---LDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSIS  1293
             G W+ GLKDG G  YP G     L K      ++ ++ LSH SS +  ++VKPKV RSIS
Sbjct  181   GVWTKGLKDGLGMFYPAGSKHRFLRKTSDRHDQKRKKQLSHTSS-TISESVKPKVNRSIS  239

Query  1294  EKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
             E+      + SG IS R  S   D AL  SS ++L  D+S +LS ++ D K++ L   +V
Sbjct  240   ERFSYSLLKGSGSISLRTTSQGEDVALDDSSRDMLACDSSSVLSQSSDD-KSDFLETGSV  298

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
             AYEREY QGVLI+ERI ++  LS +S QR KF AKEV++ SC+   +GRKSYYLMLNLQL
Sbjct  299   AYEREYTQGVLIKERIINISRLSRKSKQRIKFHAKEVKRRSCVYFLEGRKSYYLMLNLQL  358

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRYSVGKITP+P+REVRQSDFG+QARIKMYFPRKGS+ TP H SIDFYWKDYCP+VFR 
Sbjct  359   GIRYSVGKITPVPIREVRQSDFGDQARIKMYFPRKGSQFTPSHHSIDFYWKDYCPMVFRY  418

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR LFKL+AA+YMMSIC DDGLREL SPGKSGS+FYLS DDRFVIKTLKKSELKVLLKML
Sbjct  419   LRELFKLDAAEYMMSICGDDGLRELSSPGKSGSLFYLSRDDRFVIKTLKKSELKVLLKML  478

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YY+HVK+H+NTLITK FG++RISL+R KKVRFVVMGNMF TEL +H RYDLKGSS GR
Sbjct  479   PDYYRHVKEHDNTLITKVFGLHRISLKRGKKVRFVVMGNMFCTELRIHRRYDLKGSSHGR  538

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             FT KD+I+E TTLKDLDL YE  MDKLL E L KQLSLD +FLESQ+IIDYSLLLGLHFR
Sbjct  539   FTKKDRIDEATTLKDLDLKYEFHMDKLLREALFKQLSLDCRFLESQNIIDYSLLLGLHFR  598

Query  2374  APEHLTALLEPPDSLFKPKSTLVSSDGGI-----SILPRSLTLVTHEPSIVSTAPGPHIR  2538
             APE+L +LL+PPDS      T    +GGI     SI PR L LVTHEPS VST PGPHIR
Sbjct  599   APENLISLLQPPDSQ-NNVETNPEHEGGIFQGELSIPPRGLILVTHEPSSVSTTPGPHIR  657

Query  2539  GKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVL  2718
             G TLRA SVGD+EVDLL+PGTGRLRVQLGVNMPAQAN+K+ QDE    +VELFEVYDVVL
Sbjct  658   GSTLRAMSVGDKEVDLLVPGTGRLRVQLGVNMPAQANQKLMQDEAASVQVELFEVYDVVL  717

Query  2719  YLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA*P  2883
             YLGIIDILQ YNM+KKLEH YKSL+FDPMS+SVIEPKLYSKRFI+FLE+VF   P
Sbjct  718   YLGIIDILQEYNMKKKLEHTYKSLQFDPMSVSVIEPKLYSKRFINFLEKVFPVEP  772



>ref|XP_004230495.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010314769.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform 
X1 [Solanum lycopersicum]
Length=774

 Score =  1073 bits (2776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/775 (71%), Positives = 622/775 (80%), Gaps = 9/775 (1%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++    E V  NGD Y+G FKGV PHGKGKYT SDG+ YDG WEEGKM+G+G+ +W S
Sbjct  1     MEDSGSITEMVLSNGDAYVGSFKGVFPHGKGKYTWSDGSVYDGCWEEGKMSGEGRFVWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA+Y+GD   GYLHGFG FS SDGSVY+G W+MN QHG+GRK+YQNSD+YDGCWKEGVR+
Sbjct  61    GASYEGDFSGGYLHGFGVFSGSDGSVYRGVWRMNTQHGIGRKQYQNSDIYDGCWKEGVRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY WSNGNMY G WK G M GRGVMKWF+GDLFDG W++GLRHGSGCYRFADGSYYF
Sbjct  121   GSGRYAWSNGNMYIGSWKDGKMCGRGVMKWFDGDLFDGCWLNGLRHGSGCYRFADGSYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGCA---LDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSIS  1293
             G W+ GLKDG G  YP G     L KC  D   E R+      S S  ++VKPKVKRS S
Sbjct  181   GVWTKGLKDGHGMFYPAGSKHRFLRKCS-DRSDEKRKRRLSHISSSNSESVKPKVKRSFS  239

Query  1294  EKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
             E+I     R SG IS+R  S+  D AL  SS +++  D+S +LS ++ D + E L   +V
Sbjct  240   ERISSSLLRSSGSISQRTTSLGEDIALGDSSRDIMTCDSSSVLSQSSLDDRTEFLETGSV  299

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
             AYEREY QGVLI+ERI ++  LS +S QR KF AKEV++ SC+D  +GRKSYYLMLNLQL
Sbjct  300   AYEREYTQGVLIKERIVNISKLSRKSKQRCKFHAKEVKRKSCVDFLEGRKSYYLMLNLQL  359

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRYSVGKITP+P+REVRQSDFG+QARIKMYFPRKGS+ TP H S+DFYWKDYCP+VFR 
Sbjct  360   GIRYSVGKITPVPIREVRQSDFGDQARIKMYFPRKGSQFTPSHHSLDFYWKDYCPMVFRY  419

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR LFKL+AADYMMSIC DDGLREL SPGKSGS+FYLS DDRFVIKTLKKSELK LLKML
Sbjct  420   LRELFKLDAADYMMSICGDDGLRELSSPGKSGSLFYLSRDDRFVIKTLKKSELKALLKML  479

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YYKHVK+H+NTLITK FGV+RISL+R KKVRFVVMGNMF TEL +H RYDLKGSS GR
Sbjct  480   PDYYKHVKEHDNTLITKVFGVHRISLKRGKKVRFVVMGNMFCTELRIHRRYDLKGSSHGR  539

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
              T KD+++E TTLKDLDL YE  MDKLL E L KQLSLD +FLESQ+IIDYSLLLGLHFR
Sbjct  540   LTKKDRVDETTTLKDLDLTYEFHMDKLLREALFKQLSLDCRFLESQNIIDYSLLLGLHFR  599

Query  2374  APEHLTALLEPPDSLFKPKSTLVSSDGGI-----SILPRSLTLVTHEPSIVSTAPGPHIR  2538
             APE+L +LLEPPDSL K ++     +GGI     SI PR L LVTHEPS V+  PGPHIR
Sbjct  600   APENLMSLLEPPDSLHKVETDPDHVEGGISQGELSIPPRGLLLVTHEPSSVNVTPGPHIR  659

Query  2539  GKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVL  2718
             G TLRA SVGD+EVDLLLPGTGRLRVQLGVNMPAQAN+KV QDE    +VELFEVYDVVL
Sbjct  660   GSTLRAMSVGDQEVDLLLPGTGRLRVQLGVNMPAQANQKVMQDEAASVQVELFEVYDVVL  719

Query  2719  YLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA*P  2883
             YLGIIDILQ YNM+KKLEH YKSL+FDPMSIS IEPK+YSKRF+SFLE+VF   P
Sbjct  720   YLGIIDILQEYNMKKKLEHTYKSLKFDPMSISAIEPKIYSKRFLSFLEKVFPVEP  774



>ref|XP_011092347.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum 
indicum]
 ref|XP_011092349.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum 
indicum]
Length=767

 Score =  1071 bits (2769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/765 (70%), Positives = 617/765 (81%), Gaps = 3/765 (0%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             MEN     EK+F NGDVY G FKG+LPHGKG Y  SDGT Y+GDWEEGKMTGKG+I W S
Sbjct  1     MENLGSVCEKIFSNGDVYSGDFKGMLPHGKGNYAWSDGTVYEGDWEEGKMTGKGKIFWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
               TY+GD   GYLHGFGTF  SDGS+YKG  KMN QHG+GRKEY NSDVYDGCW+EG R+
Sbjct  61    QVTYEGDFSGGYLHGFGTFIDSDGSIYKGSLKMNSQHGIGRKEYPNSDVYDGCWREGTRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY WSNGN+Y G WK G MSGRGVMKW NGDLFDGFW +GLRHGSG YRF DGSYYF
Sbjct  121   GSGRYVWSNGNIYIGTWKNGKMSGRGVMKWSNGDLFDGFWSNGLRHGSGFYRFTDGSYYF  180

Query  1123  GTWSNGLKDGRGTLYP-VGCALDKCKIDGHKEIRR-MLSHDSSISKKDAVKPKVKRSISE  1296
             GTW+ GLKDG GT YP V   L +  + G ++ ++   S  SS+  +++V P VKRS+SE
Sbjct  181   GTWTKGLKDGPGTFYPAVSKHLSESNLQGREDKKKKQPSRSSSMDSEESVIPNVKRSLSE  240

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVA  1476
             KI   F R S R S +  S+  D     S  E++  + SC+LS +  DG+ E   N TVA
Sbjct  241   KISSSFRRGSRRFSHKTTSLDDDWDSSSSVREMMSRERSCVLSQSFRDGQNEFPDNQTVA  300

Query  1477  YEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLG  1656
             YEREYMQGVLI+ERI+++  LSH++ Q+ KF AKEV++ S +D+F+G++SYYL L+LQLG
Sbjct  301   YEREYMQGVLIKERIRNISKLSHKTKQQLKF-AKEVKRSSWVDIFEGQRSYYLRLSLQLG  359

Query  1657  IRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNL  1836
             IRY+VGKITP+PMREVR SDFGEQARI+M FPRKGS+LTPPH SIDFYWKDYCP+VFRNL
Sbjct  360   IRYTVGKITPVPMREVRSSDFGEQARIRMNFPRKGSKLTPPHCSIDFYWKDYCPMVFRNL  419

Query  1837  RRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLP  2016
             R LFKLNAADYMMSIC DDGLREL SPGKSGS+FYLS DDRFVIKTLKKSELKVLLKMLP
Sbjct  420   RELFKLNAADYMMSICGDDGLRELCSPGKSGSLFYLSHDDRFVIKTLKKSELKVLLKMLP  479

Query  2017  SYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRF  2196
             +YY HVK H+NTLITKFFG +RI+LR  KKVRFVVMGNMF TEL +H RYDLKGSS GRF
Sbjct  480   NYYSHVKAHDNTLITKFFGAHRIALRHGKKVRFVVMGNMFCTELRIHRRYDLKGSSHGRF  539

Query  2197  TDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRA  2376
             T+KD+I+E TTLKDLDL YE +MD+ LHE+L +QL+LDS FLESQ IIDYSLLLGLHF A
Sbjct  540   TNKDEIDESTTLKDLDLAYEFQMDRSLHESLFRQLALDSAFLESQQIIDYSLLLGLHFSA  599

Query  2377  PEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRA  2556
             PEHL +LLEPPDSL K +S   + DG + I P +L LVTHEP  VS  PGPHIRG TL+A
Sbjct  600   PEHLKSLLEPPDSLHKVESISAAVDGDLLIRPTNLLLVTHEPGPVSPTPGPHIRGSTLKA  659

Query  2557  NSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIID  2736
              S+G++E DLLLPGTGRLRVQLGVNMPAQAN K+ Q ET  +E+ELFEVYDVVLYLGIID
Sbjct  660   FSIGNKEADLLLPGTGRLRVQLGVNMPAQANHKLMQAETASTEIELFEVYDVVLYLGIID  719

Query  2737  ILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             ILQ YNM+KK+EH  KS++FDP SISV+EPKLYSKRFISFLE++F
Sbjct  720   ILQEYNMKKKIEHTCKSMKFDPQSISVVEPKLYSKRFISFLEKIF  764



>ref|XP_010314775.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform 
X2 [Solanum lycopersicum]
Length=765

 Score =  1068 bits (2761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/765 (71%), Positives = 617/765 (81%), Gaps = 9/765 (1%)
 Frame = +1

Query  613   VFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFE  792
             V  NGD Y+G FKGV PHGKGKYT SDG+ YDG WEEGKM+G+G+ +W SGA+Y+GD   
Sbjct  2     VLSNGDAYVGSFKGVFPHGKGKYTWSDGSVYDGCWEEGKMSGEGRFVWPSGASYEGDFSG  61

Query  793   GYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNG  972
             GYLHGFG FS SDGSVY+G W+MN QHG+GRK+YQNSD+YDGCWKEGVR+G GRY WSNG
Sbjct  62    GYLHGFGVFSGSDGSVYRGVWRMNTQHGIGRKQYQNSDIYDGCWKEGVREGSGRYAWSNG  121

Query  973   NMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDG  1152
             NMY G WK G M GRGVMKWF+GDLFDG W++GLRHGSGCYRFADGSYYFG W+ GLKDG
Sbjct  122   NMYIGSWKDGKMCGRGVMKWFDGDLFDGCWLNGLRHGSGCYRFADGSYYFGVWTKGLKDG  181

Query  1153  RGTLYPVGCA---LDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARD  1323
              G  YP G     L KC  D   E R+      S S  ++VKPKVKRS SE+I     R 
Sbjct  182   HGMFYPAGSKHRFLRKCS-DRSDEKRKRRLSHISSSNSESVKPKVKRSFSERISSSLLRS  240

Query  1324  SGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGV  1503
             SG IS+R  S+  D AL  SS +++  D+S +LS ++ D + E L   +VAYEREY QGV
Sbjct  241   SGSISQRTTSLGEDIALGDSSRDIMTCDSSSVLSQSSLDDRTEFLETGSVAYEREYTQGV  300

Query  1504  LIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKIT  1683
             LI+ERI ++  LS +S QR KF AKEV++ SC+D  +GRKSYYLMLNLQLGIRYSVGKIT
Sbjct  301   LIKERIVNISKLSRKSKQRCKFHAKEVKRKSCVDFLEGRKSYYLMLNLQLGIRYSVGKIT  360

Query  1684  PIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAA  1863
             P+P+REVRQSDFG+QARIKMYFPRKGS+ TP H S+DFYWKDYCP+VFR LR LFKL+AA
Sbjct  361   PVPIREVRQSDFGDQARIKMYFPRKGSQFTPSHHSLDFYWKDYCPMVFRYLRELFKLDAA  420

Query  1864  DYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDH  2043
             DYMMSIC DDGLREL SPGKSGS+FYLS DDRFVIKTLKKSELK LLKMLP YYKHVK+H
Sbjct  421   DYMMSICGDDGLRELSSPGKSGSLFYLSRDDRFVIKTLKKSELKALLKMLPDYYKHVKEH  480

Query  2044  ENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEG  2223
             +NTLITK FGV+RISL+R KKVRFVVMGNMF TEL +H RYDLKGSS GR T KD+++E 
Sbjct  481   DNTLITKVFGVHRISLKRGKKVRFVVMGNMFCTELRIHRRYDLKGSSHGRLTKKDRVDET  540

Query  2224  TTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLE  2403
             TTLKDLDL YE  MDKLL E L KQLSLD +FLESQ+IIDYSLLLGLHFRAPE+L +LLE
Sbjct  541   TTLKDLDLTYEFHMDKLLREALFKQLSLDCRFLESQNIIDYSLLLGLHFRAPENLMSLLE  600

Query  2404  PPDSLFKPKSTLVSSDGGI-----SILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVG  2568
             PPDSL K ++     +GGI     SI PR L LVTHEPS V+  PGPHIRG TLRA SVG
Sbjct  601   PPDSLHKVETDPDHVEGGISQGELSIPPRGLLLVTHEPSSVNVTPGPHIRGSTLRAMSVG  660

Query  2569  DREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDILQA  2748
             D+EVDLLLPGTGRLRVQLGVNMPAQAN+KV QDE    +VELFEVYDVVLYLGIIDILQ 
Sbjct  661   DQEVDLLLPGTGRLRVQLGVNMPAQANQKVMQDEAASVQVELFEVYDVVLYLGIIDILQE  720

Query  2749  YNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA*P  2883
             YNM+KKLEH YKSL+FDPMSIS IEPK+YSKRF+SFLE+VF   P
Sbjct  721   YNMKKKLEHTYKSLKFDPMSISAIEPKIYSKRFLSFLEKVFPVEP  765


 Score = 72.4 bits (176),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = +1

Query  583  MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
            M        K + N D+Y G +K  +  G G+Y  S+G  Y G W++GKM G+G + W  
Sbjct  84   MNTQHGIGRKQYQNSDIYDGCWKEGVREGSGRYAWSNGNMYIGSWKDGKMCGRGVMKWFD  143

Query  763  GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
            G  +DG    G  HG G +  +DGS Y G W   ++ G G
Sbjct  144  GDLFDGCWLNGLRHGSGCYRFADGSYYFGVWTKGLKDGHG  183



>ref|XP_004299942.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Fragaria 
vesca subsp. vesca]
Length=767

 Score =  1033 bits (2671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/769 (66%), Positives = 609/769 (79%), Gaps = 12/769 (2%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++E   EK F N DVYIG FKG+LPHGKGKY  SDGT Y+GDWEEGKMTGKGQ+IW+S
Sbjct  1     MEDSE--SEKAFSNRDVYIGKFKGILPHGKGKYAWSDGTVYEGDWEEGKMTGKGQMIWTS  58

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y GD   GYLHGFG F+  DGS Y+G W+MNIQHG+G+K+Y NSD+Y+G WKEGV +
Sbjct  59    GAQYVGDFSGGYLHGFGMFTGPDGSFYQGCWRMNIQHGIGKKQYSNSDIYEGSWKEGVHE  118

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G+GRY+W++GN Y G WK G M GRGVMKW NGDLF+GFW++GLR GSG YRFADG YYF
Sbjct  119   GNGRYSWNSGNTYVGSWKGGKMCGRGVMKWDNGDLFNGFWLNGLRDGSGIYRFADGGYYF  178

Query  1123  GTWSNGLKDGRGTLYPVGCALDK----CKIDGHKEIRRMLSHDSSI-SKKDAVKPKVKRS  1287
             GTWS GLKDG+GT YP G         C   G+ +  + LS  S + S++   KP VKRS
Sbjct  179   GTWSRGLKDGKGTFYPAGTKHPSLKMWCSSLGYYDDGKGLSSGSLLNSEEGKAKPSVKRS  238

Query  1288  ISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
             +SEK+ V    R+S RIS +  S+  +      + E L   +S  LSHT+ DG+ E   N
Sbjct  239   VSEKLSVGGILRNSSRISHKCTSLDKNWTHLDPAKEFLRYGSSHSLSHTSEDGQQEAQDN  298

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLN  1644
              ++ YEREYMQGVLI+E++K+   +S +  QR+    +E +K SC+DL  G +SYYLMLN
Sbjct  299   NSLVYEREYMQGVLIKEKVKNNMEISKKGKQRKIISVQEAKK-SCIDLLGGNRSYYLMLN  357

Query  1645  LQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIV  1824
             LQLGIRY+VGKITP+P+REVR SDFG++ARI+MYFPRKGS+ TPPH SIDF WKDYCP+V
Sbjct  358   LQLGIRYTVGKITPVPVREVRSSDFGDRARIRMYFPRKGSQFTPPHYSIDFSWKDYCPMV  417

Query  1825  FRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLL  2004
             FRNLR +FKL+AA+YMMSIC DDGLREL SPGKSGS+FYLS DDRFVIKTLKKSELKVLL
Sbjct  418   FRNLREMFKLDAAEYMMSICGDDGLRELSSPGKSGSLFYLSHDDRFVIKTLKKSELKVLL  477

Query  2005  KMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSS  2184
             +MLPSYY HV +HENTLITKFFG++RI+L+ R+KVRF+VMGNMF TEL +H R+DLKGS+
Sbjct  478   RMLPSYYCHVGEHENTLITKFFGLHRITLKTRRKVRFMVMGNMFCTELRIHRRFDLKGST  537

Query  2185  LGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGL  2364
             LGR TD DKI+E TTLKDLDL +E  MDKLL E+L KQ+SLD +FLESQ IIDYSLLLGL
Sbjct  538   LGRCTDPDKIKENTTLKDLDLPFEFHMDKLLRESLFKQISLDCKFLESQQIIDYSLLLGL  597

Query  2365  HFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGK  2544
             HFRAPE+L A  +PPD    P    V   GG SI P+ L LVTHEP  VSTAPGPHIRG 
Sbjct  598   HFRAPENLKAFSQPPDDESLPTGVTV---GGFSIPPKGLVLVTHEPGSVSTAPGPHIRGS  654

Query  2545  TLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYL  2724
             TL+A S+GD+EVDLLLPGTGRLRVQLGVNMPAQAN KV QD+ D ++VELFE YDVVLY+
Sbjct  655   TLKAYSLGDQEVDLLLPGTGRLRVQLGVNMPAQANHKVPQDDADSTDVELFEFYDVVLYM  714

Query  2725  GIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             GIIDILQ YN++KKLEH YKSL+FDP++IS +EPKLY+KRFI+FLE+VF
Sbjct  715   GIIDILQEYNVKKKLEHAYKSLQFDPLTISAVEPKLYAKRFINFLEKVF  763



>ref|XP_011005207.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Populus 
euphratica]
Length=786

 Score =  1031 bits (2667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/781 (65%), Positives = 616/781 (79%), Gaps = 12/781 (2%)
 Frame = +1

Query  574   VIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQII  753
             ++ +E++E  DEK   NGDVYIG FKG LPHGKGKY  SDGT Y+GDWEEGK+TGKGQI+
Sbjct  7     LLDIEDSESIDEKPLSNGDVYIGSFKGSLPHGKGKYIWSDGTVYEGDWEEGKITGKGQIL  66

Query  754   WSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEG  933
             WSSGATY+GD   GYLHG GTF+  DGS Y+G W+MNIQHG+G K Y N D+Y+G WKEG
Sbjct  67    WSSGATYEGDFSGGYLHGIGTFTGLDGSEYRGAWRMNIQHGLGMKRYSNLDIYEGSWKEG  126

Query  934   VRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGS  1113
             V +G GRY+W++GNMY G WK G M GRGVMKW NGD+FDGFW++GLRHGSG YRFADG 
Sbjct  127   VNEGCGRYSWNSGNMYIGNWKGGKMCGRGVMKWENGDVFDGFWLNGLRHGSGVYRFADGG  186

Query  1114  YYFGTWSNGLKDGRGTLYPVGC---ALDK--CKIDGHKEIRRMLSHDSSISKKDA--VKP  1272
             YYFG WS GLKDG+GT +P G    +L K    I      R +LSH SSI+ ++    KP
Sbjct  187   YYFGMWSMGLKDGKGTFHPAGTKHPSLRKWGSSIGCDGIGRNLLSHSSSINSEEVRVPKP  246

Query  1273  KVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
              V  S+S K+ V +  +D GR+S+R   +    +L   S E +  + SCM S T+ +G++
Sbjct  247   NVLGSLSRKMSVSKILKDPGRLSQRNALLDEKWSLCNPSEEFIYREPSCMQSQTSEEGQS  306

Query  1450  EQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
                 N TV YEREY+QGVL  E+++ ++ L  ++ QR+KF  KE ++ SC+D+F+G++SY
Sbjct  307   GMENNSTVVYEREYLQGVLKNEKVRGIE-LYRKANQRKKFHVKEAKRNSCVDIFEGQRSY  365

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
             YLMLNLQLGIRY+VGKITP+PMREVR SDFG++ARI+MYFPRKGS+ TPPH SIDFYWKD
Sbjct  366   YLMLNLQLGIRYTVGKITPVPMREVRDSDFGDRARIRMYFPRKGSQFTPPHYSIDFYWKD  425

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FKL+AADYMMSIC DDGLREL SPGKSGSIFYLS DDRFVIKTLKK E
Sbjct  426   YCPMVFRNLREMFKLDAADYMMSICGDDGLRELSSPGKSGSIFYLSHDDRFVIKTLKKFE  485

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             LK LL+MLP+YY HV  +ENTLITKFFGV+RI+LR  +KVRFVVMGNMF TEL +H RYD
Sbjct  486   LKTLLQMLPNYYTHVGKYENTLITKFFGVHRITLRGGRKVRFVVMGNMFCTELRIHRRYD  545

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGS+ GR+TD+D + E TTLKDLDL YE  MDKLL ++L KQLSLD +FLESQ IIDYS
Sbjct  546   LKGSTQGRYTDEDNVGENTTLKDLDLEYEFLMDKLLRQSLFKQLSLDCRFLESQQIIDYS  605

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPK---STLVSSDGGISILPRSLTLVTHEPSIVSTA  2520
             LLLGLHFRAPEHL ++LEPP ++       +  ++S G +S  P+ L LVTHEP  VSTA
Sbjct  606   LLLGLHFRAPEHLRSILEPPATMLNDAGLPADGINSQGHLSTPPKGLLLVTHEPGFVSTA  665

Query  2521  PGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFE  2700
             PGPHIRG TL+A S+G+REVDLLLPGTGRLRVQLGVNMPAQA+ K+ +DE D +E+ELFE
Sbjct  666   PGPHIRGNTLKAYSLGEREVDLLLPGTGRLRVQLGVNMPAQASHKLTRDEVDSAEIELFE  725

Query  2701  VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA*  2880
             VYDVVLY+G+IDILQ YN++KK+EH  KSL+FDP+SIS +EPKLY+KRF++FL RVF   
Sbjct  726   VYDVVLYMGVIDILQEYNVKKKVEHACKSLKFDPLSISAVEPKLYAKRFLNFLHRVFPEQ  785

Query  2881  P  2883
             P
Sbjct  786   P  786



>ref|XP_002270419.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X3 [Vitis vinifera]
Length=789

 Score =  1028 bits (2657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/790 (67%), Positives = 612/790 (77%), Gaps = 24/790 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             MEN E   EKVF NGD+Y+G FKGV PHGKGKYT SDGT YDGDWEEGKMTGKGQI W +
Sbjct  1     MENAESLSEKVFSNGDIYVGNFKGVFPHGKGKYTWSDGTVYDGDWEEGKMTGKGQIFWFT  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA YDGD   G+LHG GT   SDGS Y G W+MNI+HG+G+K+Y NSDVY+G WKEGV +
Sbjct  61    GAKYDGDFSGGFLHGSGTLVGSDGSSYSGSWRMNIKHGLGKKQYCNSDVYEGLWKEGVHE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G G+Y W++GN+Y G WK G M GRGVMKW NGDL++GFW+DG+RHGSG YRF DG YYF
Sbjct  121   GCGKYAWNSGNIYIGNWKAGKMCGRGVMKWENGDLYNGFWLDGVRHGSGFYRFVDGGYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGC---ALDK--CKIDGHKEIRRMLSHDSSISKKD--AVKPKVK  1281
             GTWS GLKDG GT YP G    +L K    ID     + MLSH SS++ +   A+KP V 
Sbjct  181   GTWSRGLKDGPGTYYPAGSRHPSLTKWCSSIDYDDNRKTMLSHSSSLNSEGHGALKPSVS  240

Query  1282  RSISEKI---------VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTT  1434
             RS+SE I            F R SGRIS RA+S+  D ++  S+ E L  D S MLSH +
Sbjct  241   RSLSETISRSLSEKISTAGFFRSSGRISHRAMSLDEDCSVCDSAREFLAHDTSGMLSHAS  300

Query  1435  CDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFK  1614
              + + E     T+ YEREYMQGVLI+E+I+S    S ++ QR KF AKE ++ SCM +F+
Sbjct  301   DEDQHEMRDCCTLVYEREYMQGVLIKEKIRSSAVPSEKNKQRSKFHAKEAKQRSCMGIFE  360

Query  1615  G---RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHR  1785
                 R+SYYLMLNLQLGIRY+VGKITP+PMREVR SDFG++ARI+MYFPRKGS+ TPPH 
Sbjct  361   DHQRRRSYYLMLNLQLGIRYTVGKITPVPMREVRSSDFGDRARIRMYFPRKGSQFTPPHY  420

Query  1786  SIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFV  1965
             SIDFYWKDYCP+VFRNLR +FKL+AADYMMSIC DDGLREL SPGKSGS+FYLS DDRF+
Sbjct  421   SIDFYWKDYCPMVFRNLREMFKLDAADYMMSICGDDGLRELPSPGKSGSLFYLSHDDRFL  480

Query  1966  IKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTE  2145
             IKTLKKSELKVLLKMLP+YY HV  HENTLITKFFG++RI+LR  KKVRF+VMGNMF TE
Sbjct  481   IKTLKKSELKVLLKMLPNYYNHVAAHENTLITKFFGLHRITLRGGKKVRFMVMGNMFCTE  540

Query  2146  LHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLE  2325
             L +H RYDLKGSS GR+TDKDKI+  TTLKDLDL YE  MDK L ++L +Q+SLD  FLE
Sbjct  541   LRIHRRYDLKGSSQGRYTDKDKIDSNTTLKDLDLSYEFHMDKSLRKSLFQQISLDCMFLE  600

Query  2326  SQHIIDYSLLLGLHFRAPEHLTALLEPPDSLF----KPKSTLVSSDGGISILPRSLTLVT  2493
             SQ IIDYSLLLGLHF APEHL  LLE P++       P S   +S G + I P  L LVT
Sbjct  601   SQQIIDYSLLLGLHFSAPEHLKTLLELPETNHSHGNNPGSDGATSIGDLWIPPSGLILVT  660

Query  2494  HEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDET  2673
             HEP+  STAPGPH+RG  LRA SVGD+EVDLLLPGTGRLRVQLGVNMPAQANRKV QDE 
Sbjct  661   HEPN-GSTAPGPHMRGNPLRAYSVGDKEVDLLLPGTGRLRVQLGVNMPAQANRKVLQDEA  719

Query  2674  DPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFIS  2853
             +  EVELFEVYDVVLYLGIIDILQ YN+RKK EH YKSL+FDP++ISV+EPKLYS+RFI+
Sbjct  720   NSKEVELFEVYDVVLYLGIIDILQVYNVRKKAEHAYKSLQFDPLTISVVEPKLYSRRFIN  779

Query  2854  FLERVFRA*P  2883
             FLE+VF   P
Sbjct  780   FLEKVFPEQP  789



>gb|EYU26541.1| hypothetical protein MIMGU_mgv1a001773mg [Erythranthe guttata]
Length=761

 Score =  1025 bits (2651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/768 (66%), Positives = 601/768 (78%), Gaps = 20/768 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R+ EK+  NGDVY+G  KG+ PHGKGKYT  DGT Y+GDW EGKMTGKG+I W S AT++
Sbjct  8     RSCEKIILNGDVYLGAVKGMTPHGKGKYTWLDGTIYEGDWIEGKMTGKGKIYWPSQATFE  67

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGTF+ S+GS Y+G WKMN QHG+GRK+Y+NSD+YDGCW+EGV +G GRY
Sbjct  68    GDFSGGYLHGFGTFTGSEGSFYRGSWKMNSQHGIGRKQYRNSDIYDGCWREGVHEGSGRY  127

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
              WS+GN+Y G WK G MSGRG+MKW NGDLFDGFW +GLRHGSG YRF            
Sbjct  128   AWSSGNVYIGTWKNGRMSGRGIMKWLNGDLFDGFWSNGLRHGSGLYRF------------  175

Query  1138  GLKDGRGTLYPVGCA-LDKCKIDGHKEIRRMLSHDS-SISKKDAVKPKVKRSISEKIVDR  1311
             GLKDG GT Y  G   L K  + GHK  RR   H   S   +++  P V R++SEKI   
Sbjct  176   GLKDGPGTFYRAGNKHLSKLNLGGHKVKRRRQLHSYLSNESEESGLPSVNRTLSEKISSS  235

Query  1312  FARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREY  1491
             F RDS R S    S   D +   S  E+  ++ S ++S T+ DG+ E   N T+AYEREY
Sbjct  236   FRRDSARFSHGTTS-PDDLSRTGSMREITSDEKSQVVSVTSNDGRTEFADNRTLAYEREY  294

Query  1492  MQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSV  1671
             MQGVLI+ERI+++  LSH+S QR KF +KEV++ SCMD+++G++S+YLML+LQLGIRY+V
Sbjct  295   MQGVLIKERIRNITKLSHKSKQRLKF-SKEVKRTSCMDIYRGQRSHYLMLSLQLGIRYTV  353

Query  1672  GKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFK  1851
             GKITP+PMREVR SDFGEQARIKM+FPRKG++LTPPH SIDF WKDYCP+VFRNLR LFK
Sbjct  354   GKITPVPMREVRSSDFGEQARIKMFFPRKGTQLTPPHNSIDFNWKDYCPMVFRNLRELFK  413

Query  1852  LNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKH  2031
             LNAADYMMSIC DDGLREL SPGKSGS+FYLS DDRFVIKTLKKSELKVLLKMLP YY H
Sbjct  414   LNAADYMMSICGDDGLRELSSPGKSGSLFYLSHDDRFVIKTLKKSELKVLLKMLPHYYDH  473

Query  2032  VKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDK  2211
             V+ H+NTLITKFFG +RISLR  KKVRFVVMGNMF TEL +H RYDLKGSS GRFT+KD+
Sbjct  474   VQAHDNTLITKFFGAHRISLRHGKKVRFVVMGNMFCTELRIHRRYDLKGSSQGRFTNKDE  533

Query  2212  IEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLT  2391
             I+E TTLKDLDL YE  MD+LL ++L KQ+SLD  FLESQ IIDYSLLLGLHFRAPEHL 
Sbjct  534   IDESTTLKDLDLNYEFHMDRLLRDSLFKQISLDCGFLESQQIIDYSLLLGLHFRAPEHLK  593

Query  2392  ALLEPPDSLFKPKSTL----VSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRAN  2559
             +LLEPPD+     +      V S G + I PR+L LVTHEP+ VSTAPGPH+RG  L+A 
Sbjct  594   SLLEPPDAEQAENTNHMVDGVISQGELLIPPRALLLVTHEPTSVSTAPGPHVRGDALKAY  653

Query  2560  SVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDI  2739
             S+G++E DLLLPGTGRLRVQLGVNMPAQAN K+ Q ETD +EVELFEVYDVVLYLGIIDI
Sbjct  654   SIGNKEADLLLPGTGRLRVQLGVNMPAQANHKLMQAETDSAEVELFEVYDVVLYLGIIDI  713

Query  2740  LQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA*P  2883
             LQ YNM+KK+EH  KSL++D ++IS +EP  YSKRF++FLER+F   P
Sbjct  714   LQEYNMKKKIEHACKSLKYDHLAISAVEPSFYSKRFVTFLERMFPIQP  761


 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = +1

Query  583  MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
            M +      K + N D+Y G ++  +  G G+Y  S G  Y G W+ G+M+G+G + W +
Sbjct  95   MNSQHGIGRKQYRNSDIYDGCWREGVHEGSGRYAWSSGNVYIGTWKNGRMSGRGIMKWLN  154

Query  763  GATYDGDCFEGYLHGFGTF  819
            G  +DG    G  HG G +
Sbjct  155  GDLFDGFWSNGLRHGSGLY  173



>ref|XP_010657695.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X1 [Vitis vinifera]
 ref|XP_010657696.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X1 [Vitis vinifera]
 ref|XP_010657697.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X1 [Vitis vinifera]
Length=792

 Score =  1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/793 (66%), Positives = 611/793 (77%), Gaps = 27/793 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             MEN E   EKVF NGD+Y+G FKGV PHGKGKYT SDGT YDGDWEEGKMTGKGQI W +
Sbjct  1     MENAESLSEKVFSNGDIYVGNFKGVFPHGKGKYTWSDGTVYDGDWEEGKMTGKGQIFWFT  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA YDGD   G+LHG GT   SDGS Y G W+MNI+HG+G+K+Y NSDVY+G WKEGV +
Sbjct  61    GAKYDGDFSGGFLHGSGTLVGSDGSSYSGSWRMNIKHGLGKKQYCNSDVYEGLWKEGVHE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G G+Y W++GN+Y G WK G M GRGVMKW NGDL++GFW+DG+RHGSG YRF DG YYF
Sbjct  121   GCGKYAWNSGNIYIGNWKAGKMCGRGVMKWENGDLYNGFWLDGVRHGSGFYRFVDGGYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGC---ALDK--CKIDGHKEIRRMLSHDSSISKKD--AVKPKVK  1281
             GTWS GLKDG GT YP G    +L K    ID     + MLSH SS++ +   A+KP V 
Sbjct  181   GTWSRGLKDGPGTYYPAGSRHPSLTKWCSSIDYDDNRKTMLSHSSSLNSEGHGALKPSVS  240

Query  1282  RSISEKI---------VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTT  1434
             RS+SE I            F R SGRIS RA+S+  D ++  S+ E L  D S MLSH +
Sbjct  241   RSLSETISRSLSEKISTAGFFRSSGRISHRAMSLDEDCSVCDSAREFLAHDTSGMLSHAS  300

Query  1435  CDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFK  1614
              + + E     T+ YEREYMQGVLI+E+I+S    S ++ QR KF AKE ++ SCM +F+
Sbjct  301   DEDQHEMRDCCTLVYEREYMQGVLIKEKIRSSAVPSEKNKQRSKFHAKEAKQRSCMGIFE  360

Query  1615  G---RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHR  1785
                 R+SYYLMLNLQLGIRY+VGKITP+PMREVR SDFG++ARI+MYFPRKGS+ TPPH 
Sbjct  361   DHQRRRSYYLMLNLQLGIRYTVGKITPVPMREVRSSDFGDRARIRMYFPRKGSQFTPPHY  420

Query  1786  SIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFV  1965
             SIDFYWKDYCP+VFRNLR +FKL+AADYMMSIC DDGLREL SPGKSGS+FYLS DDRF+
Sbjct  421   SIDFYWKDYCPMVFRNLREMFKLDAADYMMSICGDDGLRELPSPGKSGSLFYLSHDDRFL  480

Query  1966  IKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTE  2145
             IKTLKKSELKVLLKMLP+YY HV  HENTLITKFFG++RI+LR  KKVRF+VMGNMF TE
Sbjct  481   IKTLKKSELKVLLKMLPNYYNHVAAHENTLITKFFGLHRITLRGGKKVRFMVMGNMFCTE  540

Query  2146  LHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLE  2325
             L +H RYDLKGSS GR+TDKDKI+  TTLKDLDL YE  MDK L ++L +Q+SLD  FLE
Sbjct  541   LRIHRRYDLKGSSQGRYTDKDKIDSNTTLKDLDLSYEFHMDKSLRKSLFQQISLDCMFLE  600

Query  2326  SQHIIDYSLLLGLHFRAPEHLTALLEPPDSLF-------KPKSTLVSSDGGISILPRSLT  2484
             SQ IIDYSLLLGLHF APEHL  LLE P++            S   +S G + I P  L 
Sbjct  601   SQQIIDYSLLLGLHFSAPEHLKTLLELPETNHSHGNNPGSDGSYGATSIGDLWIPPSGLI  660

Query  2485  LVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQ  2664
             LVTHEP+  STAPGPH+RG  LRA SVGD+EVDLLLPGTGRLRVQLGVNMPAQANRKV Q
Sbjct  661   LVTHEPN-GSTAPGPHMRGNPLRAYSVGDKEVDLLLPGTGRLRVQLGVNMPAQANRKVLQ  719

Query  2665  DETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKR  2844
             DE +  EVELFEVYDVVLYLGIIDILQ YN+RKK EH YKSL+FDP++ISV+EPKLYS+R
Sbjct  720   DEANSKEVELFEVYDVVLYLGIIDILQVYNVRKKAEHAYKSLQFDPLTISVVEPKLYSRR  779

Query  2845  FISFLERVFRA*P  2883
             FI+FLE+VF   P
Sbjct  780   FINFLEKVFPEQP  792



>ref|XP_010657699.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X2 [Vitis vinifera]
Length=790

 Score =  1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/793 (66%), Positives = 611/793 (77%), Gaps = 29/793 (4%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             MEN E   EKVF NGD+Y+G FKGV PHGKGKYT SDGT YDGDWEEGKMTGKGQI W +
Sbjct  1     MENAE--SEKVFSNGDIYVGNFKGVFPHGKGKYTWSDGTVYDGDWEEGKMTGKGQIFWFT  58

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA YDGD   G+LHG GT   SDGS Y G W+MNI+HG+G+K+Y NSDVY+G WKEGV +
Sbjct  59    GAKYDGDFSGGFLHGSGTLVGSDGSSYSGSWRMNIKHGLGKKQYCNSDVYEGLWKEGVHE  118

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G G+Y W++GN+Y G WK G M GRGVMKW NGDL++GFW+DG+RHGSG YRF DG YYF
Sbjct  119   GCGKYAWNSGNIYIGNWKAGKMCGRGVMKWENGDLYNGFWLDGVRHGSGFYRFVDGGYYF  178

Query  1123  GTWSNGLKDGRGTLYPVGC---ALDK--CKIDGHKEIRRMLSHDSSISKKD--AVKPKVK  1281
             GTWS GLKDG GT YP G    +L K    ID     + MLSH SS++ +   A+KP V 
Sbjct  179   GTWSRGLKDGPGTYYPAGSRHPSLTKWCSSIDYDDNRKTMLSHSSSLNSEGHGALKPSVS  238

Query  1282  RSISEKI---------VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTT  1434
             RS+SE I            F R SGRIS RA+S+  D ++  S+ E L  D S MLSH +
Sbjct  239   RSLSETISRSLSEKISTAGFFRSSGRISHRAMSLDEDCSVCDSAREFLAHDTSGMLSHAS  298

Query  1435  CDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFK  1614
              + + E     T+ YEREYMQGVLI+E+I+S    S ++ QR KF AKE ++ SCM +F+
Sbjct  299   DEDQHEMRDCCTLVYEREYMQGVLIKEKIRSSAVPSEKNKQRSKFHAKEAKQRSCMGIFE  358

Query  1615  G---RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHR  1785
                 R+SYYLMLNLQLGIRY+VGKITP+PMREVR SDFG++ARI+MYFPRKGS+ TPPH 
Sbjct  359   DHQRRRSYYLMLNLQLGIRYTVGKITPVPMREVRSSDFGDRARIRMYFPRKGSQFTPPHY  418

Query  1786  SIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFV  1965
             SIDFYWKDYCP+VFRNLR +FKL+AADYMMSIC DDGLREL SPGKSGS+FYLS DDRF+
Sbjct  419   SIDFYWKDYCPMVFRNLREMFKLDAADYMMSICGDDGLRELPSPGKSGSLFYLSHDDRFL  478

Query  1966  IKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTE  2145
             IKTLKKSELKVLLKMLP+YY HV  HENTLITKFFG++RI+LR  KKVRF+VMGNMF TE
Sbjct  479   IKTLKKSELKVLLKMLPNYYNHVAAHENTLITKFFGLHRITLRGGKKVRFMVMGNMFCTE  538

Query  2146  LHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLE  2325
             L +H RYDLKGSS GR+TDKDKI+  TTLKDLDL YE  MDK L ++L +Q+SLD  FLE
Sbjct  539   LRIHRRYDLKGSSQGRYTDKDKIDSNTTLKDLDLSYEFHMDKSLRKSLFQQISLDCMFLE  598

Query  2326  SQHIIDYSLLLGLHFRAPEHLTALLEPPDSLF-------KPKSTLVSSDGGISILPRSLT  2484
             SQ IIDYSLLLGLHF APEHL  LLE P++            S   +S G + I P  L 
Sbjct  599   SQQIIDYSLLLGLHFSAPEHLKTLLELPETNHSHGNNPGSDGSYGATSIGDLWIPPSGLI  658

Query  2485  LVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQ  2664
             LVTHEP+  STAPGPH+RG  LRA SVGD+EVDLLLPGTGRLRVQLGVNMPAQANRKV Q
Sbjct  659   LVTHEPN-GSTAPGPHMRGNPLRAYSVGDKEVDLLLPGTGRLRVQLGVNMPAQANRKVLQ  717

Query  2665  DETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKR  2844
             DE +  EVELFEVYDVVLYLGIIDILQ YN+RKK EH YKSL+FDP++ISV+EPKLYS+R
Sbjct  718   DEANSKEVELFEVYDVVLYLGIIDILQVYNVRKKAEHAYKSLQFDPLTISVVEPKLYSRR  777

Query  2845  FISFLERVFRA*P  2883
             FI+FLE+VF   P
Sbjct  778   FINFLEKVFPEQP  790



>ref|XP_002298172.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
 gb|EEE82977.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
Length=786

 Score =  1012 bits (2616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/781 (64%), Positives = 611/781 (78%), Gaps = 12/781 (2%)
 Frame = +1

Query  574   VIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQII  753
             ++ +E++E  DEK   NGDVYIG FKG LPHGKGKY  SDGT Y+GDWEEGK+TGKGQI+
Sbjct  7     LLDIEDSESIDEKPLSNGDVYIGSFKGSLPHGKGKYIWSDGTVYEGDWEEGKITGKGQIL  66

Query  754   WSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEG  933
             WSSGA Y+GD   GYLHG GTF+  DGS Y+G W+MNIQHG+G K Y N D+Y+G WKEG
Sbjct  67    WSSGAIYEGDFSGGYLHGIGTFTGLDGSEYRGAWRMNIQHGLGMKRYSNLDIYEGSWKEG  126

Query  934   VRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGS  1113
             + +G GRY+W++GNMY G WK G M GRGVMKW NGD+FDGFW++GLRHGSG YRF+DG 
Sbjct  127   MNEGCGRYSWNSGNMYIGNWKGGKMCGRGVMKWENGDVFDGFWLNGLRHGSGVYRFSDGG  186

Query  1114  YYFGTWSNGLKDGRGTLYPVGC---ALDK--CKIDGHKEIRRMLSHDSSISKKDA--VKP  1272
             YYFG WS GLKDG+GT +P G    +L K    I      R +LSH SSI+ ++    KP
Sbjct  187   YYFGMWSMGLKDGKGTFHPAGTKHPSLRKWGSSIGCDGIGRNLLSHSSSINSEEVRVPKP  246

Query  1273  KVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
                 S+S K+ + +  +D  R+S+R   +    +L   S E +  + SC LS T+ +G++
Sbjct  247   NFLGSLSGKMSISKILKDPVRLSQRNALLDEKWSLCNPSGEFIYREPSCTLSQTSEEGQS  306

Query  1450  EQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
                 N TV YEREY+QGVL  E+++  + LS ++ QR+KF  KE ++ SC+D+F+G++SY
Sbjct  307   GVQNNSTVVYEREYLQGVLKNEKVRGTE-LSRKTKQRKKFHVKEAKRKSCVDIFEGQRSY  365

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
             YLMLNLQLGIRY+VGKITP+PMREVR SDFG++ARI+MYFPRKGS+ TPPH SIDFYWKD
Sbjct  366   YLMLNLQLGIRYTVGKITPVPMREVRDSDFGDRARIRMYFPRKGSQFTPPHYSIDFYWKD  425

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FKL+AADYMMSIC DDGLREL S GKSGSIFYLS DDRFVIKTLKK E
Sbjct  426   YCPMVFRNLREMFKLDAADYMMSICGDDGLRELSSSGKSGSIFYLSHDDRFVIKTLKKFE  485

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             LK LL+MLP+YY HV  +ENTLITKFFGV+RI+LR  +KVRFVVMGNMF TEL +H R+D
Sbjct  486   LKTLLQMLPNYYIHVGKYENTLITKFFGVHRITLRGGRKVRFVVMGNMFCTELRIHRRFD  545

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGS+ GR+TD+DK+ E TTLKDLDL YE  MDKLL ++L KQLSLD  FLESQ IIDYS
Sbjct  546   LKGSTQGRYTDEDKVGENTTLKDLDLEYEFLMDKLLRKSLFKQLSLDCSFLESQQIIDYS  605

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPK---STLVSSDGGISILPRSLTLVTHEPSIVSTA  2520
             LLLGLHFRAPE L ++LEPP ++       +  ++S G +S  P+ L LVTHEP  VSTA
Sbjct  606   LLLGLHFRAPEQLRSILEPPATMLNDAGLPADGINSQGHLSTPPKGLLLVTHEPGFVSTA  665

Query  2521  PGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFE  2700
             PGPHIRG TL+A S+G+REVDLLLPGTGRLRVQLGVNMPAQA+ K+ +DE D +E+ELFE
Sbjct  666   PGPHIRGNTLKAYSLGEREVDLLLPGTGRLRVQLGVNMPAQASHKLTRDEVDSAEIELFE  725

Query  2701  VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA*  2880
             VYDVVLY+G+IDILQ YN++KK+EH  KSL+FDP+SIS +EPKLY+KRF++FL +VF   
Sbjct  726   VYDVVLYMGVIDILQEYNVKKKVEHACKSLKFDPLSISAVEPKLYAKRFLNFLHKVFPEQ  785

Query  2881  P  2883
             P
Sbjct  786   P  786



>ref|XP_007225243.1| hypothetical protein PRUPE_ppa001726mg [Prunus persica]
 gb|EMJ26442.1| hypothetical protein PRUPE_ppa001726mg [Prunus persica]
Length=773

 Score =  1002 bits (2591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/773 (65%), Positives = 604/773 (78%), Gaps = 28/773 (4%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK F N DVYIG FKG+LPHG G YT SDGT Y+GDWEEGKMTGKG++IW+SGA Y GD 
Sbjct  7     EKAFSNRDVYIGNFKGILPHGNGNYTWSDGTVYEGDWEEGKMTGKGKLIWTSGAQYVGDF  66

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GYLHG+G F+  DGS Y+G W+MNIQHG+G+K+Y NSD+Y+G WKEGV +G+GRY+W+
Sbjct  67    SGGYLHGYGIFTGCDGSFYQGSWRMNIQHGMGKKQYCNSDIYEGSWKEGVHEGNGRYSWN  126

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             +GN Y G WK G M GRG+MKW NGDLF+GFW++GLR GSG YRFADG YYFGTWS GLK
Sbjct  127   SGNAYIGSWKGGKMCGRGIMKWANGDLFNGFWLNGLRDGSGVYRFADGGYYFGTWSRGLK  186

Query  1147  DGRGTLYPVGC----------ALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISE  1296
             DG+GT YPVG           +LD C  DG   +  +L+     S++   +P VKRS SE
Sbjct  187   DGKGTFYPVGTKHPSLKKWCSSLDYCN-DG-TSLSGLLN-----SEESRAQPSVKRSFSE  239

Query  1297  KI-VDRFARDSGRISRRAVSVAGDAALHCS-STEVLPEDASCMLSHTTCDGKAEQLGNIT  1470
             K+ +    R+S RIS +A+S+  +   HC  S E +  D+   LSH + +G+ E   N +
Sbjct  240   KLSISGLLRNSSRISHKAMSLDKNWT-HCDPSQEFIRYDSLSALSHASEEGQPEAQDNSS  298

Query  1471  VAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGR-KSYYLMLNL  1647
             V YEREYMQGVLI+ER  +   +S +S QR K    + ++ SC+D+F    +SYYLMLNL
Sbjct  299   V-YEREYMQGVLIKERASNYTEISRKSKQRNKIAVMQEKR-SCIDIFGAHSRSYYLMLNL  356

Query  1648  QLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVF  1827
             QLGIRY+VGKITP+P+REVR SDFG++ARI+MYFPRKGS+ TPPH S+DFYWKDYCP+VF
Sbjct  357   QLGIRYTVGKITPVPVREVRSSDFGDRARIRMYFPRKGSQFTPPHYSVDFYWKDYCPMVF  416

Query  1828  RNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLK  2007
             RNLR +FKL+AA+YMMSIC DDGLREL SPGKSGSIFYLS DDRFVIKTL+K+ELKVLLK
Sbjct  417   RNLREMFKLDAAEYMMSICGDDGLRELSSPGKSGSIFYLSHDDRFVIKTLRKTELKVLLK  476

Query  2008  MLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSL  2187
             MLPSYY HV +HENTLITK FG++RI+L+  KKVRF+VMGNMF TEL +H RYDLKGSS+
Sbjct  477   MLPSYYCHVGEHENTLITKIFGLHRITLKGGKKVRFMVMGNMFCTELRIHRRYDLKGSSI  536

Query  2188  GRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLH  2367
             GR TDKDKI+E TTLKDLDL +E  MDKLL E+L KQ+SLD  FL+SQ IIDYSLLLGLH
Sbjct  537   GRSTDKDKIDENTTLKDLDLKFEFHMDKLLRESLFKQISLDCMFLQSQQIIDYSLLLGLH  596

Query  2368  FRAPEHLTALLEPPDSLFKPKST-----LVSSDGGISILPRSLTLVTHEPSIVSTAPGPH  2532
             F  PE+L A  +PP ++   ++      + SS G + I P+ L LVTHEP  VSTAPGPH
Sbjct  597   FIVPENLKAFSQPPGTMHNHENLATGDGVTSSQGELLIPPKGLLLVTHEPGSVSTAPGPH  656

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG TL+A S+GD+EVDLLLPGTGRLRVQLGVNMPAQAN K+ QDE D +EVELFE YDV
Sbjct  657   IRGSTLKAYSLGDKEVDLLLPGTGRLRVQLGVNMPAQANLKLLQDEVDSTEVELFEFYDV  716

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VLY+GIIDILQ YN++KK+EH YKSL+FDP SIS +EPKLY+KRFI+FLE+VF
Sbjct  717   VLYMGIIDILQEYNVKKKVEHAYKSLQFDPQSISAVEPKLYAKRFINFLEKVF  769


 Score = 79.0 bits (193),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = +1

Query  865   IQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGD  1044
             +++ V  K + N DVY G +K  +  G+G YTWS+G +Y G W++G M+G+G + W +G 
Sbjct  1     MEYTVSEKAFSNRDVYIGNFKGILPHGNGNYTWSDGTVYEGDWEEGKMTGKGKLIWTSGA  60

Query  1045  LFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
              + G +  G  HG G +   DGS+Y G+W   ++ G G
Sbjct  61    QYVGDFSGGYLHGYGIFTGCDGSFYQGSWRMNIQHGMG  98



>ref|XP_008218794.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like [Prunus 
mume]
Length=773

 Score =  1001 bits (2589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/773 (64%), Positives = 603/773 (78%), Gaps = 28/773 (4%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK F N DVYIG FKG+LPHG G YT SDGT Y+GDWEEGKMTGKG++IW+SGA Y GD 
Sbjct  7     EKAFSNRDVYIGNFKGILPHGNGNYTWSDGTAYEGDWEEGKMTGKGKLIWTSGAQYSGDF  66

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GYLHG+G F+  DGS Y+G W+MNIQHG+G+K+Y NSD+Y+G WKEGV +G GRY+W+
Sbjct  67    SGGYLHGYGIFTGCDGSFYQGSWRMNIQHGMGKKQYCNSDIYEGSWKEGVHEGSGRYSWN  126

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             +GN Y G WK G M GRG+MKW NGDLF+GFW++GLR GSG YRFADG YYFGTWS GLK
Sbjct  127   SGNAYIGSWKGGKMCGRGIMKWANGDLFNGFWLNGLRDGSGVYRFADGGYYFGTWSRGLK  186

Query  1147  DGRGTLYPVGC----------ALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISE  1296
             DG+GT YPVG           +LD C  DG   +  +L+     S++   +P VKRS SE
Sbjct  187   DGKGTFYPVGTKHPSLKKWCSSLDYCN-DG-TSLSGLLN-----SEESRAQPSVKRSFSE  239

Query  1297  KI-VDRFARDSGRISRRAVSVAGDAALHCS-STEVLPEDASCMLSHTTCDGKAEQLGNIT  1470
             K+      R+S RIS +A+S+  +   HC  S E +  D+ C LSH + +G+ E   N +
Sbjct  240   KLSFSGLLRNSSRISHKAMSLDKNWT-HCDPSREFIRYDSLCTLSHASEEGQPEAQDNSS  298

Query  1471  VAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGR-KSYYLMLNL  1647
             V YEREYMQGVLI+ER  +   +S +S QR K    + ++ SC+D+F    +SYYLMLNL
Sbjct  299   V-YEREYMQGVLIKERASNHTEISRKSKQRNKIAVMQEKR-SCIDIFGAHSRSYYLMLNL  356

Query  1648  QLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVF  1827
             QLGIRY+VGKITP+P+REVR SDFG++ARI+MYFPRKGS+ TPPH S+DFYWKDYCP+VF
Sbjct  357   QLGIRYTVGKITPVPVREVRSSDFGDRARIRMYFPRKGSQFTPPHYSVDFYWKDYCPMVF  416

Query  1828  RNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLK  2007
             RNLR +FKL+AA+YMMSIC DDGLREL SPGKSGSIFYLS DDRFVIKTL+K+ELKVLLK
Sbjct  417   RNLREMFKLDAAEYMMSICGDDGLRELSSPGKSGSIFYLSHDDRFVIKTLRKTELKVLLK  476

Query  2008  MLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSL  2187
             MLPSYY HV +HENTLITK FG++RI+L+  KKVRF+VMGNMF TEL +H RYDLKGSS+
Sbjct  477   MLPSYYCHVGEHENTLITKIFGLHRITLKGGKKVRFMVMGNMFCTELRIHRRYDLKGSSI  536

Query  2188  GRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLH  2367
             GR T+KDK++E TTLKDLDL +E  MDKLL E+L KQ+SLD  FL+SQ IIDYSLLLGLH
Sbjct  537   GRSTNKDKVDENTTLKDLDLKFEFHMDKLLRESLFKQISLDCMFLQSQQIIDYSLLLGLH  596

Query  2368  FRAPEHLTALLEPPDSLFKPKST-----LVSSDGGISILPRSLTLVTHEPSIVSTAPGPH  2532
             F  PE+L A+ +PP ++   ++      + SS G + I P+ L LVTHEP  VSTAPGPH
Sbjct  597   FIVPENLKAISQPPGTMHNHENLATGDGVTSSQGELLIPPKGLLLVTHEPGSVSTAPGPH  656

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG TL+A S+GD+EVDLLLPGTGRLRVQLGVNMPA AN K+ QDE D +EVELFE YDV
Sbjct  657   IRGSTLKAYSLGDKEVDLLLPGTGRLRVQLGVNMPAHANLKLLQDEVDSTEVELFEFYDV  716

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VLY+GIIDILQ YN++KK+EH YKSL+FDP SIS +EPKLY+KRFI+FLE+VF
Sbjct  717   VLYMGIIDILQEYNVKKKVEHAYKSLQFDPQSISAVEPKLYAKRFINFLEKVF  769


 Score = 79.3 bits (194),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 58/98 (59%), Gaps = 0/98 (0%)
 Frame = +1

Query  865   IQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGD  1044
             +++ V  K + N DVY G +K  +  G+G YTWS+G  Y G W++G M+G+G + W +G 
Sbjct  1     MEYTVSEKAFSNRDVYIGNFKGILPHGNGNYTWSDGTAYEGDWEEGKMTGKGKLIWTSGA  60

Query  1045  LFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
              + G +  G  HG G +   DGS+Y G+W   ++ G G
Sbjct  61    QYSGDFSGGYLHGYGIFTGCDGSFYQGSWRMNIQHGMG  98



>ref|XP_006471081.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Citrus 
sinensis]
Length=785

 Score =   999 bits (2582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/791 (63%), Positives = 602/791 (76%), Gaps = 30/791 (4%)
 Frame = +1

Query  574   VIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQII  753
             ++IME+  R  +K F NGD+Y+G F+G LPHGKGKY   DGT Y+GDWEEGKMTGKG I+
Sbjct  4     LLIMEDTGRL-KKSFTNGDIYVGNFEGELPHGKGKYIWLDGTVYEGDWEEGKMTGKGYIV  62

Query  754   WSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEG  933
             W SGA Y+GD   GYL GFGTF+  DGSVY+G+W+MNI+HG+GRKEY NSD+YDG WKEG
Sbjct  63    WPSGAKYEGDFSGGYLDGFGTFTGHDGSVYRGNWRMNIRHGLGRKEYPNSDIYDGSWKEG  122

Query  934   VRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGS  1113
             V +G GRY+W++GN+Y G WK G MSGRGVMKW NGD++DG W++G RHGSG Y FADG 
Sbjct  123   VHEGSGRYSWNSGNIYIGSWKDGKMSGRGVMKWMNGDIYDGSWLNGYRHGSGVYMFADGG  182

Query  1114  YYFGTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSH-------------DSSISK  1254
             +Y GTWS GLKDG+G  YP G          H  +RRM S+              SSI+ 
Sbjct  183   HYSGTWSKGLKDGKGKFYPAGSK--------HPSLRRMCSNLGYDDNTKGLPSQGSSINS  234

Query  1255  K--DAVKPKVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLS  1425
             +  +  KP+VKRS+SE+I V    R SGRIS R  S+ G+ +    S + +  D S  L 
Sbjct  235   EGSETSKPRVKRSLSERISVGGLLRSSGRISHRTSSLDGNWSQRHPSVKSISNDFSSKLL  294

Query  1426  HTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMD  1605
             H + + +++      V YEREYMQGVL++E +++    + +   R K   KEV+K SC+D
Sbjct  295   HDSDESQSDVPDGSPVVYEREYMQGVLMKETVRNYTEQTRKGKPRNKHSVKEVKKKSCVD  354

Query  1606  LFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHR  1785
             +F+G +SYYLMLNLQLGIRY+VGKITP+PMREVR SDFG++ARI+MYFPRKGS+ TPPH 
Sbjct  355   IFEGHRSYYLMLNLQLGIRYTVGKITPVPMREVRSSDFGDRARIRMYFPRKGSQFTPPHN  414

Query  1786  SIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFV  1965
             SIDF WKDYCP+VFRNLR +FKL+AA+YMMSIC DDGLRE  SPGKSGSIFYLS DDRF 
Sbjct  415   SIDFSWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLRERSSPGKSGSIFYLSHDDRFF  474

Query  1966  IKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTE  2145
             IKTLKK+ELKVLL+ML  YY HVK HENTLITKFFG++RI+LR  +KVRFVVMGNMF TE
Sbjct  475   IKTLKKTELKVLLRMLHEYYIHVKKHENTLITKFFGLHRITLRGGRKVRFVVMGNMFCTE  534

Query  2146  LHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLE  2325
             L +H  YDLKGS++GR TDKDKI+E TTLKDLDL +E +MDKLL E L KQ+S+D +FLE
Sbjct  535   LRIHRSYDLKGSTVGRCTDKDKIKENTTLKDLDLSFEFQMDKLLREYLFKQISIDCEFLE  594

Query  2326  SQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKST-----LVSSDGGISILPRSLTLV  2490
             SQ IIDYSLLLGLHFRAPEHL ALLE P +     S      ++ S G + I P+ L LV
Sbjct  595   SQQIIDYSLLLGLHFRAPEHLKALLELPTTATNSDSLPRTDGIIGSQGELIIPPKGLLLV  654

Query  2491  THEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDE  2670
             THEPS VSTAPGPHIRG TLRA SVGD+EVDLL+PGTGR +VQLGVNMPAQAN K+  +E
Sbjct  655   THEPSFVSTAPGPHIRGSTLRAFSVGDKEVDLLIPGTGRFKVQLGVNMPAQANHKLLDNE  714

Query  2671  TDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFI  2850
              D +EVELFEVYDVVLY+GIIDILQ YN++KK+EH +KSL+FDP  ISV+EPK Y+ RFI
Sbjct  715   CDSNEVELFEVYDVVLYMGIIDILQEYNVKKKIEHAFKSLQFDPQLISVVEPKFYASRFI  774

Query  2851  SFLERVFRA*P  2883
             +FL++ F   P
Sbjct  775   NFLKKKFPEQP  785



>ref|XP_010030104.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X2 [Eucalyptus grandis]
 ref|XP_010030105.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X2 [Eucalyptus grandis]
 ref|XP_010030106.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X2 [Eucalyptus grandis]
Length=783

 Score =   998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/777 (64%), Positives = 600/777 (77%), Gaps = 12/777 (2%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYT-SSDGTTYDGDWEEGKMTGKGQIIWS  759
             MENNE  +EKV  NGD+Y G FKG+LPHGKG+YT +++   Y+G+WE GKMTGKG+I W 
Sbjct  1     MENNEMLEEKVLSNGDLYYGDFKGMLPHGKGRYTWANNKVVYEGEWELGKMTGKGKIFWE  60

Query  760   SGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVR  939
             SGA Y+GD   GYLHG GTF+  DGSVY G W+MNIQHGVGRKEY NSDVY+G WKEGVR
Sbjct  61    SGARYEGDISGGYLHGCGTFTKPDGSVYTGDWRMNIQHGVGRKEYGNSDVYEGMWKEGVR  120

Query  940   DGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYY  1119
             +G GRYTW++G+ Y G WK G M GRG+MKW NGDL+DG W++GLRH SG YRFADG+YY
Sbjct  121   EGSGRYTWNSGHTYVGNWKGGKMWGRGIMKWVNGDLYDGSWLNGLRHESGIYRFADGAYY  180

Query  1120  FGTWSNGLKDGRGTLYPVGC---ALDKCKIDGHKEIRRMLSHDS---SISKKDAVKPKVK  1281
             FGTW++ LK+G+GT YP G    +L K +  G+ +  + LS  S   +  K    K  + 
Sbjct  181   FGTWNSDLKEGKGTYYPAGSKHPSLKKLRSMGYNDKGKNLSSRSLSLAFDKSRPPKTSIN  240

Query  1282  RSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQL  1458
             RS SEK+ +    R+ GRIS RA+S+  + ++  S  E+  +++S  +     + + +  
Sbjct  241   RSYSEKVSMGGVLRNLGRISSRAMSLDENWSVFYSEGELGSQESSFEVPEVPEERQDKMQ  300

Query  1459  GNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
              + ++ YEREYMQGVLI+ERI++   L+ ++ Q+ KF  KE +K  CMD+    +S+YL 
Sbjct  301   DDSSLIYEREYMQGVLIKERIRNYQELTRKTEQKNKFHGKESKKRPCMDMPLRDRSFYLK  360

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             LNLQLGIRY+VGKITP+PMREVR SDFGE+ARI+MYFPRKGS+ TPPH SIDFYWKDYCP
Sbjct  361   LNLQLGIRYTVGKITPVPMREVRSSDFGERARIRMYFPRKGSQFTPPHYSIDFYWKDYCP  420

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFY S D RFVIKTLKKSELKV
Sbjct  421   MVFRNLREMFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYNSHDCRFVIKTLKKSELKV  480

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LLKMLP YY HV  HENTLITKFFG++RI L+  +KVRFVVMGNMF TEL +H RYDLKG
Sbjct  481   LLKMLPHYYNHVGRHENTLITKFFGLHRIKLKGGRKVRFVVMGNMFCTELQIHRRYDLKG  540

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SSLGRFTDK+KI + TTLKDLDL YE  MDK L E   KQ+SLD  FLESQ IIDYSLLL
Sbjct  541   SSLGRFTDKEKIHQNTTLKDLDLAYEFHMDKFLREAFFKQISLDCMFLESQQIIDYSLLL  600

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLV----SSDGGISILPRSLTLVTHEPSIVSTAPG  2526
             GLHFRAPE L ALL    ++   +S+      +S G + I P+ L LVTHEPS VST PG
Sbjct  601   GLHFRAPEQLKALLNGGAAMVNEESSSTANGPTSRGELQIPPKGLLLVTHEPSSVSTTPG  660

Query  2527  PHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVY  2706
             PHIRG TLRA S+GD+EVDLLLPGT RLRVQLGVNMPAQANRK+ +DE D +E+ELFEVY
Sbjct  661   PHIRGSTLRAFSLGDKEVDLLLPGTARLRVQLGVNMPAQANRKLIEDEVDSAEIELFEVY  720

Query  2707  DVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA  2877
             DVVLY+GIIDILQ YN++KK+EH YKSL +DP+SISVIEPKLY+KRFISFLERVF A
Sbjct  721   DVVLYMGIIDILQEYNLKKKIEHAYKSLWYDPLSISVIEPKLYAKRFISFLERVFPA  777



>ref|XP_006431885.1| hypothetical protein CICLE_v10000342mg [Citrus clementina]
 gb|ESR45125.1| hypothetical protein CICLE_v10000342mg [Citrus clementina]
Length=785

 Score =   998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/783 (63%), Positives = 600/783 (77%), Gaps = 14/783 (2%)
 Frame = +1

Query  574   VIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQII  753
             ++IME+  R  +K F NGD+Y+G F+G LPHGKGKY   DGT Y+GDWEEGKMTGKG I+
Sbjct  4     LLIMEDTGRL-KKSFTNGDIYVGNFEGELPHGKGKYIWLDGTVYEGDWEEGKMTGKGYIV  62

Query  754   WSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEG  933
             W SGA  +GD   GYLHGFGTF+  DGSVY+G+W+MNI+HG+GRKEY NSD+YDG WKEG
Sbjct  63    WPSGAKSEGDFSGGYLHGFGTFTGHDGSVYRGNWRMNIRHGLGRKEYPNSDIYDGSWKEG  122

Query  934   VRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGS  1113
             V +G GRY+W++GN+Y G WK G MSGRGVMKW NGD++DG W++G RHGSG Y FADG 
Sbjct  123   VHEGSGRYSWNSGNIYIGSWKDGKMSGRGVMKWMNGDIYDGSWLNGYRHGSGVYMFADGG  182

Query  1114  YYFGTWSNGLKDGRGTLYPVGCALDK----CKIDGHKEIRRML-SHDSSISKK--DAVKP  1272
             +Y GTWS GLKDG+G  YP G         C   G+ +  + L S  SSI+ +  +  KP
Sbjct  183   HYSGTWSKGLKDGKGKFYPAGSKHPSLRRICSNLGYDDNTKGLPSQGSSINSEGSETSKP  242

Query  1273  KVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
             +VKRS+SE+I V    R SGRIS R  S+ G+ +    S E +  D S  L H + + ++
Sbjct  243   RVKRSLSERISVGGLLRSSGRISHRTSSLDGNWSQRHPSVESISNDFSSKLLHDSDESQS  302

Query  1450  EQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
             +      V YEREYMQGVL++E +++    + +   R K   KEV+K SC+D+F+G +SY
Sbjct  303   DMPDGSPVVYEREYMQGVLMKETVRNYTEQTRKGKPRNKHSVKEVKKKSCVDIFEGHRSY  362

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
             YLMLNLQLGIRY+VGKITP+PMREVR SDFG++ARI+MYFPRKGS+ TPPH SIDF WKD
Sbjct  363   YLMLNLQLGIRYTVGKITPVPMREVRSSDFGDRARIRMYFPRKGSQFTPPHNSIDFSWKD  422

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FKL+AA+YMMSIC  DGLRE  SPGKSGSIFYLS DDRF IKTLKK+E
Sbjct  423   YCPMVFRNLREMFKLDAAEYMMSICGADGLRERSSPGKSGSIFYLSHDDRFFIKTLKKTE  482

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             LKVLL+ML  YY HVK HENTLITKFFG++RI+LR  +KVRFVVMGNMF TEL +H  YD
Sbjct  483   LKVLLRMLHEYYIHVKKHENTLITKFFGLHRITLRGGRKVRFVVMGNMFCTELRIHRSYD  542

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGS++GR TDKDKI+E TTLKDLDL +E +MDKLL E L KQ+S+D +FLESQ IIDYS
Sbjct  543   LKGSTVGRCTDKDKIKENTTLKDLDLSFEFQMDKLLREYLFKQISIDCEFLESQQIIDYS  602

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKST-----LVSSDGGISILPRSLTLVTHEPSIVS  2514
             LLLGLHFRAPEHL ALLE P +     S      ++ S G I I P+ L LVTHEPS VS
Sbjct  603   LLLGLHFRAPEHLKALLELPTTATNSDSLPRTDGIIGSQGEIIIPPKGLLLVTHEPSFVS  662

Query  2515  TAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVEL  2694
             TAPGPHIRG TLRA SVGD+EVDLL+PGTGR +VQLGVNMPAQAN K+  +E D +EVEL
Sbjct  663   TAPGPHIRGSTLRAFSVGDKEVDLLIPGTGRFKVQLGVNMPAQANHKLLDNECDSNEVEL  722

Query  2695  FEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFR  2874
             FEVYDVVLY+GIIDILQ YN++KK+EH +KSL+FDP  IS +EPK Y+ RFI+FL++ F 
Sbjct  723   FEVYDVVLYMGIIDILQEYNVKKKIEHAFKSLQFDPQLISAVEPKFYASRFINFLKKKFP  782

Query  2875  A*P  2883
               P
Sbjct  783   EQP  785



>ref|XP_002529289.1| phosphatidylinositol-4-phosphate 5-kinase, putative [Ricinus 
communis]
 gb|EEF33121.1| phosphatidylinositol-4-phosphate 5-kinase, putative [Ricinus 
communis]
Length=789

 Score =   995 bits (2573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/780 (64%), Positives = 596/780 (76%), Gaps = 26/780 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R D KV  NGD+YIG FKGVLPHGKGKY  +DGT Y+GDW+EGKMTGKGQIIWSSGA Y+
Sbjct  18    RPDTKVLSNGDIYIGEFKGVLPHGKGKYKWTDGTVYEGDWDEGKMTGKGQIIWSSGAKYE  77

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   G+LHGFGT    DGS Y+G W+MNIQHG+GRK+Y N D Y+G WKEGV +G GRY
Sbjct  78    GDFSGGHLHGFGTLIGPDGSNYRGAWRMNIQHGLGRKQYSNLDTYEGSWKEGVHEGSGRY  137

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
              W++GN + G WK G +SGRGVMKW NGD++DG+W +GLR+GSG Y FADG  YFGTWS 
Sbjct  138   CWNSGNTFIGNWKGGKVSGRGVMKWANGDVYDGYWSNGLRNGSGVYMFADGGCYFGTWSR  197

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSS------------ISKKDAVKPKVK  1281
             GLKDG+GT YP G  L   +  G       L HD S             ++  A +P V 
Sbjct  198   GLKDGKGTFYPAGTKLPSLRRWGSS-----LGHDESGRSSLSHSSSLSSAEDRASRPSVM  252

Query  1282  RSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQL  1458
             RS+S+K+ +    R+SGRIS R  SV        SS E + E+ SC+LS  +     E L
Sbjct  253   RSLSDKMSIGGMLRNSGRISHRTNSVDEKWGPCDSSRESIYEEPSCVLSQASNSALREGL  312

Query  1459  GNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
                T+ YEREYMQGVL++ERI+S +  SH+S Q+ KF  KE +K SC+D+F+G +SYYLM
Sbjct  313   AKSTIIYEREYMQGVLVKERIRSKEP-SHKSKQKNKFHVKEAKKKSCVDIFEGHQSYYLM  371

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             LNLQLGIRY+VGKITP+P REVR SDFG++ARI+MYFPRKGS+ TPPH SIDFYWKDYCP
Sbjct  372   LNLQLGIRYTVGKITPVPRREVRTSDFGDRARIRMYFPRKGSQFTPPHYSIDFYWKDYCP  431

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FKL+AA+YMMSIC DDGLREL SPGKSGSIFYLS DDRFVIKTLKKSELK 
Sbjct  432   MVFRNLREMFKLDAAEYMMSICGDDGLRELSSPGKSGSIFYLSHDDRFVIKTLKKSELKF  491

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
              LKMLP+YY HV  HENTLITKFFGV+RI LR  +KVRFVVMGNMF TEL +H RYDLKG
Sbjct  492   FLKMLPNYYDHVGKHENTLITKFFGVHRIKLRGGRKVRFVVMGNMFCTELKIHRRYDLKG  551

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             S+ GRFTD DKIE  +TLKDLDL Y+ +MDK+L ++L KQLS D  FL+SQ IIDYSLLL
Sbjct  552   STQGRFTDADKIEANSTLKDLDLKYDFQMDKMLRDSLFKQLSEDCLFLQSQQIIDYSLLL  611

Query  2359  GLHFRAPEHLTALLEP----PDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPG  2526
             GLHFRAPE L A+LE     PD    P    ++S G   ++P  L LVTHEPS V+TAPG
Sbjct  612   GLHFRAPEQLKAILESAGTMPDHENLPSGDGITSQGE-PLIPTGLLLVTHEPSSVNTAPG  670

Query  2527  PHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVY  2706
             PHIRG TLRA SVG +EVDLLLPGTGRLRVQLGVNMPAQA+ K++Q E D  EVELFEVY
Sbjct  671   PHIRGNTLRAYSVGAKEVDLLLPGTGRLRVQLGVNMPAQASCKLRQ-EVDSMEVELFEVY  729

Query  2707  DVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFL-ERVFRA*P  2883
             DVVLY+GIIDILQ YN++KK+E+K KS++FDP+SISV+EPKLY++RF+ FL ++VF   P
Sbjct  730   DVVLYMGIIDILQEYNVKKKVENKCKSMKFDPVSISVVEPKLYAERFLKFLQQKVFPEQP  789



>ref|XP_011006535.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X2 [Populus euphratica]
Length=787

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/791 (62%), Positives = 594/791 (75%), Gaps = 31/791 (4%)
 Frame = +1

Query  574   VIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQII  753
             ++ +E++E  D+K   NG+VYIG+FKG LPHGKGKY   DGT Y GDWEEGKMTGKGQI+
Sbjct  7     LLDIEDSESIDKKALSNGEVYIGIFKGTLPHGKGKYIWCDGTVYKGDWEEGKMTGKGQIL  66

Query  754   WSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEG  933
             WSSGA Y+GD   GYLHG GT    DGS Y+G W+MN +HG+GRK+Y N DVY+G WKEG
Sbjct  67    WSSGAKYEGDFSGGYLHGIGTLIGHDGSEYRGAWRMNARHGLGRKQYSNLDVYEGSWKEG  126

Query  934   VRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGS  1113
             +R+G G+Y+W+NGN Y G WK G + GRGVMKW NGDLFDGFW++GLRHGSG YRFADG 
Sbjct  127   MREGCGKYSWNNGNTYMGNWKGGKICGRGVMKWENGDLFDGFWINGLRHGSGVYRFADGG  186

Query  1114  YYFGTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSH---------------DSSI  1248
             YYFG WS GLKDG+GT Y  G          H  +RR  S                  + 
Sbjct  187   YYFGMWSMGLKDGKGTFYSAGTK--------HPSLRRWCSSLGCYESGRNLLSHSSSLNS  238

Query  1249  SKKDAVKPKVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLS  1425
              K   + P   RS+SE++ ++   +DSGR S   VS+  +++     +E +  + SCMLS
Sbjct  239   EKTRVLIPNDMRSLSERMSINGIFKDSGRFSLGTVSLDENSSRCSLGSEFICREPSCMLS  298

Query  1426  HTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMD  1605
              T+ +G+     N TV YEREYMQGVL  E++K+ +  S ++ QR KF  K  ++ S +D
Sbjct  299   QTSDEGQRGVQDNCTVVYEREYMQGVLKNEKVKNTEP-SRKTKQRNKFDVKVTKRKSYVD  357

Query  1606  LFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHR  1785
             +F+G  SYYLML+LQLGIRY+VGKITP+PMR  R SDFG++ARI+MYFPRKGS+ TPPH 
Sbjct  358   IFQGHWSYYLMLSLQLGIRYTVGKITPVPMRGARDSDFGDRARIRMYFPRKGSQFTPPHY  417

Query  1786  SIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFV  1965
             SIDFYWKDYCP+VFRNLR +FKL+AA+YMMSIC DDGL EL S GKSGSIF+LS DDRFV
Sbjct  418   SIDFYWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLTELPSSGKSGSIFFLSHDDRFV  477

Query  1966  IKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTE  2145
             IKTLKK ELK LLKMLP YY HV  HENTLITK FGV+RI+LR  KKVRFVVMGNMF TE
Sbjct  478   IKTLKKFELKTLLKMLPEYYDHVGKHENTLITKIFGVHRITLRGGKKVRFVVMGNMFCTE  537

Query  2146  LHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLE  2325
             L +H RYDLKGS+ GR+TDKDK+ E TTLKDLDL YE  MDKLL E+L KQLSLD  FLE
Sbjct  538   LRIHDRYDLKGSTQGRYTDKDKVGENTTLKDLDLAYEFHMDKLLRESLFKQLSLDCSFLE  597

Query  2326  SQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSD-----GGISILPRSLTLV  2490
             SQ IIDYSLLLG+HFRAPE L A+LEPP ++    +TL +SD     G + I P+ L LV
Sbjct  598   SQQIIDYSLLLGIHFRAPEQLRAILEPPATMLN-HATLATSDGINSQGPLVIPPKGLLLV  656

Query  2491  THEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDE  2670
             THEPS VST PGPH RG TL+ANS+G++EVDLLLPGTGRLRVQLGVNMPAQA+ K+ QDE
Sbjct  657   THEPSSVSTTPGPHSRGDTLKANSLGEKEVDLLLPGTGRLRVQLGVNMPAQASHKLMQDE  716

Query  2671  TDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFI  2850
              D +E+ELFEVYDVVLY+GIIDILQ Y ++KK+EH  KSL+FDP SIS++EPK Y+KRFI
Sbjct  717   VDSAEIELFEVYDVVLYMGIIDILQEYKVKKKVEHACKSLKFDPQSISIVEPKFYAKRFI  776

Query  2851  SFLERVFRA*P  2883
             +FL +VF   P
Sbjct  777   NFLHKVFPQQP  787



>ref|XP_010030102.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X1 [Eucalyptus grandis]
Length=793

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/772 (64%), Positives = 596/772 (77%), Gaps = 12/772 (2%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYT-SSDGTTYDGDWEEGKMTGKGQIIWSSGATY  774
             R +EKV  NGD+Y G FKG+LPHGKG+YT +++   Y+G+WE GKMTGKG+I W SGA Y
Sbjct  16    RLEEKVLSNGDLYYGDFKGMLPHGKGRYTWANNKVVYEGEWELGKMTGKGKIFWESGARY  75

Query  775   DGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGR  954
             +GD   GYLHG GTF+  DGSVY G W+MNIQHGVGRKEY NSDVY+G WKEGVR+G GR
Sbjct  76    EGDISGGYLHGCGTFTKPDGSVYTGDWRMNIQHGVGRKEYGNSDVYEGMWKEGVREGSGR  135

Query  955   YTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWS  1134
             YTW++G+ Y G WK G M GRG+MKW NGDL+DG W++GLRH SG YRFADG+YYFGTW+
Sbjct  136   YTWNSGHTYVGNWKGGKMWGRGIMKWVNGDLYDGSWLNGLRHESGIYRFADGAYYFGTWN  195

Query  1135  NGLKDGRGTLYPVGC---ALDKCKIDGHKEIRRMLSHDS---SISKKDAVKPKVKRSISE  1296
             + LK+G+GT YP G    +L K +  G+ +  + LS  S   +  K    K  + RS SE
Sbjct  196   SDLKEGKGTYYPAGSKHPSLKKLRSMGYNDKGKNLSSRSLSLAFDKSRPPKTSINRSYSE  255

Query  1297  KI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
             K+ +    R+ GRIS RA+S+  + ++  S  E+  +++S  +     + + +   + ++
Sbjct  256   KVSMGGVLRNLGRISSRAMSLDENWSVFYSEGELGSQESSFEVPEVPEERQDKMQDDSSL  315

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
              YEREYMQGVLI+ERI++   L+ ++ Q+ KF  KE +K  CMD+    +S+YL LNLQL
Sbjct  316   IYEREYMQGVLIKERIRNYQELTRKTEQKNKFHGKESKKRPCMDMPLRDRSFYLKLNLQL  375

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+PMREVR SDFGE+ARI+MYFPRKGS+ TPPH SIDFYWKDYCP+VFRN
Sbjct  376   GIRYTVGKITPVPMREVRSSDFGERARIRMYFPRKGSQFTPPHYSIDFYWKDYCPMVFRN  435

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFY S D RFVIKTLKKSELKVLLKML
Sbjct  436   LREMFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYNSHDCRFVIKTLKKSELKVLLKML  495

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YY HV  HENTLITKFFG++RI L+  +KVRFVVMGNMF TEL +H RYDLKGSSLGR
Sbjct  496   PHYYNHVGRHENTLITKFFGLHRIKLKGGRKVRFVVMGNMFCTELQIHRRYDLKGSSLGR  555

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             FTDK+KI + TTLKDLDL YE  MDK L E   KQ+SLD  FLESQ IIDYSLLLGLHFR
Sbjct  556   FTDKEKIHQNTTLKDLDLAYEFHMDKFLREAFFKQISLDCMFLESQQIIDYSLLLGLHFR  615

Query  2374  APEHLTALLEPPDSLFKPKSTLV----SSDGGISILPRSLTLVTHEPSIVSTAPGPHIRG  2541
             APE L ALL    ++   +S+      +S G + I P+ L LVTHEPS VST PGPHIRG
Sbjct  616   APEQLKALLNGGAAMVNEESSSTANGPTSRGELQIPPKGLLLVTHEPSSVSTTPGPHIRG  675

Query  2542  KTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLY  2721
              TLRA S+GD+EVDLLLPGT RLRVQLGVNMPAQANRK+ +DE D +E+ELFEVYDVVLY
Sbjct  676   STLRAFSLGDKEVDLLLPGTARLRVQLGVNMPAQANRKLIEDEVDSAEIELFEVYDVVLY  735

Query  2722  LGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA  2877
             +GIIDILQ YN++KK+EH YKSL +DP+SISVIEPKLY+KRFISFLERVF A
Sbjct  736   MGIIDILQEYNLKKKIEHAYKSLWYDPLSISVIEPKLYAKRFISFLERVFPA  787


 Score = 68.6 bits (166),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 56/103 (54%), Gaps = 1/103 (1%)
 Frame = +1

Query  853   WKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGN-MYTGIWKKGNMSGRGVMK  1029
             WK+ + + +  K   N D+Y G +K  +  G GRYTW+N   +Y G W+ G M+G+G + 
Sbjct  9     WKLMMLYRLEEKVLSNGDLYYGDFKGMLPHGKGRYTWANNKVVYEGEWELGKMTGKGKIF  68

Query  1030  WFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
             W +G  ++G    G  HG G +   DGS Y G W   ++ G G
Sbjct  69    WESGARYEGDISGGYLHGCGTFTKPDGSVYTGDWRMNIQHGVG  111



>ref|XP_008339353.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like [Malus 
domestica]
Length=773

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/773 (64%), Positives = 586/773 (76%), Gaps = 28/773 (4%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK F N DVY+G FKG+LPHG GKYT SDGT Y+GDWEEGKMTGKG++IW+SG  Y GD 
Sbjct  7     EKAFSNRDVYVGNFKGILPHGNGKYTWSDGTVYEGDWEEGKMTGKGKLIWTSGGQYAGDF  66

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+HG+G F+  DGS Y G W+MN+QHG+G+K+Y +SD+Y+G WKEGV++G GRY WS
Sbjct  67    SGGYVHGYGIFNGPDGSFYHGSWRMNVQHGMGKKQYCDSDIYEGSWKEGVQEGSGRYLWS  126

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             +GN Y G WK G M GRGVMKW NGDL++G W++GLR GSG YRFADG YYFGTWS GLK
Sbjct  127   SGNTYIGSWKGGKMCGRGVMKWENGDLYNGSWLNGLRDGSGVYRFADGGYYFGTWSRGLK  186

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSI-------------SKKDAVKPKVKRS  1287
             DG+GT YPVG          H  ++R  S                  S +   +P VKRS
Sbjct  187   DGKGTFYPVGTK--------HPSLKRWCSSVGYSSDGSSSLSGHLJNSMEGKARPTVKRS  238

Query  1288  ISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
              SEKI +    R+S RIS +A+S+  +      S E +  D+ C LS  + D + E   N
Sbjct  239   FSEKISIGGILRNSRRISHKAMSLDKNWTACDPSXEFIRYDSLCSLSQASEDVQHETRDN  298

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLN  1644
              T  YEREYMQGVLI+ER ++   +S ++ QR K       K SC+D+F   +SYYLMLN
Sbjct  299   NTSVYEREYMQGVLIKERERNHTEISRKNKQRNKISV--TPKSSCIDMFGAHRSYYLMLN  356

Query  1645  LQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIV  1824
             LQLGIRY+VGKITP+P+REVR SDFGE+ARI+MYFPR+GS+ TPPH S+DFYWKDYCP+V
Sbjct  357   LQLGIRYTVGKITPVPVREVRSSDFGERARIRMYFPRRGSQFTPPHYSVDFYWKDYCPMV  416

Query  1825  FRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLL  2004
             FRNLR +FKL+AA+YMMSIC DDGLREL SPGKSGSIFYLS DDRFVIKTL+K+ELKVLL
Sbjct  417   FRNLREMFKLDAAEYMMSICGDDGLRELSSPGKSGSIFYLSHDDRFVIKTLRKTELKVLL  476

Query  2005  KMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSS  2184
             KMLPSYY HV  HENTLITKFFG++RI+L+  KKVRF+VMGNMF TEL +H RYDLKGSS
Sbjct  477   KMLPSYYCHVGKHENTLITKFFGLHRITLKGGKKVRFMVMGNMFCTELRIHRRYDLKGSS  536

Query  2185  LGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGL  2364
             +GR TDK+KI E TTLKDLDL +E  MDKLL E+L KQ+SLD  FL+SQ IIDYSLLLGL
Sbjct  537   IGRCTDKNKIRENTTLKDLDLSFEFHMDKLLRESLFKQISLDCMFLQSQQIIDYSLLLGL  596

Query  2365  HFRAPEHLTALLEPPDSLFK----PKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPH  2532
             HFRAPE+L    +PP ++      P +  VS+ G + I P+ L LVTHEP  VSTAPGPH
Sbjct  597   HFRAPENLKGFSQPPAAMHNDESLPTNDGVSAQGELLIPPKGLLLVTHEPGSVSTAPGPH  656

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG TL+A S+GD+EVDLL+PGTGRLRVQLGVNMPAQA  K+ QDE D +EVELFE YDV
Sbjct  657   IRGSTLKAYSLGDKEVDLLVPGTGRLRVQLGVNMPAQAYHKLTQDEVDSTEVELFEFYDV  716

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VLY+GIIDILQ YN +KK EH YKSL+FDP  IS +EPKLY+KRFI+FLE+VF
Sbjct  717   VLYMGIIDILQEYNTKKKXEHAYKSLQFDPQCISAVEPKLYAKRFINFLEKVF  769


 Score = 80.5 bits (197),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = +1

Query  865   IQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGD  1044
             + + V  K + N DVY G +K  +  G+G+YTWS+G +Y G W++G M+G+G + W +G 
Sbjct  1     MDYAVSEKAFSNRDVYVGNFKGILPHGNGKYTWSDGTVYEGDWEEGKMTGKGKLIWTSGG  60

Query  1045  LFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
              + G +  G  HG G +   DGS+Y G+W   ++ G G
Sbjct  61    QYAGDFSGGYVHGYGIFNGPDGSFYHGSWRMNVQHGMG  98



>gb|KDP38876.1| hypothetical protein JCGZ_05033 [Jatropha curcas]
Length=787

 Score =   988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/785 (65%), Positives = 589/785 (75%), Gaps = 19/785 (2%)
 Frame = +1

Query  574   VIIMENNERTDEK-VFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQI  750
             ++ ME+ E  D K V  NGDVYIG  KGVLPHGKGKYT +DGT Y+GDWEEGKMTGKG I
Sbjct  7     LLNMEDTEGDDNKNVLSNGDVYIGDLKGVLPHGKGKYTWTDGTVYEGDWEEGKMTGKGHI  66

Query  751   IWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKE  930
              W SGA Y+GD    YLHG G F  +DGS YKG W+MNIQHG+GRK+Y NSDVYDG WKE
Sbjct  67    FWPSGANYEGDFSGTYLHGIGAFVGNDGSEYKGAWRMNIQHGLGRKQYSNSDVYDGSWKE  126

Query  931   GVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADG  1110
             GV +G G Y+W++GN Y G WK G M GRGVMKW NGDLFDG W++GLRHGSG YRFADG
Sbjct  127   GVHEGCGTYSWNSGNTYIGNWKSGKMCGRGVMKWANGDLFDGCWLNGLRHGSGVYRFADG  186

Query  1111  SYYFGTWSNGLKDGRGTLYPVGCALDKCK----IDGHKEIRRMLSHDSSISKKD-----A  1263
              YYFGTWS GLKDG+GT YP G  L   +      G+ +  R     SS    +     A
Sbjct  187   GYYFGTWSKGLKDGKGTFYPAGTKLPSLRRWSTSTGYDDSGRSSLSHSSSLNSEQGRDTA  246

Query  1264  VKPKVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCD  1440
              +P V RS+SEKI +    R+SGRIS R  S+    +   S+ E++  + S ++S  + D
Sbjct  247   ARPSVMRSVSEKISISGMIRNSGRISHRTASLDEHRSAFDSARELISREPSSVISRAS-D  305

Query  1441  GKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGR  1620
                 Q+ N TV YEREYMQGVLI+ERI++ +  S ++ Q+ KF  KE    SC+ +F G 
Sbjct  306   EAEVQVRN-TVVYEREYMQGVLIKERIRNTEP-SRKAKQKNKFHVKEAENMSCVGIFGGH  363

Query  1621  KSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFY  1800
             +SYYLMLNLQLGIRY+VGKITP+PMREVR SDFG++ARI+MYFPRKGS+ TPPH SIDFY
Sbjct  364   QSYYLMLNLQLGIRYTVGKITPVPMREVRGSDFGDRARIRMYFPRKGSQFTPPHYSIDFY  423

Query  1801  WKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLK  1980
             WKDYCP+VFRNLR +FKL+AA+YMMSIC DDGLREL SPGKSGSIFYLS DDRFVIKTLK
Sbjct  424   WKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLRELSSPGKSGSIFYLSHDDRFVIKTLK  483

Query  1981  KSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHH  2160
             KSELK  L+MLP+YY +V  HENTLITKFFGV+RI LR  +KVRFVVMGNMF TEL +H 
Sbjct  484   KSELKFFLRMLPNYYHYVGKHENTLITKFFGVHRIKLRGGRKVRFVVMGNMFCTELRIHR  543

Query  2161  RYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHII  2340
             RYDLKGS+ GRFTDKDKI+E TTLKD DL YE  MDK+L E+L KQLS D  FL+SQ II
Sbjct  544   RYDLKGSTYGRFTDKDKIKENTTLKDCDLNYEFHMDKMLRESLFKQLSEDCMFLQSQQII  603

Query  2341  DYSLLLGLHFRAPEHLTALLEP----PDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSI  2508
             DYSLLLGLHFRAPE L  LLE     PD+   P    V+S G   I P  L LVTHEPS 
Sbjct  604   DYSLLLGLHFRAPEQLKTLLESDGSVPDNENSPSIDGVNSQGEPLIPPTGLILVTHEPSF  663

Query  2509  VSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEV  2688
             V+TAPGPHIRG TLRA SVG +EVDLLLPGTGRLRVQLGVNMPAQA RK+   E D  EV
Sbjct  664   VNTAPGPHIRGNTLRAYSVGAKEVDLLLPGTGRLRVQLGVNMPAQAIRKLGV-EVDSMEV  722

Query  2689  ELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERV  2868
             ELFEVYDVVLY+GIIDILQ YN+ KK+EH  KSL+ DP+SIS +EPK Y+ RF+ FL++V
Sbjct  723   ELFEVYDVVLYMGIIDILQEYNVTKKVEHACKSLKCDPLSISAVEPKFYADRFLKFLQKV  782

Query  2869  FRA*P  2883
             F   P
Sbjct  783   FPEQP  787



>gb|KHN48102.1| Phosphatidylinositol-4-phosphate 5-kinase 7 [Glycine soja]
Length=774

 Score =   986 bits (2549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/771 (63%), Positives = 592/771 (77%), Gaps = 16/771 (2%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++ER +EK F NGDVYIG  KG+LPHGKGKYT SDG  Y+GDW  GKMTGKG I W +
Sbjct  1     MEDSERFEEKSFSNGDVYIGKIKGMLPHGKGKYTWSDGAVYEGDWVNGKMTGKGLITWPT  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+   GYLHG GTF+ S G +Y G W+M+  HG+GRKEY NSDVY+G WKEG+R+
Sbjct  61    GAKYEGEFSGGYLHGHGTFTHSTGCIYTGGWRMDAHHGIGRKEYSNSDVYEGLWKEGIRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY+W NGN Y G WK G + GRGVMKW NGD+FDG W++GL+HGSG YRFADG  Y 
Sbjct  121   GCGRYSWENGNTYIGNWKSGKIDGRGVMKWANGDIFDGCWLNGLKHGSGVYRFADGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDS----SISKKDAVKPKVKRSI  1290
             GTWS GLKDG+GT YP G      K    K++  + S DS    ++ K  A K K  RS 
Sbjct  181   GTWSKGLKDGKGTFYPAGS-----KQPSLKKLCSLNSDDSRLLLNMEKHTAPKQKFTRSF  235

Query  1291  SEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNI  1467
             SEKI V   ++ S +IS R  S+  +  L   +   +  D+S  LS T  + ++E     
Sbjct  236   SEKISVSGRSKSSRQISHRTSSLDANCILQDPAGGCICRDSSPTLSQTFNESQSEATSVN  295

Query  1468  TVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNL  1647
             ++ YEREYMQGVLI ERI++   + H++ ++ K+  K+V+KGS +D+F G +SYYL LNL
Sbjct  296   SLVYEREYMQGVLIMERIRNYSEMPHKNKRQNKYSVKQVKKGSWIDIFGGSRSYYLKLNL  355

Query  1648  QLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVF  1827
             QLGIRY+VGKITP+P REVR SDFG++ARI+MYFP++GS+LTPPH SIDFYWKDYCP+VF
Sbjct  356   QLGIRYTVGKITPVPAREVRSSDFGDRARIRMYFPKEGSQLTPPHCSIDFYWKDYCPMVF  415

Query  1828  RNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLK  2007
             RNLR +FKL+AA+YMMSIC D GLR++ SPGKSGSIF+LS DDRFVIKTLKK ELKV+L 
Sbjct  416   RNLREMFKLDAAEYMMSICGDSGLRDISSPGKSGSIFFLSQDDRFVIKTLKKYELKVMLN  475

Query  2008  MLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSL  2187
             MLP YY HV  +ENTLITKFFG++RI+LR  KKVRFVVMGNMF TELH+H RYDLKGS+ 
Sbjct  476   MLPKYYHHVGSYENTLITKFFGLHRITLRGGKKVRFVVMGNMFCTELHIHRRYDLKGSTQ  535

Query  2188  GRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLH  2367
             GR+T +DKI   TTLKDLDL YE  MDK L E+L KQ+SLD  FLESQHIIDYSLLLGLH
Sbjct  536   GRYTKEDKINSNTTLKDLDLKYEFHMDKKLRESLFKQISLDCMFLESQHIIDYSLLLGLH  595

Query  2368  FRAPEHLTALLEPPDSLFKPKSTLVSSD-----GGISILPRSLTLVTHEPSIVSTAPGPH  2532
             FRAPE+L AL+EPP  L +P  +L S D     G   I+P+ L LV HEPS V+TAPGPH
Sbjct  596   FRAPENLKALVEPP-RLMQPPHSLPSEDDAHKQGEQLIIPKGLLLVAHEPSFVNTAPGPH  654

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG TLRA S+GD++VDLLLPGT RLRVQLGVNMPAQA RK++ D+ + SEVELFEVYDV
Sbjct  655   IRGNTLRAYSIGDKQVDLLLPGTARLRVQLGVNMPAQATRKLQGDKVEESEVELFEVYDV  714

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             VLY+GIIDILQ Y ++KKLEH  KSL++DPM+ISV+EPK Y++RFI+F+E+
Sbjct  715   VLYMGIIDILQEYTVKKKLEHACKSLQYDPMTISVVEPKTYAERFINFMEK  765



>ref|XP_006585224.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X2 [Glycine max]
Length=774

 Score =   983 bits (2542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/770 (63%), Positives = 589/770 (76%), Gaps = 14/770 (2%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++ER +EK F NGDVYIG  KG+LPHGKGKYT SDG  Y+GDW  GKMTGKG I W +
Sbjct  1     MEDSERFEEKSFSNGDVYIGKIKGMLPHGKGKYTWSDGAVYEGDWVNGKMTGKGLITWPT  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+   GYLHG GTF+ S G +Y G W+M+  HG+GRKEY NSDVY+G WKEG+R+
Sbjct  61    GAKYEGEFSGGYLHGHGTFTHSTGCIYTGGWRMDAHHGIGRKEYSNSDVYEGLWKEGIRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY+W NGN Y G WK G + GRGVMKW NGD+FDG W++GL+HGSG YRFADG  Y 
Sbjct  121   GCGRYSWENGNTYIGNWKSGKIDGRGVMKWANGDIFDGCWLNGLKHGSGVYRFADGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDS----SISKKDAVKPKVKRSI  1290
             GTWS GLKDG+GT YP G      K    K++  + S DS    ++ K  A K K  RS 
Sbjct  181   GTWSKGLKDGKGTFYPAGS-----KQPSLKKLCSLNSDDSRLLLNMEKHTAPKQKFTRSF  235

Query  1291  SEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNI  1467
             SEKI V   ++ S +IS R  S+  +  L   +   +  D+S  LS T  + ++E     
Sbjct  236   SEKISVSGRSKSSRQISHRTSSLDANCILQDPAGGCICRDSSPTLSQTFNESQSEATSVN  295

Query  1468  TVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNL  1647
             ++ YEREYMQGVLI ERI++   + H++ ++ K+  K+V+KGS +D+F G +SYYL LNL
Sbjct  296   SLVYEREYMQGVLIMERIRNYSEMPHKNKRQNKYSVKQVKKGSWIDIFGGSRSYYLKLNL  355

Query  1648  QLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVF  1827
             QLGIRY+VGKITP+P REVR SDFG++ARI+MYFP++GS+LTPPH SIDFYWKDYCP+VF
Sbjct  356   QLGIRYTVGKITPVPAREVRSSDFGDRARIRMYFPKEGSQLTPPHCSIDFYWKDYCPMVF  415

Query  1828  RNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLK  2007
             RNLR +FKL+AA+YMMSIC D GLR++ SPGKSGSIF+LS DDRFVIKTLKK ELKV+L 
Sbjct  416   RNLREMFKLDAAEYMMSICGDSGLRDISSPGKSGSIFFLSQDDRFVIKTLKKYELKVMLN  475

Query  2008  MLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSL  2187
             MLP YY HV  +ENTLITKFFG++RI+LR  KKVRFVVMGNMF TELH+H RYDLKGS+ 
Sbjct  476   MLPKYYHHVGSYENTLITKFFGLHRITLRGGKKVRFVVMGNMFCTELHIHRRYDLKGSTQ  535

Query  2188  GRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLH  2367
             GR+T +DKI   TTLKDLDL YE  MDK L E+L KQ+SLD  FLESQHIIDYSLLLGLH
Sbjct  536   GRYTKEDKINSNTTLKDLDLKYEFHMDKKLRESLFKQISLDCMFLESQHIIDYSLLLGLH  595

Query  2368  FRAPEHLTALLEPPDSLFKPKSTLVSSD----GGISILPRSLTLVTHEPSIVSTAPGPHI  2535
             FRAPE+L AL+EPP  +  P S     D    G   I+P+ L LV HEPS V+TAPGPHI
Sbjct  596   FRAPENLKALVEPPRLMQLPHSLPSEDDAHKQGEQLIIPKGLLLVAHEPSFVNTAPGPHI  655

Query  2536  RGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVV  2715
             RG TLRA S+GD++VDLLLPGT RLRVQLGVNMPAQA RK++ D+ + SEVELFEVYDVV
Sbjct  656   RGNTLRAYSIGDKQVDLLLPGTARLRVQLGVNMPAQATRKLQGDKVEESEVELFEVYDVV  715

Query  2716  LYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             LY+GIIDILQ Y ++KKLEH  KSL++DPM+ISV+EPK Y++RFI+F+E+
Sbjct  716   LYMGIIDILQEYTVKKKLEHACKSLQYDPMTISVVEPKTYAERFINFMEK  765



>ref|XP_006580229.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like [Glycine 
max]
Length=773

 Score =   983 bits (2542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/770 (63%), Positives = 590/770 (77%), Gaps = 15/770 (2%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++ER +E+ F NGDVYIG  KG+LPHGKGKYT SDGT Y+GDW  GKMTGKG I W +
Sbjct  1     MEDSERFEERSFSNGDVYIGKIKGMLPHGKGKYTWSDGTVYEGDWVNGKMTGKGLITWPT  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+   GYLHG GTF+ S G +Y G W+M+  HG+GRKEY NSD+Y+G WKEG+R+
Sbjct  61    GAKYEGEFSGGYLHGHGTFTHSTGCIYSGGWRMDAHHGIGRKEYSNSDIYEGLWKEGIRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY+W NGN Y G WK G + GRGVMKW N D+FDG W++GL+ GSG YRFADG  Y 
Sbjct  121   GCGRYSWENGNTYIGNWKSGKIDGRGVMKWANDDIFDGCWINGLKQGSGVYRFADGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDS---SISKKDAVKPKVKRSIS  1293
             GTWS GLKDGRGT YP G      K    K++  + S D    +  K  A K K  RS S
Sbjct  181   GTWSKGLKDGRGTFYPAGS-----KQPSLKKLCSLNSDDGLLLNTEKHTATKQKFTRSFS  235

Query  1294  EKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNIT  1470
             EKI V   ++ S +IS R  S+  +  +   + + +  D+S  LS T  + ++E  G  +
Sbjct  236   EKISVSGRSKSSRQISHRTSSLDANCIIQDPAGDCICRDSSPTLSQTFNESQSEASGVNS  295

Query  1471  VAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQ  1650
             + YEREYMQGVLI ERI++   + H++ ++  F  K+ +K S +D+F G +SYYL LNLQ
Sbjct  296   LLYEREYMQGVLIMERIRNYSEIPHKNKRQNTFSVKQAKKSSWIDIFGGSRSYYLKLNLQ  355

Query  1651  LGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFR  1830
             LGIRY+VGKITP+P REVR SDFG++ARI+MYFP++GS+LTPPH SIDFYWKDYCP+VFR
Sbjct  356   LGIRYTVGKITPVPAREVRSSDFGDRARIRMYFPKEGSQLTPPHCSIDFYWKDYCPMVFR  415

Query  1831  NLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKM  2010
             NLR +FKL+AA+YMMSIC D GLR++ SPGKSGSIF+LS DDRFVIKTLKK ELKV+L M
Sbjct  416   NLREMFKLDAAEYMMSICGDSGLRDISSPGKSGSIFFLSQDDRFVIKTLKKYELKVMLNM  475

Query  2011  LPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLG  2190
             LP YY HV  +ENTLITKFFG++RI+LR  KKVRFVVMGNMF TELH+H RYDLKGS+ G
Sbjct  476   LPKYYHHVGSYENTLITKFFGLHRITLRGGKKVRFVVMGNMFCTELHIHRRYDLKGSTQG  535

Query  2191  RFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHF  2370
             R+TDKDKI   TTLKDLDL YE  MDK L E+L KQ+SLD  FLESQHIIDYSLLLGLHF
Sbjct  536   RYTDKDKINSNTTLKDLDLKYEFHMDKKLRESLFKQISLDCMFLESQHIIDYSLLLGLHF  595

Query  2371  RAPEHLTALLEPPDSLFKPKSTLVSSD-----GGISILPRSLTLVTHEPSIVSTAPGPHI  2535
             RAPE+L AL+EPP  L +P+  L S D     G   I+P+ L LV HEPS V+TAPGPHI
Sbjct  596   RAPENLKALVEPP-RLPQPQHGLPSEDDAQKQGEQLIIPKGLLLVAHEPSFVNTAPGPHI  654

Query  2536  RGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVV  2715
             RG TLRA S+GD++VDLLLPGT RLRVQLGVNMPAQA RK+++D+ + SEVELFEVYDVV
Sbjct  655   RGNTLRAYSIGDKQVDLLLPGTARLRVQLGVNMPAQATRKLQEDKVEESEVELFEVYDVV  714

Query  2716  LYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             LY+GIIDILQ Y ++KKLEH  KSL++DPM+ISV+EPK Y++RFI+F+E+
Sbjct  715   LYMGIIDILQEYTVKKKLEHACKSLQYDPMTISVVEPKTYAERFINFMEK  764



>ref|XP_011006533.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X1 [Populus euphratica]
 ref|XP_011006534.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X1 [Populus euphratica]
Length=794

 Score =   983 bits (2540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/798 (62%), Positives = 594/798 (74%), Gaps = 38/798 (5%)
 Frame = +1

Query  574   VIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQII  753
             ++ +E++E  D+K   NG+VYIG+FKG LPHGKGKY   DGT Y GDWEEGKMTGKGQI+
Sbjct  7     LLDIEDSESIDKKALSNGEVYIGIFKGTLPHGKGKYIWCDGTVYKGDWEEGKMTGKGQIL  66

Query  754   WSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEG  933
             WSSGA Y+GD   GYLHG GT    DGS Y+G W+MN +HG+GRK+Y N DVY+G WKEG
Sbjct  67    WSSGAKYEGDFSGGYLHGIGTLIGHDGSEYRGAWRMNARHGLGRKQYSNLDVYEGSWKEG  126

Query  934   VRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGS  1113
             +R+G G+Y+W+NGN Y G WK G + GRGVMKW NGDLFDGFW++GLRHGSG YRFADG 
Sbjct  127   MREGCGKYSWNNGNTYMGNWKGGKICGRGVMKWENGDLFDGFWINGLRHGSGVYRFADGG  186

Query  1114  YYFGTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSH---------------DSSI  1248
             YYFG WS GLKDG+GT Y  G          H  +RR  S                  + 
Sbjct  187   YYFGMWSMGLKDGKGTFYSAGTK--------HPSLRRWCSSLGCYESGRNLLSHSSSLNS  238

Query  1249  SKKDAVKPKVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLS  1425
              K   + P   RS+SE++ ++   +DSGR S   VS+  +++     +E +  + SCMLS
Sbjct  239   EKTRVLIPNDMRSLSERMSINGIFKDSGRFSLGTVSLDENSSRCSLGSEFICREPSCMLS  298

Query  1426  HTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMD  1605
              T+ +G+     N TV YEREYMQGVL  E++K+ +  S ++ QR KF  K  ++ S +D
Sbjct  299   QTSDEGQRGVQDNCTVVYEREYMQGVLKNEKVKNTEP-SRKTKQRNKFDVKVTKRKSYVD  357

Query  1606  LFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHR  1785
             +F+G  SYYLML+LQLGIRY+VGKITP+PMR  R SDFG++ARI+MYFPRKGS+ TPPH 
Sbjct  358   IFQGHWSYYLMLSLQLGIRYTVGKITPVPMRGARDSDFGDRARIRMYFPRKGSQFTPPHY  417

Query  1786  SIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFV  1965
             SIDFYWKDYCP+VFRNLR +FKL+AA+YMMSIC DDGL EL S GKSGSIF+LS DDRFV
Sbjct  418   SIDFYWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLTELPSSGKSGSIFFLSHDDRFV  477

Query  1966  IKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTE  2145
             IKTLKK ELK LLKMLP YY HV  HENTLITK FGV+RI+LR  KKVRFVVMGNMF TE
Sbjct  478   IKTLKKFELKTLLKMLPEYYDHVGKHENTLITKIFGVHRITLRGGKKVRFVVMGNMFCTE  537

Query  2146  LHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIK-------QLS  2304
             L +H RYDLKGS+ GR+TDKDK+ E TTLKDLDL YE  MDKLL E+L K       QLS
Sbjct  538   LRIHDRYDLKGSTQGRYTDKDKVGENTTLKDLDLAYEFHMDKLLRESLFKNTFLLCRQLS  597

Query  2305  LDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSD-----GGISIL  2469
             LD  FLESQ IIDYSLLLG+HFRAPE L A+LEPP ++    +TL +SD     G + I 
Sbjct  598   LDCSFLESQQIIDYSLLLGIHFRAPEQLRAILEPPATMLN-HATLATSDGINSQGPLVIP  656

Query  2470  PRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQAN  2649
             P+ L LVTHEPS VST PGPH RG TL+ANS+G++EVDLLLPGTGRLRVQLGVNMPAQA+
Sbjct  657   PKGLLLVTHEPSSVSTTPGPHSRGDTLKANSLGEKEVDLLLPGTGRLRVQLGVNMPAQAS  716

Query  2650  RKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPK  2829
              K+ QDE D +E+ELFEVYDVVLY+GIIDILQ Y ++KK+EH  KSL+FDP SIS++EPK
Sbjct  717   HKLMQDEVDSAEIELFEVYDVVLYMGIIDILQEYKVKKKVEHACKSLKFDPQSISIVEPK  776

Query  2830  LYSKRFISFLERVFRA*P  2883
              Y+KRFI+FL +VF   P
Sbjct  777   FYAKRFINFLHKVFPQQP  794



>ref|XP_006597317.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X1 [Glycine max]
 ref|XP_006597318.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X2 [Glycine max]
 ref|XP_006597319.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X3 [Glycine max]
 ref|XP_006597320.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X4 [Glycine max]
 ref|XP_006597321.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X5 [Glycine max]
 ref|XP_006597322.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X6 [Glycine max]
Length=771

 Score =   980 bits (2534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/780 (62%), Positives = 598/780 (77%), Gaps = 22/780 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++ R DEK F NGDVYIGM KG++PH KGKYT SDGT Y+GDWE  KMTGKG I+WSS
Sbjct  1     MEDSGRFDEKSFSNGDVYIGMIKGIVPHDKGKYTWSDGTVYEGDWEGEKMTGKGLIVWSS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+   GYLHG+GT ++S G +Y+G W+MN QHG+GRK+Y NSDV++G WKEGV +
Sbjct  61    GAQYEGEISGGYLHGYGTLTTSAGCIYRGGWRMNAQHGIGRKQYSNSDVFEGLWKEGVPE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRYTW+NGNMY G WK G + GRGVMKW NGD FDG W++GL HG+G YRF DG  Y 
Sbjct  121   GSGRYTWNNGNMYVGNWKNGKIYGRGVMKWVNGDTFDGLWLNGLMHGTGVYRFGDGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSS--------ISKKDAVKPKV  1278
             GTW+ GLKDG+G  YP G          H  ++++ S   S        + K++A K +V
Sbjct  181   GTWNKGLKDGKGVFYPAGSK--------HPSLKKLHSPRDSDHNGFLLNVEKQEAPKARV  232

Query  1279  KRSISEK--IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAE  1452
             KRS+SE   ++ RF +   +IS R  S+  +     S+ + +  D+S  LS+     ++E
Sbjct  233   KRSLSENMPVISRF-KSFRQISHRTSSLKINLIRSDSAQDCVCHDSSLTLSNALDGDQSE  291

Query  1453  QLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYY  1632
               G  T+ YEREY+QGVLI ERI      S +  Q+ KF  K+V+K SC+D+F+GR+SYY
Sbjct  292   ASGESTLVYEREYVQGVLIMERICECSESSREKKQQNKFSVKQVKKSSCLDIFEGRRSYY  351

Query  1633  LMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDY  1812
             L LNLQLGIRY+VGKITP+P REVR SDFG++ARI+MYFPR GS+LTPPH SI+FYWKDY
Sbjct  352   LKLNLQLGIRYTVGKITPVPAREVRSSDFGDRARIRMYFPRAGSKLTPPHSSINFYWKDY  411

Query  1813  CPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSEL  1992
             CP+VFRNLR +FKL+AA+YMMSIC D GLR+L SPGKSGSIFYLS DDRFVIKT+ KSEL
Sbjct  412   CPMVFRNLREMFKLDAAEYMMSICGDSGLRDLSSPGKSGSIFYLSKDDRFVIKTVNKSEL  471

Query  1993  KVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDL  2172
             KVLL MLP YY+HV DHENTLITKFFG++RI+LR  KKVRFVVMGN+F TEL +H RYDL
Sbjct  472   KVLLSMLPKYYRHVGDHENTLITKFFGLHRITLRGGKKVRFVVMGNVFCTELQIHRRYDL  531

Query  2173  KGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSL  2352
             KGS  GR+T+ DKI   TTLKDLDL YE  MDK L E+L+KQ+SLD +FLESQHIIDYSL
Sbjct  532   KGSKQGRYTNNDKINCNTTLKDLDLKYEFHMDKKLRESLLKQISLDCKFLESQHIIDYSL  591

Query  2353  LLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPH  2532
             LLGLHFRAPE++ A +E  +S+ + +S     +G + ILP+ L LV+HEPSIV+TAPGPH
Sbjct  592   LLGLHFRAPENMKAFVEHHESVQRQESLPSGDEGQLLILPKGLLLVSHEPSIVNTAPGPH  651

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQ--DETDPSEVELFEVY  2706
             IRG TLRA S+GD EVDLLLPG  RLRVQLGVNMPAQA R++++  D+ +  EVELFEVY
Sbjct  652   IRGNTLRAYSMGDNEVDLLLPGIARLRVQLGVNMPAQATRRLQEDKDKVEAKEVELFEVY  711

Query  2707  DVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFL-ERVFRA*P  2883
             DVVLY+G+IDILQ YN+RKK+EH YKSL+FDPM+ISV+EPK+Y +RFI FL E+VF   P
Sbjct  712   DVVLYMGVIDILQNYNLRKKIEHAYKSLQFDPMTISVVEPKIYDERFIKFLEEKVFPKTP  771



>gb|KHN06500.1| Phosphatidylinositol-4-phosphate 5-kinase 7 [Glycine soja]
Length=773

 Score =   979 bits (2530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/770 (62%), Positives = 588/770 (76%), Gaps = 15/770 (2%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++ER +E+ F NGDVYIG  KG+LPHGKGKYT SDG  Y+GDW  GKMTGKG I W +
Sbjct  1     MEDSERFEERSFSNGDVYIGKIKGMLPHGKGKYTWSDGAVYEGDWVNGKMTGKGLITWPT  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+   GYLHG GTF+ S G +Y G W+M+  HG+GRKEY NSD+Y+G WKEG+R+
Sbjct  61    GAKYEGEFSGGYLHGHGTFTHSTGCIYSGGWRMDAHHGIGRKEYSNSDIYEGLWKEGIRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY+W NGN Y G WK G + GRGVMKW N D+FDG W++GL+ GSG YRFADG  Y 
Sbjct  121   GCGRYSWENGNTYIGNWKSGKIDGRGVMKWANDDIFDGCWINGLKQGSGVYRFADGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDS---SISKKDAVKPKVKRSIS  1293
             GTWS GLKDGRGT YP G      K    K++  + S D    +  K  A K K  RS S
Sbjct  181   GTWSKGLKDGRGTFYPAGS-----KQPSLKKLCSLNSDDGLLLNTEKHTATKQKFTRSFS  235

Query  1294  EKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNIT  1470
             EKI V   ++ S +I  R  S+  +  +   + + +  D+S  LS T  + ++E  G  +
Sbjct  236   EKISVSGRSKSSRQICHRTSSLDANCIIQDPAGDCICRDSSPTLSQTFNESQSEASGVNS  295

Query  1471  VAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQ  1650
             + YEREYMQGVLI ERI++   + H++ ++  F  K+ +K S +D+F G +SYYL LNLQ
Sbjct  296   LLYEREYMQGVLIMERIRNYSEIPHKNKRQNTFSVKQAKKSSWIDIFGGSRSYYLKLNLQ  355

Query  1651  LGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFR  1830
             LGIRY+VGKITP+P REVR SDFG++ARI+MYFP++GS+LTPPH SIDFYWKDYCP+VFR
Sbjct  356   LGIRYTVGKITPVPAREVRSSDFGDRARIRMYFPKEGSQLTPPHCSIDFYWKDYCPMVFR  415

Query  1831  NLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKM  2010
             NLR +FKL+AA+YMMSIC D GLR++ SPGKSGSIF+LS DDRFVIKTLKK ELKV+L M
Sbjct  416   NLREMFKLDAAEYMMSICGDSGLRDISSPGKSGSIFFLSQDDRFVIKTLKKYELKVMLNM  475

Query  2011  LPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLG  2190
             LP YY HV  +ENTLITKFFG++RI+LR  KKVRFVVMGNMF TELH+H RYDLKGS+ G
Sbjct  476   LPKYYHHVGSYENTLITKFFGLHRITLRGGKKVRFVVMGNMFCTELHIHRRYDLKGSTQG  535

Query  2191  RFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHF  2370
             R+TDKDKI   TTLKDLDL YE  MDK L E+L KQ+SLD  FLESQHIIDYSLLLGLHF
Sbjct  536   RYTDKDKINSNTTLKDLDLKYEFHMDKKLRESLFKQISLDCMFLESQHIIDYSLLLGLHF  595

Query  2371  RAPEHLTALLEPPDSLFKPKSTLVSSD-----GGISILPRSLTLVTHEPSIVSTAPGPHI  2535
             RAPE+L AL+EPP  L +P+  L S D     G   I+P+ L LV HEPS V+TAPGPHI
Sbjct  596   RAPENLKALVEPP-RLPQPQHGLPSEDDAQKQGEQLIIPKGLLLVAHEPSFVNTAPGPHI  654

Query  2536  RGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVV  2715
             RG TLRA S+GD++VDLLLPGT RLRVQLGVNMPAQA RK+++D+ + SEVELFEVYDVV
Sbjct  655   RGNTLRAYSIGDKQVDLLLPGTARLRVQLGVNMPAQATRKLQEDKVEESEVELFEVYDVV  714

Query  2716  LYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             LY+GIIDILQ Y ++KKLEH  KSL++DPM+ISV+EPK Y++RFI+F+E+
Sbjct  715   LYMGIIDILQEYTVKKKLEHACKSLQYDPMTISVVEPKTYAERFINFMEK  764



>ref|XP_003531303.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X1 [Glycine max]
Length=776

 Score =   979 bits (2530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/772 (63%), Positives = 589/772 (76%), Gaps = 16/772 (2%)
 Frame = +1

Query  583   MENNERT--DEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIW  756
             ME++ER   +EK F NGDVYIG  KG+LPHGKGKYT SDG  Y+GDW  GKMTGKG I W
Sbjct  1     MEDSERCRFEEKSFSNGDVYIGKIKGMLPHGKGKYTWSDGAVYEGDWVNGKMTGKGLITW  60

Query  757   SSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGV  936
              +GA Y+G+   GYLHG GTF+ S G +Y G W+M+  HG+GRKEY NSDVY+G WKEG+
Sbjct  61    PTGAKYEGEFSGGYLHGHGTFTHSTGCIYTGGWRMDAHHGIGRKEYSNSDVYEGLWKEGI  120

Query  937   RDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSY  1116
             R+G GRY+W NGN Y G WK G + GRGVMKW NGD+FDG W++GL+HGSG YRFADG  
Sbjct  121   REGCGRYSWENGNTYIGNWKSGKIDGRGVMKWANGDIFDGCWLNGLKHGSGVYRFADGGL  180

Query  1117  YFGTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDS----SISKKDAVKPKVKR  1284
             Y GTWS GLKDG+GT YP G      K    K++  + S DS    ++ K  A K K  R
Sbjct  181   YIGTWSKGLKDGKGTFYPAGS-----KQPSLKKLCSLNSDDSRLLLNMEKHTAPKQKFTR  235

Query  1285  SISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLG  1461
             S SEKI V   ++ S +IS R  S+  +  L   +   +  D+S  LS T  + ++E   
Sbjct  236   SFSEKISVSGRSKSSRQISHRTSSLDANCILQDPAGGCICRDSSPTLSQTFNESQSEATS  295

Query  1462  NITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
               ++ YEREYMQGVLI ERI++   + H++ ++ K+  K+V+KGS +D+F G +SYYL L
Sbjct  296   VNSLVYEREYMQGVLIMERIRNYSEMPHKNKRQNKYSVKQVKKGSWIDIFGGSRSYYLKL  355

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDFG++ARI+MYFP++GS+LTPPH SIDFYWKDYCP+
Sbjct  356   NLQLGIRYTVGKITPVPAREVRSSDFGDRARIRMYFPKEGSQLTPPHCSIDFYWKDYCPM  415

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FKL+AA+YMMSIC D GLR++ SPGKSGSIF+LS DDRFVIKTLKK ELKV+
Sbjct  416   VFRNLREMFKLDAAEYMMSICGDSGLRDISSPGKSGSIFFLSQDDRFVIKTLKKYELKVM  475

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L MLP YY HV  +ENTLITKFFG++RI+LR  KKVRFVVMGNMF TELH+H RYDLKGS
Sbjct  476   LNMLPKYYHHVGSYENTLITKFFGLHRITLRGGKKVRFVVMGNMFCTELHIHRRYDLKGS  535

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             + GR+T +DKI   TTLKDLDL YE  MDK L E+L KQ+SLD  FLESQHIIDYSLLLG
Sbjct  536   TQGRYTKEDKINSNTTLKDLDLKYEFHMDKKLRESLFKQISLDCMFLESQHIIDYSLLLG  595

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSD----GGISILPRSLTLVTHEPSIVSTAPGP  2529
             LHFRAPE+L AL+EPP  +  P S     D    G   I+P+ L LV HEPS V+TAPGP
Sbjct  596   LHFRAPENLKALVEPPRLMQLPHSLPSEDDAHKQGEQLIIPKGLLLVAHEPSFVNTAPGP  655

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYD  2709
             HIRG TLRA S+GD++VDLLLPGT RLRVQLGVNMPAQA RK++ D+ + SEVELFEVYD
Sbjct  656   HIRGNTLRAYSIGDKQVDLLLPGTARLRVQLGVNMPAQATRKLQGDKVEESEVELFEVYD  715

Query  2710  VVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             VVLY+GIIDILQ Y ++KKLEH  KSL++DPM+ISV+EPK Y++RFI+F+E+
Sbjct  716   VVLYMGIIDILQEYTVKKKLEHACKSLQYDPMTISVVEPKTYAERFINFMEK  767



>ref|XP_008449413.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X2 [Cucumis melo]
Length=779

 Score =   977 bits (2525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/786 (62%), Positives = 588/786 (75%), Gaps = 26/786 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME+ +   E V  NGDVYIG FK  LPHGKGKY   +GT YDGDWE+GKMTGKG+I W S
Sbjct  1     MEDIQGLAENVLSNGDVYIGSFKDSLPHGKGKYMWLEGTIYDGDWEDGKMTGKGKITWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+GD   GYLHGFGTF  SDGS+Y G W+MNI HG+GRK Y N D+YDG WKEG+ +
Sbjct  61    GARYEGDISGGYLHGFGTFYYSDGSIYNGAWRMNIHHGIGRKLYANLDIYDGSWKEGIPE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY WS+GN Y G WK G M G+G+MKW NGD F GFW++G RHGSG Y FADG+YYF
Sbjct  121   GCGRYFWSSGNSYIGNWKGGQMCGKGIMKWVNGDHFIGFWLNGFRHGSGVYHFADGAYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGC---ALDKCK------IDGHKEIRRMLSHDSSISKKDAVKPK  1275
             G+WS GLKDG+GT YP G    +L+K        IDG   + R LS +  + K+ A K  
Sbjct  181   GSWSKGLKDGKGTFYPAGSKPPSLEKWHNFIGYDIDGKGFVSRTLSLN--LEKEKAPKHG  238

Query  1276  VKRSISEKIVDRFARDSGRISRRAVSV----AGDAALHCSSTEVLPEDASCMLSHTT--C  1437
             +K S SEKI       +G +S    S+      D A   S+ E      SC++SH +   
Sbjct  239   LKHSFSEKISVTGISSAGGLSNWPTSMEVNWGSDPARETSADE-----DSCVMSHASKSV  293

Query  1438  DGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
              G+     N  + YEREY+QGVLI+ER+K  + L  +S +R+K   KE  + SC++ F+ 
Sbjct  294   KGQNNVPYNHRMVYEREYIQGVLIQERVKEYEELLDRSKERKKTTMKEAARVSCVNFFES  353

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              +SYYLMLNLQLGIRY+VGKITP+PMREVR SDFG +ARI MYFPRKGS+ TPPH S+DF
Sbjct  354   HRSYYLMLNLQLGIRYTVGKITPVPMREVRASDFGRRARIVMYFPRKGSQFTPPHYSVDF  413

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
             +WKDYCP+VFRNLR +FKL+AA+YMMSIC DDGLREL SPGKSGSIFYLS DDRFVIKTL
Sbjct  414   HWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLRELSSPGKSGSIFYLSQDDRFVIKTL  473

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMH  2157
             KKSELKVLLKMLP YY HVK HENTLITKFFG++RI++  R KVRFVVMGNMF TEL +H
Sbjct  474   KKSELKVLLKMLPKYYDHVKAHENTLITKFFGLHRITIHGRSKVRFVVMGNMFCTELRIH  533

Query  2158  HRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHI  2337
              RYDLKGS+ GR+T  DK ++G TLKDLDL YE  MDKLL ++L KQ+SLD  FLES HI
Sbjct  534   RRYDLKGSTFGRYTHGDKSKDGITLKDLDLSYEFHMDKLLRQSLFKQISLDCMFLESLHI  593

Query  2338  IDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTL----VSSDGGISILPRSLTLVTHEPS  2505
             IDYSLLLG+HFRAPE L ALLEPP ++  P++ L     SS+   +I P+ L LVTHEPS
Sbjct  594   IDYSLLLGVHFRAPEKLKALLEPPATVQHPENLLHDDGESSESEPTIPPKGLILVTHEPS  653

Query  2506  IVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSE  2685
              V+TAPGPHIRG+ L+A S+GDREVD+LLPGT R RVQLGVNMPA A++K+++  ++ +E
Sbjct  654   SVTTAPGPHIRGRPLKAYSLGDREVDVLLPGTARFRVQLGVNMPAHASQKLREARSESAE  713

Query  2686  VELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             VELFE YDVVLY+GIIDILQ YN+ KKLEH YKS RFDP+SISV+EP LY+ RFISFLE+
Sbjct  714   VELFEFYDVVLYMGIIDILQEYNVVKKLEHAYKSFRFDPLSISVVEPHLYAARFISFLEK  773

Query  2866  VFRA*P  2883
             VF   P
Sbjct  774   VFHELP  779



>ref|XP_010533934.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 [Tarenaya 
hassleriana]
 ref|XP_010533936.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 [Tarenaya 
hassleriana]
Length=777

 Score =   976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/778 (63%), Positives = 594/778 (76%), Gaps = 17/778 (2%)
 Frame = +1

Query  574   VIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQII  753
             ++I     R  EK FPNGD Y G FKG LPHG+G Y  +DGT Y+G WEEGK++GKG++ 
Sbjct  1     MLIEMETRRFGEKEFPNGDFYSGEFKGELPHGRGSYVWTDGTIYEGVWEEGKISGKGKLT  60

Query  754   WSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEG  933
             WS+GA Y+GD   GYLHGFGT +S DGSVY G W+MN++HG+GRKEY NSD+Y+G WKEG
Sbjct  61    WSAGAKYEGDFSGGYLHGFGTLTSPDGSVYSGSWRMNVRHGLGRKEYSNSDIYNGSWKEG  120

Query  934   VRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGS  1113
             ++DG G Y+W+NGN Y G WKKG M GRGVM+W NGDLFDGFWV+G RHGSG Y+FADG 
Sbjct  121   LQDGSGSYSWNNGNRYIGNWKKGKMYGRGVMRWANGDLFDGFWVNGSRHGSGVYKFADGG  180

Query  1114  YYFGTWSNGLKDGRGTLYPVGC---ALDK-CKIDGHKEIRR-MLSHDSSISKKDAVKPK-  1275
              YFGTW+ GLKDG+G  YP G    +L K C+  G+ +    +LS  SSI+ ++    K 
Sbjct  181   LYFGTWTRGLKDGKGIFYPAGSKHPSLKKWCQSFGYDDTGNFLLSRSSSINVEEVRHSKT  240

Query  1276  VKRSISEKI-VDRFARDSGR-ISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
             + RS+SE   ++   R+S R +S R +    + +L   + + +    S    HT+  G++
Sbjct  241   ITRSLSENPPINGTMRNSHRRLSDRFLDE--NWSLCDPTRDFVCHGPSNKSIHTSDSGQS  298

Query  1450  EQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
             E      + YEREYMQGVLIRER+ S D +SH++        KE+   +CM    G++SY
Sbjct  299   EGQDKNRIVYEREYMQGVLIRERVISSDNMSHKANPPSH--QKEIGTSTCMAFLGGKQSY  356

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
             YLMLNLQLGIRY+VGKITP+P REVR SDFG++ARI+M+FPR+GS+ TPPH+SIDFYWKD
Sbjct  357   YLMLNLQLGIRYTVGKITPVPRREVRASDFGDRARIRMFFPREGSQFTPPHKSIDFYWKD  416

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FKL+AA+YMMSIC DDGLRE+ SPGKSGSIFYLS DDRFVIKTLKKSE
Sbjct  417   YCPMVFRNLREMFKLDAAEYMMSICGDDGLREISSPGKSGSIFYLSHDDRFVIKTLKKSE  476

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             LKVLL+MLP YY HV DHENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL +H RYD
Sbjct  477   LKVLLRMLPKYYDHVGDHENTLITKFFGVHRIKLKWGKKVRFVVMGNMFCTELKIHRRYD  536

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGS+ GRFTDK KIEE TTLKDLDL YE  MDKLL E L KQ+ LD  FLES  IIDYS
Sbjct  537   LKGSTQGRFTDKSKIEEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCSFLESLQIIDYS  596

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHEPSIVST  2517
             LLLGLHFRAPE L  +LEPP+SL   + ++ S D G    +SI P+ L LVTHEPS V+T
Sbjct  597   LLLGLHFRAPEQLNDILEPPNSL-SDQDSIASVDAGSSQELSIPPKGLLLVTHEPSSVNT  655

Query  2518  APGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
             APGPHIRG TLRA SVG+REVDL+LPGT RLRVQLGVNMPAQA+ K+ QD  + + +ELF
Sbjct  656   APGPHIRGSTLRAFSVGEREVDLILPGTARLRVQLGVNMPAQAHHKLLQDNEETARIELF  715

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             EVYDVV+Y+GIIDILQ YNM+KK+EH  KSL++DPM+IS IEP+LYSKRFI FL +VF
Sbjct  716   EVYDVVIYMGIIDILQEYNMKKKVEHTCKSLQYDPMTISAIEPELYSKRFIDFLVKVF  773



>gb|KHG21070.1| Phosphatidylinositol-4-phosphate 5-kinase 8 [Gossypium arboreum]
 gb|KHG27344.1| Phosphatidylinositol-4-phosphate 5-kinase 8 [Gossypium arboreum]
Length=803

 Score =   976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/800 (60%), Positives = 601/800 (75%), Gaps = 22/800 (3%)
 Frame = +1

Query  532   REVYRNSYGMGI*CVIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDG  711
              E   N   +G    I +E+ ER +EK FPNGD+Y+G FK +LPHGKGKYT SDGT YDG
Sbjct  10    EESKANDEQLGPSSCINVESVERLNEKAFPNGDLYVGDFKEILPHGKGKYTWSDGTVYDG  69

Query  712   DWEEGKMTGKGQIIWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKE  891
             DWE GK  GKG +IW SGA Y+GD   GYLHGFG F++SDGS+Y+GHW+MNI+HG G+K+
Sbjct  70    DWEAGKTAGKGLLIWPSGAKYNGDISGGYLHGFGAFTASDGSIYEGHWRMNIRHGYGKKK  129

Query  892   YQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDG  1071
             Y NSD+Y+G WKEG  +G G Y W+NGN YTG WK+G M GRGVM+W NGD ++G W +G
Sbjct  130   YSNSDIYEGEWKEGEHEGKGIYFWNNGNKYTGNWKRGKMHGRGVMEWINGDHYNGCWFNG  189

Query  1072  LRHGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVGC---ALDKCKI-----DGHKEIRRM  1227
              RHG+G Y++ADG YYFGTW+ GLKDG+G  YP G    +L KC       D HK +   
Sbjct  190   FRHGNGIYQYADGGYYFGTWTRGLKDGKGLFYPAGSKRPSLKKCCTSLGYDDDHKTV---  246

Query  1228  LSHDSSISKKDAV--KPKVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVL  1398
             L   SS+  ++ +  KP +KRS+SEKI V    + SGR+S +    +G   L  S  E +
Sbjct  247   LPQCSSLHLEEHIVKKPSIKRSLSEKISVSGVLKGSGRMSSKTAESSG---LSDSGREFV  303

Query  1399  PEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAK  1578
               ++S   S  +  G++E   N  V YEREYMQGV+I+ERI+  + LS ++ ++ KF AK
Sbjct  304   HHNSSGTFSFDSDAGQSELQENTAVIYEREYMQGVMIKERIRDYNELSKKAEKKTKFHAK  363

Query  1579  EVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRK  1758
             E +K SC+ +FKG  SY+LMLNLQLGIRY+VGKITP+P REVR +DFG++ARI M+FP+K
Sbjct  364   ETQKSSCVGIFKGHNSYHLMLNLQLGIRYTVGKITPVPKREVRAADFGDRARITMFFPKK  423

Query  1759  GSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIF  1938
             GS+ TPPH+SIDFYWKDYCP+VFR+LR LFKL+AA+YMMSIC DDGL E+ SPGKSGS+F
Sbjct  424   GSQFTPPHKSIDFYWKDYCPMVFRHLRELFKLDAAEYMMSICGDDGLTEISSPGKSGSLF  483

Query  1939  YLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFV  2118
             YLS DD+FVIKTLKKSELKVLLKMLP Y+ HVK+HENTLITKFFG++RI+L  R+KVRFV
Sbjct  484   YLSHDDKFVIKTLKKSELKVLLKMLPKYHNHVKEHENTLITKFFGLHRITLPGRRKVRFV  543

Query  2119  VMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQ  2298
             VMGNMF TEL +H RYDLKGS+ GR TDKDKI E TTLKDLDL YE  MDK L E L  Q
Sbjct  544   VMGNMFCTELRIHRRYDLKGSTHGRITDKDKIHENTTLKDLDLSYEFHMDKSLREFLFDQ  603

Query  2299  LSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEP----PDSLFKPKSTLVSSDGGISI  2466
             ++ D  FL+SQ IIDYSLLLGLHFRAPE L  L+EP    P+    P    +++DG +  
Sbjct  604   IADDCAFLKSQQIIDYSLLLGLHFRAPEPLDGLVEPPNISPNMQSSPAGQGLTADGEVLF  663

Query  2467  LPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQA  2646
               +   L+ HEPS V+T PGPHIRG+ LRA S+G++EVD+++PGTGRLRVQLGVNMPA+A
Sbjct  664   PSKGFVLLAHEPSSVNTDPGPHIRGRALRAFSLGNQEVDIMVPGTGRLRVQLGVNMPARA  723

Query  2647  NRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEP  2826
             N K+ QDE+D +EVELFEVYDV+LY+GIIDILQ YN +KK EH YKS++F P +ISV+EP
Sbjct  724   NHKLPQDESDSAEVELFEVYDVILYMGIIDILQEYNAKKKAEHAYKSVKFGPTTISVVEP  783

Query  2827  KLYSKRFISFL-ERVFRA*P  2883
             +LY+ RF +FL ++VF   P
Sbjct  784   ELYANRFTNFLKQKVFPGQP  803



>ref|XP_008449410.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X1 [Cucumis melo]
 ref|XP_008449411.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X1 [Cucumis melo]
 ref|XP_008449412.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X1 [Cucumis melo]
Length=780

 Score =   976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/787 (62%), Positives = 588/787 (75%), Gaps = 27/787 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME+ +   E V  NGDVYIG FK  LPHGKGKY   +GT YDGDWE+GKMTGKG+I W S
Sbjct  1     MEDIQGLAENVLSNGDVYIGSFKDSLPHGKGKYMWLEGTIYDGDWEDGKMTGKGKITWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+GD   GYLHGFGTF  SDGS+Y G W+MNI HG+GRK Y N D+YDG WKEG+ +
Sbjct  61    GARYEGDISGGYLHGFGTFYYSDGSIYNGAWRMNIHHGIGRKLYANLDIYDGSWKEGIPE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY WS+GN Y G WK G M G+G+MKW NGD F GFW++G RHGSG Y FADG+YYF
Sbjct  121   GCGRYFWSSGNSYIGNWKGGQMCGKGIMKWVNGDHFIGFWLNGFRHGSGVYHFADGAYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGC---ALDKCK------IDGHKEIRRMLSHDSSISKKDAVKPK  1275
             G+WS GLKDG+GT YP G    +L+K        IDG   + R LS +  + K+ A K  
Sbjct  181   GSWSKGLKDGKGTFYPAGSKPPSLEKWHNFIGYDIDGKGFVSRTLSLN--LEKEKAPKHG  238

Query  1276  VKRSISEKIVDRFARDSGRISRRAVSV----AGDAALHCSSTEVLPEDASCMLSHTT--C  1437
             +K S SEKI       +G +S    S+      D A   S+ E      SC++SH +   
Sbjct  239   LKHSFSEKISVTGISSAGGLSNWPTSMEVNWGSDPARETSADE-----DSCVMSHASKSV  293

Query  1438  DGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
              G+     N  + YEREY+QGVLI+ER+K  + L  +S +R+K   KE  + SC++ F+ 
Sbjct  294   KGQNNVPYNHRMVYEREYIQGVLIQERVKEYEELLDRSKERKKTTMKEAARVSCVNFFES  353

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              +SYYLMLNLQLGIRY+VGKITP+PMREVR SDFG +ARI MYFPRKGS+ TPPH S+DF
Sbjct  354   HRSYYLMLNLQLGIRYTVGKITPVPMREVRASDFGRRARIVMYFPRKGSQFTPPHYSVDF  413

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
             +WKDYCP+VFRNLR +FKL+AA+YMMSIC DDGLREL SPGKSGSIFYLS DDRFVIKTL
Sbjct  414   HWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLRELSSPGKSGSIFYLSQDDRFVIKTL  473

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMH  2157
             KKSELKVLLKMLP YY HVK HENTLITKFFG++RI++  R KVRFVVMGNMF TEL +H
Sbjct  474   KKSELKVLLKMLPKYYDHVKAHENTLITKFFGLHRITIHGRSKVRFVVMGNMFCTELRIH  533

Query  2158  HRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHI  2337
              RYDLKGS+ GR+T  DK ++G TLKDLDL YE  MDKLL ++L KQ+SLD  FLES HI
Sbjct  534   RRYDLKGSTFGRYTHGDKSKDGITLKDLDLSYEFHMDKLLRQSLFKQISLDCMFLESLHI  593

Query  2338  IDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTL-----VSSDGGISILPRSLTLVTHEP  2502
             IDYSLLLG+HFRAPE L ALLEPP ++  P++ L      SS+   +I P+ L LVTHEP
Sbjct  594   IDYSLLLGVHFRAPEKLKALLEPPATVQHPENLLHDDAGESSESEPTIPPKGLILVTHEP  653

Query  2503  SIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPS  2682
             S V+TAPGPHIRG+ L+A S+GDREVD+LLPGT R RVQLGVNMPA A++K+++  ++ +
Sbjct  654   SSVTTAPGPHIRGRPLKAYSLGDREVDVLLPGTARFRVQLGVNMPAHASQKLREARSESA  713

Query  2683  EVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLE  2862
             EVELFE YDVVLY+GIIDILQ YN+ KKLEH YKS RFDP+SISV+EP LY+ RFISFLE
Sbjct  714   EVELFEFYDVVLYMGIIDILQEYNVVKKLEHAYKSFRFDPLSISVVEPHLYAARFISFLE  773

Query  2863  RVFRA*P  2883
             +VF   P
Sbjct  774   KVFHELP  780



>ref|XP_007148509.1| hypothetical protein PHAVU_006G214700g [Phaseolus vulgaris]
 gb|ESW20503.1| hypothetical protein PHAVU_006G214700g [Phaseolus vulgaris]
Length=771

 Score =   976 bits (2522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/782 (62%), Positives = 596/782 (76%), Gaps = 26/782 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++ R DEK F NGDVYIGM KG+LPH KGKYT SDGT Y+GDWE  KMTGKG ++WS+
Sbjct  1     MEDSGRFDEKSFSNGDVYIGMIKGILPHDKGKYTWSDGTVYEGDWEGEKMTGKGLVVWST  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+   GYLHG+GT ++S G +Y+G WKMN QHG+G ++Y NSDVY+G WKEGV +
Sbjct  61    GAHYEGEICGGYLHGYGTLTTSAGCIYRGGWKMNAQHGIGLQKYSNSDVYEGLWKEGVPE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRYTW+NGNMY G WK G + GRGVMKW  GD F GFW +G+ HGSG Y F +G  Y 
Sbjct  121   GSGRYTWNNGNMYVGNWKNGRIDGRGVMKWVKGDTFHGFWSNGVMHGSGVYSFGEGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDS----------SISKKDAVKP  1272
             GTW+ GLKDG+G  YP G           +   RM+SH            +I K +A K 
Sbjct  181   GTWNKGLKDGKGVFYPAGSK---------QPSLRMISHSPHHSDDNGFLLNIQKHEAPKA  231

Query  1273  KVKRSISEKI--VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
             +VKRS+SE I  + RF +   +IS+R  S+  +     S+ + +  D+S  LS+   + +
Sbjct  232   RVKRSLSENISVISRF-KSFRQISQRTSSLKINLVRDDSAQDCVCHDSSLALSNDLDEDQ  290

Query  1447  AEQLG-NITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
             +E      T+ YEREY+QGVLI ERI      S +  Q+ KF  K+V+K SC+D F+G++
Sbjct  291   SEASSVKSTLVYEREYVQGVLIMERISECSESSRKKKQQNKFSVKQVKKSSCLDNFQGQR  350

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SYYL LNLQLGIRY+VGKITP+P REVR SDFG++ARI+MYFPR GS+LTPPH SI+FYW
Sbjct  351   SYYLKLNLQLGIRYTVGKITPVPAREVRSSDFGDRARIRMYFPRAGSKLTPPHSSINFYW  410

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR +FKL+AA+YMMSIC D GLR+L SPGKSGSIFYLS DDRFVIKT+ K
Sbjct  411   KDYCPMVFRNLREMFKLDAAEYMMSICGDSGLRDLSSPGKSGSIFYLSKDDRFVIKTVNK  470

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SEL+VLL MLP YY+HV DHENTLITKFFG++RI+LR  KKVRFVVMGN+F TEL +H R
Sbjct  471   SELQVLLSMLPKYYRHVGDHENTLITKFFGLHRITLRGGKKVRFVVMGNVFCTELQIHRR  530

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             YDLKGSS GR+TD DKI   TTLKDLDL YE  MDK L E+L+KQ+SLD +FLESQHIID
Sbjct  531   YDLKGSSHGRYTDNDKINCNTTLKDLDLKYEFHMDKKLRESLLKQISLDCKFLESQHIID  590

Query  2344  YSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAP  2523
             YSLLLGLHFRAPE++ A +E  +S+ + +  L S D    ILP+ L LV+HEPSIV+TAP
Sbjct  591   YSLLLGLHFRAPENMKAFVEHHESM-QHQENLPSGDEEHLILPKGLLLVSHEPSIVNTAP  649

Query  2524  GPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPS-EVELFE  2700
             GPHIRG TLRA S+GD EVDLLLPGT RLRVQLGVNMPAQA RK+ +D+ + + EVELFE
Sbjct  650   GPHIRGNTLRAYSMGDTEVDLLLPGTARLRVQLGVNMPAQATRKIVEDKVEEAKEVELFE  709

Query  2701  VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFL-ERVFRA  2877
             VYDVVLY+GIIDILQ+YN++KK+EH YKSL+FDP+++SV+EPK+Y++RF+ FL E+VF  
Sbjct  710   VYDVVLYMGIIDILQSYNLKKKIEHSYKSLQFDPITVSVVEPKMYAQRFLKFLEEKVFPQ  769

Query  2878  *P  2883
              P
Sbjct  770   TP  771



>gb|KHG13183.1| Phosphatidylinositol-4-phosphate 5-kinase 8 -like protein [Gossypium 
arboreum]
 gb|KHG17073.1| Phosphatidylinositol-4-phosphate 5-kinase 8 -like protein [Gossypium 
arboreum]
Length=798

 Score =   974 bits (2517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/789 (61%), Positives = 599/789 (76%), Gaps = 15/789 (2%)
 Frame = +1

Query  547   NSYGMGI*CVIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEG  726
             N+  +G    I +EN ER ++KVF NGD+Y+G FK  LPHGKGKYT S+G  Y+GDWE G
Sbjct  15    NADPLGPVSCIGVENVERPNKKVFSNGDLYVGDFKAALPHGKGKYTWSNGMVYEGDWEAG  74

Query  727   KMTGKGQIIWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSD  906
             KM GKG ++W SG  Y+GD   GYLHGFGT +S DGSVY+G W+MNIQHG G+K+Y NSD
Sbjct  75    KMIGKGLLLWPSGERYNGDISGGYLHGFGTLTSPDGSVYEGQWRMNIQHGFGKKKYANSD  134

Query  907   VYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGS  1086
             VY+G WKEG  +G+GRY W+NGN YTG WK+G M GRGVM+W NGD ++G W++GLRHGS
Sbjct  135   VYEGEWKEGEHEGNGRYFWNNGNKYTGNWKRGKMHGRGVMEWVNGDKYNGCWLNGLRHGS  194

Query  1087  GCYRFADGSYYFGTWSNGLKDGRGTLYPVGCALDKCK-----IDGHKEIRRMLSHDSSIS  1251
             G Y++ADG YYFGTW+ GLKDG+G  YP G      K     +      + +LS  SS++
Sbjct  195   GIYQYADGGYYFGTWTRGLKDGKGVFYPAGSKRPSLKNFCISLGYDNGPKSVLSQCSSLN  254

Query  1252  KKDAV--KPKVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSST-EVLPEDASCM  1419
              + +   K  V+RS+SEKI V    R SGRIS ++     +++ H  ST E     +S  
Sbjct  255   LEGSTVKKRSVRRSVSEKISVSGVLRSSGRISHKSA----ESSRHSDSTRESRHHYSSGT  310

Query  1420  LSHTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSC  1599
              S  +  G++E   N  V YEREYMQGV+I+ER++    L  ++ ++ K  AKE +K SC
Sbjct  311   FSFDSDGGQSEVQENTAVVYEREYMQGVMIKERVRGYTELPKKAEKKTKHHAKETKKSSC  370

Query  1600  MDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPP  1779
               +FKG+ SY+LMLNLQLGIRY+VGKITP+P REVR +DFG +ARI M+FPR+GS+ TPP
Sbjct  371   FGIFKGKNSYHLMLNLQLGIRYTVGKITPVPKREVRTADFGHRARITMFFPRRGSQFTPP  430

Query  1780  HRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDR  1959
             H+S+DFYWKDYCP+VFRNLR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDR
Sbjct  431   HKSVDFYWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYLSHDDR  490

Query  1960  FVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFY  2139
             FVIKTLKKSELKVLLKMLP YY HVK+HENTLITKFFG+++I++  ++KVRFVVMGNMF 
Sbjct  491   FVIKTLKKSELKVLLKMLPKYYNHVKEHENTLITKFFGLHQITVHDKRKVRFVVMGNMFC  550

Query  2140  TELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQF  2319
             TEL +H RYDLKGS+ GR TDKDKI E TTLKDLDL YE +MDK L +    Q++LD  F
Sbjct  551   TELRIHRRYDLKGSTHGRCTDKDKIHENTTLKDLDLSYEFQMDKSLQKFFFHQIALDCNF  610

Query  2320  LESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHE  2499
             L+SQHIIDYSLLLGLHFRAPE L  LLEPP  +   +S+    DG +    + L LV HE
Sbjct  611   LKSQHIIDYSLLLGLHFRAPEQLNGLLEPP-MMPNIESSPAGQDGEVLFPSKGLLLVAHE  669

Query  2500  PSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDP  2679
             PS VST PGPHIRG+ LRA S+GD+EVD+L+PGTGRL+VQLGVNMPAQAN+K+ +DE D 
Sbjct  670   PSSVSTDPGPHIRGRPLRAFSLGDKEVDVLVPGTGRLQVQLGVNMPAQANQKLSRDEADS  729

Query  2680  SEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFL  2859
             +EVELFEVYDVV+Y+GIIDILQ YN +KK EH  KS++FDP+SISV+EP+LY++RFI+FL
Sbjct  730   AEVELFEVYDVVIYMGIIDILQEYNAKKKAEHACKSVKFDPLSISVVEPELYAQRFINFL  789

Query  2860  -ERVFRA*P  2883
              ++VF   P
Sbjct  790   KQKVFPEQP  798



>ref|XP_007148510.1| hypothetical protein PHAVU_006G214700g [Phaseolus vulgaris]
 gb|ESW20504.1| hypothetical protein PHAVU_006G214700g [Phaseolus vulgaris]
Length=772

 Score =   973 bits (2515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/782 (62%), Positives = 593/782 (76%), Gaps = 25/782 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++ R DEK F NGDVYIGM KG+LPH KGKYT SDGT Y+GDWE  KMTGKG ++WS+
Sbjct  1     MEDSGRFDEKSFSNGDVYIGMIKGILPHDKGKYTWSDGTVYEGDWEGEKMTGKGLVVWST  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+   GYLHG+GT ++S G +Y+G WKMN QHG+G ++Y NSDVY+G WKEGV +
Sbjct  61    GAHYEGEICGGYLHGYGTLTTSAGCIYRGGWKMNAQHGIGLQKYSNSDVYEGLWKEGVPE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRYTW+NGNMY G WK G + GRGVMKW  GD F GFW +G+ HGSG Y F +G  Y 
Sbjct  121   GSGRYTWNNGNMYVGNWKNGRIDGRGVMKWVKGDTFHGFWSNGVMHGSGVYSFGEGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDS----------SISKKDAVKP  1272
             GTW+ GLKDG+G  YP G               RM+SH            +I K +A K 
Sbjct  181   GTWNKGLKDGKGVFYPAGSKQPSL---------RMISHSPHHSDDNGFLLNIQKHEAPKA  231

Query  1273  KVKRSISEKI--VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
             +VKRS+SE I  + RF +   +IS+R  S+  +     S+ + +  D+S  LS+   + +
Sbjct  232   RVKRSLSENISVISRF-KSFRQISQRTSSLKINLVRDDSAQDCVCHDSSLALSNDLDEDQ  290

Query  1447  AEQLG-NITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
             +E      T+ YEREY+QGVLI ERI      S +  Q+ KF  K+V+K SC+D F+G++
Sbjct  291   SEASSVKSTLVYEREYVQGVLIMERISECSESSRKKKQQNKFSVKQVKKSSCLDNFQGQR  350

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SYYL LNLQLGIRY+VGKITP+P REVR SDFG++ARI+MYFPR GS+LTPPH SI+FYW
Sbjct  351   SYYLKLNLQLGIRYTVGKITPVPAREVRSSDFGDRARIRMYFPRAGSKLTPPHSSINFYW  410

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR +FKL+AA+YMMSIC D GLR+L SPGKSGSIFYLS DDRFVIKT+ K
Sbjct  411   KDYCPMVFRNLREMFKLDAAEYMMSICGDSGLRDLSSPGKSGSIFYLSKDDRFVIKTVNK  470

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SEL+VLL MLP YY+HV DHENTLITKFFG++RI+LR  KKVRFVVMGN+F TEL +H R
Sbjct  471   SELQVLLSMLPKYYRHVGDHENTLITKFFGLHRITLRGGKKVRFVVMGNVFCTELQIHRR  530

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             YDLKGSS GR+TD DKI   TTLKDLDL YE  MDK L E+L+KQ+SLD +FLESQHIID
Sbjct  531   YDLKGSSHGRYTDNDKINCNTTLKDLDLKYEFHMDKKLRESLLKQISLDCKFLESQHIID  590

Query  2344  YSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAP  2523
             YSLLLGLHFRAPE++ A +E  +S+   ++     +    ILP+ L LV+HEPSIV+TAP
Sbjct  591   YSLLLGLHFRAPENMKAFVEHHESMQHQENLPSGDEEEHLILPKGLLLVSHEPSIVNTAP  650

Query  2524  GPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPS-EVELFE  2700
             GPHIRG TLRA S+GD EVDLLLPGT RLRVQLGVNMPAQA RK+ +D+ + + EVELFE
Sbjct  651   GPHIRGNTLRAYSMGDTEVDLLLPGTARLRVQLGVNMPAQATRKIVEDKVEEAKEVELFE  710

Query  2701  VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFL-ERVFRA  2877
             VYDVVLY+GIIDILQ+YN++KK+EH YKSL+FDP+++SV+EPK+Y++RF+ FL E+VF  
Sbjct  711   VYDVVLYMGIIDILQSYNLKKKIEHSYKSLQFDPITVSVVEPKMYAQRFLKFLEEKVFPQ  770

Query  2878  *P  2883
              P
Sbjct  771   TP  772



>gb|KHN33459.1| Phosphatidylinositol-4-phosphate 5-kinase 8 [Glycine soja]
Length=799

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/809 (61%), Positives = 603/809 (75%), Gaps = 52/809 (6%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++ R DEK F NGDVYIGM KG++PH KGKYT SDGT Y+GDWE  KMTGKG I+WSS
Sbjct  1     MEDSGRFDEKSFSNGDVYIGMIKGIVPHDKGKYTWSDGTVYEGDWEGEKMTGKGLIVWSS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+   GYLHG+GT ++S G +Y+G W+MN QHG+GRK+Y NSDV++G WKEGV +
Sbjct  61    GAQYEGEISGGYLHGYGTLTTSAGCIYRGGWRMNAQHGIGRKQYSNSDVFEGLWKEGVPE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRYTW+NGNMY G WK G + GRGVMKW NGD FDG W++GL HG+G YRF DG  Y 
Sbjct  121   GSGRYTWNNGNMYVGNWKNGKIYGRGVMKWVNGDTFDGLWLNGLMHGTGVYRFGDGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLS-HDS-------SISKKDAVKPKV  1278
             GTW+ GLKDG+G  YP G          H  ++++ S HDS       ++ K++A K +V
Sbjct  181   GTWNKGLKDGKGVFYPAGSK--------HPSLKKLHSPHDSDHNGFLLNVEKQEAPKARV  232

Query  1279  KRSISEK--IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAE  1452
             KRS+SE   ++ RF +   +IS R  S+  +     S+ + +  D+S  LS+     ++E
Sbjct  233   KRSLSENMPVISRF-KSFRQISHRTSSLKINLIRSDSAQDCVCHDSSLTLSNALDGDQSE  291

Query  1453  QLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYY  1632
               G  T+ YEREY+QGVLI ERI      S +  Q+ KF  K+V+K SC+D+F+GR+SYY
Sbjct  292   ASGESTLVYEREYVQGVLIMERICECSESSREKKQQNKFSVKQVKKSSCLDIFEGRRSYY  351

Query  1633  LMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDY  1812
             L LNLQLGIRY+VGKITP+P REVR SDFG++ARI+MYFPR GS+LTPPH SI+FYWKDY
Sbjct  352   LKLNLQLGIRYTVGKITPVPAREVRSSDFGDRARIRMYFPRAGSKLTPPHSSINFYWKDY  411

Query  1813  CPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSEL  1992
             CP+VFRNLR +FKL+AA+YMMSIC D GLR+L SPGKSGSIFYLS DDRFVIKT+ KSEL
Sbjct  412   CPMVFRNLREMFKLDAAEYMMSICGDSGLRDLSSPGKSGSIFYLSKDDRFVIKTVNKSEL  471

Query  1993  KVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDL  2172
             KVLL MLP YY+HV DHENTLITKFFG++RI+LR  KKVRFVVMGN+F TEL +H RYDL
Sbjct  472   KVLLSMLPKYYRHVGDHENTLITKFFGLHRITLRGGKKVRFVVMGNVFCTELQIHRRYDL  531

Query  2173  KGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSL  2352
             KGS  GR+T+ DKI   TTLKDLDL YE  MDK L E+L+KQ+SLD +FLESQHIIDYSL
Sbjct  532   KGSKQGRYTNNDKINCNTTLKDLDLKYEFHMDKKLRESLLKQISLDCKFLESQHIIDYSL  591

Query  2353  LLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPH  2532
             LLGLHFRAPE++ A +E  +S+ + +S L S DG + ILP+ L LV+HEPSIV+TAPGPH
Sbjct  592   LLGLHFRAPENMKAFVEHHESVQRQES-LPSGDGQLLILPKGLLLVSHEPSIVNTAPGPH  650

Query  2533  IRGKTLRANSVGDREVDLLLPGT-----------------------------GRLRVQLG  2625
             IRG TLRA S+GD EVDLLLPG                               RLRVQLG
Sbjct  651   IRGNTLRAYSMGDNEVDLLLPGNLKPAPLHGFSSIIVYSLVTQLKHVVRNLIPRLRVQLG  710

Query  2626  VNMPAQANRKVKQ--DETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFD  2799
             VNMPAQA R++++  D+ +  EVELFEVYDVVLY+G+IDILQ YN+RKK+EH YKSL+FD
Sbjct  711   VNMPAQATRRLQEDKDKVEAKEVELFEVYDVVLYMGVIDILQNYNLRKKIEHAYKSLQFD  770

Query  2800  PMSISVIEPKLYSKRFISFL-ERVFRA*P  2883
             PM+ISV+EPK+Y +RFI FL E+VF   P
Sbjct  771   PMTISVVEPKIYDERFIKFLEEKVFPKTP  799



>ref|XP_010681797.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Beta 
vulgaris subsp. vulgaris]
Length=773

 Score =   967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/778 (62%), Positives = 580/778 (75%), Gaps = 20/778 (3%)
 Frame = +1

Query  574   VIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQII  753
             +++MEN ER  +KVF NGDVY G + G +PHGKGKYT SDGT Y+GDWEEGKMTGKG II
Sbjct  1     MLVMENTER--DKVFSNGDVYCGDYLGTIPHGKGKYTWSDGTIYEGDWEEGKMTGKGLII  58

Query  754   WSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEG  933
             WSSG+TY+GD   GYLHG G  + +DGS Y G W+MN + G G+K+Y NSD Y+G WKEG
Sbjct  59    WSSGSTYEGDFSGGYLHGQGVLTGADGSTYDGTWRMNTKDGFGKKKYYNSDFYEGSWKEG  118

Query  934   VRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGS  1113
             +R G  +Y WS+GN Y G WK G M GRG++KW NGD+F G WVDGLR GSG YRFADGS
Sbjct  119   LRQGSAKYIWSSGNEYIGTWKAGLMCGRGLLKWGNGDIFYGLWVDGLRDGSGFYRFADGS  178

Query  1114  YYFGTWSNGLKDGRGTLYPVGCA-------LDKCKIDGHKEIRRMLSHDSSISKKDAVKP  1272
              Y GTWS G+KDGRGT YP G               DG+     +    SS+ +    + 
Sbjct  179   CYCGTWSRGIKDGRGTFYPAGSKHISLKKWFKSAGYDGN-----LKGQLSSVEENSTSRA  233

Query  1273  KVKRSISEKIVD-RFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
             ++KRSISEK+      R   +IS RA S   D  +   S E+  +++S  L   + D + 
Sbjct  234   RIKRSISEKVTSGNSMRSPSQISSRA-SFDRDYIVGDISRELSSKESSYKLICKSDDDQR  292

Query  1450  EQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
             +      V +EREYMQGVLIRE IK   G S++   R KF  KE +  SC+ +  G +S+
Sbjct  293   DGQEESDVVFEREYMQGVLIREHIKKNAGKSYKVKHRSKFTIKESKTRSCITISSGNQSH  352

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
             Y MLNLQLGIRY+VGKITP+P REVR +DF EQARIKM+FPRKGS+LTPPH S+DFYWKD
Sbjct  353   YFMLNLQLGIRYTVGKITPVPAREVRCTDFAEQARIKMFFPRKGSQLTPPHYSLDFYWKD  412

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FKL+A++YMMSIC DDGLRE+ S GKSGS+FYLS DDRFVIKTL+KSE
Sbjct  413   YCPMVFRNLREMFKLDASEYMMSICGDDGLREISSAGKSGSMFYLSHDDRFVIKTLRKSE  472

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             LKV L+MLPSYY HV+ HENTLITKFFG++RI L+  +KVRFVVMGNMFYTEL +H RYD
Sbjct  473   LKVFLRMLPSYYNHVQLHENTLITKFFGLHRIKLKCGRKVRFVVMGNMFYTELRIHRRYD  532

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGSS GR+TDK K+ +  TLKDLDL YE  MD+ L + L KQ+ LD  FL+SQ+IIDYS
Sbjct  533   LKGSSYGRYTDKGKMNQNATLKDLDLSYEFYMDRSLRDALFKQIDLDCIFLQSQNIIDYS  592

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTL----VSSDGGISILPRSLTLVTHEPSIVST  2517
             LL+GLHFRAPEHL +LLE PDSL+  ++ L     +S  G+S+ P  L LVTHEP  VST
Sbjct  593   LLMGLHFRAPEHLKSLLELPDSLYNTENELAADGATSTAGLSVPPTGLMLVTHEPGSVST  652

Query  2518  APGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
             APGPHIRG TLRA SVGD+EVDLLLPGTGRLRVQLGVNMPA AN KVK +E D +EVELF
Sbjct  653   APGPHIRGSTLRAYSVGDKEVDLLLPGTGRLRVQLGVNMPALANSKVKDNEADSTEVELF  712

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             EVYDVVLYLGIIDILQ YN+RKK+EH  KSL  DPM+ISV+EPK Y+ RFI FLE+VF
Sbjct  713   EVYDVVLYLGIIDILQDYNLRKKIEHASKSLFLDPMAISVVEPKFYASRFIDFLEKVF  770



>ref|XP_007159587.1| hypothetical protein PHAVU_002G250000g [Phaseolus vulgaris]
 gb|ESW31581.1| hypothetical protein PHAVU_002G250000g [Phaseolus vulgaris]
Length=774

 Score =   967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/774 (62%), Positives = 587/774 (76%), Gaps = 22/774 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++ER +EK FPNGDVYIG  K VLPHGKGKYT  DGT Y+GDW  GKM+GKG I W  
Sbjct  1     MEDSERFEEKSFPNGDVYIGRIKDVLPHGKGKYTWKDGTFYEGDWVGGKMSGKGLITWPR  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+   GYLHG GTF+ S G +Y G W+M+  HG+GRK Y NSD+YDG WKEG+R+
Sbjct  61    GAKYEGEFSGGYLHGHGTFTHSTGCIYTGGWRMDAHHGIGRKMYSNSDIYDGLWKEGIRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY+W NGN+Y G WK G ++GRGVMKW NGD+FDG W++GL+ GSG YRFADG  Y 
Sbjct  121   GCGRYSWENGNVYIGNWKTGKINGRGVMKWANGDIFDGSWLNGLKQGSGVYRFADGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDS-------SISKKDAVKPKVK  1281
             GTWS GLKDG+GT YP G             +R++ S +S       +  K    K K  
Sbjct  181   GTWSKGLKDGKGTFYPAGSK--------QPSLRKLCSLNSDDSGLLSNTEKHMPPKQKFT  232

Query  1282  RSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQL  1458
             RS SEKI V   ++ S +IS R  S+  + +L   + + +  D+S  +S T  + ++E  
Sbjct  233   RSFSEKISVSGRSKSSRQISHRTSSLDSNFSLQNPAGDCICRDSSPSVSQTLNESQSEAS  292

Query  1459  GNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
              + ++ YEREYMQGVLI ER +    + H++ ++ KF  K+V+K S +D+  GR+SYYL 
Sbjct  293   LSPSLVYEREYMQGVLIMERTRHYSEIPHKNKRQNKFSVKQVKKSSWIDILGGRRSYYLK  352

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             LNLQLGIRY+VGKITP+P R+VR SDFG++ARI+MYFP+KGS+ TPPH SIDFYWKDYCP
Sbjct  353   LNLQLGIRYTVGKITPVPARDVRSSDFGDRARIRMYFPKKGSQFTPPHCSIDFYWKDYCP  412

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FKL+AA+YMMSIC D GLR++ SPGKSGSIF+LS DDRFVIKTLKK ELKV
Sbjct  413   MVFRNLREMFKLDAAEYMMSICGDSGLRDISSPGKSGSIFFLSQDDRFVIKTLKKYELKV  472

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             +L MLP YY HV  +ENTLITKFFG++RI+LR  KKVRFVVMGNMF TELH+H RYDLKG
Sbjct  473   MLNMLPKYYHHVGSYENTLITKFFGLHRITLRGGKKVRFVVMGNMFCTELHIHRRYDLKG  532

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SS GR+T ++KI   TTLKDLDL YE  MDK L E+L KQ+S+D  FLESQHIIDYSLLL
Sbjct  533   SSQGRYTKEEKINSNTTLKDLDLKYEFYMDKKLRESLFKQISVDCMFLESQHIIDYSLLL  592

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLVSSD-----GGISILPRSLTLVTHEPSIVSTAP  2523
             GLHFRAPE+L AL+E P  L +P+ ++ S D     G   I+P+ L LV HEPS V+TAP
Sbjct  593   GLHFRAPENLKALVE-PSRLMQPQFSIPSEDDAHKQGEQLIIPKGLLLVAHEPSFVNTAP  651

Query  2524  GPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEV  2703
             GPHIRG TLRA S+GD+EVDLLLPGT RLRVQLGVNMPAQA RKV++D+ + SEVELFEV
Sbjct  652   GPHIRGNTLRAYSIGDKEVDLLLPGTARLRVQLGVNMPAQATRKVQEDKVEESEVELFEV  711

Query  2704  YDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             YDVVLY+GIIDILQ Y ++KKLEH  KSL+ DPM+ISV++PK Y++RFISF+E+
Sbjct  712   YDVVLYMGIIDILQEYTVKKKLEHACKSLQHDPMTISVVKPKTYAERFISFMEK  765



>ref|XP_010103902.1| Phosphatidylinositol-4-phosphate 5-kinase 8 [Morus notabilis]
 gb|EXB97343.1| Phosphatidylinositol-4-phosphate 5-kinase 8 [Morus notabilis]
Length=761

 Score =   966 bits (2498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/774 (63%), Positives = 581/774 (75%), Gaps = 28/774 (4%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME+ ER+ EK F NGDVY+G F GVLPHG GKYT SDGT Y+GDWE GKMTGKG +IW S
Sbjct  1     MEDTERSGEKAFSNGDVYVGNFNGVLPHGNGKYTWSDGTVYEGDWENGKMTGKGNMIWLS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+GD   GYLHGFGT + SDGS+Y+G W+MNI HGVG+K+Y NS++Y+G WKEG  D
Sbjct  61    GARYEGDFSGGYLHGFGTLTGSDGSIYRGAWRMNIVHGVGKKQYCNSEIYEGQWKEGAHD  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G G+YTW++GNMY G WK G M GRGVM+W NGDLFDG W++G RHG+G YR+ADG YYF
Sbjct  121   GSGKYTWNSGNMYIGSWKAGKMCGRGVMRWANGDLFDGLWLNGFRHGNGIYRYADGGYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGCA---LDKC--KIDGHKEIRRMLSHDSSISKKDAVKPKVKRS  1287
             GTWS  LKDG+G  YP G     L KC    D  KE + +LS  S  S+  A    VKRS
Sbjct  181   GTWSQDLKDGKGIFYPAGSKHPYLMKCCSSRDYDKEGKNLLSSSSLNSEGKAQTSIVKRS  240

Query  1288  ISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
             +SEKI V  F + S RIS  A  +  +     SS   L  D SC LS+T   G+     +
Sbjct  241   LSEKISVGGFLKSSSRISHGATLLKQNFRTSSSSRNFLCHDPSCTLSNTIEGGQYVSQDS  300

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLN  1644
              ++ YEREYMQGVLI+ERI+    LS +  +   F   + +K SC+D+F+GR+S+YL LN
Sbjct  301   DSLVYEREYMQGVLIKERIRKYTELSKKCKEPNSFHTDKAKKASCIDIFEGRRSHYLRLN  360

Query  1645  LQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIV  1824
             LQLGIRY+VGKITP+P+REVR SDFG++ARI+MYFPRKGS+ TPPH SIDFYWKDYCP+V
Sbjct  361   LQLGIRYTVGKITPVPVREVRSSDFGDRARIRMYFPRKGSQFTPPHDSIDFYWKDYCPMV  420

Query  1825  FRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLL  2004
             FRNLR +FKL+AA+YMMSIC DDGLREL SPGKSGSIFYLS DDRFVIKTLK+ ELK +L
Sbjct  421   FRNLREMFKLDAAEYMMSICGDDGLRELSSPGKSGSIFYLSHDDRFVIKTLKRPELKAML  480

Query  2005  KMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSS  2184
             KMLP+YY+HV +HENTLITKFFG++RI LR  +KVRFVVMGNMFYTEL +H RYDLKGS+
Sbjct  481   KMLPNYYRHVGEHENTLITKFFGLHRIKLRGGRKVRFVVMGNMFYTELRIHRRYDLKGST  540

Query  2185  LGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGL  2364
              GR T KDKI + TTLKDLDL YE  MDKLL ++L KQ+ LD  FLESQ IIDYSLL+GL
Sbjct  541   HGRITKKDKISQHTTLKDLDLTYEFHMDKLLRQSLFKQIKLDCMFLESQQIIDYSLLVGL  600

Query  2365  HFRAPEHLTALLEPPDSLFKPKSTLVSSDG-----GISILPRSLTLVTHEPSIVSTAPGP  2529
             HFRAPE L +  EPPD+    + TL+++DG      + I P  L LVTHEPS VSTAPGP
Sbjct  601   HFRAPEQLKS-FEPPDTRHTLE-TLLANDGENLQAELPIPPNGLRLVTHEPSSVSTAPGP  658

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYD  2709
             HIRG+TL+A S+GD+EVD+LLPGTGRLRVQLGVNMPAQA RK+   E D SEVELFE   
Sbjct  659   HIRGRTLKAFSLGDKEVDVLLPGTGRLRVQLGVNMPAQAQRKLCLVEEDSSEVELFE---  715

Query  2710  VVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
                          YN++KKLEH YKS +FDPMSISV+EP LY+ RF  FLER+F
Sbjct  716   ------------EYNVKKKLEHAYKSTQFDPMSISVVEPHLYASRFTKFLERIF  757



>ref|XP_006585481.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X1 [Glycine max]
 ref|XP_006585482.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X2 [Glycine max]
Length=769

 Score =   963 bits (2489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/773 (63%), Positives = 597/773 (77%), Gaps = 21/773 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R DEK F NGDVYIGM KG+LPH KGKYT SDGT ++G+WE  KMTGKG I+WSSGA Y+
Sbjct  7     RFDEKSFSNGDVYIGMIKGILPHDKGKYTWSDGTVFEGNWEGEKMTGKGLIVWSSGAQYE  66

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GYL G+GT ++S G +Y+G W+MN QHG+GRK+Y NSDVY+G WKEGV +G GRY
Sbjct  67    GEISGGYLDGYGTLTTSAGCIYRGGWRMNAQHGIGRKQYSNSDVYEGLWKEGVHEGSGRY  126

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGNMY G WK G + GRGVMKW NGD FDG W++GL HGSG YRF DG  Y G W+ 
Sbjct  127   TWNNGNMYVGNWKNGKIDGRGVMKWVNGDTFDGLWLNGLMHGSGVYRFGDGGLYIGAWNK  186

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEIRRMLS-HDS-------SISKKDAVKPKVKRSIS  1293
             GLKDG+G  YP G          H  ++++ S HDS       ++ K++A K +VKRS+S
Sbjct  187   GLKDGKGVFYPAGSK--------HPSLKKLHSPHDSDHNGFLLNVEKQEAPKARVKRSLS  238

Query  1294  EK--IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNI  1467
             E   ++ RF +   +IS R  S+  +   + S+ + +  D+S  LS+   D ++E     
Sbjct  239   ENMPVISRF-KSFRQISHRTSSLKINLIRNDSAQDCVCHDSSLPLSNAVDDDQSEASSES  297

Query  1468  TVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNL  1647
             T+ YEREY+QGVLI ERI      S +  Q+ KF  K+V+K SC+D+F+GR+SYYL LNL
Sbjct  298   TLVYEREYVQGVLIMERISECSESSRRKKQQNKFSVKQVKKSSCLDIFEGRQSYYLKLNL  357

Query  1648  QLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVF  1827
             QLGIRY+VGKITP+P REVR SDFG++ARI+MYFPR GS+LTPPH SI+FYWKDYCP+VF
Sbjct  358   QLGIRYTVGKITPVPAREVRSSDFGDRARIRMYFPRAGSKLTPPHCSINFYWKDYCPMVF  417

Query  1828  RNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLK  2007
             RNLR +F+L+AA+YMMSIC D GLR+L SPGKSGSIFYLS DDRFVIKT+ KSELKVLL 
Sbjct  418   RNLREMFRLDAAEYMMSICGDSGLRDLSSPGKSGSIFYLSKDDRFVIKTVNKSELKVLLN  477

Query  2008  MLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSL  2187
             MLP YY+HV DHENTLITKFFG+++I+LR  KKVRFVVMGN+F TEL +H RYDLKGSS 
Sbjct  478   MLPKYYRHVGDHENTLITKFFGLHQITLRGGKKVRFVVMGNVFCTELQIHRRYDLKGSSQ  537

Query  2188  GRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLH  2367
             GR+T+ DKI   TTLKDLDL YE +MDK L E+L+KQ+SLD +FLESQHIIDYSLLLGLH
Sbjct  538   GRYTNNDKINCNTTLKDLDLKYEFQMDKKLRESLLKQISLDCKFLESQHIIDYSLLLGLH  597

Query  2368  FRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKT  2547
             FRAPE++ A +E  +S+ + +S     +G + ILP+ L LV+HEPSIV+TAPGPHIRG T
Sbjct  598   FRAPENMKAFVEHHESVQRQESLPSGDEGELLILPKGLLLVSHEPSIVNTAPGPHIRGNT  657

Query  2548  LRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLG  2727
             LRA S+GD EVDLLLPGT RLRVQLGVNMPAQA RKV+++     EVELFEVYDVVLY+G
Sbjct  658   LRAYSMGDNEVDLLLPGTARLRVQLGVNMPAQATRKVEEEVEA-KEVELFEVYDVVLYMG  716

Query  2728  IIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFL-ERVFRA*P  2883
             +IDILQ YN+RKK+EH YKSL+FDPM+ISV+EPK+Y +RFI FL E+VF   P
Sbjct  717   VIDILQNYNLRKKIEHAYKSLQFDPMTISVVEPKMYDERFIKFLEEKVFPETP  769



>ref|XP_010547556.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 [Tarenaya 
hassleriana]
 ref|XP_010547564.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 [Tarenaya 
hassleriana]
Length=743

 Score =   962 bits (2487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/770 (63%), Positives = 582/770 (76%), Gaps = 48/770 (6%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R+ EK FPNGD Y G  KG LPHG+GKY+ SDGT Y+GDWEEGK++GKG++ WS GA Y+
Sbjct  5     RSGEKEFPNGDSYTGELKGELPHGRGKYSWSDGTFYEGDWEEGKISGKGKLKWSYGAEYE  64

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGT +S DGSVY G W+MN++HG+GRKEY NSD+YDG WKEG+++G G Y
Sbjct  65    GDFSGGYLHGFGTLTSPDGSVYNGAWRMNVRHGLGRKEYSNSDIYDGSWKEGLQEGSGSY  124

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W+NGN Y G WKKG M GRGVM+W NGDLFDGFWV+G RHGSG YRF+DG  YFGTW++
Sbjct  125   SWNNGNRYIGNWKKGKMYGRGVMRWENGDLFDGFWVNGSRHGSGVYRFSDGGLYFGTWTH  184

Query  1138  GLKDGRGTLYPVGC---ALDKC--KIDGHKEIRRMLSHDSSISKKDAVKPK-VKRSISEK  1299
             GLKDG+GT YP G    +L KC   ++ +     +LS  SSI+ ++    + + RS+SEK
Sbjct  185   GLKDGKGTFYPAGIKHPSLKKCCHSLEYNDTRNFLLSRSSSINLEEVRHSRTITRSLSEK  244

Query  1300  IVDRFA-RDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVA  1476
             I      R+SGRIS R                 LP++                     V 
Sbjct  245   IPTSVTIRNSGRISDR----------------FLPDENKN-----------------PVV  271

Query  1477  YEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLG  1656
             YEREYMQGVLIRER+ S   +SH++    +   KEV   +C++LF GR+SYYLMLNLQLG
Sbjct  272   YEREYMQGVLIRERVLSCGDMSHKTKPPSR--PKEVGTSTCINLFGGRQSYYLMLNLQLG  329

Query  1657  IRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNL  1836
             IRY+VGKITP+P REVR SDFG +ARI+M+FPR+GS+ TPPH+SIDFYWKDYCP+VFRNL
Sbjct  330   IRYTVGKITPVPRREVRASDFGNKARIRMFFPREGSQFTPPHKSIDFYWKDYCPMVFRNL  389

Query  1837  RRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLP  2016
             R +FKL+AA+YMMSIC DDGLRE+ SPGKSGS+FYLS DDRFV+KTLKKSELKVLLKMLP
Sbjct  390   REMFKLDAAEYMMSICGDDGLREISSPGKSGSLFYLSHDDRFVVKTLKKSELKVLLKMLP  449

Query  2017  SYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRF  2196
              YY HV  +ENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL +H RYDLKGSS GRF
Sbjct  450   KYYDHVGKYENTLITKFFGVHRIKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSSQGRF  509

Query  2197  TDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRA  2376
             TDK+KIEE TTLKDLDL YE  MDKLL E L KQ+ LD  FLES  IIDYSLLLGLHFRA
Sbjct  510   TDKNKIEEKTTLKDLDLAYEFHMDKLLREALFKQIDLDCSFLESLQIIDYSLLLGLHFRA  569

Query  2377  PEHLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHEPSIVSTAPGPHIRGK  2544
             PEHL  +LEPP+S+   + ++ S + G    +SI P+ L LV HEPS V+T PGPHIRG 
Sbjct  570   PEHLDNILEPPNSM-SDQDSVASVEAGLSQELSIPPKGLLLVRHEPSSVNTEPGPHIRGS  628

Query  2545  TLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETD-PSEVELFEVYDVVLY  2721
              LRA SVG++EVDL+LPG  RLRVQLGVNMPAQA+ KV Q+E +  + +ELFEVYDVVLY
Sbjct  629   ALRAFSVGEKEVDLILPGITRLRVQLGVNMPAQAHHKVLQEEEEKTTSIELFEVYDVVLY  688

Query  2722  LGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             +GIIDILQ YNMRKK+EH  KSL +DP SISVI+PKLYS+RF  FL +VF
Sbjct  689   MGIIDILQEYNMRKKVEHTCKSLHYDPSSISVIQPKLYSQRFTRFLRKVF  738



>ref|XP_007041490.1| Phosphatidylinositol-4-phosphate 5-kinase family protein isoform 
1 [Theobroma cacao]
 gb|EOX97321.1| Phosphatidylinositol-4-phosphate 5-kinase family protein isoform 
1 [Theobroma cacao]
Length=803

 Score =   959 bits (2480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/783 (61%), Positives = 591/783 (75%), Gaps = 22/783 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             +EN ER +EK F N D Y+G FK +LPHGKGKYT SDGT Y+GDW  GKMTGKG ++W S
Sbjct  27    VENVERLNEKAFSNRDFYVGDFKEILPHGKGKYTWSDGTVYEGDWGAGKMTGKGLLLWPS  86

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y GD   GYLHG G F++ DGS+Y+G W+MNI+HG GRK+Y NSDVY+G WKEGV +
Sbjct  87    GAMYKGDISGGYLHGTGAFTAPDGSIYEGQWRMNIRHGFGRKKYSNSDVYEGEWKEGVHE  146

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G+GRY W+NGN YTG WK+G M GRG M+W NGD ++G W++G R GSG Y++ADG YYF
Sbjct  147   GNGRYFWNNGNKYTGNWKRGKMHGRGAMEWVNGDQYNGCWLNGFRQGSGIYQYADGGYYF  206

Query  1123  GTWSNGLKDGRGTLYPVGC---ALDKCKI-----DGHKEIRRMLSHDSSISKKDAV--KP  1272
             GTW+ GLKDG+G  YP G    +L K  +     +GHK     LS   S++ ++ +  KP
Sbjct  207   GTWTRGLKDGKGLFYPAGSKRPSLKKFCVSLGYDNGHKS---ALSQCPSLNLEECMVKKP  263

Query  1273  KVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
              VKRS+SE+I V    R SGRIS +    A ++ L  S  E +  ++S   S  +  G++
Sbjct  264   SVKRSLSERISVSSVLRSSGRISHK---TAENSRLSDSGREFIRHNSSGTFSLDSDAGQS  320

Query  1450  EQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
             E   N  V YEREYMQGV+I+ERI++   LS ++ +R K  AKE +K  C+ +FKG+ SY
Sbjct  321   EVQENTAVVYEREYMQGVMIKERIRNYGELSQKAEKRTKSHAKETKKSLCVGVFKGKNSY  380

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
             +LMLNLQLGIRY+VGKITP+P REVR +DFG++ARI M+FP KGS+ TPPH+SIDFYWKD
Sbjct  381   HLMLNLQLGIRYTVGKITPVPKREVRTADFGDRARITMFFPSKGSQFTPPHKSIDFYWKD  440

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FKL+AA+YMMSIC DDGL +  SPGKSGSIFYLS DD+FVIKTLK+SE
Sbjct  441   YCPMVFRNLREMFKLDAAEYMMSICGDDGLTDFSSPGKSGSIFYLSHDDKFVIKTLKRSE  500

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             LKVL KMLP YY HVK++ENTLITKFFG++RI+L  R+KVRFVVMGNMF TEL +H RYD
Sbjct  501   LKVLHKMLPKYYNHVKEYENTLITKFFGLHRITLPGRRKVRFVVMGNMFCTELRIHRRYD  560

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGS+ GR TDKDKI E TTLKD DL YE  MDK L + L  Q+++D  FL+SQ IIDYS
Sbjct  561   LKGSTHGRCTDKDKIRENTTLKDRDLSYEFHMDKSLRKFLFHQIAVDCTFLKSQQIIDYS  620

Query  2350  LLLGLHFRAPEHLTALLEPPDSL----FKPKSTLVSSDGGISILPRSLTLVTHEPSIVST  2517
             LLLGLHFRAPE L+ LLE P+ +      P    ++++G +    + L LV HEPS VST
Sbjct  621   LLLGLHFRAPEQLSGLLEAPNMMPNIESSPAGEGLTTEGELLFPSKGLRLVAHEPSSVST  680

Query  2518  APGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
              PGPHIRG+ LRA S+GD+EVD+L+PGTGRLRVQLGVNMPAQAN K+ + E D +EVELF
Sbjct  681   EPGPHIRGRALRAFSLGDKEVDVLVPGTGRLRVQLGVNMPAQANHKLSRVEADSAEVELF  740

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFL-ERVFR  2874
             EVYDVVLY+GIIDILQ YN +KK EH  KS++ DPMSIS +EP+LY+KRFI+FL ++VF 
Sbjct  741   EVYDVVLYMGIIDILQEYNAKKKAEHACKSVKLDPMSISAVEPELYAKRFINFLSQKVFP  800

Query  2875  A*P  2883
               P
Sbjct  801   EEP  803



>gb|KEH20716.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Medicago 
truncatula]
Length=766

 Score =   952 bits (2462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/772 (60%), Positives = 581/772 (75%), Gaps = 24/772 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME+N R +EK F NGDVYIG FKG+LPHG GKYT SDG+ Y+GDW +GKMTGKG +IW S
Sbjct  1     MEDNGRFEEKSFTNGDVYIGKFKGILPHGNGKYTWSDGSVYEGDWIDGKMTGKGILIWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+    YLHG GTF+ S+G VY G W+MN  HG+GRK Y NSD+Y+G WKEG+R+
Sbjct  61    GAKYEGEFSGSYLHGHGTFTKSNGCVYTGGWRMNAHHGIGRKAYSNSDIYEGLWKEGIRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G G++TW++G++Y G WKKG + GRG+MKWFNGD+FDG W++GLR GSG YRF+DG  Y 
Sbjct  121   GSGKFTWNDGSIYIGNWKKGKIDGRGIMKWFNGDVFDGCWLNGLRQGSGVYRFSDGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKI  1302
             GTWS GLKDG+GT YP G             +++  ++  S         +  RS+SEK 
Sbjct  181   GTWSKGLKDGKGTFYPSGSK--------QPSLKKWCTNLHSDENCKVPNSRFNRSLSEK-  231

Query  1303  VDRFARDSGR------ISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
                 AR SGR      +S+    +  +  +   + + +  D+S  L  T+ +G++E    
Sbjct  232   ----ARASGRSKSSRHLSQSTSLLDENHVIQNPADDCICRDSSSALPRTSNEGQSEVSVM  287

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRR-KFPAKEVRKGSCMDLFKGRKSYYLML  1641
               + +EREYMQGVLI ER++      H   +R+ KF  K+V+K S +   + R+SYYL L
Sbjct  288   SNMVFEREYMQGVLIVERLRECSEKPHNKNKRQSKFSMKQVKKSSFIGTIQNRRSYYLKL  347

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDFGE+ARI+MYFP++GS+LTPPH S+DFYWKDYCP+
Sbjct  348   NLQLGIRYTVGKITPVPAREVRSSDFGERARIRMYFPKEGSQLTPPHCSVDFYWKDYCPM  407

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FKL+AA+YMMSIC D  L+++ SPGKSGSIF++S DD+FVIKTLKK ELKVL
Sbjct  408   VFRNLREMFKLDAAEYMMSICGDCALKDISSPGKSGSIFFISQDDKFVIKTLKKYELKVL  467

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L MLP YY HV  +ENTLITKFFG++RI+LR  KKVRFVVMGNMF TELH+H RYDLKGS
Sbjct  468   LNMLPKYYHHVGSYENTLITKFFGIHRITLRGGKKVRFVVMGNMFCTELHIHRRYDLKGS  527

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             S GR+T +DKI   TTLKDLDL YE  MDK L E+L KQ+SLD +FLESQHIIDYSLLLG
Sbjct  528   SQGRYTSQDKINSNTTLKDLDLKYEFHMDKKLRESLFKQISLDCKFLESQHIIDYSLLLG  587

Query  2362  LHFRAPEHLTALLEPPDSLFK----PKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGP  2529
             LHFRAPE+L AL+EPP S+ +    P +  +   G   I+P+ L LV HEPS V+  PGP
Sbjct  588   LHFRAPENLKALVEPPGSIQRQFSLPSADDILKQGEQLIIPKGLLLVAHEPSFVNATPGP  647

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYD  2709
             HIRG TLRA S+G++EVDLLLPGT RL VQLGVNMPAQA   +++D+ + SEVELFEVYD
Sbjct  648   HIRGNTLRAYSIGNKEVDLLLPGTARLPVQLGVNMPAQATSLLQEDKVEESEVELFEVYD  707

Query  2710  VVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             VVLY+GIIDILQ YN++KKLEH YKSL+FDPM+ISVIEPK+Y++RFI+F+++
Sbjct  708   VVLYMGIIDILQEYNVKKKLEHAYKSLQFDPMTISVIEPKIYAERFINFMDK  759



>ref|XP_004504180.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X2 [Cicer arietinum]
 ref|XP_004504181.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X3 [Cicer arietinum]
Length=763

 Score =   951 bits (2459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/775 (60%), Positives = 576/775 (74%), Gaps = 33/775 (4%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME++ R +EK F NGDVY+G FKG+LPHG GKYT S+GT Y+GDW +GK TGKG I W S
Sbjct  1     MEDDGRFEEKCFSNGDVYVGKFKGILPHGDGKYTWSNGTVYEGDWIDGKRTGKGLITWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+    YLHG GTF+ S+G VY G W+MN  HG+G+K Y NSD Y+G WKEG+R+
Sbjct  61    GAKYEGEFSGSYLHGHGTFTKSNGCVYTGGWRMNAHHGIGQKVYSNSDSYEGLWKEGIRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRYTW+NG+ Y G WKKG + GRG+M W NGD+FDG W +GLR GSG YRF+DG  Y 
Sbjct  121   GSGRYTWNNGSSYIGNWKKGKIDGRGIMTWGNGDIFDGCWSNGLRQGSGVYRFSDGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVG---------CALDKCKIDGHKEIRRMLSHDSSISKKDAVKPK  1275
             GTWS GLKDG+GT YP G         C++      GH  + R LS  + +S +      
Sbjct  181   GTWSKGLKDGKGTYYPSGSKQPPLNKWCSILNTDDSGHIRLNRRLSEKAPVSGR------  234

Query  1276  VKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQ  1455
                          ++    +S R  S+  + +L   S + +  D+S  L  T+ +G++E 
Sbjct  235   -------------SKSLRHLSHRTPSLDANWSLQNPSGDCICRDSSSALLQTSNEGQSEA  281

Query  1456  LGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRR-KFPAKEVRKGSCMDLFKGRKSYY  1632
              G   +  EREYMQGVLI ERIK    + H   +R+ KF  K V+K S MD+F+ R+SYY
Sbjct  282   SGMSNMVSEREYMQGVLIMERIKQYSEILHNKNKRQNKFSMKPVKKSSFMDIFEDRRSYY  341

Query  1633  LMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDY  1812
             L LNLQLGIRY+VGKITPIP REVR SDFG++ARI+MYFP+ GS+LTPPH S+DFYWKDY
Sbjct  342   LKLNLQLGIRYTVGKITPIPAREVRSSDFGDRARIRMYFPKDGSQLTPPHCSLDFYWKDY  401

Query  1813  CPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSEL  1992
             CP+VFRNLR +FKL+AA+YMMSIC D GL+++ SPGKSGSIF++S DD+FVIKTLKK EL
Sbjct  402   CPMVFRNLREMFKLDAAEYMMSICGDCGLKDISSPGKSGSIFFISQDDKFVIKTLKKYEL  461

Query  1993  KVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDL  2172
             KVLL MLP YY HV  +ENTLITKFFGV+RI+LR  KKVRFVVMGNMF TELH+H RYDL
Sbjct  462   KVLLNMLPKYYNHVGSYENTLITKFFGVHRITLRGGKKVRFVVMGNMFCTELHIHRRYDL  521

Query  2173  KGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSL  2352
             KGSS GR+T K+KI   +TLKDLDL YE  MDK L E+L KQ+SLD +FLESQHIIDYSL
Sbjct  522   KGSSQGRYTRKEKINSNSTLKDLDLKYEFHMDKKLRESLFKQISLDCKFLESQHIIDYSL  581

Query  2353  LLGLHFRAPEHLTALLEPPDSLFK----PKSTLVSSDGGISILPRSLTLVTHEPSIVSTA  2520
             LLGLHFRAPE+L AL+EPP S+ +    P    +   G   I+P  L LV HEPS V+T 
Sbjct  582   LLGLHFRAPENLKALVEPPRSMQRLHSLPSGDDILKQGEQLIIPNGLLLVAHEPSFVNTT  641

Query  2521  PGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFE  2700
             PGPHIRG TLRA S+GDREVD+LLPGT RLRVQLGVNMPAQA R +++D+ + SE+ELFE
Sbjct  642   PGPHIRGNTLRAYSIGDREVDVLLPGTARLRVQLGVNMPAQATRLLQEDKVEESEIELFE  701

Query  2701  VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             VYDVVLY+GIIDILQ YN++KK+EH YKS++FDPMS+SVIEP+ Y++RFI+F+++
Sbjct  702   VYDVVLYMGIIDILQEYNIKKKIEHAYKSIQFDPMSVSVIEPRTYAQRFINFMDK  756



>ref|XP_003629980.1| Phosphatidylinositol-4-phosphate 5-kinase [Medicago truncatula]
 gb|AET04456.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Medicago 
truncatula]
Length=767

 Score =   951 bits (2458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/774 (60%), Positives = 584/774 (75%), Gaps = 27/774 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME+N R +EK F NGDVYIG FKG+LPHG GKYT SDG+ Y+GDW +GKMTGKG +IW S
Sbjct  1     MEDNGRFEEKSFTNGDVYIGKFKGILPHGNGKYTWSDGSVYEGDWIDGKMTGKGILIWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+    YLHG GTF+ S+G VY G W+MN  HG+GRK Y NSD+Y+G WKEG+R+
Sbjct  61    GAKYEGEFSGSYLHGHGTFTKSNGCVYTGGWRMNAHHGIGRKAYSNSDIYEGLWKEGIRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G G++TW++G++Y G WKKG + GRG+MKWFNGD+FDG W++GLR GSG YRF+DG  Y 
Sbjct  121   GSGKFTWNDGSIYIGNWKKGKIDGRGIMKWFNGDVFDGCWLNGLRQGSGVYRFSDGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKI  1302
             GTWS GLKDG+GT YP G             +++  ++  S         +  RS+SEK 
Sbjct  181   GTWSKGLKDGKGTFYPSGSK--------QPSLKKWCTNLHSDENCKVPNSRFNRSLSEK-  231

Query  1303  VDRFARDSGR------ISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
                 AR SGR      +S+    +  +  +   + + +  D+S  L  T+ +G++E    
Sbjct  232   ----ARASGRSKSSRHLSQSTSLLDENHVIQNPADDCICRDSSSALPRTSNEGQSEVSVM  287

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRR-KFPAKEVRKGSCMDLFKGRKSYYLML  1641
               + +EREYMQGVLI ER++      H   +R+ KF  K+V+K S +   + R+SYYL L
Sbjct  288   SNMVFEREYMQGVLIVERLRECSEKPHNKNKRQSKFSMKQVKKSSFIGTIQNRRSYYLKL  347

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDFGE+ARI+MYFP++GS+LTPPH S+DFYWKDYCP+
Sbjct  348   NLQLGIRYTVGKITPVPAREVRSSDFGERARIRMYFPKEGSQLTPPHCSVDFYWKDYCPM  407

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FKL+AA+YMMSIC D  L+++ SPGKSGSIF++S DD+FVIKTLKK ELKVL
Sbjct  408   VFRNLREMFKLDAAEYMMSICGDCALKDISSPGKSGSIFFISQDDKFVIKTLKKYELKVL  467

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L MLP YY HV  +ENTLITKFFG++RI+LR  KKVRFVVMGNMF TELH+H RYDLKGS
Sbjct  468   LNMLPKYYHHVGSYENTLITKFFGIHRITLRGGKKVRFVVMGNMFCTELHIHRRYDLKGS  527

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             S GR+T +DKI   TTLKDLDL YE  MDK L E+L KQ+SLD +FLESQHIIDYSLLLG
Sbjct  528   SQGRYTSQDKINSNTTLKDLDLKYEFHMDKKLRESLFKQISLDCKFLESQHIIDYSLLLG  587

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSD------GGISILPRSLTLVTHEPSIVSTAP  2523
             LHFRAPE+L AL+EPP S+ + + +L S+D      G   I+P+ L LV HEPS V+  P
Sbjct  588   LHFRAPENLKALVEPPGSI-QRQFSLPSADVDILKQGEQLIIPKGLLLVAHEPSFVNATP  646

Query  2524  GPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEV  2703
             GPHIRG TLRA S+G++EVDLLLPGT RL VQLGVNMPAQA   +++D+ + SEVELFEV
Sbjct  647   GPHIRGNTLRAYSIGNKEVDLLLPGTARLPVQLGVNMPAQATSLLQEDKVEESEVELFEV  706

Query  2704  YDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             YDVVLY+GIIDILQ YN++KKLEH YKSL+FDPM+ISVIEPK+Y++RFI+F+++
Sbjct  707   YDVVLYMGIIDILQEYNVKKKLEHAYKSLQFDPMTISVIEPKIYAERFINFMDK  760



>ref|XP_009355209.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X2 [Pyrus x bretschneideri]
Length=773

 Score =   951 bits (2457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/769 (62%), Positives = 578/769 (75%), Gaps = 20/769 (3%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK F NGDVY+G FKG LPHG GKYT  DGT Y+GDWEEGKMTGKG++IW+SGA Y GD 
Sbjct  7     EKAFSNGDVYVGNFKGTLPHGNGKYTWCDGTVYEGDWEEGKMTGKGKLIWTSGAQYVGDF  66

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GYLHG G F+  DGS Y+G W+MNIQHG+G+K+Y+NSD+Y+G WKEGV++G GRY WS
Sbjct  67    SGGYLHGDGIFNGPDGSFYQGSWRMNIQHGMGKKQYRNSDIYEGSWKEGVQEGSGRYLWS  126

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             +GN YTG WK G M GRGVMKW NGDL++G W++GLR G G YRFADG YYFGTWS GLK
Sbjct  127   SGNTYTGSWKGGKMCGRGVMKWENGDLYNGSWLNGLRDGCGVYRFADGGYYFGTWSRGLK  186

Query  1147  DGRGTLYPVG---------CALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEK  1299
             DG+GT YP G         C+      DG   + R L +    S +   +P VK S SEK
Sbjct  187   DGKGTFYPAGTKHPSLKEWCSSVGYSSDGSSSLSRHLLN----STEGNARPTVKCSFSEK  242

Query  1300  I-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVA  1476
             I +    R+S RIS +A+S+  +      S + +  D+   +S  + D + E   N T  
Sbjct  243   ISIGGILRNSRRISHKAMSLDKNWTDRYPSRDFIRYDSLSSMSQASEDIEHEMRDNNTSV  302

Query  1477  YEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLG  1656
             YEREY+QGV +RER  +   +S +S QR       + K SC+D+F   +SYYLMLNLQLG
Sbjct  303   YEREYVQGVFVREREYNHTEISRKSKQRNNVSV--MPKSSCIDMFGANRSYYLMLNLQLG  360

Query  1657  IRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNL  1836
             IRY+VGKITP+P+REVR SDFG++ARI+MYFPRKGS+ TPPH S+DFYWKDYCP+VFRNL
Sbjct  361   IRYTVGKITPVPVREVRPSDFGDRARIRMYFPRKGSQFTPPHYSVDFYWKDYCPMVFRNL  420

Query  1837  RRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLP  2016
             R +FKL+AA+YMMSIC D+GLRE+ SPGKSGSIFY+S DDRF +KTL+K+ELKV+LKMLP
Sbjct  421   REMFKLDAAEYMMSICGDNGLREISSPGKSGSIFYISHDDRFFVKTLRKTELKVMLKMLP  480

Query  2017  SYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRF  2196
              YY HV +HENTLITK FG++RI+L+  KKVRF+VMGNMF TEL +H RYDLKGS++GR 
Sbjct  481   RYYSHVDEHENTLITKKFGLHRITLKGGKKVRFMVMGNMFCTELRIHRRYDLKGSTIGRC  540

Query  2197  TDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRA  2376
             TD+DKI+E TTLKDLDL +E  MDKLL   L KQ+SLD +FL+SQ IIDYSLLLGLHFRA
Sbjct  541   TDEDKIDENTTLKDLDLKFEFHMDKLLRGELFKQISLDCKFLQSQQIIDYSLLLGLHFRA  600

Query  2377  PEHLTALLEPPDSLFKPKSTL----VSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGK  2544
             PE      +PP ++   +S L    V+  G   I P+ L LVTHEP  VSTAPGPHIRG 
Sbjct  601   PEDPKGFSQPPATMHNHESLLADDGVTLQGEPLIPPKGLRLVTHEPGSVSTAPGPHIRGS  660

Query  2545  TLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYL  2724
              L+A S+GD+EVDLLLPGTGRLRVQLGVNMPA+A RK+ Q+E D +EVE FE Y+VVLY+
Sbjct  661   PLKAYSLGDKEVDLLLPGTGRLRVQLGVNMPARAKRKIAQEEVDSTEVEPFEFYNVVLYM  720

Query  2725  GIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             GIIDILQ YN +K LEH YKSL+FDP  IS +EP+LY KRFI+FLE+VF
Sbjct  721   GIIDILQEYNAKKILEHAYKSLKFDPQRISAVEPELYVKRFINFLEKVF  769


 Score = 80.5 bits (197),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = +1

Query  865   IQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGD  1044
             +++ V  K + N DVY G +K  +  G+G+YTW +G +Y G W++G M+G+G + W +G 
Sbjct  1     MEYAVSEKAFSNGDVYVGNFKGTLPHGNGKYTWCDGTVYEGDWEEGKMTGKGKLIWTSGA  60

Query  1045  LFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
              + G +  G  HG G +   DGS+Y G+W   ++ G G
Sbjct  61    QYVGDFSGGYLHGDGIFNGPDGSFYQGSWRMNIQHGMG  98



>ref|XP_004504179.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X1 [Cicer arietinum]
Length=767

 Score =   948 bits (2450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/770 (60%), Positives = 572/770 (74%), Gaps = 33/770 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R +EK F NGDVY+G FKG+LPHG GKYT S+GT Y+GDW +GK TGKG I W SGA Y+
Sbjct  10    RFEEKCFSNGDVYVGKFKGILPHGDGKYTWSNGTVYEGDWIDGKRTGKGLITWPSGAKYE  69

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+    YLHG GTF+ S+G VY G W+MN  HG+G+K Y NSD Y+G WKEG+R+G GRY
Sbjct  70    GEFSGSYLHGHGTFTKSNGCVYTGGWRMNAHHGIGQKVYSNSDSYEGLWKEGIREGSGRY  129

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NG+ Y G WKKG + GRG+M W NGD+FDG W +GLR GSG YRF+DG  Y GTWS 
Sbjct  130   TWNNGSSYIGNWKKGKIDGRGIMTWGNGDIFDGCWSNGLRQGSGVYRFSDGGLYIGTWSK  189

Query  1138  GLKDGRGTLYPVG---------CALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSI  1290
             GLKDG+GT YP G         C++      GH  + R LS  + +S +           
Sbjct  190   GLKDGKGTYYPSGSKQPPLNKWCSILNTDDSGHIRLNRRLSEKAPVSGR-----------  238

Query  1291  SEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNIT  1470
                     ++    +S R  S+  + +L   S + +  D+S  L  T+ +G++E  G   
Sbjct  239   --------SKSLRHLSHRTPSLDANWSLQNPSGDCICRDSSSALLQTSNEGQSEASGMSN  290

Query  1471  VAYEREYMQGVLIRERIKSVDGLSHQSTQRR-KFPAKEVRKGSCMDLFKGRKSYYLMLNL  1647
             +  EREYMQGVLI ERIK    + H   +R+ KF  K V+K S MD+F+ R+SYYL LNL
Sbjct  291   MVSEREYMQGVLIMERIKQYSEILHNKNKRQNKFSMKPVKKSSFMDIFEDRRSYYLKLNL  350

Query  1648  QLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVF  1827
             QLGIRY+VGKITPIP REVR SDFG++ARI+MYFP+ GS+LTPPH S+DFYWKDYCP+VF
Sbjct  351   QLGIRYTVGKITPIPAREVRSSDFGDRARIRMYFPKDGSQLTPPHCSLDFYWKDYCPMVF  410

Query  1828  RNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLK  2007
             RNLR +FKL+AA+YMMSIC D GL+++ SPGKSGSIF++S DD+FVIKTLKK ELKVLL 
Sbjct  411   RNLREMFKLDAAEYMMSICGDCGLKDISSPGKSGSIFFISQDDKFVIKTLKKYELKVLLN  470

Query  2008  MLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSL  2187
             MLP YY HV  +ENTLITKFFGV+RI+LR  KKVRFVVMGNMF TELH+H RYDLKGSS 
Sbjct  471   MLPKYYNHVGSYENTLITKFFGVHRITLRGGKKVRFVVMGNMFCTELHIHRRYDLKGSSQ  530

Query  2188  GRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLH  2367
             GR+T K+KI   +TLKDLDL YE  MDK L E+L KQ+SLD +FLESQHIIDYSLLLGLH
Sbjct  531   GRYTRKEKINSNSTLKDLDLKYEFHMDKKLRESLFKQISLDCKFLESQHIIDYSLLLGLH  590

Query  2368  FRAPEHLTALLEPPDSLFK----PKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHI  2535
             FRAPE+L AL+EPP S+ +    P    +   G   I+P  L LV HEPS V+T PGPHI
Sbjct  591   FRAPENLKALVEPPRSMQRLHSLPSGDDILKQGEQLIIPNGLLLVAHEPSFVNTTPGPHI  650

Query  2536  RGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVV  2715
             RG TLRA S+GDREVD+LLPGT RLRVQLGVNMPAQA R +++D+ + SE+ELFEVYDVV
Sbjct  651   RGNTLRAYSIGDREVDVLLPGTARLRVQLGVNMPAQATRLLQEDKVEESEIELFEVYDVV  710

Query  2716  LYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             LY+GIIDILQ YN++KK+EH YKS++FDPMS+SVIEP+ Y++RFI+F+++
Sbjct  711   LYMGIIDILQEYNIKKKIEHAYKSIQFDPMSVSVIEPRTYAQRFINFMDK  760



>ref|XP_009355207.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009355208.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X1 [Pyrus x bretschneideri]
Length=774

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/770 (62%), Positives = 577/770 (75%), Gaps = 21/770 (3%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK F NGDVY+G FKG LPHG GKYT  DGT Y+GDWEEGKMTGKG++IW+SGA Y GD 
Sbjct  7     EKAFSNGDVYVGNFKGTLPHGNGKYTWCDGTVYEGDWEEGKMTGKGKLIWTSGAQYVGDF  66

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GYLHG G F+  DGS Y+G W+MNIQHG+G+K+Y+NSD+Y+G WKEGV++G GRY WS
Sbjct  67    SGGYLHGDGIFNGPDGSFYQGSWRMNIQHGMGKKQYRNSDIYEGSWKEGVQEGSGRYLWS  126

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             +GN YTG WK G M GRGVMKW NGDL++G W++GLR G G YRFADG YYFGTWS GLK
Sbjct  127   SGNTYTGSWKGGKMCGRGVMKWENGDLYNGSWLNGLRDGCGVYRFADGGYYFGTWSRGLK  186

Query  1147  DGRGTLYPVG---------CALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEK  1299
             DG+GT YP G         C+      DG   + R L +    S +   +P VK S SEK
Sbjct  187   DGKGTFYPAGTKHPSLKEWCSSVGYSSDGSSSLSRHLLN----STEGNARPTVKCSFSEK  242

Query  1300  I-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVA  1476
             I +    R+S RIS +A+S+  +      S + +  D+   +S  + D + E   N T  
Sbjct  243   ISIGGILRNSRRISHKAMSLDKNWTDRYPSRDFIRYDSLSSMSQASEDIEHEMRDNNTSV  302

Query  1477  YEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLG  1656
             YEREY+QGV +RER  +   +S +S QR       + K SC+D+F   +SYYLMLNLQLG
Sbjct  303   YEREYVQGVFVREREYNHTEISRKSKQRNNVSV--MPKSSCIDMFGANRSYYLMLNLQLG  360

Query  1657  IRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNL  1836
             IRY+VGKITP+P+REVR SDFG++ARI+MYFPRKGS+ TPPH S+DFYWKDYCP+VFRNL
Sbjct  361   IRYTVGKITPVPVREVRPSDFGDRARIRMYFPRKGSQFTPPHYSVDFYWKDYCPMVFRNL  420

Query  1837  RRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLP  2016
             R +FKL+AA+YMMSIC D+GLRE+ SPGKSGSIFY+S DDRF +KTL+K+ELKV+LKMLP
Sbjct  421   REMFKLDAAEYMMSICGDNGLREISSPGKSGSIFYISHDDRFFVKTLRKTELKVMLKMLP  480

Query  2017  SYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRF  2196
              YY HV +HENTLITK FG++RI+L+  KKVRF+VMGNMF TEL +H RYDLKGS++GR 
Sbjct  481   RYYSHVDEHENTLITKKFGLHRITLKGGKKVRFMVMGNMFCTELRIHRRYDLKGSTIGRC  540

Query  2197  TDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRA  2376
             TD+DKI+E TTLKDLDL +E  MDKLL   L KQ+SLD +FL+SQ IIDYSLLLGLHFRA
Sbjct  541   TDEDKIDENTTLKDLDLKFEFHMDKLLRGELFKQISLDCKFLQSQQIIDYSLLLGLHFRA  600

Query  2377  PEHLTALLEPPDSLFKPKSTL----VSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGK  2544
             PE      +PP ++   +S L    V+  G + I P+ L LVTHEP  VSTAPGPHIRG 
Sbjct  601   PEDPKGFSQPPATMHNHESLLADDGVTLQGELLIPPKGLLLVTHEPGSVSTAPGPHIRGS  660

Query  2545  TLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYL  2724
              L+A S+GD+EVDLLLPGTGRLRVQLGVNMPA A RK  Q+E D +EVELFE Y VVLY+
Sbjct  661   PLKAYSLGDKEVDLLLPGTGRLRVQLGVNMPALAKRKHAQEEVDSTEVELFEFYHVVLYM  720

Query  2725  GIIDILQAYNMRKKLEHKYKSLR-FDPMSISVIEPKLYSKRFISFLERVF  2871
             GIIDILQ YN+ KKLEH YKSL+  DP  IS +EP+LY+KRFI+F++ VF
Sbjct  721   GIIDILQEYNVEKKLEHAYKSLKNIDPQRISAVEPELYAKRFINFMKSVF  770


 Score = 80.5 bits (197),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = +1

Query  865   IQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGD  1044
             +++ V  K + N DVY G +K  +  G+G+YTW +G +Y G W++G M+G+G + W +G 
Sbjct  1     MEYAVSEKAFSNGDVYVGNFKGTLPHGNGKYTWCDGTVYEGDWEEGKMTGKGKLIWTSGA  60

Query  1045  LFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
              + G +  G  HG G +   DGS+Y G+W   ++ G G
Sbjct  61    QYVGDFSGGYLHGDGIFNGPDGSFYQGSWRMNIQHGMG  98



>gb|KCW57068.1| hypothetical protein EUGRSUZ_I02724 [Eucalyptus grandis]
Length=758

 Score =   942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/777 (62%), Positives = 577/777 (74%), Gaps = 37/777 (5%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYT-SSDGTTYDGDWEEGKMTGKGQIIWS  759
             MENNE  +EKV  NGD+Y G FKG+LPHGKG+YT +++   Y+G+WE GKMTGKG+I W 
Sbjct  1     MENNEMLEEKVLSNGDLYYGDFKGMLPHGKGRYTWANNKVVYEGEWELGKMTGKGKIFWE  60

Query  760   SGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVR  939
             SGA Y+GD   GYLHG GTF+  DGSVY G W+MNIQHGVGRKEY NSDVY+G WKEGVR
Sbjct  61    SGARYEGDISGGYLHGCGTFTKPDGSVYTGDWRMNIQHGVGRKEYGNSDVYEGMWKEGVR  120

Query  940   DGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYY  1119
             +G GRYTW++G+ Y G WK G M GRG+MKW NGDL+DG W++GLRH SG YRFADG+YY
Sbjct  121   EGSGRYTWNSGHTYVGNWKGGKMWGRGIMKWVNGDLYDGSWLNGLRHESGIYRFADGAYY  180

Query  1120  FGTWSNGLKDGRGTLYPVGC---ALDKCKIDGHKEIRRMLSHDS---SISKKDAVKPKVK  1281
             FGTW++ LK+G+GT YP G    +L K +  G+ +  + LS  S   +  K    K  + 
Sbjct  181   FGTWNSDLKEGKGTYYPAGSKHPSLKKLRSMGYNDKGKNLSSRSLSLAFDKSRPPKTSIN  240

Query  1282  RSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQL  1458
             RS SEK+ +    R+ GRIS RA+S+  + ++  S  E+  +++S  +     + + +  
Sbjct  241   RSYSEKVSMGGVLRNLGRISSRAMSLDENWSVFYSEGELGSQESSFEVPEVPEERQDKMQ  300

Query  1459  GNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
              + ++ YEREYMQGVLI+ERI++   L+ ++ Q+ KF  KE +K  CMD+    +S+YL 
Sbjct  301   DDSSLIYEREYMQGVLIKERIRNYQELTRKTEQKNKFHGKESKKRPCMDMPLRDRSFYLK  360

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             LNLQLGIRY+VGKITP+PMREVR SDFGE+ARI+MYFPRKGS+ TPPH SIDFYWKDYCP
Sbjct  361   LNLQLGIRYTVGKITPVPMREVRSSDFGERARIRMYFPRKGSQFTPPHYSIDFYWKDYCP  420

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFY S D RFVIKTLKKSELKV
Sbjct  421   MVFRNLREMFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYNSHDCRFVIKTLKKSELKV  480

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LLKMLP YY HV  HENTLITKFFG++RI L+  +KVRFVVMGNMF TEL +H RYDLKG
Sbjct  481   LLKMLPHYYNHVGRHENTLITKFFGLHRIKLKGGRKVRFVVMGNMFCTELQIHRRYDLKG  540

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SSLGRFTDK+KI + TTLKDLDL YE  MDK L E   KQ+SLD  FLESQ IIDYSLLL
Sbjct  541   SSLGRFTDKEKIHQNTTLKDLDLAYEFHMDKFLREAFFKQISLDCMFLESQQIIDYSLLL  600

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLV----SSDGGISILPRSLTLVTHEPSIVSTAPG  2526
             GLHFRAPE L ALL    ++   +S+      +S G + I P+ L LVTHEPS VST PG
Sbjct  601   GLHFRAPEQLKALLNGGAAMVNEESSSTANGPTSRGELQIPPKGLLLVTHEPSSVSTTPG  660

Query  2527  PHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVY  2706
             PHIRG TLRA S+GD+EVDLLLPGT RLRVQLGVNMPAQANRK+ +DE            
Sbjct  661   PHIRGSTLRAFSLGDKEVDLLLPGTARLRVQLGVNMPAQANRKLIEDE------------  708

Query  2707  DVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA  2877
                           YN++KK+EH YKSL +DP+SISVIEPKLY+KRFISFLERVF A
Sbjct  709   -------------EYNLKKKIEHAYKSLWYDPLSISVIEPKLYAKRFISFLERVFPA  752



>emb|CDY40487.1| BnaC09g14450D [Brassica napus]
Length=794

 Score =   941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/783 (61%), Positives = 579/783 (74%), Gaps = 28/783 (4%)
 Frame = +1

Query  577   IIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIW  756
             I++    R +E+ F NGDVY G  +G LPHGKGKY  SDG  Y+GDWEEGK++GKG+I W
Sbjct  18    ILVNMEIRLEEREFSNGDVYSGQLRGTLPHGKGKYAWSDGIIYEGDWEEGKISGKGKITW  77

Query  757   SSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGV  936
              SGA Y+GD   GYLHGFGT +S DGSVY G W+MN++HG+GRKEY NSD YDG W+EG+
Sbjct  78    LSGAKYEGDFSGGYLHGFGTMTSPDGSVYSGSWRMNVRHGLGRKEYCNSDSYDGSWREGL  137

Query  937   RDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSY  1116
             +DG G YTW+NGN + G WKKG MSGRGVM W NGDLF+GFW++GLRHGSG Y++ADG +
Sbjct  138   QDGSGSYTWTNGNRFIGNWKKGKMSGRGVMSWGNGDLFNGFWLNGLRHGSGVYKYADGGF  197

Query  1117  YFGTWSNGLKDGRGTLYPVGCALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-  1275
             YFGTWS GLKDG G  YPVG      K   H+          +LSHDSSI+ ++    K 
Sbjct  198   YFGTWSRGLKDGTGVYYPVGSKHPSLK-KWHRHFGYNDTGNFILSHDSSINLEELRNSKA  256

Query  1276  VKRSISE-KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPED-----ASCMLSHTTC  1437
             V R++SE       AR+SGR+S R +           ST   P D            +  
Sbjct  257   VSRTLSEITTTSGLARNSGRMSERFLD-------ENWSTTDPPRDYMGHGPLSKSGRSAG  309

Query  1438  DGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
              G+ E  G   + +EREYMQGVLI+ERI S   +S ++  R     KEV   +C+    G
Sbjct  310   SGENEGRGKNPIVFEREYMQGVLIKERIMSSIDMSRKA--RPLDGPKEVSISACVSFLGG  367

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
             + +YYLMLNLQLGIRY+VGKITP+P REVR SDFGE+ARI M+FPR GS+ TP H+SIDF
Sbjct  368   KWNYYLMLNLQLGIRYTVGKITPVPRREVRASDFGERARITMFFPRNGSQYTPSHKSIDF  427

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
              WKDYCP+VFRNLR +FKL+AADYMMSIC DDGLRE+ SPGKSGSIFYLS DDRFVIKTL
Sbjct  428   DWKDYCPMVFRNLREMFKLDAADYMMSICGDDGLREISSPGKSGSIFYLSHDDRFVIKTL  487

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMH  2157
             K+SELKVLL+MLP YY+HV +HENTLITKFFGV+R+ L+  KKVRFVVMGNMF TEL +H
Sbjct  488   KRSELKVLLRMLPRYYEHVGEHENTLITKFFGVHRLKLKWGKKVRFVVMGNMFCTELKIH  547

Query  2158  HRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHI  2337
              RYDLKGS+ GRFT+K+KI E TT+KDLDL YE  MDKLL E L KQ+ LD  FLES  I
Sbjct  548   RRYDLKGSTQGRFTEKNKIREKTTMKDLDLAYEFHMDKLLREALFKQILLDCSFLESLQI  607

Query  2338  IDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSS-DGGI----SILPRSLTLVTHEP  2502
             IDYSLLLGLHFRAP+ L  +LEPP+ +   +S  V+S + G+    SI P+ L LVTHEP
Sbjct  608   IDYSLLLGLHFRAPDQLNDILEPPNEMSDQESDSVASVEVGLPREPSIPPKGLLLVTHEP  667

Query  2503  SIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPS  2682
             + V+TAPGPHIRG TLRA + G++EVDL+LPGT RLRVQLGVNMPAQA+ K+ QD+ +  
Sbjct  668   NSVNTAPGPHIRGSTLRAFAAGEKEVDLILPGTARLRVQLGVNMPAQAHHKLHQDQEESG  727

Query  2683  EVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLE  2862
              VELFEVYDVV+Y+G+IDILQ YNM+K++EH  KS+++DPMSIS IEP LY+KRF  FL 
Sbjct  728   TVELFEVYDVVVYMGMIDILQEYNMKKRMEHTCKSIQYDPMSISAIEPTLYAKRFTDFLL  787

Query  2863  RVF  2871
             +VF
Sbjct  788   KVF  790



>ref|XP_009113176.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 [Brassica 
rapa]
Length=773

 Score =   939 bits (2428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/771 (61%), Positives = 574/771 (74%), Gaps = 18/771 (2%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R +E+ F NGDVY G  +G LPHGKGKY  SDG  Y+GDWEEGK++GKG+I W SGA Y+
Sbjct  4     RLEEREFSNGDVYSGQLRGTLPHGKGKYAWSDGIIYEGDWEEGKISGKGKITWLSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGT +S DGSVY G W+MN++HG+GRKEY NSD YDG W+EG++DG G Y
Sbjct  64    GDFSGGYLHGFGTMTSPDGSVYSGSWRMNVRHGLGRKEYCNSDSYDGSWREGLQDGSGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN + G WKKG MSGRGVM W NGDLF+GFW++GLRHGSG Y++ADG +YFGTWS 
Sbjct  124   TWTNGNRFIGNWKKGKMSGRGVMSWSNGDLFNGFWLNGLRHGSGVYKYADGGFYFGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSISE  1296
             GLKDG G  YP G      K   H+          +LSHDSSI+ ++    K V R++SE
Sbjct  184   GLKDGTGVYYPAGSKHPSLK-KWHRHFGYNDTGNFILSHDSSINLEELRNSKAVSRTLSE  242

Query  1297  -KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
                    AR+SGR+S R +    +        + +          +   G+ E  G   +
Sbjct  243   ITTTSGLARNSGRMSERFLDE--NWGTTDPPRDYMGHGPLSKSGRSAGSGENEGRGKNPI  300

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
              +EREYMQGVLI+ERI S   +S ++  R     KEV   +C+    G+ +YYLMLNLQL
Sbjct  301   VFEREYMQGVLIKERIMSSIDMSRKA--RPLDGPKEVSISACVSFLGGKWNYYLMLNLQL  358

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P REVR SDFGE+ARI M+FPR GS+ TP H+SIDF WKDYCP+VFRN
Sbjct  359   GIRYTVGKITPVPRREVRASDFGERARITMFFPRNGSQYTPSHKSIDFDWKDYCPMVFRN  418

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +FKL+AADYMMSIC DDGLRE+ SPGKSGSIFYLS DDRFVIKTLK+SELKVLL+ML
Sbjct  419   LREMFKLDAADYMMSICGDDGLREISSPGKSGSIFYLSHDDRFVIKTLKRSELKVLLRML  478

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YY+HV +HENTLITKFFGV+R+ L+  KKVRFVVMGNMF TEL +H RYDLKGS+ GR
Sbjct  479   PRYYEHVGEHENTLITKFFGVHRLKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGR  538

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             FT+K+KI E TT+KDLDL YE  MDKLL E   KQ+ LD  FLES  IIDYSLLLGLHFR
Sbjct  539   FTEKNKIREKTTMKDLDLAYEFHMDKLLREAFFKQIVLDCSFLESLQIIDYSLLLGLHFR  598

Query  2374  APEHLTALLEPPDSLFKPKSTLVSS-DGGI----SILPRSLTLVTHEPSIVSTAPGPHIR  2538
             AP+ L  +LEPP+ +   ++  V+S + G+    SI P+ L LVTHEP+ V+TAPGPHIR
Sbjct  599   APDQLNDILEPPNEMSDQENDSVASVEVGLPREPSIPPKGLLLVTHEPNSVNTAPGPHIR  658

Query  2539  GKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVL  2718
             G TLRA + G++EVDL+LPGT RLRVQLGVNMPAQA+ K++QDE +   VELFEVYDVV+
Sbjct  659   GSTLRAFAAGEKEVDLILPGTARLRVQLGVNMPAQAHHKLRQDEEESGTVELFEVYDVVV  718

Query  2719  YLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             Y+G+IDILQ YNM+K++EH  KS+++DPMSIS IEP LY+KRF  FL +VF
Sbjct  719   YMGMIDILQEYNMKKRMEHTCKSIQYDPMSISAIEPTLYAKRFTDFLLKVF  769



>emb|CDY12865.1| BnaA09g14090D [Brassica napus]
Length=779

 Score =   938 bits (2425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/773 (61%), Positives = 574/773 (74%), Gaps = 18/773 (2%)
 Frame = +1

Query  592   NERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGAT  771
             N   +E+ F NGDVY G  +G LPHGKGKY  SDG  Y+GDWEEGK++GKG+I W SGA 
Sbjct  8     NHWLEEREFSNGDVYSGQLRGTLPHGKGKYAWSDGIIYEGDWEEGKISGKGKITWLSGAK  67

Query  772   YDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHG  951
             Y+GD   GYLHGFGT +S DGSVY G W+MN++HG+GRKEY NSD YDG W+EG++DG G
Sbjct  68    YEGDFSGGYLHGFGTMTSPDGSVYSGSWRMNVRHGLGRKEYCNSDSYDGSWREGLQDGSG  127

Query  952   RYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTW  1131
              YTW+NGN + G WKKG MSGRGVM W NGDLF+GFW++GLRHGSG Y++ADG +YFGTW
Sbjct  128   SYTWTNGNRFIGNWKKGKMSGRGVMSWSNGDLFNGFWLNGLRHGSGVYKYADGGFYFGTW  187

Query  1132  SNGLKDGRGTLYPVGCALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSI  1290
             S GLKDG G  YP G      K   H+          +LSHDSSI+ ++    K V R++
Sbjct  188   SRGLKDGTGVYYPAGSKHPSLK-KWHRHFGYNDTGNFILSHDSSINLEELRNSKAVSRTL  246

Query  1291  SE-KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNI  1467
             SE       AR+SGR+S R +    +        + +          +   G+ E  G  
Sbjct  247   SEITTTSGLARNSGRMSERFLDE--NWGTTDPPRDYMGHGPLSKSGRSAGSGENEGRGKN  304

Query  1468  TVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNL  1647
              + +EREYMQGVLI+ERI S   +S ++  R     KEV   +C+    G+ +YYLMLNL
Sbjct  305   PIVFEREYMQGVLIKERIMSSIDMSRKA--RPLDGPKEVSISACVSFLGGKWNYYLMLNL  362

Query  1648  QLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVF  1827
             QLGIRY+VGKITP+P REVR SDFGE+ARI M+FPR GS+ TP H+SIDF WKDYCP+VF
Sbjct  363   QLGIRYTVGKITPVPRREVRASDFGERARITMFFPRNGSQYTPSHKSIDFDWKDYCPMVF  422

Query  1828  RNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLK  2007
             RNLR +FKL+AADYMMSIC DDGLRE+ SPGKSGSIFYLS DDRFVIKTLK+SELKVLL+
Sbjct  423   RNLREMFKLDAADYMMSICGDDGLREISSPGKSGSIFYLSHDDRFVIKTLKRSELKVLLR  482

Query  2008  MLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSL  2187
             MLP YY+HV +HENTLITKFFGV+R+ L+  KKVRFVVMGNMF TEL +H RYDLKGS+ 
Sbjct  483   MLPRYYEHVGEHENTLITKFFGVHRLKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSTQ  542

Query  2188  GRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLH  2367
             GRFT+K+KI E TT+KDLDL YE  MDKLL E   KQ+ LD  FLES  IIDYSLLLGLH
Sbjct  543   GRFTEKNKIREKTTMKDLDLAYEFHMDKLLREAFFKQIVLDCSFLESLQIIDYSLLLGLH  602

Query  2368  FRAPEHLTALLEPPDSLFKPKSTLVSS-DGGI----SILPRSLTLVTHEPSIVSTAPGPH  2532
             FRAP+ L  +LEPP+ +   ++  V+S + G+    SI P+ L LVTHEP+ V+TAPGPH
Sbjct  603   FRAPDQLNDILEPPNEMSDQENDSVASVEVGLPREPSIPPKGLLLVTHEPNSVNTAPGPH  662

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG TLRA + G++EVDL+LPGT RLRVQLGVNMPAQA+ K++QDE +   VELFEVYDV
Sbjct  663   IRGSTLRAFAAGEKEVDLILPGTARLRVQLGVNMPAQAHHKLRQDEEESGTVELFEVYDV  722

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             V+Y+G+IDILQ YNM+K++EH  KS+++DPMSIS IEP LY+KRF  FL +VF
Sbjct  723   VVYMGMIDILQEYNMKKRMEHTCKSIQYDPMSISAIEPTLYAKRFTDFLLKVF  775


 Score = 75.5 bits (184),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = +1

Query  865   IQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGD  1044
             + H +  +E+ N DVY G  +  +  G G+Y WS+G +Y G W++G +SG+G + W +G 
Sbjct  7     MNHWLEEREFSNGDVYSGQLRGTLPHGKGKYAWSDGIIYEGDWEEGKISGKGKITWLSGA  66

Query  1045  LFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
              ++G +  G  HG G     DGS Y G+W   ++ G G
Sbjct  67    KYEGDFSGGYLHGFGTMTSPDGSVYSGSWRMNVRHGLG  104



>gb|AAG51639.1|AC018908_5 putative phosphatidylinositol-4-phosphate 5-kinase; 11335-7537 
[Arabidopsis thaliana]
Length=769

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/767 (62%), Positives = 571/767 (74%), Gaps = 18/767 (2%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E+VF NGDVY G  KG LPHGKGKY   DG  Y+GDWEEGK++G+G+++WSSGA Y+
Sbjct  8     RPAERVFSNGDVYSGQLKGTLPHGKGKYAWPDGIIYEGDWEEGKISGRGKLMWSSGAKYE  67

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGT +S DGSVY G W+MN++HG+GRKEY NSDVYDG W+EG++DG G Y
Sbjct  68    GDFSGGYLHGFGTLTSPDGSVYAGAWRMNVRHGLGRKEYCNSDVYDGSWREGLQDGSGSY  127

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W NGN + G WKKG MSGRGVM W NGDLF+GFW++GLRHGSG Y++ADG +YFGTWS 
Sbjct  128   SWYNGNRFIGNWKKGKMSGRGVMSWANGDLFNGFWLNGLRHGSGVYKYADGGFYFGTWSR  187

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSISE  1296
             GLKDG G  YP G      K   H+          +LSH+S+I+  D    K V RS+SE
Sbjct  188   GLKDGSGVFYPAGSKHPSLK-KWHRHFGYDDTGNFLLSHNSTINIDDLRTSKAVSRSLSE  246

Query  1297  -KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
                     R S R      S +          + +    S   + +   G++E      +
Sbjct  247   LTTTSGLTRTSERYPDDYWSTSD------PPRDFMHHGPSSKSARSVDSGQSEIRDKNPI  300

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
              +EREYMQGVLI+ERI S   +SH++  R     KEV   +C+    G+ ++YLMLNLQL
Sbjct  301   VFEREYMQGVLIKERIMSSIDMSHRA--RPLNLTKEVTVSACVSFLGGKWNHYLMLNLQL  358

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P REVR SDF E+ARI M+FPR GS+ TPPH+SIDF WKDYCP+VFRN
Sbjct  359   GIRYTVGKITPVPPREVRASDFSERARIMMFFPRNGSQYTPPHKSIDFDWKDYCPMVFRN  418

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +FKL+AADYMMSIC DDGLRE+ SPGKSGSIFYLS DDRFVIKTLK+SELKVLL+ML
Sbjct  419   LREMFKLDAADYMMSICGDDGLREISSPGKSGSIFYLSHDDRFVIKTLKRSELKVLLRML  478

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YY+HV D+ENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL +H RYDLKGS+ GR
Sbjct  479   PRYYEHVGDYENTLITKFFGVHRIKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGR  538

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             +T+K+KI E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES  I+DYSLLLGLHFR
Sbjct  539   YTEKNKIGEKTTLKDLDLAYEFHMDKLLREALFKQIILDCSFLESLQILDYSLLLGLHFR  598

Query  2374  APEHLTALLEPPDSLFKPKS-TLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTL  2550
             AP+ LT +LEPP+ +   +S ++V+     SI P+ L +VTHEP+ V+TAPGPHIRG TL
Sbjct  599   APDPLTDILEPPNEMSDQESDSVVNLPREPSIPPKGLLMVTHEPNSVNTAPGPHIRGSTL  658

Query  2551  RANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGI  2730
             RA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ QD  +   VELFEVYDVV+Y+GI
Sbjct  659   RAFSVGEKEVDLILPGTARLRVQLGVNMPAQAHHKLGQDNEESGTVELFEVYDVVVYMGI  718

Query  2731  IDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             IDILQ YNM+KK+EH  KS+++DPM+IS IEP LYSKRFI FL +VF
Sbjct  719   IDILQEYNMKKKVEHTCKSMKYDPMTISAIEPTLYSKRFIDFLLKVF  765



>ref|XP_006385216.1| hypothetical protein POPTR_0003s01350g [Populus trichocarpa]
 gb|ERP63013.1| hypothetical protein POPTR_0003s01350g [Populus trichocarpa]
Length=764

 Score =   934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/788 (60%), Positives = 574/788 (73%), Gaps = 54/788 (7%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             +E++E  D+K   NG+VYIG+FK  LPHGKGKY   DGT Y GDWEEGKMTGKGQI+WSS
Sbjct  10    IEDSESIDKKALSNGEVYIGIFKATLPHGKGKYIWCDGTVYKGDWEEGKMTGKGQILWSS  69

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+GD   GYLHG GT    DGS Y+G W+MN++HG+GRK+Y N DVY+G WK G   
Sbjct  70    GAKYEGDFSGGYLHGIGTLIGHDGSEYRGAWRMNVRHGLGRKQYSNLDVYEGNWKGGKIC  129

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G G   W NG+++ G                       FW++GLRHGSG YRFADG YYF
Sbjct  130   GRGVMKWENGDLFDG-----------------------FWINGLRHGSGVYRFADGGYYF  166

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSH---------------DSSISKK  1257
             G WS GLKDG+GT YP G          H  +RR  S                  +  K 
Sbjct  167   GMWSMGLKDGKGTFYPAGTK--------HPSLRRWCSSLGCYESGRNLLSHSSSLNSEKT  218

Query  1258  DAVKPKVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTT  1434
               + P   RS+SE++ ++   +DSGR S+  VS+  +++     +E +  + SCMLS T+
Sbjct  219   RVLIPNDMRSLSERMSINGIFKDSGRFSQGTVSLDENSSRCSLGSEFICREPSCMLSQTS  278

Query  1435  CDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFK  1614
              +G++    N TV YEREYMQGVL  E++K+ +  S ++ QR KF  KE ++ S +D+F+
Sbjct  279   DEGQSGVQDNCTVVYEREYMQGVLKNEKVKNTEP-SRKTKQRNKFHVKETKRKSYVDIFQ  337

Query  1615  GRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSID  1794
             G  SYYLML+LQLGIRY+VGKITP+PMR VR SDFG++ARI+MYFPRKGS+ TPPH SID
Sbjct  338   GHWSYYLMLSLQLGIRYTVGKITPVPMRGVRDSDFGDRARIRMYFPRKGSQFTPPHYSID  397

Query  1795  FYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKT  1974
             FYWKDYCP+VFRNLR +FKL+AA+YMMSIC DDGL EL S GKSGSIF+LS DDRFVIKT
Sbjct  398   FYWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLTELPSSGKSGSIFFLSHDDRFVIKT  457

Query  1975  LKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHM  2154
             LKK ELK LLKMLP YY HV  HENTLITK FGV+RI+LR  KKVRFVVMGNMF TEL +
Sbjct  458   LKKFELKTLLKMLPKYYIHVGKHENTLITKIFGVHRITLRGGKKVRFVVMGNMFCTELRI  517

Query  2155  HHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQH  2334
             H RYDLKGS+ GR+TDKDK+ E TTLKDLDL YE  MDKLL E+L KQLSLD  FLESQ 
Sbjct  518   HGRYDLKGSTQGRYTDKDKVGENTTLKDLDLAYEFHMDKLLRESLFKQLSLDCSFLESQQ  577

Query  2335  IIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSD-----GGISILPRSLTLVTHE  2499
             IIDYSLLLG+HFRAPE L A+LEPP ++ +  +TL +SD     G + I P+ L LVTHE
Sbjct  578   IIDYSLLLGIHFRAPEQLRAILEPPATM-QNHATLATSDGINSQGPLVIPPKGLLLVTHE  636

Query  2500  PSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDP  2679
             PS VST PG HIRG TL+ANSVG++EVDLLLPGTGRLRVQLGVNMPAQA+ K+ QDE D 
Sbjct  637   PSSVSTTPGSHIRGDTLKANSVGEKEVDLLLPGTGRLRVQLGVNMPAQASHKLMQDEVDS  696

Query  2680  SEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFL  2859
             +E+ELFEVYDVVLY+G+IDILQ Y ++KK+EH  KSL+FDP SIS++EPKLY+KRFI+FL
Sbjct  697   AEIELFEVYDVVLYMGVIDILQEYKVKKKVEHACKSLKFDPQSISIVEPKLYAKRFINFL  756

Query  2860  ERVFRA*P  2883
              +VF   P
Sbjct  757   HKVFPQQP  764



>ref|NP_176286.2| phosphatidylinositol-4-phosphate 5-kinase 8 [Arabidopsis thaliana]
 sp|Q8RY89.1|PI5K8_ARATH RecName: Full=Phosphatidylinositol 4-phosphate 5-kinase 8; Short=AtPIP5K8; 
AltName: Full=1-phosphatidylinositol 4-phosphate 
kinase 8; AltName: Full=Diphosphoinositide kinase 8; AltName: 
Full=PtdIns(4)P-5-kinase 8 [Arabidopsis thaliana]
 gb|AAL69491.1| putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis 
thaliana]
 gb|AAM91758.1| putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis 
thaliana]
 gb|AEE33744.1| phosphatidylinositol-4-phosphate 5-kinase 8 [Arabidopsis thaliana]
Length=769

 Score =   934 bits (2413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/771 (61%), Positives = 571/771 (74%), Gaps = 22/771 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E+VF NGDVY G  KG LPHGKGKY   DG  Y+GDWEEGK++G+G+++WSSGA Y+
Sbjct  4     RPAERVFSNGDVYSGQLKGTLPHGKGKYAWPDGIIYEGDWEEGKISGRGKLMWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGT +S DGSVY G W+MN++HG+GRKEY NSDVYDG W+EG++DG G Y
Sbjct  64    GDFSGGYLHGFGTLTSPDGSVYAGAWRMNVRHGLGRKEYCNSDVYDGSWREGLQDGSGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W NGN + G WKKG MSGRGVM W NGDLF+GFW++GLRHGSG Y++ADG +YFGTWS 
Sbjct  124   SWYNGNRFIGNWKKGKMSGRGVMSWANGDLFNGFWLNGLRHGSGVYKYADGGFYFGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSISE  1296
             GLKDG G  YP G      K   H+          +LSH+S+I+  D    K V RS+SE
Sbjct  184   GLKDGSGVFYPAGSKHPSLK-KWHRHFGYDDTGNFLLSHNSTINIDDLRTSKAVSRSLSE  242

Query  1297  -KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
                     R S R      S +          + +    S   + +   G++E      +
Sbjct  243   LTTTSGLTRTSERYPDDYWSTSD------PPRDFMHHGPSSKSARSVDSGQSEIRDKNPI  296

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
              +EREYMQGVLI+ERI S   +SH++  R     KEV   +C+    G+ ++YLMLNLQL
Sbjct  297   VFEREYMQGVLIKERIMSSIDMSHRA--RPLNLTKEVTVSACVSFLGGKWNHYLMLNLQL  354

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P REVR SDF E+ARI M+FPR GS+ TPPH+SIDF WKDYCP+VFRN
Sbjct  355   GIRYTVGKITPVPPREVRASDFSERARIMMFFPRNGSQYTPPHKSIDFDWKDYCPMVFRN  414

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +FKL+AADYMMSIC DDGLRE+ SPGKSGSIFYLS DDRFVIKTLK+SELKVLL+ML
Sbjct  415   LREMFKLDAADYMMSICGDDGLREISSPGKSGSIFYLSHDDRFVIKTLKRSELKVLLRML  474

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YY+HV D+ENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL +H RYDLKGS+ GR
Sbjct  475   PRYYEHVGDYENTLITKFFGVHRIKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGR  534

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             +T+K+KI E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES  I+DYSLLLGLHFR
Sbjct  535   YTEKNKIGEKTTLKDLDLAYEFHMDKLLREALFKQIILDCSFLESLQILDYSLLLGLHFR  594

Query  2374  APEHLTALLEPPDSLFKPKSTLVSS-DGGI----SILPRSLTLVTHEPSIVSTAPGPHIR  2538
             AP+ LT +LEPP+ +   +S  V S D  +    SI P+ L +VTHEP+ V+TAPGPHIR
Sbjct  595   APDPLTDILEPPNEMSDQESDSVGSVDVNLPREPSIPPKGLLMVTHEPNSVNTAPGPHIR  654

Query  2539  GKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVL  2718
             G TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ QD  +   VELFEVYDVV+
Sbjct  655   GSTLRAFSVGEKEVDLILPGTARLRVQLGVNMPAQAHHKLGQDNEESGTVELFEVYDVVV  714

Query  2719  YLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             Y+GIIDILQ YNM+KK+EH  KS+++DPM+IS IEP LYSKRFI FL +VF
Sbjct  715   YMGIIDILQEYNMKKKVEHTCKSMKYDPMTISAIEPTLYSKRFIDFLLKVF  765



>ref|NP_001185275.1| phosphatidylinositol-4-phosphate 5-kinase 8 [Arabidopsis thaliana]
 gb|AEE33745.1| phosphatidylinositol-4-phosphate 5-kinase 8 [Arabidopsis thaliana]
Length=781

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/768 (62%), Positives = 570/768 (74%), Gaps = 22/768 (3%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             E+VF NGDVY G  KG LPHGKGKY   DG  Y+GDWEEGK++G+G+++WSSGA Y+GD 
Sbjct  19    ERVFSNGDVYSGQLKGTLPHGKGKYAWPDGIIYEGDWEEGKISGRGKLMWSSGAKYEGDF  78

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GYLHGFGT +S DGSVY G W+MN++HG+GRKEY NSDVYDG W+EG++DG G Y+W 
Sbjct  79    SGGYLHGFGTLTSPDGSVYAGAWRMNVRHGLGRKEYCNSDVYDGSWREGLQDGSGSYSWY  138

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN + G WKKG MSGRGVM W NGDLF+GFW++GLRHGSG Y++ADG +YFGTWS GLK
Sbjct  139   NGNRFIGNWKKGKMSGRGVMSWANGDLFNGFWLNGLRHGSGVYKYADGGFYFGTWSRGLK  198

Query  1147  DGRGTLYPVGCALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSISE-KI  1302
             DG G  YP G      K   H+          +LSH+S+I+  D    K V RS+SE   
Sbjct  199   DGSGVFYPAGSKHPSLK-KWHRHFGYDDTGNFLLSHNSTINIDDLRTSKAVSRSLSELTT  257

Query  1303  VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYE  1482
                  R S R      S +          + +    S   + +   G++E      + +E
Sbjct  258   TSGLTRTSERYPDDYWSTSD------PPRDFMHHGPSSKSARSVDSGQSEIRDKNPIVFE  311

Query  1483  REYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIR  1662
             REYMQGVLI+ERI S   +SH++  R     KEV   +C+    G+ ++YLMLNLQLGIR
Sbjct  312   REYMQGVLIKERIMSSIDMSHRA--RPLNLTKEVTVSACVSFLGGKWNHYLMLNLQLGIR  369

Query  1663  YSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRR  1842
             Y+VGKITP+P REVR SDF E+ARI M+FPR GS+ TPPH+SIDF WKDYCP+VFRNLR 
Sbjct  370   YTVGKITPVPPREVRASDFSERARIMMFFPRNGSQYTPPHKSIDFDWKDYCPMVFRNLRE  429

Query  1843  LFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSY  2022
             +FKL+AADYMMSIC DDGLRE+ SPGKSGSIFYLS DDRFVIKTLK+SELKVLL+MLP Y
Sbjct  430   MFKLDAADYMMSICGDDGLREISSPGKSGSIFYLSHDDRFVIKTLKRSELKVLLRMLPRY  489

Query  2023  YKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTD  2202
             Y+HV D+ENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL +H RYDLKGS+ GR+T+
Sbjct  490   YEHVGDYENTLITKFFGVHRIKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGRYTE  549

Query  2203  KDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPE  2382
             K+KI E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES  I+DYSLLLGLHFRAP+
Sbjct  550   KNKIGEKTTLKDLDLAYEFHMDKLLREALFKQIILDCSFLESLQILDYSLLLGLHFRAPD  609

Query  2383  HLTALLEPPDSLFKPKSTLVSS-DGGI----SILPRSLTLVTHEPSIVSTAPGPHIRGKT  2547
              LT +LEPP+ +   +S  V S D  +    SI P+ L +VTHEP+ V+TAPGPHIRG T
Sbjct  610   PLTDILEPPNEMSDQESDSVGSVDVNLPREPSIPPKGLLMVTHEPNSVNTAPGPHIRGST  669

Query  2548  LRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLG  2727
             LRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ QD  +   VELFEVYDVV+Y+G
Sbjct  670   LRAFSVGEKEVDLILPGTARLRVQLGVNMPAQAHHKLGQDNEESGTVELFEVYDVVVYMG  729

Query  2728  IIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             IIDILQ YNM+KK+EH  KS+++DPM+IS IEP LYSKRFI FL +VF
Sbjct  730   IIDILQEYNMKKKVEHTCKSMKYDPMTISAIEPTLYSKRFIDFLLKVF  777



>ref|XP_006306825.1| hypothetical protein CARUB_v10008368mg [Capsella rubella]
 ref|XP_006306826.1| hypothetical protein CARUB_v10008368mg [Capsella rubella]
 gb|EOA39723.1| hypothetical protein CARUB_v10008368mg [Capsella rubella]
 gb|EOA39724.1| hypothetical protein CARUB_v10008368mg [Capsella rubella]
Length=770

 Score =   932 bits (2409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/773 (61%), Positives = 580/773 (75%), Gaps = 25/773 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R+ ++ FPNGD Y G  KG+LPHGKGKY  SDGTTY+GDW++GK++GKG++IWSSGA Y+
Sbjct  4     RSGDREFPNGDFYSGEVKGLLPHGKGKYVWSDGTTYEGDWDQGKISGKGKLIWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHG+GT +S D SVY G W+MN++HG+GRKEY NSD+YDG WKEG++DG G Y
Sbjct  64    GDFSGGYLHGYGTMTSPDESVYCGTWRMNVRHGLGRKEYCNSDLYDGSWKEGLQDGRGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W+NGN Y G WKKG M  RGVM+W NGDL+DGFW++G RHGSG Y+F+DG  Y+GTWS 
Sbjct  124   SWTNGNRYIGSWKKGKMCERGVMRWANGDLYDGFWLNGFRHGSGVYKFSDGCLYYGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCK-----IDGHKEIRRMLSHDSSISKKDAVKPK-VKRSISEK  1299
             GLKDG+G  YP G      K     ++     + +LS  +S++ ++    K V RS+S +
Sbjct  184   GLKDGKGVFYPAGSKQPSLKKWCRSLEYDDTGKFVLSRSASVNVEELRSSKTVTRSLSVE  243

Query  1300  IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCM--LSHT---TCDGKAEQLGN  1464
                    +SGRIS R   +  D    C      P D +C   LS +   +  G++E    
Sbjct  244   TSAGEMTNSGRISDR---LTDDIWKSCDP----PRDFTCHGPLSKSARFSRSGESEGQDK  296

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLN  1644
               + YEREYMQGVLIRE I S    SH+     +   KEVR  S +   +G  +YYLMLN
Sbjct  297   NRIVYEREYMQGVLIRETIMSSVDRSHKIKPPHR--PKEVRARSLLTFLRGEHNYYLMLN  354

Query  1645  LQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIV  1824
             LQLGIRY+VGKITP+P REVR SDFG+ AR KM+FPR GS  TPPH+SIDF WKDYCP+V
Sbjct  355   LQLGIRYTVGKITPVPRREVRASDFGKNARTKMFFPRDGSNFTPPHKSIDFSWKDYCPMV  414

Query  1825  FRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLL  2004
             FRNLR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSEL+VLL
Sbjct  415   FRNLREMFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYLSHDDRFVIKTLKKSELQVLL  474

Query  2005  KMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSS  2184
             KMLP YY+HV DHENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGSS
Sbjct  475   KMLPKYYEHVGDHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSS  534

Query  2185  LGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGL  2364
              GRFT+K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES +IIDYSLLLGL
Sbjct  535   QGRFTEKIKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCSFLESLNIIDYSLLLGL  594

Query  2365  HFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS----ILPRSLTLVTHEPSIVSTAPGPH  2532
             HFRAP  L  +LEPP+++   + ++ S D G++    I P+ L LVTHEP+ V+TAPGPH
Sbjct  595   HFRAPGQLNDILEPPNAM-SDQESVSSVDVGLTQEIYIPPKGLLLVTHEPNSVNTAPGPH  653

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYDV
Sbjct  654   IRGSTLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLIEDKEESATIELFEVYDV  713

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             V+Y+GIIDILQ YN +KK+EH  KSL++DPM+ISV EP +YSKRF++FL +VF
Sbjct  714   VVYMGIIDILQEYNTKKKVEHTCKSLQYDPMTISVTEPAIYSKRFVNFLHKVF  766



>ref|XP_002886578.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH62837.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=769

 Score =   929 bits (2401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/771 (61%), Positives = 571/771 (74%), Gaps = 22/771 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E+ F NGDVY G  KG LPHGKGKY   DG  Y+GDWEEGK++G+G+++WSSGA Y+
Sbjct  4     RPVEREFSNGDVYFGQLKGTLPHGKGKYAWPDGIVYEGDWEEGKISGRGKLMWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGT +  DGSVY G W+MN++HG+GRKEY NSDVYDG W+EG++DG G Y
Sbjct  64    GDFSGGYLHGFGTLTLPDGSVYAGAWRMNVRHGLGRKEYCNSDVYDGSWREGLQDGSGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W NGN + G WKKG MSGRGVM W NGDLF+GFW++GLRHGSG Y++ADG +YFGTWS 
Sbjct  124   SWYNGNRFIGNWKKGKMSGRGVMSWANGDLFNGFWLNGLRHGSGVYKYADGGFYFGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSISE  1296
             GLKDG G  YP G      K   H+          +LSH+S+ +  D    K V RS+SE
Sbjct  184   GLKDGSGVFYPAGSKHPSLK-KWHRHFGYDDTGNFLLSHNSTTNIDDLRTSKAVSRSLSE  242

Query  1297  -KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
                     R S R      S +          + L    S   + +   G++E      +
Sbjct  243   LTTTSGLTRTSERYPDDYWSTSD------PPRDFLHHGPSSKSARSVDSGQSEIRDKNPI  296

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
              +EREYMQGVLI+ERI S   +SH++  R     KEV   +C+    G+ ++YLMLNLQL
Sbjct  297   VFEREYMQGVLIKERIMSSIDMSHRA--RPLNLTKEVTVSTCVSFLGGKWNHYLMLNLQL  354

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P REVR SDF E+ARI M+FPR GS+ TPPH+SIDF WKDYCP+VFRN
Sbjct  355   GIRYTVGKITPVPPREVRASDFSERARIMMFFPRNGSQYTPPHKSIDFDWKDYCPMVFRN  414

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +FKL+AADYMMSIC DDGLRE+ SPGKSGSIFYLS DDRFVIKTLK+SELKVLL ML
Sbjct  415   LREMFKLDAADYMMSICGDDGLREISSPGKSGSIFYLSHDDRFVIKTLKRSELKVLLTML  474

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YY+HV ++ENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL +H RYDLKGS+ GR
Sbjct  475   PRYYEHVGNYENTLITKFFGVHRIKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGR  534

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             +T+K+KI E TT+KDLDL YE  MDKLL E L KQ+ LDS FLES  I+DYSLLLGLHFR
Sbjct  535   YTEKNKIGEKTTMKDLDLAYEFHMDKLLREALFKQIILDSSFLESLQILDYSLLLGLHFR  594

Query  2374  APEHLTALLEPPDSLFKPKSTLVSS-DGGI----SILPRSLTLVTHEPSIVSTAPGPHIR  2538
             AP+ LT +LEPP+ +   +S  V+S D  +    +I P+ L +VTHEP+ V+TAPGPHIR
Sbjct  595   APDPLTDILEPPNEISDQESDSVASVDVSLPREPAIPPKGLLMVTHEPNSVNTAPGPHIR  654

Query  2539  GKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVL  2718
             G TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K++QD+ +   VELFEVYDVV+
Sbjct  655   GSTLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLRQDKEESGTVELFEVYDVVV  714

Query  2719  YLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             Y+GIIDILQ YNM+KK+EH  KS+++DPM+IS IEP LYSKRFI FL +VF
Sbjct  715   YMGIIDILQEYNMKKKVEHTCKSMKYDPMTISAIEPTLYSKRFIDFLLKVF  765



>ref|XP_006417406.1| hypothetical protein EUTSA_v10006872mg [Eutrema salsugineum]
 gb|ESQ35759.1| hypothetical protein EUTSA_v10006872mg [Eutrema salsugineum]
Length=769

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/771 (61%), Positives = 574/771 (74%), Gaps = 18/771 (2%)
 Frame = +1

Query  592   NERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGAT  771
             + R  ++ F NGD Y G  KG+LPHGKGKY   DGT Y+GDW+EGK++GKG ++WSSG  
Sbjct  2     DTRPGDREFSNGDFYCGEVKGLLPHGKGKYAWLDGTIYEGDWDEGKISGKGTLLWSSGTK  61

Query  772   YDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHG  951
             Y+GD   GYLHG GT +S D SVY G W+MN++HG+GRKEY NSD+YDG WKEG++DG G
Sbjct  62    YEGDFSGGYLHGVGTMTSPDESVYSGAWRMNVRHGLGRKEYCNSDLYDGSWKEGLQDGRG  121

Query  952   RYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTW  1131
              Y+W+NGN Y G WKKG M GRGVM+W NGDLFDGFW++G RHGSG Y+FADG  YFGTW
Sbjct  122   SYSWTNGNRYIGNWKKGKMCGRGVMRWANGDLFDGFWLNGSRHGSGVYKFADGCLYFGTW  181

Query  1132  SNGLKDGRGTLYPVGC---ALDK-CKIDGHKEIRR-MLSHDSSISKKDAVK-PKVKRSIS  1293
             SNGLKDG+G  YP G    +L K C+   + +  + +LS  SS++ ++      V RS+S
Sbjct  182   SNGLKDGKGVFYPAGSKHPSLKKWCRSLEYDDTGKFVLSRTSSVNVEELRNLSSVTRSLS  241

Query  1294  EKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNIT  1470
              K      A++SGRIS R      D  L  S  +      S   + ++  G++E      
Sbjct  242   VKTSASGTAKNSGRISDRFQ----DVNLRTSDGDFTCHGPSSKSARSSGPGQSEGQDKNR  297

Query  1471  VAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQ  1650
             + YEREYMQGVLIRE I S    SH+   R     KE R  +     KG  +YYLMLNLQ
Sbjct  298   IVYEREYMQGVLIRETITSSVDKSHKI--RPPNLPKECRSRTLATFLKGDHNYYLMLNLQ  355

Query  1651  LGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFR  1830
             LGIRY+VGKITP+P REVR SDFG++AR  M+FP  GS  TPPH+SIDF WKDYCP+VFR
Sbjct  356   LGIRYTVGKITPVPRREVRSSDFGKKARTVMFFPSDGSNFTPPHKSIDFSWKDYCPMVFR  415

Query  1831  NLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKM  2010
             NLR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSEL+VLL+M
Sbjct  416   NLREMFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYLSHDDRFVIKTLKKSELQVLLRM  475

Query  2011  LPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLG  2190
             LP YY HV +HENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGSS G
Sbjct  476   LPRYYGHVGEHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSSHG  535

Query  2191  RFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHF  2370
             RFT+K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES HIIDYSLLLGLHF
Sbjct  536   RFTEKIKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCAFLESLHIIDYSLLLGLHF  595

Query  2371  RAPEHLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHEPSIVSTAPGPHIR  2538
             RAP  L  +LEPP+++   + ++ S D G    ISI P+ L LVTHEP+ V+TAPGPHIR
Sbjct  596   RAPGQLNDILEPPNAI-SDQESVSSVDVGLAQEISIPPKGLLLVTHEPNSVNTAPGPHIR  654

Query  2539  GKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVL  2718
             G TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYDVV+
Sbjct  655   GSTLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLIEDKEESATIELFEVYDVVV  714

Query  2719  YLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             Y+GIIDILQ YN +KK+EHK KSL++DPM+ISV EP +YSKRF+ FL +VF
Sbjct  715   YMGIIDILQEYNTKKKVEHKCKSLQYDPMTISVTEPTIYSKRFVDFLHKVF  765



>ref|XP_010475976.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 isoform 
X1 [Camelina sativa]
 ref|XP_010475977.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 isoform 
X1 [Camelina sativa]
Length=771

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/774 (60%), Positives = 575/774 (74%), Gaps = 26/774 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R+ ++ FPNGD Y G  KG+LP+GKGKY  SDGT Y+GDW++GK++GKG++ WSSGA Y+
Sbjct  4     RSGDREFPNGDFYSGEVKGLLPNGKGKYVWSDGTIYEGDWDQGKISGKGKLFWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHG+GT +S D S+Y G W+MN++HG+GRKEY NSD+YDG WKEG++DG G Y
Sbjct  64    GDFSGGYLHGYGTMTSPDDSIYSGTWRMNVRHGLGRKEYCNSDLYDGSWKEGLQDGRGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W+NGN Y G WKKG M  RGVM+W NGDL+DGFW++G RHGSG Y+FADG  Y+GTWS 
Sbjct  124   SWTNGNRYIGSWKKGKMCERGVMRWANGDLYDGFWLNGFRHGSGVYKFADGCLYYGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCK-----IDGHKEIRRMLSHDSSISKKDAVKPK-VKRSIS-E  1296
             GLKDG+G  YP G      K     ++     + +LS  +S++ ++      V RS+S E
Sbjct  184   GLKDGKGVFYPAGSKQPSLKKWCRSLEYDDTGKFVLSRSASVNVEELRSSNTVSRSLSVE  243

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCML-----SHTTCDGKAEQLG  1461
                   A+ SGRIS R      D    C      P D +C +     +  +  G++E   
Sbjct  244   TSAGEMAKHSGRISDRYTD---DIWRSCDP----PRDFTCHVPLSKSARFSGSGQSEGQD  296

Query  1462  NITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
                + YEREYMQGVLIRE I S    SH+   +     KEVR  S +   +G  +YYLML
Sbjct  297   KNRIVYEREYMQGVLIRETIMSSVDRSHKI--KPPLRPKEVRARSLLTFLRGEHNYYLML  354

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDFG+ AR KM+FPR GS  TPPH+SIDF WKDYCP+
Sbjct  355   NLQLGIRYTVGKITPVPRREVRASDFGKNARTKMFFPRDGSNFTPPHKSIDFSWKDYCPM  414

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSEL+VL
Sbjct  415   VFRNLREMFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYLSHDDRFVIKTLKKSELQVL  474

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L+MLP YY+HV  HENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGS
Sbjct  475   LRMLPKYYEHVGYHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGS  534

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             S GRFT+K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES +IIDYSLLLG
Sbjct  535   SQGRFTEKTKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCSFLESLNIIDYSLLLG  594

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHEPSIVSTAPGP  2529
             LHFRAP  L  +LEPP+++   + ++ S D G    +SI P+ L LVTHEP+ V+TAPGP
Sbjct  595   LHFRAPGQLNDILEPPNAM-SDQESVSSVDVGLTQELSIPPKGLLLVTHEPNSVNTAPGP  653

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYD  2709
             HIRG TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYD
Sbjct  654   HIRGSTLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLVEDKEESATIELFEVYD  713

Query  2710  VVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VV+Y+GIIDILQ YN +KK+EH  KSL++DPM+ISV EP +YSKRF++FL +VF
Sbjct  714   VVVYMGIIDILQEYNTKKKVEHTCKSLQYDPMTISVTEPSIYSKRFVNFLHKVF  767



>ref|XP_010418032.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 [Camelina 
sativa]
Length=769

 Score =   926 bits (2393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/774 (60%), Positives = 570/774 (74%), Gaps = 28/774 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E+ F NGDVY G  KG LP+GKGKY   DG  Y+GDWEEGK++G+G+++WSSGA Y+
Sbjct  4     RAGEREFSNGDVYCGQLKGTLPYGKGKYAWPDGIIYEGDWEEGKISGRGKLMWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGT +S DGSVY G W+MN++HG+GRKEY NSDVYDG W+EG++DG G Y
Sbjct  64    GDFSGGYLHGFGTLTSPDGSVYAGAWRMNVRHGLGRKEYCNSDVYDGSWREGLQDGSGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W NGN + G WKKG MSGRG+M W NGDLF+GFW++GLRHGSG Y++ADG +YFGTWS 
Sbjct  124   SWYNGNRFIGNWKKGKMSGRGIMSWANGDLFNGFWLNGLRHGSGVYKYADGGFYFGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSISE  1296
             GLKDG G  YP G      K   H+          +LSH+S+++  D    K V RS+SE
Sbjct  184   GLKDGSGVFYPAGSKHPSLK-KWHRHFGYDDTGNFLLSHNSTVNIDDLRNSKAVSRSLSE  242

Query  1297  -KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
                    AR S R      S +          + +    +   + +   G++E      +
Sbjct  243   ITTTSGLARTSERYPDDYWSTSD------PPRDFMHHGPASKSARSVDSGQSEGRDKNPI  296

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
              +EREYMQGVLI+ERI S   +SH++  R     KEV   +C+    GR ++YLMLNLQL
Sbjct  297   VFEREYMQGVLIKERIMSSIDMSHRA--RPLNLTKEVTVSACVSFLGGRWNHYLMLNLQL  354

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P REVR SDF E+ARI M+FPR GS+ TPPH+SIDF WKDYCP+VFRN
Sbjct  355   GIRYTVGKITPVPPREVRASDFSERARIMMFFPRNGSQYTPPHKSIDFDWKDYCPMVFRN  414

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +FKL+AADYMMSIC DDGLRE+ S GKSGSIFYLS DDRFVIKTLK+SELKVLL+ML
Sbjct  415   LREMFKLDAADYMMSICGDDGLREISSAGKSGSIFYLSHDDRFVIKTLKRSELKVLLRML  474

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YY+HV D+ENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL +H RYDLKGS+ GR
Sbjct  475   PRYYEHVGDYENTLITKFFGVHRIKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGR  534

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             FT+K+KI E TT+KDLDL YEL MDKLL E L KQ+ LD  FLES  I+DYSLLLGLHFR
Sbjct  535   FTEKNKIGEKTTMKDLDLAYELHMDKLLREALFKQIILDCSFLESLQILDYSLLLGLHFR  594

Query  2374  APEHLTALLEPPDSLFKPKSTLVSSDGGISI--------LPRSLTLVTHEPSIVSTAPGP  2529
             AP+  T +L+PP+ +   +S    SD  + +         P+ L +VTHEP+ V+TAPGP
Sbjct  595   APDPRTDILDPPNEMSDQES---DSDASVDVSLPREPSNPPKGLLMVTHEPNSVNTAPGP  651

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYD  2709
             HIRG TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ QD+ +P  VELFEVYD
Sbjct  652   HIRGSTLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLGQDKEEPGTVELFEVYD  711

Query  2710  VVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VV+Y+G+IDILQ YNM+KK+EH  KS+++DPM+IS IEP LYSKRFI FL +VF
Sbjct  712   VVVYMGMIDILQEYNMKKKVEHTCKSMKYDPMTISAIEPTLYSKRFIDFLLKVF  765



>ref|NP_172559.2| 1-phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis thaliana]
 sp|Q9SUI2.1|PI5K7_ARATH RecName: Full=Phosphatidylinositol 4-phosphate 5-kinase 7; Short=AtPIP5K7; 
AltName: Full=1-phosphatidylinositol 4-phosphate 
kinase 7; AltName: Full=Diphosphoinositide kinase 7; Short=AtP5K2; 
AltName: Full=PtdIns(4)P-5-kinase 7 [Arabidopsis thaliana]
 emb|CAB53377.1| phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis thaliana]
 gb|AAL32796.1| Unknown protein [Arabidopsis thaliana]
 gb|AAQ56785.1| At1g10900 [Arabidopsis thaliana]
 gb|AEE28661.1| 1-phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis thaliana]
Length=754

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/767 (61%), Positives = 571/767 (74%), Gaps = 29/767 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R+ ++ FPNGD Y G  KG++P+GKGKY  SDGT Y+GDW+EGK++GKG++IWSSGA Y+
Sbjct  4     RSGDREFPNGDFYSGEVKGIIPNGKGKYAWSDGTIYEGDWDEGKISGKGKLIWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGT +S D SVY G W+MN++HG+GRKEY NSD+YDG WKEG++DG G Y
Sbjct  64    GDFSGGYLHGFGTMTSPDESVYSGAWRMNVRHGLGRKEYCNSDLYDGLWKEGLQDGRGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W+NGN Y G WKKG M  RGVM+W NGDL+DGFW++G RHGSG Y+FADG  Y+GTWS 
Sbjct  124   SWTNGNRYIGNWKKGKMCERGVMRWENGDLYDGFWLNGFRHGSGVYKFADGCLYYGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFA  1317
             GLKDG+G  YP G      K    K+  R L +D      D  K  + RS S  + +  +
Sbjct  184   GLKDGKGVFYPAGT-----KQPSLKKWCRSLEYD------DTGKFVLSRSASVNVEELRS  232

Query  1318  RDSGRISRRAVSVAGDAALHCSSTEVLPEDASC-----MLSHTTCDGKAEQLGNITVAYE  1482
              ++   S    + AG+    C      P D +C       +  +  G++E      + YE
Sbjct  233   LNTVTQSLSVKTSAGETT--CDP----PRDFTCHGPVSKSARFSGSGQSEGQDKNRIVYE  286

Query  1483  REYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIR  1662
             REYMQGVLIRE I S    SH+     +   +EVR  S M   +G  +YYLMLNLQLGIR
Sbjct  287   REYMQGVLIRETIMSSVDRSHKIKPPNR--PREVRARSLMTFLRGEHNYYLMLNLQLGIR  344

Query  1663  YSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRR  1842
             Y+VGKITP+P REVR SDFG+ AR KM+FPR GS  TPPH+S+DF WKDYCP+VFRNLR+
Sbjct  345   YTVGKITPVPRREVRASDFGKNARTKMFFPRDGSNFTPPHKSVDFSWKDYCPMVFRNLRQ  404

Query  1843  LFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSY  2022
             +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSEL+VLL+MLP Y
Sbjct  405   MFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYLSHDDRFVIKTLKKSELQVLLRMLPKY  464

Query  2023  YKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTD  2202
             Y+HV DHENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGS+ GRFT+
Sbjct  465   YEHVGDHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGRFTE  524

Query  2203  KDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPE  2382
             K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES +IIDYSLLLGLHFRAP 
Sbjct  525   KIKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCSFLESLNIIDYSLLLGLHFRAPG  584

Query  2383  HLTALLEPPDSLFKPKSTLVSSDGGI----SILPRSLTLVTHEPSIVSTAPGPHIRGKTL  2550
              L  +LEPP+++   + ++ S D G+    SI P+ L LVTHEP+ V+TAPGPHIRG TL
Sbjct  585   QLNDILEPPNAM-SDQESVSSVDVGLTQEHSIPPKGLLLVTHEPNSVNTAPGPHIRGSTL  643

Query  2551  RANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGI  2730
             RA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYDVV+Y+GI
Sbjct  644   RAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLIEDKEESATIELFEVYDVVVYMGI  703

Query  2731  IDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             IDILQ YN +KK+EH  KSL++DPM+ISV EP  YSKRF++FL +VF
Sbjct  704   IDILQEYNTKKKVEHTCKSLQYDPMTISVTEPSTYSKRFVNFLHKVF  750



>ref|XP_002892608.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68867.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=760

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/767 (61%), Positives = 571/767 (74%), Gaps = 23/767 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R+ ++ FPNGD Y G  KG+LP+GKGKY  SDGT Y+GDW++GK++GKG++IWSSGA Y+
Sbjct  4     RSGDREFPNGDFYSGEVKGLLPNGKGKYAWSDGTIYEGDWDQGKISGKGKLIWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGT +S D SVY G W+MN++HG+GRKEY NSD+YDG WKEG++DG G Y
Sbjct  64    GDFSGGYLHGFGTMTSPDESVYSGAWRMNVRHGLGRKEYSNSDLYDGLWKEGLQDGRGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W+NGN Y G WKKG M  RGVM+W NGDL+DGFW++G RHGSG Y+FADG  Y+GTWS 
Sbjct  124   SWTNGNRYIGNWKKGKMCERGVMRWANGDLYDGFWLNGFRHGSGVYKFADGCLYYGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFA  1317
             GLKDG+G  YP G      K    K+  R L +D      D  K  + RS S  + +  +
Sbjct  184   GLKDGKGVFYPAGS-----KQPSLKKWSRSLEYD------DTGKFVLSRSASVNVEELRS  232

Query  1318  RDSGRISRRAVSVAGDAALHCSSTEVLPEDASCM--LSHTT---CDGKAEQLGNITVAYE  1482
              ++   S    + A         T   P D +C   LS +      G++E      + YE
Sbjct  233   LNTVTQSLSVKTSADRLPDEIWRTCDPPRDFTCHGPLSKSARFFGSGQSEGQDRNRIVYE  292

Query  1483  REYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIR  1662
             REYMQGVLIRE I S    SH+     +   KEVR  S +   +G  +YYLMLNLQLGIR
Sbjct  293   REYMQGVLIRETIMSSVDRSHKIKPPHR--PKEVRARSLLTFLRGEHNYYLMLNLQLGIR  350

Query  1663  YSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRR  1842
             Y+VGKITP+P REVR SDFG+ AR KM+FPR GS  TPPH+S+DF WKDYCP+VFRNLR+
Sbjct  351   YTVGKITPVPRREVRASDFGKNARTKMFFPRDGSNFTPPHKSVDFSWKDYCPMVFRNLRQ  410

Query  1843  LFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSY  2022
             +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSEL+VLL+MLP Y
Sbjct  411   MFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYLSHDDRFVIKTLKKSELQVLLRMLPKY  470

Query  2023  YKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTD  2202
             Y+HV DHENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGSS GRFT+
Sbjct  471   YEHVGDHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSSQGRFTE  530

Query  2203  KDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPE  2382
             K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES +IIDYSLLLGLHFRAP 
Sbjct  531   KIKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCSFLESLNIIDYSLLLGLHFRAPG  590

Query  2383  HLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHEPSIVSTAPGPHIRGKTL  2550
              L  +LEPP+++   + ++ S D G    +SI P+ L LVTHEP+ V+TAPGPHIRG TL
Sbjct  591   QLHDILEPPNAM-SDQESVSSVDVGLAQELSIPPKGLLLVTHEPNSVNTAPGPHIRGSTL  649

Query  2551  RANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGI  2730
             RA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYDVV+Y+GI
Sbjct  650   RAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLIEDKEESATIELFEVYDVVVYMGI  709

Query  2731  IDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             IDILQ YN +KK+EH  KSL++DPM+ISV EP +YSKRF++FL +VF
Sbjct  710   IDILQEYNTKKKVEHTCKSLQYDPMTISVTEPSIYSKRFVNFLHKVF  756



>ref|XP_010430074.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Camelina 
sativa]
 ref|XP_010430075.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Camelina 
sativa]
Length=769

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/774 (60%), Positives = 569/774 (74%), Gaps = 28/774 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E+ F NGDVY G  KG LP+GKGKY   DG  Y+GDWEEGK++G+G+++WSSGA Y+
Sbjct  4     RAGEREFSNGDVYSGQLKGTLPYGKGKYAWPDGIIYEGDWEEGKISGRGKLMWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGT +S DGSVY G W+MN++HG+GRKEY NSDVYDG W+EG++DG G Y
Sbjct  64    GDFSGGYLHGFGTLTSPDGSVYAGAWRMNVRHGLGRKEYCNSDVYDGSWREGLQDGSGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W NGN + G WKKG MSGRG+M W NGDLF+GFW++GLRHGSG Y++ADG +YFGTWS 
Sbjct  124   SWYNGNRFIGNWKKGKMSGRGIMSWANGDLFNGFWLNGLRHGSGVYKYADGGFYFGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSISE  1296
             GLKDG G  YP G      K   H+          +LSH+S+++  D    K V RS+SE
Sbjct  184   GLKDGSGVFYPAGSKHPSLK-KWHRHFGYDDTGNFLLSHNSTVNIDDLRNSKAVSRSLSE  242

Query  1297  -KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
                    AR S R      S +          + +    +   + +   G++E      +
Sbjct  243   ITTTSGLARTSERYPDDYWSTSD------PPRDFMHHGPASKSARSVDSGQSEARDKNPI  296

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
              +EREYMQGVLI+ERI S   +SH++  R     KEV   +C+    GR ++YLMLNLQL
Sbjct  297   VFEREYMQGVLIKERIMSSIDMSHRA--RPLNLTKEVTVSACVSFLGGRWNHYLMLNLQL  354

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P REVR SDF E+ARI M+FPR GS+ TPPH+SI+F WKDYCP+VFRN
Sbjct  355   GIRYTVGKITPVPPREVRASDFSERARIMMFFPRNGSQYTPPHKSINFDWKDYCPMVFRN  414

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +FKL+AADYMMSIC DDGLRE+ S GKSGSIFYLS DDRFVIKTLK+SELKVLL+ML
Sbjct  415   LREMFKLDAADYMMSICGDDGLREISSAGKSGSIFYLSHDDRFVIKTLKRSELKVLLRML  474

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YY+HV D+ENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL +H RYDLKGS+ GR
Sbjct  475   PRYYEHVGDYENTLITKFFGVHRIKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGR  534

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             FT+K+KI E TT+KDLDL YEL MDKLL E L KQ+ LD  FLES  I+DYSLLLGLHFR
Sbjct  535   FTEKNKIGEKTTMKDLDLAYELHMDKLLREALFKQIILDCSFLESLQILDYSLLLGLHFR  594

Query  2374  APEHLTALLEPPDSLFKPKSTLVSSDGGISI--------LPRSLTLVTHEPSIVSTAPGP  2529
             AP+    +L+PP  +   +S    SD  + +         P+ L +VTHEP+ V+TAPGP
Sbjct  595   APDPRADILDPPIEMSDQES---DSDASVDVSFPREPSNPPKGLLMVTHEPNSVNTAPGP  651

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYD  2709
             HIRG TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ QD+ +P  VELFEVYD
Sbjct  652   HIRGSTLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLGQDKEEPGTVELFEVYD  711

Query  2710  VVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VV+Y+GIIDILQ YNM+KK+EHK KS+++DPM+IS IEP LYSKRFI FL +VF
Sbjct  712   VVVYMGIIDILQEYNMKKKVEHKCKSMKYDPMTISAIEPTLYSKRFIDFLLKVF  765



>ref|XP_010458463.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X1 [Camelina sativa]
Length=772

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/774 (60%), Positives = 575/774 (74%), Gaps = 25/774 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R+ ++ FPNGD Y G  KG+LP+GKGKY  SDGT Y+GDW++GK++GKG++ WSSGA Y+
Sbjct  4     RSGDREFPNGDFYSGEVKGLLPNGKGKYVWSDGTIYEGDWDQGKISGKGKLFWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHG+GT +S D SVY G W+MN++HG+GRKEY NSD+YDG WKEG++DG G Y
Sbjct  64    GDFSGGYLHGYGTMTSPDDSVYSGTWRMNVRHGLGRKEYCNSDLYDGSWKEGLQDGRGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W+NGN Y G WKKG M  RGVM+W NGDL+DGFW++G RHGSG Y+FADG  Y+GTWS 
Sbjct  124   SWTNGNRYIGSWKKGKMCERGVMRWANGDLYDGFWLNGFRHGSGVYKFADGCLYYGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCK-----IDGHKEIRRMLSHDSSISKKDAVKPK-VKRSIS-E  1296
             GLKDG+G  YP G      K     ++     + +LS  +S++ ++      V RS+S E
Sbjct  184   GLKDGKGVFYPAGSKQPSLKKWCRSLEYDDTGKFVLSRSASVNVEELRSSNTVTRSLSVE  243

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCS-----STEVLPEDASCMLSHTTCDGKAEQLG  1461
                   A+ SGRIS R      D    C      +T  +P   S   S +   G++E   
Sbjct  244   TSAGEMAKHSGRISDRYTD---DIWRSCDPPRDFTTCHVPLSKSARFSGS---GQSEGQD  297

Query  1462  NITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
                + YEREYMQG+LIRE I S    SH+   +     KEVR  S +   +G  +YYLM+
Sbjct  298   KNRIVYEREYMQGILIRETIMSSVDRSHKI--KPPLRPKEVRARSLLTFLRGEHNYYLMV  355

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDFG+ AR KM+FPR GS  TPPH+SIDF WKDYCP+
Sbjct  356   NLQLGIRYTVGKITPVPRREVRASDFGKNARTKMFFPRDGSNFTPPHKSIDFSWKDYCPM  415

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSEL+VL
Sbjct  416   VFRNLREMFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYLSHDDRFVIKTLKKSELQVL  475

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L+MLP YY+HV  HENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGS
Sbjct  476   LRMLPKYYEHVGYHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGS  535

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             S GRFT+K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES +IIDYSLLLG
Sbjct  536   SQGRFTEKTKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCSFLESLNIIDYSLLLG  595

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHEPSIVSTAPGP  2529
             LHFRAP  L  +LEPP+++   + ++ S D G    +SI P+ L LVTHEP+ V+TAPGP
Sbjct  596   LHFRAPGQLNDILEPPNAM-SDQESVSSVDVGLTQELSIPPKGLLLVTHEPNSVNTAPGP  654

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYD  2709
             HIRG TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYD
Sbjct  655   HIRGSTLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLVEDKEESATIELFEVYD  714

Query  2710  VVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VV+Y+GIIDILQ YN +KK+EH  KSL++DPM+ISV EP +YSKRF++FL +VF
Sbjct  715   VVVYMGIIDILQEYNTKKKVEHTCKSLQYDPMTISVTEPSIYSKRFVNFLHKVF  768



>ref|XP_006300768.1| hypothetical protein CARUB_v10019843mg [Capsella rubella]
 gb|EOA33666.1| hypothetical protein CARUB_v10019843mg [Capsella rubella]
Length=769

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/771 (60%), Positives = 570/771 (74%), Gaps = 22/771 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E+ F NGDVY+G  +G LP GKGKY   DG  Y+GDWEEGK++G+G+++WSSGA Y+
Sbjct  4     RAGEREFSNGDVYVGQLRGTLPDGKGKYAWPDGIIYEGDWEEGKISGRGKLMWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGT +S DGS+Y G W+MN++HG+GRKEY NSDVYDG W+EG++DG+G Y
Sbjct  64    GDFSGGYLHGFGTLTSPDGSIYAGAWRMNVRHGLGRKEYCNSDVYDGSWREGLQDGNGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
              W NGN + G WKKG MSGRGVM W NGDLF+GFW++GLRHGSG Y++ADG +YFGTWS 
Sbjct  124   FWYNGNRFIGNWKKGKMSGRGVMSWANGDLFNGFWLNGLRHGSGVYKYADGGFYFGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSISE  1296
             GLKDG G  YP G      K   H+          +LSH+S+I+  D    K V RS+SE
Sbjct  184   GLKDGSGVFYPAGSKHPSLK-KWHRHFGYDDTGNFLLSHNSTINIDDLRTSKAVSRSLSE  242

Query  1297  -KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
                     R S R      S +          + +    S   + +   G++E      +
Sbjct  243   ITTTSGLTRTSERYPDDYWSTSD------PPRDFMHHGPSSKSARSVDSGQSEGRDKNPI  296

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
              +EREYMQGVLI+ERI S   +SH++  R     KEV   +C+    G+ ++YLMLNLQL
Sbjct  297   VFEREYMQGVLIKERIMSSIDMSHRA--RPLNLTKEVTVSACVSFLAGKWNHYLMLNLQL  354

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P REVR SDFGE+ARI M+FPR GS+ TPPH+SIDF WKDYCP+VFRN
Sbjct  355   GIRYTVGKITPVPPREVRASDFGERARIMMFFPRNGSQYTPPHKSIDFDWKDYCPMVFRN  414

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +FKL+AADYMMSIC DDGLRE+ S GKSGSIFYLS DDRFVIKTLK+SELKVLL+ML
Sbjct  415   LREMFKLDAADYMMSICGDDGLREISSAGKSGSIFYLSHDDRFVIKTLKRSELKVLLRML  474

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YY+HV D+ENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL +H RYDLKGS+ GR
Sbjct  475   PRYYEHVGDYENTLITKFFGVHRIKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGR  534

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             +T+K+KI E TT+KDLDL YE  MDKLL E L KQ+ LD  FLES  I+DYSLLLGLHFR
Sbjct  535   YTEKNKIAEKTTMKDLDLAYEFHMDKLLREALFKQIILDCSFLESLQILDYSLLLGLHFR  594

Query  2374  APEHLTALLEPPDSLFKPKSTLVSS-DGGI----SILPRSLTLVTHEPSIVSTAPGPHIR  2538
             AP+  T +L+PP+ +   +S  V+S D  +    S  P+ L +VTHEP+ V+TAPGPHIR
Sbjct  595   APDPRTEMLDPPNEMSDEESDSVASVDVSLPREPSNPPKGLLMVTHEPNFVNTAPGPHIR  654

Query  2539  GKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVL  2718
             G TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ QD+ +   VELFEVYDVV+
Sbjct  655   GSTLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLGQDKEESGTVELFEVYDVVV  714

Query  2719  YLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             Y+GIIDILQ YNM+KK+EH  KS+++DPM+IS IEP LYSKRFI FL +VF
Sbjct  715   YMGIIDILQEYNMKKKVEHTCKSMKYDPMTISAIEPSLYSKRFIDFLLKVF  765



>gb|AAB65487.1| phosphatidylinositol-4-phosphate 5-kinase isolog; 89655-95590 
[Arabidopsis thaliana]
Length=859

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/764 (61%), Positives = 569/764 (74%), Gaps = 29/764 (4%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             ++ FPNGD Y G  KG++P+GKGKY  SDGT Y+GDW+EGK++GKG++IWSSGA Y+GD 
Sbjct  112   DREFPNGDFYSGEVKGIIPNGKGKYAWSDGTIYEGDWDEGKISGKGKLIWSSGAKYEGDF  171

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GYLHGFGT +S D SVY G W+MN++HG+GRKEY NSD+YDG WKEG++DG G Y+W+
Sbjct  172   SGGYLHGFGTMTSPDESVYSGAWRMNVRHGLGRKEYCNSDLYDGLWKEGLQDGRGSYSWT  231

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WKKG M  RGVM+W NGDL+DGFW++G RHGSG Y+FADG  Y+GTWS GLK
Sbjct  232   NGNRYIGNWKKGKMCERGVMRWENGDLYDGFWLNGFRHGSGVYKFADGCLYYGTWSRGLK  291

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARDS  1326
             DG+G  YP G      K    K+  R L +D      D  K  + RS S  + +  + ++
Sbjct  292   DGKGVFYPAGT-----KQPSLKKWCRSLEYD------DTGKFVLSRSASVNVEELRSLNT  340

Query  1327  GRISRRAVSVAGDAALHCSSTEVLPEDASC-----MLSHTTCDGKAEQLGNITVAYEREY  1491
                S    + AG+    C      P D +C       +  +  G++E      + YEREY
Sbjct  341   VTQSLSVKTSAGETT--CDP----PRDFTCHGPVSKSARFSGSGQSEGQDKNRIVYEREY  394

Query  1492  MQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSV  1671
             MQGVLIRE I S    SH+     +   +EVR  S M   +G  +YYLMLNLQLGIRY+V
Sbjct  395   MQGVLIRETIMSSVDRSHKIKPPNR--PREVRARSLMTFLRGEHNYYLMLNLQLGIRYTV  452

Query  1672  GKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFK  1851
             GKITP+P REVR SDFG+ AR KM+FPR GS  TPPH+S+DF WKDYCP+VFRNLR++FK
Sbjct  453   GKITPVPRREVRASDFGKNARTKMFFPRDGSNFTPPHKSVDFSWKDYCPMVFRNLRQMFK  512

Query  1852  LNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKH  2031
             L+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSEL+VLL+MLP YY+H
Sbjct  513   LDAAEYMMSICGDDGLTEISSPGKSGSIFYLSHDDRFVIKTLKKSELQVLLRMLPKYYEH  572

Query  2032  VKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDK  2211
             V DHENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGS+ GRFT+K K
Sbjct  573   VGDHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGRFTEKIK  632

Query  2212  IEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLT  2391
             I+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES +IIDYSLLLGLHFRAP  L 
Sbjct  633   IQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCSFLESLNIIDYSLLLGLHFRAPGQLN  692

Query  2392  ALLEPPDSLFKPKSTLVSSDGGI----SILPRSLTLVTHEPSIVSTAPGPHIRGKTLRAN  2559
              +LEPP+++   + ++ S D G+    SI P+ L LVTHEP+ V+TAPGPHIRG TLRA 
Sbjct  693   DILEPPNAM-SDQESVSSVDVGLTQEHSIPPKGLLLVTHEPNSVNTAPGPHIRGSTLRAF  751

Query  2560  SVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDI  2739
             SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYDVV+Y+GIIDI
Sbjct  752   SVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLIEDKEESATIELFEVYDVVVYMGIIDI  811

Query  2740  LQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             LQ YN +KK+EH  KSL++DPM+ISV EP  YSKRF++FL +VF
Sbjct  812   LQEYNTKKKVEHTCKSLQYDPMTISVTEPSTYSKRFVNFLHKVF  855



>ref|XP_009118220.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 isoform 
X2 [Brassica rapa]
Length=769

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/784 (60%), Positives = 573/784 (73%), Gaps = 44/784 (6%)
 Frame = +1

Query  592   NERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGAT  771
             + R  E+ F NGD Y G  KG LPHGKGKY  SDGT Y GDW EGK++GKG+++W SGA 
Sbjct  2     DTRPGEREFSNGDFYSGELKGSLPHGKGKYEWSDGTIYQGDWYEGKISGKGKLVWPSGAK  61

Query  772   YDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHG  951
             Y+GD   GYLHG GT +S DGSVY G W+MN++HG+GRKEY NSD+YDG WKEG+++GHG
Sbjct  62    YEGDFSGGYLHGIGTMTSPDGSVYSGAWRMNVRHGLGRKEYCNSDLYDGSWKEGLQEGHG  121

Query  952   RYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTW  1131
              Y+W+NGN Y G WK G M GRGVM+W NGDLFDGFW +G RHGSG Y++ DG  Y+G W
Sbjct  122   SYSWTNGNRYIGNWKNGKMCGRGVMRWANGDLFDGFWSNGFRHGSGVYKYVDGCLYYGAW  181

Query  1132  SNGLKDGRGTLYPVGC---ALDK-CKIDGHKEIRR-MLSHDSSISKKD-----AVKPK--  1275
             S+GLKDG+G  YP G    +L K C+   H +  + +LS  SSI+ ++      V P   
Sbjct  182   SHGLKDGKGVFYPAGSKHPSLKKWCRSLQHDDTGKFVLSRSSSINVEELRSLSTVTPSLS  241

Query  1276  VKRSI---SEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASC-----MLSHT  1431
             VK S+   S+ + +RF  ++ R+S                 E  P D +C       + +
Sbjct  242   VKTSVTGTSKTLSERFRDENLRVS-----------------EPPPSDFTCHGPSSKSARS  284

Query  1432  TCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLF  1611
             +  G+ E      V YEREYMQGVLIRE I S    SH+   R     K+V+  + M   
Sbjct  285   SGSGQREGQDKNRVVYEREYMQGVLIRETITSSVDRSHKI--RPPNLPKQVKSRNFMTFL  342

Query  1612  KGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSI  1791
             KG  +YYLMLNLQLGIRY+VGKITP+P REVR SDFG++AR  +YFPR GS  TPPH+SI
Sbjct  343   KGEHNYYLMLNLQLGIRYTVGKITPVPRREVRASDFGKKARTMVYFPRDGSNFTPPHKSI  402

Query  1792  DFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIK  1971
             DF WKDYCP+VFRNLR +FKL+ ADYMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIK
Sbjct  403   DFSWKDYCPMVFRNLRAMFKLDPADYMMSICGDDGLTEICSPGKSGSIFYLSHDDRFVIK  462

Query  1972  TLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELH  2151
             TLKKSEL+VLLKMLP YY+HV DHENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL 
Sbjct  463   TLKKSELEVLLKMLPKYYRHVGDHENTLITKFFGVHRIKLKLGKKVRFVVMGNMFCTELK  522

Query  2152  MHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQ  2331
             +H RYDLKGS+ GR T+K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES 
Sbjct  523   IHRRYDLKGSTQGRITEKTKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCAFLESL  582

Query  2332  HIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHE  2499
             HIIDYSLLLG+HFRAP  L   LEPP+ +   + ++ S D G    +SI P+ L LVTHE
Sbjct  583   HIIDYSLLLGVHFRAPGQLNDTLEPPN-VMSDQESVSSVDVGMAQELSIPPKGLLLVTHE  641

Query  2500  PSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDP  2679
             P+ V+TAPGPHIRG TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + 
Sbjct  642   PNSVNTAPGPHIRGSTLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLDEDKEES  701

Query  2680  SEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFL  2859
             + +ELFEVYDVV+Y+GIIDILQ YN +KK+EHK KSLR+DPM+ISV EPK+YSKRF+ FL
Sbjct  702   ATIELFEVYDVVVYMGIIDILQEYNAKKKVEHKCKSLRYDPMTISVTEPKVYSKRFVDFL  761

Query  2860  ERVF  2871
             ++VF
Sbjct  762   QKVF  765



>ref|XP_009118218.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 isoform 
X1 [Brassica rapa]
 ref|XP_009118219.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 isoform 
X1 [Brassica rapa]
Length=772

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/782 (60%), Positives = 572/782 (73%), Gaps = 44/782 (6%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E+ F NGD Y G  KG LPHGKGKY  SDGT Y GDW EGK++GKG+++W SGA Y+
Sbjct  7     RPGEREFSNGDFYSGELKGSLPHGKGKYEWSDGTIYQGDWYEGKISGKGKLVWPSGAKYE  66

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHG GT +S DGSVY G W+MN++HG+GRKEY NSD+YDG WKEG+++GHG Y
Sbjct  67    GDFSGGYLHGIGTMTSPDGSVYSGAWRMNVRHGLGRKEYCNSDLYDGSWKEGLQEGHGSY  126

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W+NGN Y G WK G M GRGVM+W NGDLFDGFW +G RHGSG Y++ DG  Y+G WS+
Sbjct  127   SWTNGNRYIGNWKNGKMCGRGVMRWANGDLFDGFWSNGFRHGSGVYKYVDGCLYYGAWSH  186

Query  1138  GLKDGRGTLYPVGC---ALDK-CKIDGHKEIRR-MLSHDSSISKKD-----AVKPK--VK  1281
             GLKDG+G  YP G    +L K C+   H +  + +LS  SSI+ ++      V P   VK
Sbjct  187   GLKDGKGVFYPAGSKHPSLKKWCRSLQHDDTGKFVLSRSSSINVEELRSLSTVTPSLSVK  246

Query  1282  RSI---SEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASC-----MLSHTTC  1437
              S+   S+ + +RF  ++ R+S                 E  P D +C       + ++ 
Sbjct  247   TSVTGTSKTLSERFRDENLRVS-----------------EPPPSDFTCHGPSSKSARSSG  289

Query  1438  DGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
              G+ E      V YEREYMQGVLIRE I S    SH+   R     K+V+  + M   KG
Sbjct  290   SGQREGQDKNRVVYEREYMQGVLIRETITSSVDRSHKI--RPPNLPKQVKSRNFMTFLKG  347

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
               +YYLMLNLQLGIRY+VGKITP+P REVR SDFG++AR  +YFPR GS  TPPH+SIDF
Sbjct  348   EHNYYLMLNLQLGIRYTVGKITPVPRREVRASDFGKKARTMVYFPRDGSNFTPPHKSIDF  407

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
              WKDYCP+VFRNLR +FKL+ ADYMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTL
Sbjct  408   SWKDYCPMVFRNLRAMFKLDPADYMMSICGDDGLTEICSPGKSGSIFYLSHDDRFVIKTL  467

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMH  2157
             KKSEL+VLLKMLP YY+HV DHENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL +H
Sbjct  468   KKSELEVLLKMLPKYYRHVGDHENTLITKFFGVHRIKLKLGKKVRFVVMGNMFCTELKIH  527

Query  2158  HRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHI  2337
              RYDLKGS+ GR T+K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES HI
Sbjct  528   RRYDLKGSTQGRITEKTKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCAFLESLHI  587

Query  2338  IDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHEPS  2505
             IDYSLLLG+HFRAP  L   LEPP+ +   + ++ S D G    +SI P+ L LVTHEP+
Sbjct  588   IDYSLLLGVHFRAPGQLNDTLEPPN-VMSDQESVSSVDVGMAQELSIPPKGLLLVTHEPN  646

Query  2506  IVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSE  2685
              V+TAPGPHIRG TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + + 
Sbjct  647   SVNTAPGPHIRGSTLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLDEDKEESAT  706

Query  2686  VELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             +ELFEVYDVV+Y+GIIDILQ YN +KK+EHK KSLR+DPM+ISV EPK+YSKRF+ FL++
Sbjct  707   IELFEVYDVVVYMGIIDILQEYNAKKKVEHKCKSLRYDPMTISVTEPKVYSKRFVDFLQK  766

Query  2866  VF  2871
             VF
Sbjct  767   VF  768



>ref|XP_010473269.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform 
X2 [Camelina sativa]
Length=769

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/778 (61%), Positives = 571/778 (73%), Gaps = 36/778 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E+ F NGDVY G  KG LP+GKGKY   DG  Y+GDWEEGK++G+G+++WSSGA Y+
Sbjct  4     RAGEREFSNGDVYSGQLKGTLPYGKGKYAWPDGIIYEGDWEEGKISGRGKLMWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGT +S DGSVY G W+MN++HG+GRKEY NSDVYDG W+EG++DG G Y
Sbjct  64    GDFSGGYLHGFGTLTSPDGSVYAGAWRMNVRHGLGRKEYCNSDVYDGSWREGLQDGSGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W NGN + G WKKG MSGRG+M W NGDLF+GFW+ GLRHGSG Y++ADG +YFGTWS 
Sbjct  124   SWYNGNRFIGNWKKGKMSGRGIMSWANGDLFNGFWLIGLRHGSGVYKYADGGFYFGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSISE  1296
             GLKDG G  YP G      K   H+          +LSH+S+I+  D    K V RS+SE
Sbjct  184   GLKDGSGVFYPAGSKHPSLK-KWHRHFGYDDTGNFLLSHNSTINIDDLRNSKAVSRSLSE  242

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPED-----ASCMLSHTTCDGKAEQLG  1461
                      SG ++R +     D      ST   P D      S   + +    ++E   
Sbjct  243   -----ITTTSG-LTRTSERYPDDYW----STSYPPRDFMHHGPSSKSARSVDSVQSEGRD  292

Query  1462  NITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
                + +EREYMQGVLI+ERI S   +SH++  R     KEV   +C+    GR ++YLML
Sbjct  293   KNPIVFEREYMQGVLIKERIMSSIDMSHRA--RPLNLTKEVTVSACVSFLGGRWNHYLML  350

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDF E+ARI M+FPR GS+ TPPH+SIDF WKDYCP+
Sbjct  351   NLQLGIRYTVGKITPVPPREVRASDFSERARIMMFFPRNGSQYTPPHKSIDFDWKDYCPM  410

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FKL+AADYMMSIC DDGLRE+ S GKSGSIFYLS DDRFVIKTLK+SELKVL
Sbjct  411   VFRNLREMFKLDAADYMMSICGDDGLREISSAGKSGSIFYLSHDDRFVIKTLKRSELKVL  470

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L+MLP YY+HV D+ENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL +H RYDLKGS
Sbjct  471   LRMLPRYYEHVGDYENTLITKFFGVHRIKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGS  530

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             + GRFT+K+KI E TT+KDLDL YEL MDKLL E L KQ+ LD  FLES  I+DYSLLLG
Sbjct  531   TQGRFTEKNKIGEKTTMKDLDLAYELHMDKLLREALFKQIILDCSFLESLQILDYSLLLG  590

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISI--------LPRSLTLVTHEPSIVST  2517
             LHFRAP+  T +L+PP+ +   +S    SD  + +         P+ L +VTHEP+ V+T
Sbjct  591   LHFRAPDPRTDILDPPNEMSDQES---DSDASVDVSLPREPSNPPKGLLMVTHEPNSVNT  647

Query  2518  APGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
             APGPHIRG TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ QD+ +P  VELF
Sbjct  648   APGPHIRGSTLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLGQDKEEPGTVELF  707

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             EVYDVV+Y+GIIDILQ YNM+KK+EH  KS+++DPM+IS IEP LYSKRFI FL +VF
Sbjct  708   EVYDVVVYMGIIDILQEYNMKKKVEHTCKSMKYDPMTISAIEPTLYSKRFIDFLLKVF  765



>ref|XP_010473268.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform 
X1 [Camelina sativa]
Length=769

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/778 (60%), Positives = 571/778 (73%), Gaps = 36/778 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E+ F NGDVY G  KG LP+GKGKY   DG  Y+GDWEEGK++G+G+++WSSGA Y+
Sbjct  4     RAGEREFSNGDVYSGQLKGTLPYGKGKYAWPDGIIYEGDWEEGKISGRGKLMWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHGFGT +S DGSVY G W+MN++HG+GRKEY NSDVYDG W+EG++DG G Y
Sbjct  64    GDFSGGYLHGFGTLTSPDGSVYAGAWRMNVRHGLGRKEYCNSDVYDGSWREGLQDGSGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W NGN + G WKKG MSGRG+M W NGDLF+GFW++GLRHGSG Y++ADG +Y GTWS 
Sbjct  124   SWYNGNRFIGNWKKGKMSGRGIMSWANGDLFNGFWLNGLRHGSGVYKYADGGFYXGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSISE  1296
             GLKDG G  YP G      K   H+          +LSH+S+I+  D    K V RS+SE
Sbjct  184   GLKDGSGVFYPAGSKHPSLK-KWHRHFGYDDTGNFLLSHNSTINIDDLRNSKAVSRSLSE  242

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPED-----ASCMLSHTTCDGKAEQLG  1461
                      SG ++R +     D      ST   P D      S   + +    ++E   
Sbjct  243   -----ITTTSG-LTRTSERYPDDYW----STSYPPRDFMHHGPSSKSARSVDSVQSEGRD  292

Query  1462  NITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
                + +EREYMQGVLI+ERI S   +SH++  R     KEV   +C+    GR ++YLML
Sbjct  293   KNPIVFEREYMQGVLIKERIMSSIDMSHRA--RPLNLTKEVTVSACVSFLGGRWNHYLML  350

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDF E+ARI M+FPR GS+ TPPH+SIDF WKDYCP+
Sbjct  351   NLQLGIRYTVGKITPVPPREVRASDFSERARIMMFFPRNGSQYTPPHKSIDFDWKDYCPM  410

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FKL+AADYMMSIC DDGLRE+ S GKSGSIFYLS DDRFVIKTLK+SELKVL
Sbjct  411   VFRNLREMFKLDAADYMMSICGDDGLREISSAGKSGSIFYLSHDDRFVIKTLKRSELKVL  470

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L+MLP YY+HV D+ENTLITKFFGV+RI L+  KKVRFVVMGNMF TEL +H RYDLKGS
Sbjct  471   LRMLPRYYEHVGDYENTLITKFFGVHRIKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGS  530

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             + GRFT+K+KI E TT+KDLDL YEL MDKLL E L KQ+ LD  FLES  I+DYSLLLG
Sbjct  531   TQGRFTEKNKIGEKTTMKDLDLAYELHMDKLLREALFKQIILDCSFLESLQILDYSLLLG  590

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISI--------LPRSLTLVTHEPSIVST  2517
             LHFRAP+  T +L+PP+ +   +S    SD  + +         P+ L +VTHEP+ V+T
Sbjct  591   LHFRAPDPRTDILDPPNEMSDQES---DSDASVDVSLPREPSNPPKGLLMVTHEPNSVNT  647

Query  2518  APGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
             APGPHIRG TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ QD+ +P  VELF
Sbjct  648   APGPHIRGSTLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLGQDKEEPGTVELF  707

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             EVYDVV+Y+GIIDILQ YNM+KK+EH  KS+++DPM+IS IEP LYSKRFI FL +VF
Sbjct  708   EVYDVVVYMGIIDILQEYNMKKKVEHTCKSMKYDPMTISAIEPTLYSKRFIDFLLKVF  765



>ref|XP_008378836.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Malus 
domestica]
Length=785

 Score =   919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/777 (60%), Positives = 571/777 (73%), Gaps = 24/777 (3%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK F NGDVY+G FKG LPHG GKYT  DGT Y+GDWEEGKMTGKG++IW+SGA Y GD 
Sbjct  7     EKAFSNGDVYVGNFKGTLPHGNGKYTWCDGTVYEGDWEEGKMTGKGKLIWTSGAQYVGDF  66

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GYLHG+G F+  DGS Y+G W+MNIQHG+G+K+Y NSD+Y+G  KEGV++G GRY WS
Sbjct  67    SGGYLHGYGIFNGPDGSFYQGSWRMNIQHGMGKKQYWNSDIYEGSCKEGVQEGSGRYXWS  126

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             +GN Y G WK G M GRG+MKW NGDL++G W++GLR G G Y+F DG YYFGTWS GLK
Sbjct  127   SGNTYIGSWKGGKMCGRGIMKWENGDLYNGSWLNGLRDGCGVYKFPDGGYYFGTWSRGLK  186

Query  1147  DGRGTLYPVGC---ALDK-CKIDGHK-EIRRMLSHDSSISKKDAVKPKVKRSISEKI-VD  1308
             DG+GT YP G    +L K C   G+  +    LS     S +   +P VK S SEK+ + 
Sbjct  187   DGKGTFYPAGTKHPSLKKWCXSVGYSSDGPSSLSGHLLNSTEGNTRPTVKCSFSEKMSIG  246

Query  1309  RFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYERE  1488
                R+S  ISR+A+S+  +      S + +  D+   LS ++ D + E   N T  YERE
Sbjct  247   GILRNSRXISRKAMSLDKNWTDRYPSRDFIRYDSLSSLSQSSEDIEHEMRDNNTSVYERE  306

Query  1489  YMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYS  1668
             Y+QGVL+RER ++   +S +S QR       + K SC+D+     SYYLMLNLQLGIRY+
Sbjct  307   YVQGVLVRERERNHTEISRKSKQRNNVSV--MPKSSCIDMIGANISYYLMLNLQLGIRYT  364

Query  1669  VGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLF  1848
             VGKITP+P+REVR SDF ++ARI+MYFPRKGS+ TPPH S+DFYWKDYCP+VFRNLR +F
Sbjct  365   VGKITPVPVREVRPSDFADRARIRMYFPRKGSQFTPPHYSVDFYWKDYCPMVFRNLREMF  424

Query  1849  KLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYK  2028
             KL+AA+YMMSIC D+GLRE+ SPGKSGSIFY+S DDRF IKTL+K+ELKV+LKMLP YY 
Sbjct  425   KLDAAEYMMSICGDNGLREISSPGKSGSIFYISHDDRFFIKTLRKTELKVMLKMLPRYYX  484

Query  2029  HVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKD  2208
             HV +HENTLITK FG++ I+L+  KK RF+VMGNMF TEL +H RYDLKGS++GR TDKD
Sbjct  485   HVDEHENTLITKXFGLHXITLKGGKKXRFMVMGNMFCTELRIHRRYDLKGSTIGRCTDKD  544

Query  2209  KIEEGTTLKDLDLMYELRMDKLLHETLIK--------QLSLDSQFLESQHIIDYSLLLGL  2364
             KI+  TTLKDLDL +E  MDKLL   L K        Q+SLD +FL+SQ IIDYSLLLGL
Sbjct  545   KIDXNTTLKDLDLKFEFHMDKLLRGXLFKXVLVSFYLQISLDCKFLQSQQIIDYSLLLGL  604

Query  2365  HFRAPEHLTALLEPPDSLFK----PKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPH  2532
             HFRAPE L    +PP ++      P    V+  G + I P+ L LVTHEP  VSTAPGPH
Sbjct  605   HFRAPEDLKGFSQPPPTMHNHESLPADDGVTLQGELVIPPKGLLLVTHEPGSVSTAPGPH  664

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG  L+A S+GD+EVDLLLPGTGRLRVQLGVNMPAQA RK  Q+E D +EVELFE YDV
Sbjct  665   IRGSPLKAYSLGDKEVDLLLPGTGRLRVQLGVNMPAQAKRKPAQEEVDSTEVELFEFYDV  724

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRF----DPMSISVIEPKLYSKRFISFLERVF  2871
             VLY+GIIDILQ YN +KKLEH YKS +      P  IS +EP+LY+KRFI+FLE VF
Sbjct  725   VLYMGIIDILQEYNAKKKLEHAYKSFKNIDPQGPQRISAVEPELYAKRFINFLEEVF  781


 Score = 80.1 bits (196),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = +1

Query  865   IQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGD  1044
             +++ V  K + N DVY G +K  +  G+G+YTW +G +Y G W++G M+G+G + W +G 
Sbjct  1     MEYAVSEKAFSNGDVYVGNFKGTLPHGNGKYTWCDGTVYEGDWEEGKMTGKGKLIWTSGA  60

Query  1045  LFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
              + G +  G  HG G +   DGS+Y G+W   ++ G G
Sbjct  61    QYVGDFSGGYLHGYGIFNGPDGSFYQGSWRMNIQHGMG  98



>emb|CDY19330.1| BnaC05g08390D [Brassica napus]
Length=769

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/765 (60%), Positives = 567/765 (74%), Gaps = 30/765 (4%)
 Frame = +1

Query  604   DEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGD  783
             + + F NGD + G  KG+LPHGKGKY+ SDGT Y+GDW++GK++GKG++IWSSGA Y+GD
Sbjct  22    ERREFSNGDFFSGEVKGLLPHGKGKYSWSDGTVYEGDWDQGKISGKGKLIWSSGAKYEGD  81

Query  784   CFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTW  963
                GYLHG GT +S D SVY G W+MN++HG+GRKEY NSD+YDG W+EG ++G G Y+W
Sbjct  82    FSGGYLHGIGTMTSPDQSVYSGAWRMNVRHGLGRKEYCNSDLYDGSWREGSQEGRGSYSW  141

Query  964   SNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGL  1143
             +NGN Y G WKKG M GRGVM+W NGDLFDGFW++G RHGSG Y+FADGS YFGTWS G+
Sbjct  142   TNGNRYIGSWKKGKMGGRGVMRWGNGDLFDGFWLNGCRHGSGVYKFADGSLYFGTWSRGV  201

Query  1144  KDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSS----ISKKDAVKPKVKRSISEKIVDR  1311
             KDG+G  YP G      K    K+  R L +D +    +S+  ++     RS+S   V+R
Sbjct  202   KDGKGIFYPAGS-----KHPSLKKWCRSLEYDDTGKFVLSRSSSIDVDDLRSLSLSTVNR  256

Query  1312  FARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAE-QLGNITVAYERE  1488
                    +S R  +         S     P + +   + T   G++E Q     VAYERE
Sbjct  257   ------SLSMRTST---------SGMSDRPRELTSKSARTLGSGQSEGQDKKNRVAYERE  301

Query  1489  YMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYS  1668
             YMQGVLIRE + +         +     +K+V   + +    G  +Y+LMLNLQLGIRY+
Sbjct  302   YMQGVLIRESVTTSSVDRSLKIRPPSTLSKQVSARTFLTFLTGEHNYHLMLNLQLGIRYT  361

Query  1669  VGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLF  1848
             VGKITP+P R+VR SDFG++AR  M+FP+ GS  TPPH+SIDF WKDYCP+VFRNLR +F
Sbjct  362   VGKITPVPRRDVRGSDFGKKARTVMFFPKDGSNFTPPHKSIDFSWKDYCPMVFRNLREMF  421

Query  1849  KLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYK  2028
             KL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSELKVLL+MLP YYK
Sbjct  422   KLDAAEYMMSICGDDGLTEICSPGKSGSIFYLSHDDRFVIKTLKKSELKVLLRMLPRYYK  481

Query  2029  HVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKD  2208
             HV DHENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGSS GRFT+K 
Sbjct  482   HVGDHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSSHGRFTEKS  541

Query  2209  KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHL  2388
             KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES  IIDYSLLLGLHFRAP  L
Sbjct  542   KIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCAFLESLQIIDYSLLLGLHFRAPGQL  601

Query  2389  TALLEPPDSLFKPKSTLVSSDGGI----SILPRSLTLVTHEPSIVSTAPGPHIRGKTLRA  2556
               +LEPP+++   + ++ S D G+    SI P+ L LVTHEP+ VSTAPGPHIRG TLRA
Sbjct  602   NDILEPPNAM-SDQESVSSVDVGVTQELSIPPKGLLLVTHEPNSVSTAPGPHIRGSTLRA  660

Query  2557  NSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIID  2736
              SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYDVV+Y+GIID
Sbjct  661   FSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLDEDKEESATIELFEVYDVVVYMGIID  720

Query  2737  ILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             ILQ YN +KK+EHK KSL++DPM+ISV EP +YSKRF++FL +VF
Sbjct  721   ILQEYNTKKKVEHKCKSLQYDPMTISVTEPTIYSKRFVNFLHKVF  765



>ref|XP_010916562.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010916563.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform 
X1 [Elaeis guineensis]
Length=790

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/777 (61%), Positives = 572/777 (74%), Gaps = 16/777 (2%)
 Frame = +1

Query  586   ENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSG  765
             EN+ER  E+V  NGDVY+G   G+LPHG GKY  SDGT Y+G+WE+ KMTG+G+I W +G
Sbjct  13    ENSERHCEEVLANGDVYVGNLDGLLPHGTGKYIWSDGTLYEGEWEKSKMTGRGRIYWPAG  72

Query  766   ATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDG  945
             ATY+GD   G+LHG GTF    GSVYKG W+MNIQHG+G K Y NSD+Y+G W+EG+++G
Sbjct  73    ATYEGDICGGFLHGSGTFYGPGGSVYKGSWRMNIQHGMGTKTYPNSDIYEGLWREGLQEG  132

Query  946   HGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFG  1125
              GRYTWS+GN Y G WK G M+GRGVMKW NGDLFDG W+DGL HGSG Y++ADG+YYFG
Sbjct  133   IGRYTWSSGNTYIGNWKAGKMNGRGVMKWANGDLFDGVWLDGLEHGSGYYKYADGAYYFG  192

Query  1126  TWSNGLKDGRGTLYPVGCALDKCKI-------DGHKEIRRMLSHDSSISKKDAVKPKVKR  1284
             TWS GLKDGRGT YP G  L K K        DG + +    S  SS   ++    K + 
Sbjct  193   TWSRGLKDGRGTFYPAGSKLPKQKFSESVVCNDGAQSLC-TASLMSSEGLRNKPLHKKRY  251

Query  1285  SISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
             S+    +  +   SGRIS R  S  G      S+  VL +D+S  LS ++ DG  +   +
Sbjct  252   SLDGWNISSYFCHSGRISHRPTSFDGIWNFGDSACSVLSQDSSLTLSSSSDDGPHKLQHD  311

Query  1465  ITVAYEREYMQGVLIRERIKSVD-GLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
               + YEREY+QGVLI ER +S D G+ H      K   K+ R G    + KG KSYYLML
Sbjct  312   NVLVYEREYVQGVLIMERARSSDSGVKHTKKCHHKIRRKQPR-GPGEAIHKGHKSYYLML  370

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+PMREVR SDFG +ARI+MYFP KGS+ TPPH SIDF+WKDYCP+
Sbjct  371   NLQLGIRYTVGKITPVPMREVRSSDFGPRARIRMYFPSKGSQFTPPHHSIDFFWKDYCPM  430

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FK++AADYMMSIC  DGL+EL SPGKSGSIFYLS D+RFVIKTL+K ELK+L
Sbjct  431   VFRNLREMFKIDAADYMMSICGVDGLKELSSPGKSGSIFYLSQDERFVIKTLRKYELKIL  490

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             LKMLP YY HV  ++NTLITKFFG++RI+++  +KVRFVVMGNMF TEL +H RYDLKGS
Sbjct  491   LKMLPKYYNHVGIYDNTLITKFFGLHRITIKGARKVRFVVMGNMFCTELRIHRRYDLKGS  550

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             S GR T K  I E TTLKDLDL Y   ++    E+L +Q+SLD  FLESQ IIDYS+LLG
Sbjct  551   SQGRSTSKHNINENTTLKDLDLSYVFHLENSWRESLFRQISLDCMFLESQCIIDYSMLLG  610

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVS-----SDGGISILPRSLTLVTHEPSIVSTAPG  2526
             LHFRAPEHL ALLE   +L    S+  +     S   +++ P+ L LV HEP  V+T PG
Sbjct  611   LHFRAPEHLKALLESQHTLQNSSSSQANNSDEPSQDEVTVPPKGLLLVAHEPGSVNTMPG  670

Query  2527  PHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDE-TDPSEVELFEV  2703
              HIRG TLRA++VGD EVDL+LPGTGRLRVQLGVNMPAQA RK+  +E  D +E++  EV
Sbjct  671   SHIRGSTLRASAVGDEEVDLILPGTGRLRVQLGVNMPAQAQRKLLHNEGPDSAEIDPVEV  730

Query  2704  YDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFR  2874
             YDVVLYLGIIDILQ YNM KK+EH YKSL+FDP+SIS +EPKLYSKRFISFLE+VFR
Sbjct  731   YDVVLYLGIIDILQEYNMTKKIEHAYKSLKFDPLSISAVEPKLYSKRFISFLEKVFR  787



>ref|XP_009148427.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 isoform 
X1 [Brassica rapa]
Length=760

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/770 (60%), Positives = 568/770 (74%), Gaps = 30/770 (4%)
 Frame = +1

Query  589   NNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGA  768
             N+   + + F NGD Y G  KG+LPHGKG Y+ SDGT Y+GDW++GK++GKG++IWSSGA
Sbjct  8     NHPPEERREFSNGDFYSGEVKGLLPHGKGMYSWSDGTIYEGDWDQGKISGKGKLIWSSGA  67

Query  769   TYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGH  948
              Y+GD   GYLHG GT +S D SVY G W+MN++HG+GRKEY NSD+YDG W+EG ++G 
Sbjct  68    KYEGDFSGGYLHGIGTMTSPDQSVYSGAWRMNVRHGLGRKEYCNSDLYDGSWREGSQEGR  127

Query  949   GRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGT  1128
             G Y+W+NGN Y G WKKG M GRGVM+W NGDLFDGFW++G RHGSG Y+FADGS YFGT
Sbjct  128   GSYSWTNGNRYIGSWKKGGMCGRGVMRWGNGDLFDGFWLNGCRHGSGVYKFADGSLYFGT  187

Query  1129  WSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSS----ISKKDAVKPKVKRSISE  1296
             WS G+KDG+G  YP G      K    K+  R L +D +    +S+  ++     RS+S 
Sbjct  188   WSRGVKDGKGIYYPAGS-----KHPSLKKWCRSLEYDDTGKFVLSRSSSIDVDELRSLSL  242

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAE-QLGNITV  1473
               V+R       +S R  +         S     P + +   + +   G++E Q     V
Sbjct  243   SAVNR------SLSMRTST---------SGMSDHPRELTSKSARSLGSGQSEGQDKKNRV  287

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
             AYEREYMQGVLIRE + +         +     +K+V   + +    G  +Y+LMLNLQL
Sbjct  288   AYEREYMQGVLIRESVVTSSVDRSLKIRPPSTLSKQVSARTFLTFLTGEHNYHLMLNLQL  347

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P R+VR SDFG++AR  M+FP+ GS  TPPH+SIDF WKDYCP+VFRN
Sbjct  348   GIRYTVGKITPVPRRDVRASDFGKKARTVMFFPKDGSNFTPPHKSIDFSWKDYCPMVFRN  407

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSELKVLL+ML
Sbjct  408   LREMFKLDAAEYMMSICGDDGLTEICSPGKSGSIFYLSHDDRFVIKTLKKSELKVLLRML  467

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YYKHV DHENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGSS GR
Sbjct  468   PRYYKHVGDHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSSHGR  527

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             FT+K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES  IIDYSLLLGLHFR
Sbjct  528   FTEKIKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCAFLESLQIIDYSLLLGLHFR  587

Query  2374  APEHLTALLEPPDSLFKPKSTLVSSDGGI----SILPRSLTLVTHEPSIVSTAPGPHIRG  2541
             AP  L  +LEPP+++   + ++ S D G+    SI P+ L LVTHEP+ VSTAPGPHIRG
Sbjct  588   APGQLNDILEPPNAM-SDQESVSSVDVGVTQELSIPPKGLLLVTHEPNSVSTAPGPHIRG  646

Query  2542  KTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLY  2721
              TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYDVV+Y
Sbjct  647   STLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLDEDKEESATIELFEVYDVVVY  706

Query  2722  LGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             +GIIDILQ YN +KK+EHK KSL++DPM+ISV EP +YSKRF++FL +VF
Sbjct  707   MGIIDILQEYNTKKKVEHKCKSLQYDPMTISVTEPTIYSKRFVNFLHKVF  756



>ref|XP_006830189.1| hypothetical protein AMTR_s00173p00020990 [Amborella trichopoda]
 gb|ERM97605.1| hypothetical protein AMTR_s00173p00020990 [Amborella trichopoda]
Length=779

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/786 (60%), Positives = 569/786 (72%), Gaps = 34/786 (4%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             M +++R  E VF NGD+Y G +KG LPHG GKY   DG  Y+G+WEE KM+G+G+I W S
Sbjct  1     MTDSQRFSETVFSNGDIYEGSYKGQLPHGTGKYIWFDGCIYEGEWEESKMSGRGKISWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA+Y+GD   GY+HG GT+ ++DG+ Y G W+MNIQHG+G+K Y NSDVY+G WKEGV +
Sbjct  61    GASYNGDFSGGYIHGSGTYIAADGASYMGDWRMNIQHGLGKKTYNNSDVYEGSWKEGVPE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY WS+GN Y G WK G M GRG++KW NGDLFDGFWVDGL  G G YRFADG YYF
Sbjct  121   GIGRYLWSSGNTYVGSWKSGKMCGRGILKWVNGDLFDGFWVDGLEQGFGIYRFADGGYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDK------------CKIDGHKEIRRMLSHDSSISKKDAV  1266
             GTWS GLKDG+G+ +P G  +              CK   H     M   D S  K    
Sbjct  181   GTWSRGLKDGKGSFFPSGSKIPNVASWLTSFNHADCKSYFHDCSASMDLEDFSAQKLR--  238

Query  1267  KPKVKRSISEK--IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCD  1440
               KVK S+SEK  ++D F + +GRIS R+ S+ GD  L  +  E+  +D   +L    C 
Sbjct  239   --KVKSSLSEKWSVIDLF-KSTGRISHRSTSLDGDLRLGANVGEISRKD---VLGKGLCA  292

Query  1441  GKAEQLGNITVAYE---REYMQGVLIRERIKSVDGLSHQSTQRRKFPAKE-VRKGSCMDL  1608
              +   +G          REY+QG+L  E I+S       + +R K   KE  R G    +
Sbjct  293   LEGGTIGTDDDDVTVYDREYIQGMLKSESIRSNQTSLKNNRKRHKRQTKEGNRPGET--V  350

Query  1609  FKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRS  1788
              KG +SYYLML+LQLGIRY+VGKITP+PMREVR SDFG +ARI+MYFPR+GS+ TPPH S
Sbjct  351   IKGHRSYYLMLSLQLGIRYTVGKITPVPMREVRSSDFGPRARIRMYFPREGSQFTPPHYS  410

Query  1789  IDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVI  1968
             IDFYWKDYCP+VFRNLR +FK++AADYM+SIC  DGLREL SPGKSGSIFYLS D+RFVI
Sbjct  411   IDFYWKDYCPMVFRNLREMFKIDAADYMISICGGDGLRELSSPGKSGSIFYLSQDERFVI  470

Query  1969  KTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTEL  2148
             KTL+KSE+K LLKMLP+YY HV  HENTLITKFFG++RI+LR  +KVRFVVMGNMF TEL
Sbjct  471   KTLRKSEVKALLKMLPNYYNHVGMHENTLITKFFGLHRITLRGGRKVRFVVMGNMFRTEL  530

Query  2149  HMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLES  2328
              +H RYDLKGS  GRFT K  I+E TTLKDLDL Y  +++    E+L KQ+SLD +FLES
Sbjct  531   RIHRRYDLKGSLQGRFTKKRAIDENTTLKDLDLAYVFQLEPSWRESLFKQISLDCKFLES  590

Query  2329  QHIIDYSLLLGLHFRAPEHLTALLEPPDSL-----FKPKSTLVSSDGGISILPRSLTLVT  2493
             Q IIDYSLLLGLHFRAPEHL  +LEP D++       P    V  +G + I PR L LV 
Sbjct  591   QCIIDYSLLLGLHFRAPEHLI-VLEPQDTIPYHVTAPPDDVNVCHEGELPIPPRGLLLVA  649

Query  2494  HEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDET  2673
             HEP+ VST PG HIRG TLRA +VGD EVDLLLPG GRLRVQLGVNMPA+ANRK++ D  
Sbjct  650   HEPNAVSTTPGSHIRGSTLRAPAVGDEEVDLLLPGMGRLRVQLGVNMPARANRKLQHDAE  709

Query  2674  DPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFIS  2853
                E++LFEVYDVVLYLGIIDILQ YN++KKLEH YKSL+FDP+SIS +EPKLYS+RF++
Sbjct  710   GSLEMDLFEVYDVVLYLGIIDILQEYNLKKKLEHAYKSLQFDPLSISAVEPKLYSERFLN  769

Query  2854  FLERVF  2871
             FL++VF
Sbjct  770   FLKKVF  775



>ref|XP_009148428.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 isoform 
X2 [Brassica rapa]
Length=759

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/770 (60%), Positives = 568/770 (74%), Gaps = 30/770 (4%)
 Frame = +1

Query  589   NNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGA  768
             N+   + + F NGD Y G  KG+LPHGKG Y+ SDGT Y+GDW++GK++GKG++IWSSGA
Sbjct  7     NHPPEERREFSNGDFYSGEVKGLLPHGKGMYSWSDGTIYEGDWDQGKISGKGKLIWSSGA  66

Query  769   TYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGH  948
              Y+GD   GYLHG GT +S D SVY G W+MN++HG+GRKEY NSD+YDG W+EG ++G 
Sbjct  67    KYEGDFSGGYLHGIGTMTSPDQSVYSGAWRMNVRHGLGRKEYCNSDLYDGSWREGSQEGR  126

Query  949   GRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGT  1128
             G Y+W+NGN Y G WKKG M GRGVM+W NGDLFDGFW++G RHGSG Y+FADGS YFGT
Sbjct  127   GSYSWTNGNRYIGSWKKGGMCGRGVMRWGNGDLFDGFWLNGCRHGSGVYKFADGSLYFGT  186

Query  1129  WSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSS----ISKKDAVKPKVKRSISE  1296
             WS G+KDG+G  YP G      K    K+  R L +D +    +S+  ++     RS+S 
Sbjct  187   WSRGVKDGKGIYYPAGS-----KHPSLKKWCRSLEYDDTGKFVLSRSSSIDVDELRSLSL  241

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAE-QLGNITV  1473
               V+R       +S R  +         S     P + +   + +   G++E Q     V
Sbjct  242   SAVNR------SLSMRTST---------SGMSDHPRELTSKSARSLGSGQSEGQDKKNRV  286

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
             AYEREYMQGVLIRE + +         +     +K+V   + +    G  +Y+LMLNLQL
Sbjct  287   AYEREYMQGVLIRESVVTSSVDRSLKIRPPSTLSKQVSARTFLTFLTGEHNYHLMLNLQL  346

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P R+VR SDFG++AR  M+FP+ GS  TPPH+SIDF WKDYCP+VFRN
Sbjct  347   GIRYTVGKITPVPRRDVRASDFGKKARTVMFFPKDGSNFTPPHKSIDFSWKDYCPMVFRN  406

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSELKVLL+ML
Sbjct  407   LREMFKLDAAEYMMSICGDDGLTEICSPGKSGSIFYLSHDDRFVIKTLKKSELKVLLRML  466

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YYKHV DHENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGSS GR
Sbjct  467   PRYYKHVGDHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSSHGR  526

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             FT+K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES  IIDYSLLLGLHFR
Sbjct  527   FTEKIKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCAFLESLQIIDYSLLLGLHFR  586

Query  2374  APEHLTALLEPPDSLFKPKSTLVSSDGGI----SILPRSLTLVTHEPSIVSTAPGPHIRG  2541
             AP  L  +LEPP+++   + ++ S D G+    SI P+ L LVTHEP+ VSTAPGPHIRG
Sbjct  587   APGQLNDILEPPNAM-SDQESVSSVDVGVTQELSIPPKGLLLVTHEPNSVSTAPGPHIRG  645

Query  2542  KTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLY  2721
              TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYDVV+Y
Sbjct  646   STLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLDEDKEESATIELFEVYDVVVY  705

Query  2722  LGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             +GIIDILQ YN +KK+EHK KSL++DPM+ISV EP +YSKRF++FL +VF
Sbjct  706   MGIIDILQEYNTKKKVEHKCKSLQYDPMTISVTEPTIYSKRFVNFLHKVF  755



>emb|CDX97920.1| BnaA06g06710D [Brassica napus]
Length=759

 Score =   909 bits (2348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/770 (59%), Positives = 566/770 (74%), Gaps = 30/770 (4%)
 Frame = +1

Query  589   NNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGA  768
             N+   + + F NGD Y G  KG+LPHGKG Y+ SDGT Y+GDW++GK++GKG++IWSSGA
Sbjct  7     NHPPEERREFSNGDFYSGEVKGLLPHGKGMYSWSDGTIYEGDWDQGKISGKGKLIWSSGA  66

Query  769   TYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGH  948
              Y+GD   GYLHG GT +S D SVY G W+MN++HG+GRKEY NSD+YDG W+EG ++G 
Sbjct  67    KYEGDFSGGYLHGIGTMTSPDQSVYSGAWRMNVRHGLGRKEYCNSDLYDGSWREGSQEGR  126

Query  949   GRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGT  1128
             G Y+W+NGN Y G WKKG M GRGVM+W NGDLFDGFW++G RHGSG Y+FADGS YFGT
Sbjct  127   GSYSWTNGNRYIGSWKKGGMCGRGVMRWGNGDLFDGFWLNGCRHGSGVYKFADGSLYFGT  186

Query  1129  WSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSS----ISKKDAVKPKVKRSISE  1296
             WS G+KDG+G  YP G      K    K+  R L +D +    +S+  ++     RS+S 
Sbjct  187   WSRGVKDGKGIFYPAGS-----KHPSLKKWCRSLEYDDTGKFVLSRSSSIDVDELRSLSL  241

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNIT-V  1473
               V+R       +S R  +         S     P + +   + +   G++E       V
Sbjct  242   SAVNR------SLSMRTST---------SGMSDHPRELTSKSARSLGSGQSEGHDKKNRV  286

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
             AYEREYMQGVLIRE + +         +     +K+V   + +    G  +Y+LMLNLQL
Sbjct  287   AYEREYMQGVLIRESVVTSSVDRSLKIRPPSTLSKQVSARTFLTFLTGEHNYHLMLNLQL  346

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P R+VR SDFG++AR  M+FP+ GS  TPPH+SIDF WKDYCP+VFRN
Sbjct  347   GIRYTVGKITPVPRRDVRASDFGKKARTVMFFPKDGSNFTPPHKSIDFSWKDYCPMVFRN  406

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSELKVLL+ML
Sbjct  407   LREMFKLDAAEYMMSICGDDGLTEICSPGKSGSIFYLSHDDRFVIKTLKKSELKVLLRML  466

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YYKHV DHENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGSS GR
Sbjct  467   PRYYKHVGDHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSSHGR  526

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             FT+K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES  IIDYSLLLGLHFR
Sbjct  527   FTEKIKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCAFLESLQIIDYSLLLGLHFR  586

Query  2374  APEHLTALLEPPDSLFKPKSTLVSSDGGI----SILPRSLTLVTHEPSIVSTAPGPHIRG  2541
             AP  L  +LEPP+++   + ++ S D G+    SI P+ L LVTHEP+ VST PGPHIRG
Sbjct  587   APGQLNDILEPPNAM-SDQESVSSVDVGVTQELSIPPKGLLLVTHEPNSVSTVPGPHIRG  645

Query  2542  KTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLY  2721
              TLRA SVG++EVDL+LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYDVV+Y
Sbjct  646   STLRAFSVGEQEVDLILPGTARLRVQLGVNMPAQAHHKLDEDKEESATIELFEVYDVVVY  705

Query  2722  LGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             +GIIDILQ YN +KK+EHK KSL++DPM+ISV EP +YSKRF++FL +VF
Sbjct  706   MGIIDILQEYNTKKKVEHKCKSLQYDPMTISVTEPTIYSKRFVNFLHKVF  755



>ref|XP_008802074.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802075.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802076.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform 
X1 [Phoenix dactylifera]
Length=790

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/775 (61%), Positives = 569/775 (73%), Gaps = 14/775 (2%)
 Frame = +1

Query  586   ENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSG  765
             E++ER  EKV PNGDVY+G F G+ PHG GKY  SDGT Y+G+WE+ KMTG+G+I W SG
Sbjct  13    EDSERHREKVLPNGDVYVGNFDGLFPHGTGKYIWSDGTLYEGEWEKSKMTGRGRIYWPSG  72

Query  766   ATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDG  945
             ATY+GD   G+LHG GTF   DGSVYKG W+MNIQHG+G K Y NS +Y+G WKEG+++G
Sbjct  73    ATYEGDICGGFLHGSGTFYGLDGSVYKGSWRMNIQHGMGTKTYPNSGIYEGLWKEGLQEG  132

Query  946   HGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFG  1125
              GRYTWSN N Y G WK G MSGRGVMKW NGDLFDG W+DGL+HGSG Y++ADG+YYFG
Sbjct  133   IGRYTWSNRNTYIGNWKAGKMSGRGVMKWENGDLFDGVWLDGLKHGSGYYKYADGAYYFG  192

Query  1126  TWSNGLKDGRGTLYPVGCALDKCKI-------DGHKEIRRMLSHDSSISKKDAVKPKVKR  1284
             TWS GLKDGRG  Y  G  L K K        DG + +    S  SS   ++    K + 
Sbjct  193   TWSRGLKDGRGIFYAAGSKLPKQKFSESVVCNDGAQSLCPA-SLMSSEGLRNKPLHKKRY  251

Query  1285  SISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
             S        +   SGRIS R VS  G   L  S+  VL +D+S  LS ++ +G+ +   +
Sbjct  252   SFDGWNTSSYFCRSGRISHRPVSFEGIWNLSDSAGSVLSQDSSLTLSSSSDEGQHKLQHD  311

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLN  1644
               + YEREY QG+LI ER +S D    + T+      ++   G    + KG KSYYLMLN
Sbjct  312   NVLVYEREYAQGILIMERTRSSDSGVKRKTKWHHKIQRKQPSGPGEAIHKGHKSYYLMLN  371

Query  1645  LQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIV  1824
             LQLGIRY+VGKITP+PMREVR SDFG +ARI+MYFP KGS+ TPPH SIDF+WKDYCP+V
Sbjct  372   LQLGIRYTVGKITPVPMREVRSSDFGPRARIQMYFPSKGSQFTPPHHSIDFFWKDYCPMV  431

Query  1825  FRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLL  2004
             FRNLR +FK++AADYMMSIC  D L+EL SPGKSGSIFYLS D+RFVIKTL+K ELK+LL
Sbjct  432   FRNLREMFKIDAADYMMSICGGDDLKELSSPGKSGSIFYLSQDERFVIKTLRKYELKILL  491

Query  2005  KMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSS  2184
             KMLP YY HV  ++NTLITKFFG++ I+++  +KVRFVVMGNMF T LH+H RYDLKGSS
Sbjct  492   KMLPKYYNHVGIYDNTLITKFFGLHTITIKGVRKVRFVVMGNMFCTGLHIHRRYDLKGSS  551

Query  2185  LGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGL  2364
              GR T K  I E TTLKDLDL Y   +++   ++L +Q+SLD  FLESQ IIDYS+LLGL
Sbjct  552   QGRSTSKHNINENTTLKDLDLSYVFHLERSWRDSLFRQISLDCMFLESQCIIDYSMLLGL  611

Query  2365  HFRAPEHLTALLEPPDSLFKPKSTLVS-----SDGGISILPRSLTLVTHEPSIVSTAPGP  2529
             HFRAPEHL ALLE   +L    S+  +     S   +++ P+ L LV HEP  VST PG 
Sbjct  612   HFRAPEHLKALLECQHTLQNSSSSQANNSDEPSQDEVTVPPKGLLLVAHEPGSVSTMPGS  671

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDET-DPSEVELFEVY  2706
             HIRG TLRA++VGD EVDL+LPGTGRLRVQLGVNMPAQA+RK+  +E  D +E++ FEVY
Sbjct  672   HIRGSTLRASAVGDEEVDLILPGTGRLRVQLGVNMPAQAHRKLLHNEVPDSAEIDHFEVY  731

Query  2707  DVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             DVVLYLGIIDILQ Y+M KK+EH YKSL+FDP+SIS +EPKLYSKRFISFLE+VF
Sbjct  732   DVVLYLGIIDILQEYDMTKKIEHAYKSLKFDPLSISTVEPKLYSKRFISFLEKVF  786



>ref|XP_004140232.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Cucumis 
sativus]
Length=816

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/824 (55%), Positives = 564/824 (68%), Gaps = 65/824 (8%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME+ +   E V  NGDVYIG FK  LPHGKGKY   +GT YDGDWE+GKMTGKG+I W S
Sbjct  1     MEDIQGLAENVLSNGDVYIGSFKDSLPHGKGKYMWFEGTIYDGDWEDGKMTGKGKITWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+GD   GYLHGFGTF  SDGS+Y G W+MNI HG+GRK Y N D+YDG WKEG+ +
Sbjct  61    GARYEGDISGGYLHGFGTFYYSDGSIYNGAWRMNIHHGIGRKLYANLDIYDGSWKEGIPE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRY WS+GN Y G WK G M G+G+MKW NGD F GFW++G RHGSG Y FADG+YYF
Sbjct  121   GCGRYFWSSGNSYIGNWKGGQMCGKGIMKWVNGDHFIGFWLNGFRHGSGVYHFADGAYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGC---ALDKC------KIDGHKEIRRMLSHDSSISKKDAVKPK  1275
             G+WS GLKDG+GT YP G    +L+K        +DG   + R LS +  + K+   K  
Sbjct  181   GSWSKGLKDGKGTFYPAGSKPPSLEKWDNFIGYDLDGKGFVSRTLSLN--LEKEKPPKHG  238

Query  1276  VKRSISEKIVDRFARDSGRISRRAVSV----AGDAALHCSSTEVLPEDASCMLSHT--TC  1437
             +K S SEKI       +G +S    S+      D A   S+        SC++SH   + 
Sbjct  239   LKHSFSEKISVTGISSAGGLSNWPTSMEVNWGSDPAREASAV-----GDSCVMSHASKSV  293

Query  1438  DGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
              G+     N  + YEREY+QGVLI+ER+K  + L  +S +R+K   KE  + SC++ F+ 
Sbjct  294   QGQNNVPYNHRMVYEREYIQGVLIQERLKEYEELLDRSKERKKTTVKEAARVSCVNFFES  353

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              +SYYLMLNLQLGIRY+VGKITP+PMREVR SDFG++ARI MYFPRKGS+ TPPH S++F
Sbjct  354   HRSYYLMLNLQLGIRYTVGKITPVPMREVRASDFGKRARIVMYFPRKGSQFTPPHYSVNF  413

Query  1798  YWKDYCPIVFRNLRRLFKLNAA------DYMMSICCDDGLR------ELLSPG-------  1920
             +WKDYCP+VFR  +R+   N A      D  M+I   +  +       L +P        
Sbjct  414   HWKDYCPMVFRG-QRVPSANVASTSDDSDKSMTISSKEFAKFRKYQESLKAPSFTPLLPS  472

Query  1921  ---KSGSIFYLSCDDRF--VIKT-----LKKSELKV---------LLKMLPSYYKHVKDH  2043
                 + ++FY   D     V KT      KK+E ++         LLKMLP YY HVK H
Sbjct  473   QREAAPNMFYKDLDMLILNVFKTRIGQDPKKTEDQLQDIVLLLVVLLKMLPKYYDHVKAH  532

Query  2044  ENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEG  2223
             ENTLITKFFG++RI++  R KVRFVVMGNMF TEL +H RYDLKGS++GR T+ DK ++G
Sbjct  533   ENTLITKFFGLHRITIHGRSKVRFVVMGNMFCTELKIHRRYDLKGSTIGRCTNGDKSKDG  592

Query  2224  TTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLE  2403
              TLKDLDL YE  MDKLL ++L KQ+ LD  FLES HIIDYSLLLG+HFRAPE L ALLE
Sbjct  593   ITLKDLDLSYEFHMDKLLRQSLFKQIYLDCMFLESLHIIDYSLLLGVHFRAPEKLKALLE  652

Query  2404  PPDSLFKPKSTL----VSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGD  2571
             PP ++  P++ L     SS+   +I P+ L LVTHEPS V+TAPGPHIRG+ L+A S+GD
Sbjct  653   PPATVQHPENLLHDDGESSESEPTIPPKGLILVTHEPSFVTTAPGPHIRGRPLKAYSLGD  712

Query  2572  REVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAY  2751
             REVD+LLPGT R RVQLGVNMPA A++K+++  ++ +EVELFE YDVVLY+GIIDILQ Y
Sbjct  713   REVDVLLPGTARFRVQLGVNMPAHASQKLREARSESAEVELFEFYDVVLYMGIIDILQEY  772

Query  2752  NMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA*P  2883
             N+ KKLEH YKS RFDP+SISV+EP LY+ RFISFLE+VF   P
Sbjct  773   NVMKKLEHAYKSFRFDPVSISVVEPHLYATRFISFLEKVFHELP  816



>ref|XP_006392102.1| hypothetical protein EUTSA_v10023316mg [Eutrema salsugineum]
 gb|ESQ29388.1| hypothetical protein EUTSA_v10023316mg [Eutrema salsugineum]
Length=697

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/703 (62%), Positives = 520/703 (74%), Gaps = 28/703 (4%)
 Frame = +1

Query  817   FSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWK  996
              +S DGSVY G W+MN++HG+GRKEY NSD YDG WKEGV+DG G YTW NGN + G WK
Sbjct  1     MTSPDGSVYSGAWRMNVRHGLGRKEYCNSDSYDGSWKEGVQDGSGSYTWINGNRFLGNWK  60

Query  997   KGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVG  1176
             KG MSGRGVM W NGDLF+GFW++GLRHGSG Y++ADG +YFGTWS GLKDG G  YP G
Sbjct  61    KGKMSGRGVMSWANGDLFNGFWLNGLRHGSGVYKYADGGFYFGTWSRGLKDGNGVFYPAG  120

Query  1177  CALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSISE-KIVDRFARDSGR  1332
                   K   H+          +LSHDSSI+  +    K V RS+SE        R+SGR
Sbjct  121   SKHPSLK-KWHRSFGYDDTGNFVLSHDSSINLDELRASKAVSRSLSEITTTSGLTRNSGR  179

Query  1333  ISRRAVSVAGDAALHCSSTEVLPED-----ASCMLSHTTCDGKAEQLGNITVAYEREYMQ  1497
             +S R +           ST   P D      S     +   G++E      + +EREYMQ
Sbjct  180   MSERFLD-------ENWSTSDPPRDFMHHGPSSKSVRSVDSGQSEARDKNPIVFEREYMQ  232

Query  1498  GVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGK  1677
             GVLI+ERI S   +SH++    +   KE+  G+CM    G+ +YYLMLNLQLGIRY+VGK
Sbjct  233   GVLIKERIMSSIDMSHRARPLDR--TKEITIGACMSFLGGKWNYYLMLNLQLGIRYTVGK  290

Query  1678  ITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLN  1857
             ITP+P REVR SDFG++ARI M+FP+ GS+ TPPH+SIDF WKDYCP+VFRNLR +FKL+
Sbjct  291   ITPVPRREVRASDFGKRARIMMFFPKNGSQYTPPHKSIDFDWKDYCPMVFRNLREMFKLD  350

Query  1858  AADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVK  2037
             AADYMMSIC DDGLRE+ SPGKSGSIFYLS DDRFVIKTLK+SELKVLL+MLP YY+HV 
Sbjct  351   AADYMMSICGDDGLREISSPGKSGSIFYLSHDDRFVIKTLKRSELKVLLRMLPRYYEHVG  410

Query  2038  DHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIE  2217
             DHENTLITKFFGV+R+ L+  KKVRFVVMGNMF TEL +H RYDLKGSS GRFT+K K+ 
Sbjct  411   DHENTLITKFFGVHRLKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSSQGRFTEKKKMG  470

Query  2218  EGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTAL  2397
             E TT+KDLDL YE  MDKLL E L KQ+ LD  FLES  IIDYSLLLGLHFRAP+ L  +
Sbjct  471   EKTTMKDLDLAYEFHMDKLLREALFKQIYLDCSFLESLQIIDYSLLLGLHFRAPDQLNDI  530

Query  2398  LEPPDSLFKPKSTLVSSDGGI----SILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSV  2565
             LEPP+++   ++  VSS   +    SI P+ L LVTHEPS V+TAPGPHIRG TLRA SV
Sbjct  531   LEPPNAMSDQENDSVSSVEVMPREPSIPPKGLLLVTHEPSSVNTAPGPHIRGSTLRAFSV  590

Query  2566  GDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPS-EVELFEVYDVVLYLGIIDIL  2742
             G++EVDL+LPGT RLRVQLGVNMPAQA+ KV+QDE + S  VELFEVYDVV+Y+GIIDIL
Sbjct  591   GEKEVDLILPGTARLRVQLGVNMPAQAHHKVRQDEEEESGMVELFEVYDVVVYMGIIDIL  650

Query  2743  QAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             Q YNM+K++EH  KS++ DPM+IS IEP LYSKRF  FL +VF
Sbjct  651   QEYNMKKRMEHTCKSMKHDPMTISAIEPTLYSKRFTDFLLKVF  693


 Score = 81.3 bits (199),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 62/113 (55%), Gaps = 0/113 (0%)
 Frame = +1

Query  619  PNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEGY  798
            P+G VY G ++  + HG G+    +  +YDG W+EG   G G   W +G  + G+  +G 
Sbjct  4    PDGSVYSGAWRMNVRHGLGRKEYCNSDSYDGSWKEGVQDGSGSYTWINGNRFLGNWKKGK  63

Query  799  LHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
            + G G  S ++G ++ G W   ++HG G  +Y +   Y G W  G++DG+G +
Sbjct  64   MSGRGVMSWANGDLFNGFWLNGLRHGSGVYKYADGGFYFGTWSRGLKDGNGVF  116


 Score = 67.8 bits (164),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            K + N D Y G +K  +  G G YT  +G  + G+W++GKM+G+G + W++G  ++G   
Sbjct  24   KEYCNSDSYDGSWKEGVQDGSGSYTWINGNRFLGNWKKGKMSGRGVMSWANGDLFNGFWL  83

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             G  HG G +  +DG  Y G W   ++ G G
Sbjct  84   NGLRHGSGVYKYADGGFYFGTWSRGLKDGNG  114



>ref|XP_008352855.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-phosphate 
5-kinase 8-like [Malus domestica]
Length=691

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/690 (61%), Positives = 510/690 (74%), Gaps = 28/690 (4%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK F N DVY+G FKG+LPHG GKYT SDGT Y+GDWEEGKMTGKG++IW+SG  Y GD 
Sbjct  7     EKAFSNRDVYVGNFKGILPHGNGKYTWSDGTVYEGDWEEGKMTGKGKLIWTSGXQYXGDF  66

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+HG+G F+  DGS Y G W+MN+QHG+G+K+Y +SD+Y+G WKEGV++G GRY WS
Sbjct  67    SGGYVHGYGIFNGPDGSFYHGSWRMNVQHGMGKKQYCDSDIYEGSWKEGVQEGSGRYLWS  126

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             +GN Y G WK G M GRGVMKW NGDL++G W++GLR GSG YRFADG YYFGTWS GLK
Sbjct  127   SGNTYIGSWKGGKMCGRGVMKWENGDLYNGSWLNGLRDGSGVYRFADGGYYFGTWSRGLK  186

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSI-------------SKKDAVKPKVKRS  1287
             DG+GT YPVG          H  ++R  S                  S +   +P VKRS
Sbjct  187   DGKGTFYPVGTK--------HPSLKRWCSSVGYSSDGSSSLSGHLLNSMEGKARPTVKRS  238

Query  1288  ISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
              SEKI +    R+S RIS +A+S+  +      S E +  D+ C LS  + D + E   N
Sbjct  239   FSEKISIGGILRNSRRISHKAMSLDKNWTACDPSXEFIRYDSLCSLSQASEDVQHETRDN  298

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLN  1644
              T  YEREYMQGVLI+ER ++   +S ++ QR K       K SC+D+F   +SYYLMLN
Sbjct  299   NTSVYEREYMQGVLIKERERNHTEISRKNKQRNKISVTP--KSSCIDMFGAHRSYYLMLN  356

Query  1645  LQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIV  1824
             LQLGIRY+VGKITP+P+REVR SDFGE+ARI+MYFPR+GS+ TPPH S+DFYWKDYCP+V
Sbjct  357   LQLGIRYTVGKITPVPVREVRSSDFGERARIRMYFPRRGSQFTPPHYSVDFYWKDYCPMV  416

Query  1825  FRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLL  2004
             FRNLR +FKL+AA+YMMSIC DDGLREL SPGKSGSIFYLS DDRFVIKTL+K+ELKVLL
Sbjct  417   FRNLREMFKLDAAEYMMSICGDDGLRELSSPGKSGSIFYLSHDDRFVIKTLRKTELKVLL  476

Query  2005  KMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSS  2184
             KMLPSYY HV  HENTLITKFFG++RI+L+  KKVRF+VMGNMF TEL +H RYDLKGSS
Sbjct  477   KMLPSYYCHVGKHENTLITKFFGLHRITLKGGKKVRFMVMGNMFCTELRIHRRYDLKGSS  536

Query  2185  LGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGL  2364
             +GR TDK+KI E TTLKDLDL +E  MDKLL E+L KQ+SLD  FL+SQ IIDYS  +GL
Sbjct  537   IGRCTDKNKIRENTTLKDLDLSFEFHMDKLLRESLFKQISLDCMFLQSQQIIDYSXXVGL  596

Query  2365  HFRAPEHLTALLEPPDSLFK----PKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPH  2532
             HFRAPE+L    +PP ++      P +  VS+ G + I P+ L LVTHEP  VSTAPGPH
Sbjct  597   HFRAPENLKGFSQPPAAMHNDESLPTNDGVSAQGELLIPPKGLLLVTHEPGSVSTAPGPH  656

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQL  2622
             IRG TL+A S+GD+EVDLL+PGTG   + L
Sbjct  657   IRGSTLKAYSLGDKEVDLLVPGTGXYFILL  686


 Score = 79.3 bits (194),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = +1

Query  865   IQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGD  1044
             + + V  K + N DVY G +K  +  G+G+YTWS+G +Y G W++G M+G+G + W +G 
Sbjct  1     MDYAVSEKAFSNRDVYVGNFKGILPHGNGKYTWSDGTVYEGDWEEGKMTGKGKLIWTSGX  60

Query  1045  LFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
              + G +  G  HG G +   DGS+Y G+W   ++ G G
Sbjct  61    QYXGDFSGGYVHGYGIFNGPDGSFYHGSWRMNVQHGMG  98



>ref|XP_008802078.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform 
X3 [Phoenix dactylifera]
Length=730

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/727 (61%), Positives = 532/727 (73%), Gaps = 14/727 (2%)
 Frame = +1

Query  730   MTGKGQIIWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDV  909
             MTG+G+I W SGATY+GD   G+LHG GTF   DGSVYKG W+MNIQHG+G K Y NS +
Sbjct  1     MTGRGRIYWPSGATYEGDICGGFLHGSGTFYGLDGSVYKGSWRMNIQHGMGTKTYPNSGI  60

Query  910   YDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSG  1089
             Y+G WKEG+++G GRYTWSN N Y G WK G MSGRGVMKW NGDLFDG W+DGL+HGSG
Sbjct  61    YEGLWKEGLQEGIGRYTWSNRNTYIGNWKAGKMSGRGVMKWENGDLFDGVWLDGLKHGSG  120

Query  1090  CYRFADGSYYFGTWSNGLKDGRGTLYPVGCALDKCKI-------DGHKEIRRMLSHDSSI  1248
              Y++ADG+YYFGTWS GLKDGRG  Y  G  L K K        DG + +    S  SS 
Sbjct  121   YYKYADGAYYFGTWSRGLKDGRGIFYAAGSKLPKQKFSESVVCNDGAQSLCPA-SLMSSE  179

Query  1249  SKKDAVKPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSH  1428
               ++    K + S        +   SGRIS R VS  G   L  S+  VL +D+S  LS 
Sbjct  180   GLRNKPLHKKRYSFDGWNTSSYFCRSGRISHRPVSFEGIWNLSDSAGSVLSQDSSLTLSS  239

Query  1429  TTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDL  1608
             ++ +G+ +   +  + YEREY QG+LI ER +S D    + T+      ++   G    +
Sbjct  240   SSDEGQHKLQHDNVLVYEREYAQGILIMERTRSSDSGVKRKTKWHHKIQRKQPSGPGEAI  299

Query  1609  FKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRS  1788
              KG KSYYLMLNLQLGIRY+VGKITP+PMREVR SDFG +ARI+MYFP KGS+ TPPH S
Sbjct  300   HKGHKSYYLMLNLQLGIRYTVGKITPVPMREVRSSDFGPRARIQMYFPSKGSQFTPPHHS  359

Query  1789  IDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVI  1968
             IDF+WKDYCP+VFRNLR +FK++AADYMMSIC  D L+EL SPGKSGSIFYLS D+RFVI
Sbjct  360   IDFFWKDYCPMVFRNLREMFKIDAADYMMSICGGDDLKELSSPGKSGSIFYLSQDERFVI  419

Query  1969  KTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTEL  2148
             KTL+K ELK+LLKMLP YY HV  ++NTLITKFFG++ I+++  +KVRFVVMGNMF T L
Sbjct  420   KTLRKYELKILLKMLPKYYNHVGIYDNTLITKFFGLHTITIKGVRKVRFVVMGNMFCTGL  479

Query  2149  HMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLES  2328
             H+H RYDLKGSS GR T K  I E TTLKDLDL Y   +++   ++L +Q+SLD  FLES
Sbjct  480   HIHRRYDLKGSSQGRSTSKHNINENTTLKDLDLSYVFHLERSWRDSLFRQISLDCMFLES  539

Query  2329  QHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVS-----SDGGISILPRSLTLVT  2493
             Q IIDYS+LLGLHFRAPEHL ALLE   +L    S+  +     S   +++ P+ L LV 
Sbjct  540   QCIIDYSMLLGLHFRAPEHLKALLECQHTLQNSSSSQANNSDEPSQDEVTVPPKGLLLVA  599

Query  2494  HEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDET  2673
             HEP  VST PG HIRG TLRA++VGD EVDL+LPGTGRLRVQLGVNMPAQA+RK+  +E 
Sbjct  600   HEPGSVSTMPGSHIRGSTLRASAVGDEEVDLILPGTGRLRVQLGVNMPAQAHRKLLHNEV  659

Query  2674  -DPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFI  2850
              D +E++ FEVYDVVLYLGIIDILQ Y+M KK+EH YKSL+FDP+SIS +EPKLYSKRFI
Sbjct  660   PDSAEIDHFEVYDVVLYLGIIDILQEYDMTKKIEHAYKSLKFDPLSISTVEPKLYSKRFI  719

Query  2851  SFLERVF  2871
             SFLE+VF
Sbjct  720   SFLEKVF  726


 Score = 78.2 bits (191),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 62/115 (54%), Gaps = 8/115 (7%)
 Frame = +1

Query  538  VYRNSYGMGI*CVIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDW  717
            VY+ S+ M I              K +PN  +Y G++K  L  G G+YT S+  TY G+W
Sbjct  37   VYKGSWRMNI--------QHGMGTKTYPNSGIYEGLWKEGLQEGIGRYTWSNRNTYIGNW  88

Query  718  EEGKMTGKGQIIWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
            + GKM+G+G + W +G  +DG   +G  HG G +  +DG+ Y G W   ++ G G
Sbjct  89   KAGKMSGRGVMKWENGDLFDGVWLDGLKHGSGYYKYADGAYYFGTWSRGLKDGRG  143



>gb|KHG21071.1| Phosphatidylinositol-4-phosphate 5-kinase 8 [Gossypium arboreum]
 gb|KHG27345.1| Phosphatidylinositol-4-phosphate 5-kinase 8 [Gossypium arboreum]
Length=685

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/691 (60%), Positives = 521/691 (75%), Gaps = 22/691 (3%)
 Frame = +1

Query  859   MNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFN  1038
             MNI+HG G+K+Y NSD+Y+G WKEG  +G G Y W+NGN YTG WK+G M GRGVM+W N
Sbjct  1     MNIRHGYGKKKYSNSDIYEGEWKEGEHEGKGIYFWNNGNKYTGNWKRGKMHGRGVMEWIN  60

Query  1039  GDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVGC---ALDKCKI---  1200
             GD ++G W +G RHG+G Y++ADG YYFGTW+ GLKDG+G  YP G    +L KC     
Sbjct  61    GDHYNGCWFNGFRHGNGIYQYADGGYYFGTWTRGLKDGKGLFYPAGSKRPSLKKCCTSLG  120

Query  1201  --DGHKEIRRMLSHDSSISKKDAV--KPKVKRSISEKI-VDRFARDSGRISRRAVSVAGD  1365
               D HK +   L   SS+  ++ +  KP +KRS+SEKI V    + SGR+S +    +G 
Sbjct  121   YDDDHKTV---LPQCSSLHLEEHIVKKPSIKRSLSEKISVSGVLKGSGRMSSKTAESSG-  176

Query  1366  AALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSH  1545
               L  S  E +  ++S   S  +  G++E   N  V YEREYMQGV+I+ERI+  + LS 
Sbjct  177   --LSDSGREFVHHNSSGTFSFDSDAGQSELQENTAVIYEREYMQGVMIKERIRDYNELSK  234

Query  1546  QSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGE  1725
             ++ ++ KF AKE +K SC+ +FKG  SY+LMLNLQLGIRY+VGKITP+P REVR +DFG+
Sbjct  235   KAEKKTKFHAKETQKSSCVGIFKGHNSYHLMLNLQLGIRYTVGKITPVPKREVRAADFGD  294

Query  1726  QARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRE  1905
             +ARI M+FP+KGS+ TPPH+SIDFYWKDYCP+VFR+LR LFKL+AA+YMMSIC DDGL E
Sbjct  295   RARITMFFPKKGSQFTPPHKSIDFYWKDYCPMVFRHLRELFKLDAAEYMMSICGDDGLTE  354

Query  1906  LLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRI  2085
             + SPGKSGS+FYLS DD+FVIKTLKKSELKVLLKMLP Y+ HVK+HENTLITKFFG++RI
Sbjct  355   ISSPGKSGSLFYLSHDDKFVIKTLKKSELKVLLKMLPKYHNHVKEHENTLITKFFGLHRI  414

Query  2086  SLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRM  2265
             +L  R+KVRFVVMGNMF TEL +H RYDLKGS+ GR TDKDKI E TTLKDLDL YE  M
Sbjct  415   TLPGRRKVRFVVMGNMFCTELRIHRRYDLKGSTHGRITDKDKIHENTTLKDLDLSYEFHM  474

Query  2266  DKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEP----PDSLFKPKS  2433
             DK L E L  Q++ D  FL+SQ IIDYSLLLGLHFRAPE L  L+EP    P+    P  
Sbjct  475   DKSLREFLFDQIADDCAFLKSQQIIDYSLLLGLHFRAPEPLDGLVEPPNISPNMQSSPAG  534

Query  2434  TLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLR  2613
               +++DG +    +   L+ HEPS V+T PGPHIRG+ LRA S+G++EVD+++PGTGRLR
Sbjct  535   QGLTADGEVLFPSKGFVLLAHEPSSVNTDPGPHIRGRALRAFSLGNQEVDIMVPGTGRLR  594

Query  2614  VQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLR  2793
             VQLGVNMPA+AN K+ QDE+D +EVELFEVYDV+LY+GIIDILQ YN +KK EH YKS++
Sbjct  595   VQLGVNMPARANHKLPQDESDSAEVELFEVYDVILYMGIIDILQEYNAKKKAEHAYKSVK  654

Query  2794  FDPMSISVIEPKLYSKRFISFL-ERVFRA*P  2883
             F P +ISV+EP+LY+ RF +FL ++VF   P
Sbjct  655   FGPTTISVVEPELYANRFTNFLKQKVFPGQP  685


 Score = 71.6 bits (174),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = +1

Query  607  EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
            +K + N D+Y G +K     GKG Y  ++G  Y G+W+ GKM G+G + W +G  Y+G  
Sbjct  9    KKKYSNSDIYEGEWKEGEHEGKGIYFWNNGNKYTGNWKRGKMHGRGVMEWINGDHYNGCW  68

Query  787  FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
            F G+ HG G +  +DG  Y G W   ++ G G
Sbjct  69   FNGFRHGNGIYQYADGGYYFGTWTRGLKDGKG  100



>ref|XP_009390891.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=788

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/781 (56%), Positives = 544/781 (70%), Gaps = 29/781 (4%)
 Frame = +1

Query  586   ENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSG  765
             E+ E   EKV  NGDVY+G F G+LPHG G+YT  +GT YDG WE+ K+TG+G+I+W SG
Sbjct  16    EHGESHAEKVLSNGDVYVGDFNGLLPHGMGRYTWLNGTIYDGQWEKNKITGRGKILWPSG  75

Query  766   ATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDG  945
             A Y+G+   G+LHG G+    DGSVYKG W MN QHG G K Y N D YDG W+EG+++G
Sbjct  76    AAYEGEISGGFLHGSGSLFGFDGSVYKGSWMMNRQHGKGIKTYSNLDEYDGFWREGLQEG  135

Query  946   HGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFG  1125
              G + WSNGN Y+G WK G MSG+GVMKW NGDLFDG W+DGL +GSG Y++ADGS Y G
Sbjct  136   FGTHKWSNGNTYSGNWKSGKMSGKGVMKWSNGDLFDGDWLDGLENGSGYYKYADGSLYVG  195

Query  1126  TWSNGLKDGRGTLYPVGCALDKCKIDGHKEI-----------RRMLSHDSSISKKDAVKP  1272
              WS GLKDG GT +P G +   C++   K I               S++  +SK  + + 
Sbjct  196   IWSRGLKDGHGTFFPTG-SRTPCQLTYSKSIVCGNKVQSLGPASFFSNEGPVSKMLSKRS  254

Query  1273  KVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAE  1452
              V R      +    R + RIS R  S+ G   ++ +      E+ S  L  +T + + E
Sbjct  255   TVNRWSMNGCL----RSTKRISHRPSSLDGIWNVNDACVSSSSENTSRTLC-STDESQLE  309

Query  1453  QLGNITVAYEREYMQGVLIRERIKSVD-GLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
              L +  + Y+REYMQGVLI ER++  D G   ++    K   +  R G    ++ G +SY
Sbjct  310   LLDDRILVYDREYMQGVLITERMRYCDFGRPQRAKWHCKMSKQPKRPGET--IYGGHRSY  367

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
             YLMLNLQLGIRY+VGKITP+PMREVR SDFG +ARI+MYFP +GS+ TPPH S+ F+WKD
Sbjct  368   YLMLNLQLGIRYTVGKITPVPMREVRSSDFGRRARIQMYFPSRGSQFTPPHNSVGFFWKD  427

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FK++AADYMMS+C  DGL+EL SPGKSGSIFYLS D+RF+IKTL+K E
Sbjct  428   YCPMVFRNLREMFKIDAADYMMSVCGGDGLKELSSPGKSGSIFYLSQDERFLIKTLRKYE  487

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             LK+LLKMLP+YY HV  +ENTLITKFFG++R++++RR KVRFVVMGNMF TEL +H RYD
Sbjct  488   LKILLKMLPNYYGHVGAYENTLITKFFGLHRLTIKRR-KVRFVVMGNMFRTELRIHRRYD  546

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGSS GR T K  I E TTLKDLDL Y   ++K   E+L +Q+SLD +FLESQ IIDYS
Sbjct  547   LKGSSHGRSTSKHNINENTTLKDLDLSYVFNLEKSWRESLFRQISLDCKFLESQSIIDYS  606

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISIL------PRSLTLVTHEPSIV  2511
             +LLGLHFRAPEHL A      +L K  +     +  I +       P+ L LV HEPS V
Sbjct  607   MLLGLHFRAPEHLKA-YSKSQNLLKHSANSADDNADIQLRDEVKTPPKGLRLVAHEPSSV  665

Query  2512  STAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDE-TDPSEV  2688
             S+ PG HIRG TLRA++  ++EVDLLLPGTGRLRVQLGVNMPA+AN K   ++    +E 
Sbjct  666   SSLPGSHIRGSTLRASAADNKEVDLLLPGTGRLRVQLGVNMPAEANWKPLHNKGLHSAEF  725

Query  2689  ELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERV  2868
                EVYDVVLY GIIDILQ YNM KK EH  KSL+ DP+SIS + PK+YSKRF+ FLE+V
Sbjct  726   NPVEVYDVVLYFGIIDILQEYNMTKKFEHCCKSLKCDPLSISAVAPKMYSKRFVEFLEKV  785

Query  2869  F  2871
             F
Sbjct  786   F  786



>ref|XP_009390248.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390249.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390250.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390251.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390252.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390253.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390254.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Musa 
acuminata subsp. malaccensis]
Length=804

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/776 (56%), Positives = 543/776 (70%), Gaps = 27/776 (3%)
 Frame = +1

Query  586   ENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSG  765
             E+ E   +KV  NGDVY+G F G+LPHG G+YT +DGT Y G WEE K+TG+G+I W SG
Sbjct  37    EHGETHCKKVLSNGDVYVGDFDGLLPHGTGRYTWTDGTIYHGQWEESKITGRGKIFWLSG  96

Query  766   ATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDG  945
             ATY+G+   G+LHG GT    DGS Y+G W+MN QHG G K Y N D YDG W+EG+++G
Sbjct  97    ATYEGELCGGFLHGSGTLFGVDGSTYRGSWRMNKQHGKGIKLYSNLDEYDGLWREGLQEG  156

Query  946   HGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFG  1125
              G Y W NGN Y+G WK G MSG+GVMKW NGDLFDG W+DGL +GSG Y++ADGS Y G
Sbjct  157   IGTYRWRNGNTYSGNWKAGKMSGKGVMKWTNGDLFDGNWLDGLENGSGYYKYADGSIYVG  216

Query  1126  TWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIV  1305
              WS GLKDG GT  P G  L            R   +    +K  ++ P        K V
Sbjct  217   IWSRGLKDGHGTFLPAGSRLPYQ--------HRYSEYIVYGNKVQSLGPTSLFGKRRKKV  268

Query  1306  DRFA-----RDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNIT  1470
             +R++     R+  RIS R   + G   +  +    L E+    L  +T +G+     +  
Sbjct  269   NRWSMIGYLRNPKRISHRPSFLDGVWNIGGACESSLSENTPYALCSSTDEGRHGLQNDSV  328

Query  1471  VAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVR--KGSCMDLFKGRKSYYLMLN  1644
             + Y+REYMQGVLI E ++  D    + +Q+ K+  K  +  +G    ++KG +SYYLMLN
Sbjct  329   LVYDREYMQGVLITESMRYYD---FRRSQKNKWHCKMKKQPRGPGETIYKGHRSYYLMLN  385

Query  1645  LQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIV  1824
             LQLGIRY+VGKITP+PMREVR SDFG +ARI+MYFP KGS+ TPPH SI F+WKDYCP+V
Sbjct  386   LQLGIRYTVGKITPVPMREVRSSDFGTRARIRMYFPSKGSQFTPPHSSIGFFWKDYCPMV  445

Query  1825  FRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLL  2004
             FRNLR +FK++AADYMMSIC  DGL+EL SPGKSGSIFYLS D+RFVIKTL+K ELK+LL
Sbjct  446   FRNLREMFKIDAADYMMSICGGDGLKELSSPGKSGSIFYLSQDERFVIKTLRKYELKILL  505

Query  2005  KMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSS  2184
             KMLP+YY HV  ++NTLITKFFG++R+++ + KKVRFVVMGNMF TEL +H RYDLKGSS
Sbjct  506   KMLPNYYDHVGAYDNTLITKFFGLHRLTI-KGKKVRFVVMGNMFRTELRIHRRYDLKGSS  564

Query  2185  LGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGL  2364
              GR T+K  I E TTLKDLDL Y   ++K   E+L +Q+SLD +FLESQ IIDYS+LLGL
Sbjct  565   HGRSTNKHNINENTTLKDLDLTYVFHLEKSWRESLFRQISLDCEFLESQSIIDYSMLLGL  624

Query  2365  HFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISIL------PRSLTLVTHEPSIVSTAPG  2526
             HFRAPEH  A  E   SL K  +        + +       P+ L LV HEPS VS+ PG
Sbjct  625   HFRAPEHFKAYSE-SQSLLKRSANSQDDISDVQLCDEVRTPPKGLRLVAHEPSSVSSLPG  683

Query  2527  PHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDE-TDPSEVELFEV  2703
              H+RG TLRA++ G++EVDLLLPGTGRLRVQLGVNMPAQA+ K+   E  D +E++  +V
Sbjct  684   SHMRGSTLRASAAGNKEVDLLLPGTGRLRVQLGVNMPAQASWKLLHGEGLDTTELDPADV  743

Query  2704  YDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             YDVVLY GIIDILQ YNM KK+EH  KSL+ DP+SIS +EPK+Y KRFI FLE+VF
Sbjct  744   YDVVLYFGIIDILQEYNMNKKIEHVCKSLKLDPVSISAVEPKMYKKRFIRFLEKVF  799



>ref|XP_009390893.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=776

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/781 (56%), Positives = 544/781 (70%), Gaps = 29/781 (4%)
 Frame = +1

Query  586   ENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSG  765
             E+ E   EKV  NGDVY+G F G+LPHG G+YT  +GT YDG WE+ K+TG+G+I+W SG
Sbjct  4     EHGESHAEKVLSNGDVYVGDFNGLLPHGMGRYTWLNGTIYDGQWEKNKITGRGKILWPSG  63

Query  766   ATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDG  945
             A Y+G+   G+LHG G+    DGSVYKG W MN QHG G K Y N D YDG W+EG+++G
Sbjct  64    AAYEGEISGGFLHGSGSLFGFDGSVYKGSWMMNRQHGKGIKTYSNLDEYDGFWREGLQEG  123

Query  946   HGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFG  1125
              G + WSNGN Y+G WK G MSG+GVMKW NGDLFDG W+DGL +GSG Y++ADGS Y G
Sbjct  124   FGTHKWSNGNTYSGNWKSGKMSGKGVMKWSNGDLFDGDWLDGLENGSGYYKYADGSLYVG  183

Query  1126  TWSNGLKDGRGTLYPVGCALDKCKIDGHKEI-----------RRMLSHDSSISKKDAVKP  1272
              WS GLKDG GT +P G +   C++   K I               S++  +SK  + + 
Sbjct  184   IWSRGLKDGHGTFFPTG-SRTPCQLTYSKSIVCGNKVQSLGPASFFSNEGPVSKMLSKRS  242

Query  1273  KVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAE  1452
              V R      +    R + RIS R  S+ G   ++ +      E+ S  L  +T + + E
Sbjct  243   TVNRWSMNGCL----RSTKRISHRPSSLDGIWNVNDACVSSSSENTSRTLC-STDESQLE  297

Query  1453  QLGNITVAYEREYMQGVLIRERIKSVD-GLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
              L +  + Y+REYMQGVLI ER++  D G   ++    K   +  R G    ++ G +SY
Sbjct  298   LLDDRILVYDREYMQGVLITERMRYCDFGRPQRAKWHCKMSKQPKRPGET--IYGGHRSY  355

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
             YLMLNLQLGIRY+VGKITP+PMREVR SDFG +ARI+MYFP +GS+ TPPH S+ F+WKD
Sbjct  356   YLMLNLQLGIRYTVGKITPVPMREVRSSDFGRRARIQMYFPSRGSQFTPPHNSVGFFWKD  415

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FK++AADYMMS+C  DGL+EL SPGKSGSIFYLS D+RF+IKTL+K E
Sbjct  416   YCPMVFRNLREMFKIDAADYMMSVCGGDGLKELSSPGKSGSIFYLSQDERFLIKTLRKYE  475

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             LK+LLKMLP+YY HV  +ENTLITKFFG++R++++RR KVRFVVMGNMF TEL +H RYD
Sbjct  476   LKILLKMLPNYYGHVGAYENTLITKFFGLHRLTIKRR-KVRFVVMGNMFRTELRIHRRYD  534

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGSS GR T K  I E TTLKDLDL Y   ++K   E+L +Q+SLD +FLESQ IIDYS
Sbjct  535   LKGSSHGRSTSKHNINENTTLKDLDLSYVFNLEKSWRESLFRQISLDCKFLESQSIIDYS  594

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISIL------PRSLTLVTHEPSIV  2511
             +LLGLHFRAPEHL A      +L K  +     +  I +       P+ L LV HEPS V
Sbjct  595   MLLGLHFRAPEHLKA-YSKSQNLLKHSANSADDNADIQLRDEVKTPPKGLRLVAHEPSSV  653

Query  2512  STAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDE-TDPSEV  2688
             S+ PG HIRG TLRA++  ++EVDLLLPGTGRLRVQLGVNMPA+AN K   ++    +E 
Sbjct  654   SSLPGSHIRGSTLRASAADNKEVDLLLPGTGRLRVQLGVNMPAEANWKPLHNKGLHSAEF  713

Query  2689  ELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERV  2868
                EVYDVVLY GIIDILQ YNM KK EH  KSL+ DP+SIS + PK+YSKRF+ FLE+V
Sbjct  714   NPVEVYDVVLYFGIIDILQEYNMTKKFEHCCKSLKCDPLSISAVAPKMYSKRFVEFLEKV  773

Query  2869  F  2871
             F
Sbjct  774   F  774



>emb|CDY34670.1| BnaC08g42290D [Brassica napus]
Length=679

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/694 (61%), Positives = 511/694 (74%), Gaps = 28/694 (4%)
 Frame = +1

Query  817   FSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWK  996
              +S DGSVY G W+MN++HG+GRKEY NSD+YDG WKEG+++GHG Y+W+NGN Y G WK
Sbjct  1     MTSPDGSVYSGAWRMNVRHGLGRKEYCNSDLYDGSWKEGLQEGHGSYSWTNGNRYIGNWK  60

Query  997   KGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVG  1176
              G M GRGVM+W NGDLFDGFW++G RHGSG Y+F DG  Y+G WS+GLKDG+G  YP G
Sbjct  61    NGKMCGRGVMRWANGDLFDGFWLNGFRHGSGVYKFVDGCLYYGAWSHGLKDGKGVFYPAG  120

Query  1177  CALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARDSGRISRRAVSV  1356
                   K    K+  R L HD      D  K  + RS S  + +  +     +S    S+
Sbjct  121   S-----KHPSLKKWCRSLQHD------DTGKFVLSRSSSINVEELRS-----LSTVTPSL  164

Query  1357  AGDAALHCSSTEVLPEDASC-----MLSHTTCDGKAEQLGNITVAYEREYMQGVLIRERI  1521
             +   ++  + +E  P D +C       + ++  G+ E      V YEREYMQGVLIRE I
Sbjct  165   SVKTSVSGTVSEPPPSDFTCHGPSSKSARSSGSGQREGQDKNRVVYEREYMQGVLIRETI  224

Query  1522  KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMRE  1701
              S    SH+   R     K+VR  S M   KG  +YYLMLNLQLGIRY+VGKITP+P RE
Sbjct  225   TSSVDRSHKI--RPPNLPKQVRDRSFMTFLKGEHNYYLMLNLQLGIRYTVGKITPVPRRE  282

Query  1702  VRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSI  1881
             VR SDFG++AR  MYFPR GS  TPPH+SIDF WKDYCP+VFRNLR +FKL+ ADYMMSI
Sbjct  283   VRASDFGKKARTMMYFPRDGSNFTPPHKSIDFSWKDYCPMVFRNLRAMFKLDPADYMMSI  342

Query  1882  CCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLIT  2061
             C DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSEL+VLLKMLP YY+HV DHENTLIT
Sbjct  343   CGDDGLTEICSPGKSGSIFYLSHDDRFVIKTLKKSELEVLLKMLPKYYRHVGDHENTLIT  402

Query  2062  KFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDL  2241
             KFFGV+RI L+  KKVRFVVMGNMF TEL +H RYDLKGS+ GR T+K KI+E TTLKDL
Sbjct  403   KFFGVHRIKLKLGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGRITEKTKIQEKTTLKDL  462

Query  2242  DLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLF  2421
             DL YE  MDKLL E L KQ+ LD  FLES HIIDYSLLLG+HFRAPE L  +LE P+ + 
Sbjct  463   DLAYEFHMDKLLREALFKQIYLDCAFLESLHIIDYSLLLGVHFRAPEQLNDILEHPNEM-  521

Query  2422  KPKSTLVSSDGG----ISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLL  2589
               + ++ S D G    +SI P+ L LVTHEP+ V+TAPGPHIRG TLRA SVG++EVDL+
Sbjct  522   SDQDSVSSVDVGMAQELSIPPKGLLLVTHEPNSVNTAPGPHIRGSTLRAFSVGEKEVDLI  581

Query  2590  LPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKL  2769
             LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYDVV+Y+GIIDILQ YN +KK+
Sbjct  582   LPGTARLRVQLGVNMPAQAHHKLDEDKEESATIELFEVYDVVVYMGIIDILQEYNAKKKV  641

Query  2770  EHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             EHK KSLR+DPM+ISV EPK+YSKRF+ FL +VF
Sbjct  642   EHKCKSLRYDPMTISVTEPKVYSKRFVDFLHKVF  675


 Score = 73.6 bits (179),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            K + N D+Y G +K  L  G G Y+ ++G  Y G+W+ GKM G+G + W++G  +DG   
Sbjct  24   KEYCNSDLYDGSWKEGLQEGHGSYSWTNGNRYIGNWKNGKMCGRGVMRWANGDLFDGFWL  83

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             G+ HG G +   DG +Y G W   ++ G G
Sbjct  84   NGFRHGSGVYKFVDGCLYYGAWSHGLKDGKG  114



>emb|CDY34857.1| BnaA09g47830D [Brassica napus]
Length=679

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/694 (61%), Positives = 510/694 (73%), Gaps = 28/694 (4%)
 Frame = +1

Query  817   FSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWK  996
              +S DGSVY G W+MN++HG+GRKEY NSD+YDG WKEG+++GHG Y+W+NGN Y G WK
Sbjct  1     MTSPDGSVYSGAWRMNVRHGLGRKEYCNSDLYDGSWKEGLQEGHGSYSWTNGNRYIGNWK  60

Query  997   KGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVG  1176
              G M GRGVM+W NGDLFDGFW +G RHGSG Y++ DG  Y+G WS+GLKDG+G  YP G
Sbjct  61    NGKMCGRGVMRWANGDLFDGFWSNGFRHGSGVYKYVDGCLYYGAWSHGLKDGKGVFYPAG  120

Query  1177  CALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARDSGRISRRAVSV  1356
                   K    K+  R L HD      D  K  + RS S  + +  +     +S    S+
Sbjct  121   S-----KHPSLKKWCRSLQHD------DTGKFVLSRSSSINVEELRS-----LSTVTPSL  164

Query  1357  AGDAALHCSSTEVLPEDASC-----MLSHTTCDGKAEQLGNITVAYEREYMQGVLIRERI  1521
             +   ++  + +E  P D +C       + ++  G+ E      V YEREYMQGVLIRE I
Sbjct  165   SVKTSVTGTVSEPPPSDFTCHGPSSKSARSSGSGQREGQDKNRVVYEREYMQGVLIRETI  224

Query  1522  KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMRE  1701
              S    SH+   R     K+V+  + M   KG  +YYLMLNLQLGIRY+VGKITP+P RE
Sbjct  225   TSSVDRSHKI--RPPNLPKQVKSRNFMTFLKGEHNYYLMLNLQLGIRYTVGKITPVPRRE  282

Query  1702  VRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSI  1881
             VR SDFG++AR  +YFPR GS  TPPH+SIDF WKDYCP+VFRNLR +FKL+ ADYMMSI
Sbjct  283   VRASDFGKKARTMVYFPRDGSNFTPPHKSIDFSWKDYCPMVFRNLRAMFKLDPADYMMSI  342

Query  1882  CCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLIT  2061
             C DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSEL+VLLKMLP YY+HV DHENTLIT
Sbjct  343   CGDDGLTEICSPGKSGSIFYLSHDDRFVIKTLKKSELEVLLKMLPKYYRHVGDHENTLIT  402

Query  2062  KFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDL  2241
             KFFGV+RI L+  KKVRFVVMGNMF TEL +H RYDLKGS+ GR T+K KI+E TTLKDL
Sbjct  403   KFFGVHRIKLKLGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGRITEKTKIQEKTTLKDL  462

Query  2242  DLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLF  2421
             DL YE  MDKLL E L KQ+ LD  FLES HIIDYSLLLG+HFRAP  L   LEPP+ + 
Sbjct  463   DLAYEFHMDKLLREALFKQIYLDCAFLESLHIIDYSLLLGVHFRAPGQLNDTLEPPN-VM  521

Query  2422  KPKSTLVSSDGG----ISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLL  2589
               + ++ S D G    +SI P+ L LVTHEP+ V+TAPGPHIRG TLRA SVG++EVDL+
Sbjct  522   SDQESVSSVDVGMAQELSIPPKGLLLVTHEPNSVNTAPGPHIRGSTLRAFSVGEQEVDLI  581

Query  2590  LPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKL  2769
             LPGT RLRVQLGVNMPAQA+ K+ +D+ + + +ELFEVYDVV+Y+GIIDILQ YN +KK+
Sbjct  582   LPGTARLRVQLGVNMPAQAHHKLDEDKEESATIELFEVYDVVVYMGIIDILQEYNAKKKV  641

Query  2770  EHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             EHK KSLR+DPM+ISV EPK+YSKRF+ FL++VF
Sbjct  642   EHKCKSLRYDPMTISVTEPKVYSKRFVDFLQKVF  675


 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 59/113 (52%), Gaps = 0/113 (0%)
 Frame = +1

Query  619  PNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEGY  798
            P+G VY G ++  + HG G+    +   YDG W+EG   G G   W++G  Y G+   G 
Sbjct  4    PDGSVYSGAWRMNVRHGLGRKEYCNSDLYDGSWKEGLQEGHGSYSWTNGNRYIGNWKNGK  63

Query  799  LHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
            + G G    ++G ++ G W    +HG G  +Y +  +Y G W  G++DG G +
Sbjct  64   MCGRGVMRWANGDLFDGFWSNGFRHGSGVYKYVDGCLYYGAWSHGLKDGKGVF  116


 Score = 72.8 bits (177),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            K + N D+Y G +K  L  G G Y+ ++G  Y G+W+ GKM G+G + W++G  +DG   
Sbjct  24   KEYCNSDLYDGSWKEGLQEGHGSYSWTNGNRYIGNWKNGKMCGRGVMRWANGDLFDGFWS  83

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             G+ HG G +   DG +Y G W   ++ G G
Sbjct  84   NGFRHGSGVYKYVDGCLYYGAWSHGLKDGKG  114



>ref|XP_009355210.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X3 [Pyrus x bretschneideri]
Length=697

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/681 (61%), Positives = 505/681 (74%), Gaps = 20/681 (3%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK F NGDVY+G FKG LPHG GKYT  DGT Y+GDWEEGKMTGKG++IW+SGA Y GD 
Sbjct  7     EKAFSNGDVYVGNFKGTLPHGNGKYTWCDGTVYEGDWEEGKMTGKGKLIWTSGAQYVGDF  66

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GYLHG G F+  DGS Y+G W+MNIQHG+G+K+Y+NSD+Y+G WKEGV++G GRY WS
Sbjct  67    SGGYLHGDGIFNGPDGSFYQGSWRMNIQHGMGKKQYRNSDIYEGSWKEGVQEGSGRYLWS  126

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             +GN YTG WK G M GRGVMKW NGDL++G W++GLR G G YRFADG YYFGTWS GLK
Sbjct  127   SGNTYTGSWKGGKMCGRGVMKWENGDLYNGSWLNGLRDGCGVYRFADGGYYFGTWSRGLK  186

Query  1147  DGRGTLYPVG---------CALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEK  1299
             DG+GT YP G         C+      DG   + R L +    S +   +P VK S SEK
Sbjct  187   DGKGTFYPAGTKHPSLKEWCSSVGYSSDGSSSLSRHLLN----STEGNARPTVKCSFSEK  242

Query  1300  I-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVA  1476
             I +    R+S RIS +A+S+  +      S + +  D+   +S  + D + E   N T  
Sbjct  243   ISIGGILRNSRRISHKAMSLDKNWTDRYPSRDFIRYDSLSSMSQASEDIEHEMRDNNTSV  302

Query  1477  YEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLG  1656
             YEREY+QGV +RER  +   +S +S QR       + K SC+D+F   +SYYLMLNLQLG
Sbjct  303   YEREYVQGVFVREREYNHTEISRKSKQRNNVSV--MPKSSCIDMFGANRSYYLMLNLQLG  360

Query  1657  IRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNL  1836
             IRY+VGKITP+P+REVR SDFG++ARI+MYFPRKGS+ TPPH S+DFYWKDYCP+VFRNL
Sbjct  361   IRYTVGKITPVPVREVRPSDFGDRARIRMYFPRKGSQFTPPHYSVDFYWKDYCPMVFRNL  420

Query  1837  RRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLP  2016
             R +FKL+AA+YMMSIC D+GLRE+ SPGKSGSIFY+S DDRF +KTL+K+ELKV+LKMLP
Sbjct  421   REMFKLDAAEYMMSICGDNGLREISSPGKSGSIFYISHDDRFFVKTLRKTELKVMLKMLP  480

Query  2017  SYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRF  2196
              YY HV +HENTLITK FG++RI+L+  KKVRF+VMGNMF TEL +H RYDLKGS++GR 
Sbjct  481   RYYSHVDEHENTLITKKFGLHRITLKGGKKVRFMVMGNMFCTELRIHRRYDLKGSTIGRC  540

Query  2197  TDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRA  2376
             TD+DKI+E TTLKDLDL +E  MDKLL   L KQ+SLD +FL+SQ IIDYSLLLGLHFRA
Sbjct  541   TDEDKIDENTTLKDLDLKFEFHMDKLLRGELFKQISLDCKFLQSQQIIDYSLLLGLHFRA  600

Query  2377  PEHLTALLEPPDSLFKPKSTL----VSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGK  2544
             PE      +PP ++   +S L    V+  G + I P+ L LVTHEP  VSTAPGPHIRG 
Sbjct  601   PEDPKGFSQPPATMHNHESLLADDGVTLQGELLIPPKGLLLVTHEPGSVSTAPGPHIRGS  660

Query  2545  TLRANSVGDREVDLLLPGTGR  2607
              L+A S+GD+EVDLLLPGTGR
Sbjct  661   PLKAYSLGDKEVDLLLPGTGR  681


 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = +1

Query  865   IQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGD  1044
             +++ V  K + N DVY G +K  +  G+G+YTW +G +Y G W++G M+G+G + W +G 
Sbjct  1     MEYAVSEKAFSNGDVYVGNFKGTLPHGNGKYTWCDGTVYEGDWEEGKMTGKGKLIWTSGA  60

Query  1045  LFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
              + G +  G  HG G +   DGS+Y G+W   ++ G G
Sbjct  61    QYVGDFSGGYLHGDGIFNGPDGSFYQGSWRMNIQHGMG  98



>gb|KEH20717.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Medicago 
truncatula]
Length=673

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/686 (59%), Positives = 503/686 (73%), Gaps = 24/686 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME+N R +EK F NGDVYIG FKG+LPHG GKYT SDG+ Y+GDW +GKMTGKG +IW S
Sbjct  1     MEDNGRFEEKSFTNGDVYIGKFKGILPHGNGKYTWSDGSVYEGDWIDGKMTGKGILIWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+    YLHG GTF+ S+G VY G W+MN  HG+GRK Y NSD+Y+G WKEG+R+
Sbjct  61    GAKYEGEFSGSYLHGHGTFTKSNGCVYTGGWRMNAHHGIGRKAYSNSDIYEGLWKEGIRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G G++TW++G++Y G WKKG + GRG+MKWFNGD+FDG W++GLR GSG YRF+DG  Y 
Sbjct  121   GSGKFTWNDGSIYIGNWKKGKIDGRGIMKWFNGDVFDGCWLNGLRQGSGVYRFSDGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKI  1302
             GTWS GLKDG+GT YP G             +++  ++  S         +  RS+SEK 
Sbjct  181   GTWSKGLKDGKGTFYPSGSK--------QPSLKKWCTNLHSDENCKVPNSRFNRSLSEK-  231

Query  1303  VDRFARDSGR------ISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
                 AR SGR      +S+    +  +  +   + + +  D+S  L  T+ +G++E    
Sbjct  232   ----ARASGRSKSSRHLSQSTSLLDENHVIQNPADDCICRDSSSALPRTSNEGQSEVSVM  287

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRR-KFPAKEVRKGSCMDLFKGRKSYYLML  1641
               + +EREYMQGVLI ER++      H   +R+ KF  K+V+K S +   + R+SYYL L
Sbjct  288   SNMVFEREYMQGVLIVERLRECSEKPHNKNKRQSKFSMKQVKKSSFIGTIQNRRSYYLKL  347

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDFGE+ARI+MYFP++GS+LTPPH S+DFYWKDYCP+
Sbjct  348   NLQLGIRYTVGKITPVPAREVRSSDFGERARIRMYFPKEGSQLTPPHCSVDFYWKDYCPM  407

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FKL+AA+YMMSIC D  L+++ SPGKSGSIF++S DD+FVIKTLKK ELKVL
Sbjct  408   VFRNLREMFKLDAAEYMMSICGDCALKDISSPGKSGSIFFISQDDKFVIKTLKKYELKVL  467

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L MLP YY HV  +ENTLITKFFG++RI+LR  KKVRFVVMGNMF TELH+H RYDLKGS
Sbjct  468   LNMLPKYYHHVGSYENTLITKFFGIHRITLRGGKKVRFVVMGNMFCTELHIHRRYDLKGS  527

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             S GR+T +DKI   TTLKDLDL YE  MDK L E+L KQ+SLD +FLESQHIIDYSLLLG
Sbjct  528   SQGRYTSQDKINSNTTLKDLDLKYEFHMDKKLRESLFKQISLDCKFLESQHIIDYSLLLG  587

Query  2362  LHFRAPEHLTALLEPPDSLFK----PKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGP  2529
             LHFRAPE+L AL+EPP S+ +    P +  +   G   I+P+ L LV HEPS V+  PGP
Sbjct  588   LHFRAPENLKALVEPPGSIQRQFSLPSADDILKQGEQLIIPKGLLLVAHEPSFVNATPGP  647

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGR  2607
             HIRG TLRA S+G++EVDLLLPGT R
Sbjct  648   HIRGNTLRAYSIGNKEVDLLLPGTAR  673



>gb|KEH20718.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Medicago 
truncatula]
Length=674

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/688 (59%), Positives = 506/688 (74%), Gaps = 27/688 (4%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME+N R +EK F NGDVYIG FKG+LPHG GKYT SDG+ Y+GDW +GKMTGKG +IW S
Sbjct  1     MEDNGRFEEKSFTNGDVYIGKFKGILPHGNGKYTWSDGSVYEGDWIDGKMTGKGILIWPS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+    YLHG GTF+ S+G VY G W+MN  HG+GRK Y NSD+Y+G WKEG+R+
Sbjct  61    GAKYEGEFSGSYLHGHGTFTKSNGCVYTGGWRMNAHHGIGRKAYSNSDIYEGLWKEGIRE  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G G++TW++G++Y G WKKG + GRG+MKWFNGD+FDG W++GLR GSG YRF+DG  Y 
Sbjct  121   GSGKFTWNDGSIYIGNWKKGKIDGRGIMKWFNGDVFDGCWLNGLRQGSGVYRFSDGGLYI  180

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKI  1302
             GTWS GLKDG+GT YP G             +++  ++  S         +  RS+SEK 
Sbjct  181   GTWSKGLKDGKGTFYPSGSK--------QPSLKKWCTNLHSDENCKVPNSRFNRSLSEK-  231

Query  1303  VDRFARDSGR------ISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
                 AR SGR      +S+    +  +  +   + + +  D+S  L  T+ +G++E    
Sbjct  232   ----ARASGRSKSSRHLSQSTSLLDENHVIQNPADDCICRDSSSALPRTSNEGQSEVSVM  287

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRR-KFPAKEVRKGSCMDLFKGRKSYYLML  1641
               + +EREYMQGVLI ER++      H   +R+ KF  K+V+K S +   + R+SYYL L
Sbjct  288   SNMVFEREYMQGVLIVERLRECSEKPHNKNKRQSKFSMKQVKKSSFIGTIQNRRSYYLKL  347

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDFGE+ARI+MYFP++GS+LTPPH S+DFYWKDYCP+
Sbjct  348   NLQLGIRYTVGKITPVPAREVRSSDFGERARIRMYFPKEGSQLTPPHCSVDFYWKDYCPM  407

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FKL+AA+YMMSIC D  L+++ SPGKSGSIF++S DD+FVIKTLKK ELKVL
Sbjct  408   VFRNLREMFKLDAAEYMMSICGDCALKDISSPGKSGSIFFISQDDKFVIKTLKKYELKVL  467

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L MLP YY HV  +ENTLITKFFG++RI+LR  KKVRFVVMGNMF TELH+H RYDLKGS
Sbjct  468   LNMLPKYYHHVGSYENTLITKFFGIHRITLRGGKKVRFVVMGNMFCTELHIHRRYDLKGS  527

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             S GR+T +DKI   TTLKDLDL YE  MDK L E+L KQ+SLD +FLESQHIIDYSLLLG
Sbjct  528   SQGRYTSQDKINSNTTLKDLDLKYEFHMDKKLRESLFKQISLDCKFLESQHIIDYSLLLG  587

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSD------GGISILPRSLTLVTHEPSIVSTAP  2523
             LHFRAPE+L AL+EPP S+ + + +L S+D      G   I+P+ L LV HEPS V+  P
Sbjct  588   LHFRAPENLKALVEPPGSI-QRQFSLPSADVDILKQGEQLIIPKGLLLVAHEPSFVNATP  646

Query  2524  GPHIRGKTLRANSVGDREVDLLLPGTGR  2607
             GPHIRG TLRA S+G++EVDLLLPGT R
Sbjct  647   GPHIRGNTLRAYSIGNKEVDLLLPGTAR  674



>ref|XP_008802077.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform 
X2 [Phoenix dactylifera]
Length=756

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/719 (59%), Positives = 517/719 (72%), Gaps = 14/719 (2%)
 Frame = +1

Query  586   ENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSG  765
             E++ER  EKV PNGDVY+G F G+ PHG GKY  SDGT Y+G+WE+ KMTG+G+I W SG
Sbjct  13    EDSERHREKVLPNGDVYVGNFDGLFPHGTGKYIWSDGTLYEGEWEKSKMTGRGRIYWPSG  72

Query  766   ATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDG  945
             ATY+GD   G+LHG GTF   DGSVYKG W+MNIQHG+G K Y NS +Y+G WKEG+++G
Sbjct  73    ATYEGDICGGFLHGSGTFYGLDGSVYKGSWRMNIQHGMGTKTYPNSGIYEGLWKEGLQEG  132

Query  946   HGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFG  1125
              GRYTWSN N Y G WK G MSGRGVMKW NGDLFDG W+DGL+HGSG Y++ADG+YYFG
Sbjct  133   IGRYTWSNRNTYIGNWKAGKMSGRGVMKWENGDLFDGVWLDGLKHGSGYYKYADGAYYFG  192

Query  1126  TWSNGLKDGRGTLYPVGCALDKCKI-------DGHKEIRRMLSHDSSISKKDAVKPKVKR  1284
             TWS GLKDGRG  Y  G  L K K        DG + +    S  SS   ++    K + 
Sbjct  193   TWSRGLKDGRGIFYAAGSKLPKQKFSESVVCNDGAQSLCPA-SLMSSEGLRNKPLHKKRY  251

Query  1285  SISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
             S        +   SGRIS R VS  G   L  S+  VL +D+S  LS ++ +G+ +   +
Sbjct  252   SFDGWNTSSYFCRSGRISHRPVSFEGIWNLSDSAGSVLSQDSSLTLSSSSDEGQHKLQHD  311

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLN  1644
               + YEREY QG+LI ER +S D    + T+      ++   G    + KG KSYYLMLN
Sbjct  312   NVLVYEREYAQGILIMERTRSSDSGVKRKTKWHHKIQRKQPSGPGEAIHKGHKSYYLMLN  371

Query  1645  LQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIV  1824
             LQLGIRY+VGKITP+PMREVR SDFG +ARI+MYFP KGS+ TPPH SIDF+WKDYCP+V
Sbjct  372   LQLGIRYTVGKITPVPMREVRSSDFGPRARIQMYFPSKGSQFTPPHHSIDFFWKDYCPMV  431

Query  1825  FRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLL  2004
             FRNLR +FK++AADYMMSIC  D L+EL SPGKSGSIFYLS D+RFVIKTL+K ELK+LL
Sbjct  432   FRNLREMFKIDAADYMMSICGGDDLKELSSPGKSGSIFYLSQDERFVIKTLRKYELKILL  491

Query  2005  KMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSS  2184
             KMLP YY HV  ++NTLITKFFG++ I+++  +KVRFVVMGNMF T LH+H RYDLKGSS
Sbjct  492   KMLPKYYNHVGIYDNTLITKFFGLHTITIKGVRKVRFVVMGNMFCTGLHIHRRYDLKGSS  551

Query  2185  LGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGL  2364
              GR T K  I E TTLKDLDL Y   +++   ++L +Q+SLD  FLESQ IIDYS+LLGL
Sbjct  552   QGRSTSKHNINENTTLKDLDLSYVFHLERSWRDSLFRQISLDCMFLESQCIIDYSMLLGL  611

Query  2365  HFRAPEHLTALLEPPDSLFKPKSTLVS-----SDGGISILPRSLTLVTHEPSIVSTAPGP  2529
             HFRAPEHL ALLE   +L    S+  +     S   +++ P+ L LV HEP  VST PG 
Sbjct  612   HFRAPEHLKALLECQHTLQNSSSSQANNSDEPSQDEVTVPPKGLLLVAHEPGSVSTMPGS  671

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDET-DPSEVELFEV  2703
             HIRG TLRA++VGD EVDL+LPGTGRLRVQLGVNMPAQA+RK+  +E  D +E++ FE+
Sbjct  672   HIRGSTLRASAVGDEEVDLILPGTGRLRVQLGVNMPAQAHRKLLHNEVPDSAEIDHFEL  730



>ref|XP_010501421.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like [Camelina 
sativa]
Length=702

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/689 (60%), Positives = 500/689 (73%), Gaps = 25/689 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R+ ++ FPNGD Y G  KG+LP+GKGKY  SDGT Y+GDW++GK++GKG++ WSSGA Y+
Sbjct  4     RSGDREFPNGDFYSGEVKGILPNGKGKYVWSDGTIYEGDWDQGKISGKGKLFWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHG+GT +S D SVY G W+MN++HG+GRKEY NSD+YDG WKEG++DG G Y
Sbjct  64    GDFSGGYLHGYGTMTSPDDSVYSGTWRMNVRHGLGRKEYCNSDLYDGSWKEGLQDGRGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W+NGN Y G WKKG M  RGVM+W NGDL+DGFW++G RHGSG Y+FADG  Y+GTWS 
Sbjct  124   SWTNGNRYIGSWKKGKMCERGVMRWANGDLYDGFWLNGFRHGSGVYKFADGCLYYGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCK-----IDGHKEIRRMLSHDSSISKKDAVKPK-VKRSIS-E  1296
             GLKDG+G  YP G      K     ++     + +LS  +S++ ++      V RS+S E
Sbjct  184   GLKDGKGVFYPAGSKQPSLKKWCRSLEYDDTGKFVLSRSASVNVEELRSSNTVTRSLSVE  243

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCS-----STEVLPEDASCMLSHTTCDGKAEQLG  1461
                   A+ SGRIS R      D    C      +T  +P   S   S +   G++E   
Sbjct  244   TSAGEMAKHSGRISDRYTD---DIWRSCDPPRDFTTCHVPLSKSARFSGS---GQSEGQD  297

Query  1462  NITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
                + YEREYMQGVLIRE I S    SH+   +     KEVR  S +   +G  +YYLML
Sbjct  298   KNRIVYEREYMQGVLIRETIMSSVDRSHKI--KPPLRPKEVRARSLLTFLRGEHNYYLML  355

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDFG+ AR KM+FPR GS  TPPH+SIDF WKDYCP+
Sbjct  356   NLQLGIRYTVGKITPVPRREVRASDFGKNARTKMFFPRDGSNFTPPHKSIDFSWKDYCPM  415

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSEL+VL
Sbjct  416   VFRNLREMFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYLSHDDRFVIKTLKKSELQVL  475

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L+MLP YY+HV DHENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGS
Sbjct  476   LRMLPKYYEHVGDHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGS  535

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             S GRFT+K KI E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES +IIDYSLLLG
Sbjct  536   SQGRFTEKTKIHEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCSFLESLNIIDYSLLLG  595

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHEPSIVSTAPGP  2529
             LHFRAP  L  +LEPP+ +   + ++ S D G    +SI P+ L LVTHEP+ V+TAPGP
Sbjct  596   LHFRAPGQLNDILEPPNEM-SDQESVSSVDVGLTQELSIPPKGLLLVTHEPNSVNTAPGP  654

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGRLRV  2616
             HIRG TLRA SVG++EVDL+LPGT RL +
Sbjct  655   HIRGSTLRAFSVGEQEVDLILPGTARLLI  683



>ref|XP_006392101.1| hypothetical protein EUTSA_v10023316mg [Eutrema salsugineum]
 gb|ESQ29387.1| hypothetical protein EUTSA_v10023316mg [Eutrema salsugineum]
Length=671

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/703 (59%), Positives = 500/703 (71%), Gaps = 54/703 (8%)
 Frame = +1

Query  817   FSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWK  996
              +S DGSVY G W+MN++HG+GRKEY NSD YDG WKEGV+DG G YTW NGN + G WK
Sbjct  1     MTSPDGSVYSGAWRMNVRHGLGRKEYCNSDSYDGSWKEGVQDGSGSYTWINGNRFLGNWK  60

Query  997   KGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVG  1176
             KG MSGRGVM W NGDLF+GFW++GLRHGSG Y++ADG +YFGTWS GLKDG G  YP G
Sbjct  61    KGKMSGRGVMSWANGDLFNGFWLNGLRHGSGVYKYADGGFYFGTWSRGLKDGNGVFYPAG  120

Query  1177  CALDKCKIDGHKEI------RRMLSHDSSISKKDAVKPK-VKRSISE-KIVDRFARDSGR  1332
                   K   H+          +LSHDSSI+  +    K V RS+SE        R+SGR
Sbjct  121   SKHPSLK-KWHRSFGYDDTGNFVLSHDSSINLDELRASKAVSRSLSEITTTSGLTRNSGR  179

Query  1333  ISRRAVSVAGDAALHCSSTEVLPED-----ASCMLSHTTCDGKAEQLGNITVAYEREYMQ  1497
             +S R +           ST   P D      S     +   G++E      + +EREYMQ
Sbjct  180   MSERFLD-------ENWSTSDPPRDFMHHGPSSKSVRSVDSGQSEARDKNPIVFEREYMQ  232

Query  1498  GVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGK  1677
             GVLI+ERI S   +SH++    +   KE+  G+CM    G+ +YYLMLNLQLGIRY+VGK
Sbjct  233   GVLIKERIMSSIDMSHRARPLDR--TKEITIGACMSFLGGKWNYYLMLNLQLGIRYTVGK  290

Query  1678  ITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLN  1857
             ITP+P REVR SDFG++ARI M+FP+ GS+ TPPH+SIDF WKDYCP+VFRNLR +FKL+
Sbjct  291   ITPVPRREVRASDFGKRARIMMFFPKNGSQYTPPHKSIDFDWKDYCPMVFRNLREMFKLD  350

Query  1858  AADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVK  2037
             AADYMMSIC DDGLRE+ SPGKSGSIFYLS DDRFVIKTLK+SELKVLL+MLP YY+HV 
Sbjct  351   AADYMMSICGDDGLREISSPGKSGSIFYLSHDDRFVIKTLKRSELKVLLRMLPRYYEHVG  410

Query  2038  DHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIE  2217
             DHENTLITKFFGV+R+ L+  KKVRFVVMGNMF TEL +H RYDLKGSS GRFT+K K+ 
Sbjct  411   DHENTLITKFFGVHRLKLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSSQGRFTEKKKMG  470

Query  2218  EGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTAL  2397
             E TT+KDLDL YE  MDKLL E L                          F+AP+ L  +
Sbjct  471   EKTTMKDLDLAYEFHMDKLLREAL--------------------------FKAPDQLNDI  504

Query  2398  LEPPDSLFKPKSTLVSSDGGI----SILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSV  2565
             LEPP+++   ++  VSS   +    SI P+ L LVTHEPS V+TAPGPHIRG TLRA SV
Sbjct  505   LEPPNAMSDQENDSVSSVEVMPREPSIPPKGLLLVTHEPSSVNTAPGPHIRGSTLRAFSV  564

Query  2566  GDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPS-EVELFEVYDVVLYLGIIDIL  2742
             G++EVDL+LPGT RLRVQLGVNMPAQA+ KV+QDE + S  VELFEVYDVV+Y+GIIDIL
Sbjct  565   GEKEVDLILPGTARLRVQLGVNMPAQAHHKVRQDEEEESGMVELFEVYDVVVYMGIIDIL  624

Query  2743  QAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             Q YNM+K++EH  KS++ DPM+IS IEP LYSKRF  FL +VF
Sbjct  625   QEYNMKKRMEHTCKSMKHDPMTISAIEPTLYSKRFTDFLLKVF  667


 Score = 80.9 bits (198),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 62/113 (55%), Gaps = 0/113 (0%)
 Frame = +1

Query  619  PNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEGY  798
            P+G VY G ++  + HG G+    +  +YDG W+EG   G G   W +G  + G+  +G 
Sbjct  4    PDGSVYSGAWRMNVRHGLGRKEYCNSDSYDGSWKEGVQDGSGSYTWINGNRFLGNWKKGK  63

Query  799  LHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
            + G G  S ++G ++ G W   ++HG G  +Y +   Y G W  G++DG+G +
Sbjct  64   MSGRGVMSWANGDLFNGFWLNGLRHGSGVYKYADGGFYFGTWSRGLKDGNGVF  116


 Score = 67.4 bits (163),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            K + N D Y G +K  +  G G YT  +G  + G+W++GKM+G+G + W++G  ++G   
Sbjct  24   KEYCNSDSYDGSWKEGVQDGSGSYTWINGNRFLGNWKKGKMSGRGVMSWANGDLFNGFWL  83

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             G  HG G +  +DG  Y G W   ++ G G
Sbjct  84   NGLRHGSGVYKYADGGFYFGTWSRGLKDGNG  114



>gb|KHN26677.1| Phosphatidylinositol-4-phosphate 5-kinase 8 [Glycine soja]
Length=638

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/639 (61%), Positives = 482/639 (75%), Gaps = 20/639 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R DEK F NGDVYIGM KG+LPH KGKYT SDGT ++G+WE  KMTGKG I+WSSGA Y+
Sbjct  7     RFDEKSFSNGDVYIGMIKGILPHDKGKYTWSDGTVFEGNWEGEKMTGKGLIVWSSGAQYE  66

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GYL G+GT ++S G +Y+G W+MN QHG+GRK+Y NSDVY+G WKEGV +G GRY
Sbjct  67    GEISGGYLDGYGTLTTSAGCIYRGGWRMNAQHGIGRKQYSNSDVYEGLWKEGVHEGSGRY  126

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGNMY G WK G + GRGVMKW NGD FDG W++GL HGSG YRF DG  Y G W+ 
Sbjct  127   TWNNGNMYVGNWKNGKIDGRGVMKWVNGDTFDGLWLNGLMHGSGVYRFGDGGLYIGAWNK  186

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEIRRMLS-HDS-------SISKKDAVKPKVKRSIS  1293
             GLKDG+G  YP G          H  ++++ S HDS       ++ K++A K +VKRS+S
Sbjct  187   GLKDGKGVFYPAGSK--------HPSLKKLHSPHDSDHNGFLLNVEKQEAPKARVKRSLS  238

Query  1294  EK--IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNI  1467
             E   ++ RF +   +IS R  S+  +   + S+ + +  D+S  LS+   D ++E     
Sbjct  239   ENMPVISRF-KSFRQISHRTSSLKINLIRNDSAQDCVCHDSSLPLSNAVDDDQSEASSES  297

Query  1468  TVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNL  1647
             T+ YEREY+QGVLI ERI      S +  Q+ KF  K+V+K SC+D+F+GR+SYYL LNL
Sbjct  298   TLVYEREYVQGVLIMERISECSESSRRKKQQNKFSVKQVKKSSCLDIFEGRQSYYLKLNL  357

Query  1648  QLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVF  1827
             QLGIRY+VGKITP+P REVR SDFG++ARI+MYFPR GS+LTPPH SI+FYWKDYCP+VF
Sbjct  358   QLGIRYTVGKITPVPAREVRSSDFGDRARIRMYFPRAGSKLTPPHCSINFYWKDYCPMVF  417

Query  1828  RNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLK  2007
             RNLR +F+L+AA+YMMSIC D GLR+L SPGKSGSIFYLS DDRFVIKT+ KSELKVLL 
Sbjct  418   RNLREMFRLDAAEYMMSICGDSGLRDLSSPGKSGSIFYLSKDDRFVIKTVNKSELKVLLN  477

Query  2008  MLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSL  2187
             MLP YY+HV DHENTLITKFFG+++I+LR  KKVRFVVMGN+F TEL +H RYDLKGSS 
Sbjct  478   MLPKYYRHVGDHENTLITKFFGLHQITLRGGKKVRFVVMGNVFCTELQIHRRYDLKGSSQ  537

Query  2188  GRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLH  2367
             GR+T+ DKI   TTLKDLDL YE +MDK L E+L+KQ+SLD +FLESQHIIDYSLLLGLH
Sbjct  538   GRYTNNDKINCNTTLKDLDLKYEFQMDKKLRESLLKQISLDCKFLESQHIIDYSLLLGLH  597

Query  2368  FRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLT  2484
             FRAPE++ A +E  +S+ + +S L S DGG S L   +T
Sbjct  598   FRAPENMKAFVEHHESVQRQES-LPSGDGGNSALSPQIT  635



>ref|XP_011006537.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X4 [Populus euphratica]
Length=648

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/649 (61%), Positives = 473/649 (73%), Gaps = 33/649 (5%)
 Frame = +1

Query  574   VIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQII  753
             ++ +E++E  D+K   NG+VYIG+FKG LPHGKGKY   DGT Y GDWEEGKMTGKGQI+
Sbjct  7     LLDIEDSESIDKKALSNGEVYIGIFKGTLPHGKGKYIWCDGTVYKGDWEEGKMTGKGQIL  66

Query  754   WSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEG  933
             WSSGA Y+GD   GYLHG GT    DGS Y+G W+MN +HG+GRK+Y N DVY+G WKEG
Sbjct  67    WSSGAKYEGDFSGGYLHGIGTLIGHDGSEYRGAWRMNARHGLGRKQYSNLDVYEGSWKEG  126

Query  934   VRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGS  1113
             +R+G G+Y+W+NGN Y G WK G + GRGVMKW NGDLFDGFW++GLRHGSG YRFADG 
Sbjct  127   MREGCGKYSWNNGNTYMGNWKGGKICGRGVMKWENGDLFDGFWINGLRHGSGVYRFADGG  186

Query  1114  YYFGTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSH---------------DSSI  1248
             YYFG WS GLKDG+GT Y  G          H  +RR  S                  + 
Sbjct  187   YYFGMWSMGLKDGKGTFYSAGTK--------HPSLRRWCSSLGCYESGRNLLSHSSSLNS  238

Query  1249  SKKDAVKPKVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLS  1425
              K   + P   RS+SE++ ++   +DSGR S   VS+  +++     +E +  + SCMLS
Sbjct  239   EKTRVLIPNDMRSLSERMSINGIFKDSGRFSLGTVSLDENSSRCSLGSEFICREPSCMLS  298

Query  1426  HTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMD  1605
              T+ +G+     N TV YEREYMQGVL  E++K+ +  S ++ QR KF  K  ++ S +D
Sbjct  299   QTSDEGQRGVQDNCTVVYEREYMQGVLKNEKVKNTEP-SRKTKQRNKFDVKVTKRKSYVD  357

Query  1606  LFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHR  1785
             +F+G  SYYLML+LQLGIRY+VGKITP+PMR  R SDFG++ARI+MYFPRKGS+ TPPH 
Sbjct  358   IFQGHWSYYLMLSLQLGIRYTVGKITPVPMRGARDSDFGDRARIRMYFPRKGSQFTPPHY  417

Query  1786  SIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFV  1965
             SIDFYWKDYCP+VFRNLR +FKL+AA+YMMSIC DDGL EL S GKSGSIF+LS DDRFV
Sbjct  418   SIDFYWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLTELPSSGKSGSIFFLSHDDRFV  477

Query  1966  IKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTE  2145
             IKTLKK ELK LLKMLP YY HV  HENTLITK FGV+RI+LR  KKVRFVVMGNMF TE
Sbjct  478   IKTLKKFELKTLLKMLPEYYDHVGKHENTLITKIFGVHRITLRGGKKVRFVVMGNMFCTE  537

Query  2146  LHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIK-------QLS  2304
             L +H RYDLKGS+ GR+TDKDK+ E TTLKDLDL YE  MDKLL E+L K       QLS
Sbjct  538   LRIHDRYDLKGSTQGRYTDKDKVGENTTLKDLDLAYEFHMDKLLRESLFKNTFLLCRQLS  597

Query  2305  LDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSD  2451
             LD  FLESQ IIDYSLLLG+HFRAPE L A+LEPP ++    +TL +SD
Sbjct  598   LDCSFLESQQIIDYSLLLGIHFRAPEQLRAILEPPATMLN-HATLATSD  645



>ref|XP_011006536.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X3 [Populus euphratica]
Length=649

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/649 (61%), Positives = 473/649 (73%), Gaps = 33/649 (5%)
 Frame = +1

Query  574   VIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQII  753
             ++ +E++E  D+K   NG+VYIG+FKG LPHGKGKY   DGT Y GDWEEGKMTGKGQI+
Sbjct  7     LLDIEDSESIDKKALSNGEVYIGIFKGTLPHGKGKYIWCDGTVYKGDWEEGKMTGKGQIL  66

Query  754   WSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEG  933
             WSSGA Y+GD   GYLHG GT    DGS Y+G W+MN +HG+GRK+Y N DVY+G WKEG
Sbjct  67    WSSGAKYEGDFSGGYLHGIGTLIGHDGSEYRGAWRMNARHGLGRKQYSNLDVYEGSWKEG  126

Query  934   VRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGS  1113
             +R+G G+Y+W+NGN Y G WK G + GRGVMKW NGDLFDGFW++GLRHGSG YRFADG 
Sbjct  127   MREGCGKYSWNNGNTYMGNWKGGKICGRGVMKWENGDLFDGFWINGLRHGSGVYRFADGG  186

Query  1114  YYFGTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSH---------------DSSI  1248
             YYFG WS GLKDG+GT Y  G          H  +RR  S                  + 
Sbjct  187   YYFGMWSMGLKDGKGTFYSAGTK--------HPSLRRWCSSLGCYESGRNLLSHSSSLNS  238

Query  1249  SKKDAVKPKVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLS  1425
              K   + P   RS+SE++ ++   +DSGR S   VS+  +++     +E +  + SCMLS
Sbjct  239   EKTRVLIPNDMRSLSERMSINGIFKDSGRFSLGTVSLDENSSRCSLGSEFICREPSCMLS  298

Query  1426  HTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMD  1605
              T+ +G+     N TV YEREYMQGVL  E++K+ +  S ++ QR KF  K  ++ S +D
Sbjct  299   QTSDEGQRGVQDNCTVVYEREYMQGVLKNEKVKNTEP-SRKTKQRNKFDVKVTKRKSYVD  357

Query  1606  LFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHR  1785
             +F+G  SYYLML+LQLGIRY+VGKITP+PMR  R SDFG++ARI+MYFPRKGS+ TPPH 
Sbjct  358   IFQGHWSYYLMLSLQLGIRYTVGKITPVPMRGARDSDFGDRARIRMYFPRKGSQFTPPHY  417

Query  1786  SIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFV  1965
             SIDFYWKDYCP+VFRNLR +FKL+AA+YMMSIC DDGL EL S GKSGSIF+LS DDRFV
Sbjct  418   SIDFYWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLTELPSSGKSGSIFFLSHDDRFV  477

Query  1966  IKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTE  2145
             IKTLKK ELK LLKMLP YY HV  HENTLITK FGV+RI+LR  KKVRFVVMGNMF TE
Sbjct  478   IKTLKKFELKTLLKMLPEYYDHVGKHENTLITKIFGVHRITLRGGKKVRFVVMGNMFCTE  537

Query  2146  LHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIK-------QLS  2304
             L +H RYDLKGS+ GR+TDKDK+ E TTLKDLDL YE  MDKLL E+L K       QLS
Sbjct  538   LRIHDRYDLKGSTQGRYTDKDKVGENTTLKDLDLAYEFHMDKLLRESLFKNTFLLCRQLS  597

Query  2305  LDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSD  2451
             LD  FLESQ IIDYSLLLG+HFRAPE L A+LEPP ++    +TL +SD
Sbjct  598   LDCSFLESQQIIDYSLLLGIHFRAPEQLRAILEPPATMLN-HATLATSD  645



>gb|EEE59762.1| hypothetical protein OsJ_12252 [Oryza sativa Japonica Group]
Length=779

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/774 (52%), Positives = 519/774 (67%), Gaps = 38/774 (5%)
 Frame = +1

Query  610   KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
                PNGD+Y+G F G++PHG GKY  +DG  YDG+W++ KMTG+G I W SGA+Y+GD  
Sbjct  20    NTLPNGDIYVGSFDGLVPHGPGKYMWTDGALYDGEWDKSKMTGRGLIQWPSGASYEGDFR  79

Query  790   EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSN  969
              G++ G GTF   DGSVYKG W+MN +HG+G   Y NSD Y+G W EG+ D  G+YTW++
Sbjct  80    GGFIDGAGTFKGVDGSVYKGSWRMNKKHGMGTMVYSNSDTYEGFWNEGLPDEFGKYTWAD  139

Query  970   GNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKD  1149
             GN+Y G WK G M+G GVM+W NGD  D  W++GL HG G  ++A G+ Y GTW  GLKD
Sbjct  140   GNVYIGRWKSGKMNGSGVMQWINGDTLDCNWLNGLAHGKGYCKYASGACYIGTWDRGLKD  199

Query  1150  GRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKV--------KRSISEKIV  1305
             G GT Y  G      KI  + E+   L+     S   +   K+        ++      +
Sbjct  200   GHGTFYQPGS-----KIPCNLEVSDCLTSHDGTSASSSSNEKITIGLLFLLQKLCKNWRL  254

Query  1306  DRFARDSGRISRRAVSV----AGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
              RF     RIS     V    +G       S++    D  C L  +  D  +        
Sbjct  255   RRFLHRPRRISNGTTPVFDDNSGSHLCQDVSSKSFSADDQC-LQDSEVDKDS--------  305

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
              YEREY+QGVLI E+ K+ D    +S   ++   ++  KG    ++KG +SYYLMLNLQL
Sbjct  306   VYEREYVQGVLIMEQPKNEDSRMSESGIAQENNWEKQAKGPMETIYKGHRSYYLMLNLQL  365

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P+REVR +DFG +ARIKMYFP +GS+ TPPH S+DF+WKDYCP+VFRN
Sbjct  366   GIRYTVGKITPVPLREVRSNDFGPRARIKMYFPCEGSQYTPPHYSVDFFWKDYCPMVFRN  425

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +F ++AADYMMSIC  D L+EL SPGKSGSIFYLS D+RFVIKTL+K+ELK+LLKML
Sbjct  426   LREMFHIDAADYMMSICGGDSLKELSSPGKSGSIFYLSQDERFVIKTLRKTELKILLKML  485

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YY HVK ++NTLITKFFGV+RI+L+  +KVRFVVMGNMF TEL +H +YDLKGS+ GR
Sbjct  486   PKYYNHVKAYDNTLITKFFGVHRITLKPGRKVRFVVMGNMFCTELRIHRKYDLKGSTQGR  545

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
              T K  I E TTLKDLDL Y   +DK   E L +Q++LD  FLESQ IIDYS+LLG+HFR
Sbjct  546   STKKQNINENTTLKDLDLSYVFHVDKPWREALFRQIALDCMFLESQSIIDYSMLLGIHFR  605

Query  2374  APEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTA--PGP-----H  2532
             AP HL  +    ++L   +ST +S++   S+       ++ +  ++  A  PGP     H
Sbjct  606   APNHLKRITSCQNAL---ESTGISAETECSVALHHEETISSKGFLLVAADEPGPAVRGSH  662

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQD-ETDPSEVELFEVYD  2709
             IRG  +RA   G  EVDL+LPGTGR RVQLGVNMPA+A RKV++D   +    +  E YD
Sbjct  663   IRGSMVRAAEGGYEEVDLVLPGTGRFRVQLGVNMPARA-RKVQEDVNVEVENRDTIEEYD  721

Query  2710  VVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VVLYLGIIDILQ YN+ K++EH  KSL+FDP+SIS ++P LYS+RFISFLE+VF
Sbjct  722   VVLYLGIIDILQEYNVSKRVEHAVKSLKFDPLSISAVDPNLYSRRFISFLEKVF  775



>ref|XP_008802079.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform 
X4 [Phoenix dactylifera]
Length=724

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/691 (59%), Positives = 492/691 (71%), Gaps = 13/691 (2%)
 Frame = +1

Query  586   ENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSG  765
             E++ER  EKV PNGDVY+G F G+ PHG GKY  SDGT Y+G+WE+ KMTG+G+I W SG
Sbjct  13    EDSERHREKVLPNGDVYVGNFDGLFPHGTGKYIWSDGTLYEGEWEKSKMTGRGRIYWPSG  72

Query  766   ATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDG  945
             ATY+GD   G+LHG GTF   DGSVYKG W+MNIQHG+G K Y NS +Y+G WKEG+++G
Sbjct  73    ATYEGDICGGFLHGSGTFYGLDGSVYKGSWRMNIQHGMGTKTYPNSGIYEGLWKEGLQEG  132

Query  946   HGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFG  1125
              GRYTWSN N Y G WK G MSGRGVMKW NGDLFDG W+DGL+HGSG Y++ADG+YYFG
Sbjct  133   IGRYTWSNRNTYIGNWKAGKMSGRGVMKWENGDLFDGVWLDGLKHGSGYYKYADGAYYFG  192

Query  1126  TWSNGLKDGRGTLYPVGCALDKCKI-------DGHKEIRRMLSHDSSISKKDAVKPKVKR  1284
             TWS GLKDGRG  Y  G  L K K        DG + +    S  SS   ++    K + 
Sbjct  193   TWSRGLKDGRGIFYAAGSKLPKQKFSESVVCNDGAQSLCPA-SLMSSEGLRNKPLHKKRY  251

Query  1285  SISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
             S        +   SGRIS R VS  G   L  S+  VL +D+S  LS ++ +G+ +   +
Sbjct  252   SFDGWNTSSYFCRSGRISHRPVSFEGIWNLSDSAGSVLSQDSSLTLSSSSDEGQHKLQHD  311

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLN  1644
               + YEREY QG+LI ER +S D    + T+      ++   G    + KG KSYYLMLN
Sbjct  312   NVLVYEREYAQGILIMERTRSSDSGVKRKTKWHHKIQRKQPSGPGEAIHKGHKSYYLMLN  371

Query  1645  LQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIV  1824
             LQLGIRY+VGKITP+PMREVR SDFG +ARI+MYFP KGS+ TPPH SIDF+WKDYCP+V
Sbjct  372   LQLGIRYTVGKITPVPMREVRSSDFGPRARIQMYFPSKGSQFTPPHHSIDFFWKDYCPMV  431

Query  1825  FRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLL  2004
             FRNLR +FK++AADYMMSIC  D L+EL SPGKSGSIFYLS D+RFVIKTL+K ELK+LL
Sbjct  432   FRNLREMFKIDAADYMMSICGGDDLKELSSPGKSGSIFYLSQDERFVIKTLRKYELKILL  491

Query  2005  KMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSS  2184
             KMLP YY HV  ++NTLITKFFG++ I+++  +KVRFVVMGNMF T LH+H RYDLKGSS
Sbjct  492   KMLPKYYNHVGIYDNTLITKFFGLHTITIKGVRKVRFVVMGNMFCTGLHIHRRYDLKGSS  551

Query  2185  LGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGL  2364
              GR T K  I E TTLKDLDL Y   +++   ++L +Q+SLD  FLESQ IIDYS+LLGL
Sbjct  552   QGRSTSKHNINENTTLKDLDLSYVFHLERSWRDSLFRQISLDCMFLESQCIIDYSMLLGL  611

Query  2365  HFRAPEHLTALLEPPDSLFKPKSTLVS-----SDGGISILPRSLTLVTHEPSIVSTAPGP  2529
             HFRAPEHL ALLE   +L    S+  +     S   +++ P+ L LV HEP  VST PG 
Sbjct  612   HFRAPEHLKALLECQHTLQNSSSSQANNSDEPSQDEVTVPPKGLLLVAHEPGSVSTMPGS  671

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGRLRVQL  2622
             HIRG TLRA++VGD EVDL+LPGTGR   QL
Sbjct  672   HIRGSTLRASAVGDEEVDLILPGTGRFTAQL  702



>ref|NP_001051005.1| Os03g0701800 [Oryza sativa Japonica Group]
 emb|CAD67588.1| phosphatidylinositol 4-phosphate 5-kinase [Oryza sativa Japonica 
Group]
 gb|AAX95508.1| Putative Phosphatidylinositol-4-phosphate 5-Kinase [Oryza sativa 
Japonica Group]
 gb|ABF98412.1| Phosphatidylinositol-4-phosphate 5-kinase 1 precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12919.1| Os03g0701800 [Oryza sativa Japonica Group]
Length=792

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/774 (52%), Positives = 519/774 (67%), Gaps = 38/774 (5%)
 Frame = +1

Query  610   KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
                PNGD+Y+G F G++PHG GKY  +DG  YDG+W++ KMTG+G I W SGA+Y+GD  
Sbjct  33    NTLPNGDIYVGSFDGLVPHGPGKYMWTDGALYDGEWDKSKMTGRGLIQWPSGASYEGDFR  92

Query  790   EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSN  969
              G++ G GTF   DGSVYKG W+MN +HG+G   Y NSD Y+G W EG+ D  G+YTW++
Sbjct  93    GGFIDGAGTFKGVDGSVYKGSWRMNKKHGMGTMVYSNSDTYEGFWNEGLPDEFGKYTWAD  152

Query  970   GNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKD  1149
             GN+Y G WK G M+G GVM+W NGD  D  W++GL HG G  ++A G+ Y GTW  GLKD
Sbjct  153   GNVYIGRWKSGKMNGSGVMQWINGDTLDCNWLNGLAHGKGYCKYASGACYIGTWDRGLKD  212

Query  1150  GRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKV--------KRSISEKIV  1305
             G GT Y  G      KI  + E+   L+     S   +   K+        ++      +
Sbjct  213   GHGTFYQPGS-----KIPCNLEVSDCLTSHDGTSASSSSNEKITIGLLFLLQKLCKNWRL  267

Query  1306  DRFARDSGRISRRAVSV----AGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
              RF     RIS     V    +G       S++    D  C L  +  D  +        
Sbjct  268   RRFLHRPRRISNGTTPVFDDNSGSHLCQDVSSKSFSADDQC-LQDSEVDKDS--------  318

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
              YEREY+QGVLI E+ K+ D    +S   ++   ++  KG    ++KG +SYYLMLNLQL
Sbjct  319   VYEREYVQGVLIMEQPKNEDSRMSESGIAQENNWEKQAKGPMETIYKGHRSYYLMLNLQL  378

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P+REVR +DFG +ARIKMYFP +GS+ TPPH S+DF+WKDYCP+VFRN
Sbjct  379   GIRYTVGKITPVPLREVRSNDFGPRARIKMYFPCEGSQYTPPHYSVDFFWKDYCPMVFRN  438

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +F ++AADYMMSIC  D L+EL SPGKSGSIFYLS D+RFVIKTL+K+ELK+LLKML
Sbjct  439   LREMFHIDAADYMMSICGGDSLKELSSPGKSGSIFYLSQDERFVIKTLRKTELKILLKML  498

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YY HVK ++NTLITKFFGV+RI+L+  +KVRFVVMGNMF TEL +H +YDLKGS+ GR
Sbjct  499   PKYYNHVKAYDNTLITKFFGVHRITLKPGRKVRFVVMGNMFCTELRIHRKYDLKGSTQGR  558

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
              T K  I E TTLKDLDL Y   +DK   E L +Q++LD  FLESQ IIDYS+LLG+HFR
Sbjct  559   STKKQNINENTTLKDLDLSYVFHVDKPWREALFRQIALDCMFLESQSIIDYSMLLGIHFR  618

Query  2374  APEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTA--PGP-----H  2532
             AP HL  +    ++L   +ST +S++   S+       ++ +  ++  A  PGP     H
Sbjct  619   APNHLKRITSCQNAL---ESTGISAETECSVALHHEETISSKGFLLVAADEPGPAVRGSH  675

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQD-ETDPSEVELFEVYD  2709
             IRG  +RA   G  EVDL+LPGTGR RVQLGVNMPA+A RKV++D   +    +  E YD
Sbjct  676   IRGSMVRAAEGGYEEVDLVLPGTGRFRVQLGVNMPARA-RKVQEDVNVEVENRDTIEEYD  734

Query  2710  VVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VVLYLGIIDILQ YN+ K++EH  KSL+FDP+SIS ++P LYS+RFISFLE+VF
Sbjct  735   VVLYLGIIDILQEYNVSKRVEHAVKSLKFDPLSISAVDPNLYSRRFISFLEKVF  788



>ref|XP_004982061.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Setaria 
italica]
Length=767

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/761 (53%), Positives = 518/761 (68%), Gaps = 21/761 (3%)
 Frame = +1

Query  613   VFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFE  792
               PNGD+Y+G F G++PHG GKY  +DGT Y G+W+  KMTG+G+I W SGA+YDGD   
Sbjct  16    TLPNGDIYVGNFAGLVPHGFGKYMWTDGTLYYGEWDTSKMTGRGEIQWPSGASYDGDLCG  75

Query  793   GYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNG  972
             G++ G GTF   DGS+YKG W+MN +HG+G   Y NSD Y+G W EG+ DG G+YTW++G
Sbjct  76    GFIDGTGTFKGVDGSLYKGSWRMNKKHGMGTMVYANSDTYEGFWNEGLPDGFGKYTWADG  135

Query  973   NMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDG  1152
             N Y G WK G M+GRGVMKW NGD  D  W++GL HG G  +++ G+ Y GTW  GLKDG
Sbjct  136   NTYIGRWKSGKMNGRGVMKWTNGDTLDCNWLNGLAHGKGFCKYSSGACYIGTWDRGLKDG  195

Query  1153  RGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKV-----KRSISEKIVDRFA  1317
              G  Y  G  +  C ++  + +       +S S  + V   +     K   + +I   F 
Sbjct  196   HGMFYQPGSKM-PCNLEVSECVTDHDVSSASSSGNENVNSGLLFLLQKLCNTWRIRSLFH  254

Query  1318  RDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQ  1497
             R   RIS     V  D     +S   L ED+S  +  TT +   + + +  + YEREY+Q
Sbjct  255   RPR-RISNGTAPVFDD-----NSGNRLSEDSST-VPLTTGECLQDNVADKVLVYEREYVQ  307

Query  1498  GVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGK  1677
             GVLI E+ K  D     S++      ++   G    +++G +SYYLMLNLQLGIRY+VGK
Sbjct  308   GVLISEKPKGHDSGMPDSSKSHDQTLQKQAGGPMETIYRGHRSYYLMLNLQLGIRYTVGK  367

Query  1678  ITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLN  1857
             ITP+P+REVR +DFG +ARI+MYFP +GS+ TPPH S++F+WKDYCP+VFRNLR +F ++
Sbjct  368   ITPVPLREVRSNDFGPRARIRMYFPSEGSQYTPPHCSVNFFWKDYCPMVFRNLREMFHID  427

Query  1858  AADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVK  2037
             AADYMMS+C DD L+EL SPGKSGSIFYLS D+RFVIKTL+K+ELK+LLKMLP YY HV+
Sbjct  428   AADYMMSLCGDDSLKELSSPGKSGSIFYLSQDERFVIKTLRKAELKILLKMLPKYYNHVR  487

Query  2038  DHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIE  2217
              ++NTLITKFFGV+RI+L+  +KVRFVVMGNMF TEL +H +YDLKGS+ GR T K  I 
Sbjct  488   AYDNTLITKFFGVHRITLKGGRKVRFVVMGNMFCTELRIHRKYDLKGSTQGRSTKKQNIN  547

Query  2218  EGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTAL  2397
             E TTLKDLDL Y   +DK   + LI+Q+SLD  FLESQ IIDYS+LLG+HFRAP HL   
Sbjct  548   ENTTLKDLDLSYVFHVDKPWRDALIRQISLDCMFLESQSIIDYSMLLGIHFRAPSHLKTS  607

Query  2398  LEPPDSLFK--PKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGD  2571
                 +SL      + L+  +   S   +   LV HEP   +T  G HIRG  +RA+  G 
Sbjct  608   SSHQNSLESGISDTDLLQYEEKSSW--KGFLLVAHEPG--TTVGGSHIRGSMVRASEAGY  663

Query  2572  REVDLLLPGTGRLRVQLGVNMPAQANRKVKQD-ETDPSEVELFEVYDVVLYLGIIDILQA  2748
              EVDL+LPGTGR RVQLGVNMPA+A  KV++D  T+    +  E YDVVLYLGIIDILQ 
Sbjct  664   EEVDLVLPGTGRFRVQLGVNMPARA-LKVREDMNTELENPDNIEEYDVVLYLGIIDILQE  722

Query  2749  YNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             YN+ K++EH  KSL+FDP+SIS ++P  Y+KRF+ FLE VF
Sbjct  723   YNVSKRVEHAVKSLKFDPLSISAVDPSSYAKRFVKFLESVF  763



>gb|EEC76018.1| hypothetical protein OsI_13176 [Oryza sativa Indica Group]
Length=792

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/774 (52%), Positives = 520/774 (67%), Gaps = 38/774 (5%)
 Frame = +1

Query  610   KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
                PNGD+Y+G F G++PHG GKY  +DG  YDG+W++ KMTG+G I W SGA+Y+GD  
Sbjct  33    NTLPNGDIYVGSFDGLVPHGPGKYMWTDGALYDGEWDKSKMTGRGLIQWPSGASYEGDFR  92

Query  790   EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSN  969
              G++ G GTF   DGSVYKG W+MN +HG+G   Y NSD Y+G W EG+ D  G+YTW++
Sbjct  93    GGFIDGAGTFKGVDGSVYKGSWRMNKKHGMGTMVYSNSDTYEGFWNEGLPDEFGKYTWAD  152

Query  970   GNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKD  1149
             GN+Y G WK G M+G GVM+W NGD  D  W++GL HG G  ++A G+ Y GTW  GLKD
Sbjct  153   GNVYIGRWKSGKMNGSGVMQWINGDTLDCNWLNGLAHGKGYCKYASGACYIGTWDRGLKD  212

Query  1150  GRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKV--------KRSISEKIV  1305
             G GT Y  G      KI  + E+   L+     S   +   K+        ++      +
Sbjct  213   GHGTFYQPGS-----KIPCNLEVSDCLTSHDGTSASSSSNEKITIGLLFLLQKLCKNWRL  267

Query  1306  DRFARDSGRISRRAVSV----AGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
              RF     RIS     V    +G       S++    D  C L  +  D  +        
Sbjct  268   RRFLHRPRRISNGTTPVFDDNSGSHLCQDVSSKSFSADDQC-LQDSEVDKDS--------  318

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
              YEREY+QGVLI E+ K+ D    +S   ++   ++  KG    ++KG +SYYLMLNLQL
Sbjct  319   VYEREYVQGVLIMEQPKNEDSRMSESGIAQENNWEKQAKGPMETIYKGHRSYYLMLNLQL  378

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P+REVR +DFG +ARIKMYFP +GS+ TPPH S+DF+WKDYCP+VFRN
Sbjct  379   GIRYTVGKITPVPLREVRSNDFGPRARIKMYFPCEGSQYTPPHYSVDFFWKDYCPMVFRN  438

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR +F ++AADYMMSIC  D L+EL SPGKSGSIFYLS D+RFVIKTL+K+ELK+LLKML
Sbjct  439   LREMFHIDAADYMMSICGGDSLKELSSPGKSGSIFYLSQDERFVIKTLRKTELKILLKML  498

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             P YY HVK ++NTLITKFFGV+RI+L+  +KVRFVVMGNMF TEL +H +YDLKGS+ GR
Sbjct  499   PKYYNHVKAYDNTLITKFFGVHRITLKPGRKVRFVVMGNMFCTELRIHRKYDLKGSTQGR  558

Query  2194  FTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
              T K  I E TTLKDLDL Y   +DK   E L +Q++LD  FLESQ IIDYS+LLG+HFR
Sbjct  559   STKKQNINENTTLKDLDLSYVFHVDKPWREALFRQIALDCMFLESQSIIDYSMLLGIHFR  618

Query  2374  APEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTA--PGP-----H  2532
             AP HL ++    ++L   ++T +S++   S+       ++ +  ++  A  PGP     H
Sbjct  619   APNHLKSITSCQNAL---ETTGMSAETECSVALHHEETISSKGFLLVAADEPGPAVRGSH  675

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQD-ETDPSEVELFEVYD  2709
             IRG  +RA   G  EVDL+LPGTGR RVQLGVNMPA+A RKV++D   +    +  E YD
Sbjct  676   IRGSMVRAAEGGYEEVDLVLPGTGRFRVQLGVNMPARA-RKVQEDVNVEVENRDTIEEYD  734

Query  2710  VVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VVLYLGIIDILQ YN+ K++EH  KSL+FDP+SIS ++P LYS+RFISFLE+VF
Sbjct  735   VVLYLGIIDILQEYNVSKRVEHAVKSLKFDPLSISAVDPNLYSRRFISFLEKVF  788



>ref|XP_010231168.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-phosphate 
5-kinase 1-like [Brachypodium distachyon]
Length=774

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/782 (52%), Positives = 522/782 (67%), Gaps = 42/782 (5%)
 Frame = +1

Query  589   NNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGA  768
             N +R D    PNGDVY+G F G++PHG GKY  +DG  Y+G+W++ KMTG+G I W SGA
Sbjct  10    NTQRGD--TLPNGDVYVGNFDGLVPHGMGKYMWTDGALYEGEWDKSKMTGRGIIQWPSGA  67

Query  769   TYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGH  948
             +Y GD   G++ G GTF   DGSVYKG W+MN + G+G   Y NSD Y+G W EG+ DG 
Sbjct  68    SYVGDFRGGFIDGTGTFKGVDGSVYKGCWRMNKKQGMGTMVYSNSDTYEGLWNEGLPDGF  127

Query  949   GRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGT  1128
             G+YTWS GN+Y G WK GNM+GRGVM+W NGD  D  W++GL HG G  ++A G+ Y GT
Sbjct  128   GKYTWSAGNIYIGSWKSGNMNGRGVMQWINGDTLDCNWLNGLAHGKGYCKYASGACYIGT  187

Query  1129  WSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPK----VKRSISE  1296
             W  G+KDG G  Y  G  +  C ++  +         +S S  + V  +    ++   ++
Sbjct  188   WDRGVKDGHGIFYEPGSKI-PCNLEVSECATTRDGASASSSSNETVNVRLLFLLQNLCNK  246

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVA  1476
               + RF     RIS     +  D + +  S + LP  +     H       E   N  + 
Sbjct  247   WGLRRFFHRPKRISNGTTPIFYDDSRNHLSQD-LPNASLSGNEHL-----QENDVNKDLV  300

Query  1477  YEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLG  1656
             YEREY+QGVLI E+ K  D     S + ++   ++  +G    ++KG +SYYLMLNLQLG
Sbjct  301   YEREYVQGVLILEQPKGKDSGMLDSGETQENTWQKQARGPMETIYKGHRSYYLMLNLQLG  360

Query  1657  IRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNL  1836
             IRY+VGKITP+P+REVR +DFG +ARI+MYFP +GS+ TPPH S++F+WKDYCP+VFRNL
Sbjct  361   IRYTVGKITPVPLREVRSNDFGPRARIRMYFPVEGSQYTPPHCSVNFFWKDYCPMVFRNL  420

Query  1837  RRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELK-------  1995
             R +F ++AADYMMSIC  D L+EL SPGKSGSIFYLS D+RFVIKTL+KSELK       
Sbjct  421   REMFHIDAADYMMSICGGDSLKELSSPGKSGSIFYLSQDERFVIKTLRKSELKIGLMXCV  480

Query  1996  --VLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
               +LLKMLP YY HVK ++NTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H +YD
Sbjct  481   LQILLKMLPKYYNHVKAYDNTLITKFFGVHRITLKAGKKVRFVVMGNMFCTELRIHRKYD  540

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGS+ GR T K KI E TTLKDLDL +   +DK   E L +Q++LD  FLESQ IIDYS
Sbjct  541   LKGSTQGRSTKKQKINENTTLKDLDLSHAFHVDKPWREALFRQITLDCMFLESQSIIDYS  600

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISI--------LPRSLTLVTHEPS  2505
             +LLG+HFRAP HL  L    ++L   +S+  SS+   S+          + L LV HEP 
Sbjct  601   MLLGIHFRAPHHLKTLTSHQNTL---ESSGNSSEMDCSVPVHYEDINSTKGLLLVAHEPG  657

Query  2506  IVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSE  2685
               +T  G HIRG  +RA+  G  EVDL+LPGTGR RVQLGVNMPA+A + ++        
Sbjct  658   --TTVGGSHIRGSMVRASEGGYEEVDLVLPGTGRFRVQLGVNMPARARKLLES-------  708

Query  2686  VELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
              ++ E YDVVLYLGIIDILQ YNM K++EH  KSL+FDP+SIS ++P LYSKRF+ FL+R
Sbjct  709   TDMVEEYDVVLYLGIIDILQEYNMSKRVEHAVKSLKFDPLSISAVDPNLYSKRFVHFLDR  768

Query  2866  VF  2871
             VF
Sbjct  769   VF  770



>gb|EMS61702.1| Phosphatidylinositol-4-phosphate 5-kinase 1 [Triticum urartu]
Length=797

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/781 (52%), Positives = 518/781 (66%), Gaps = 49/781 (6%)
 Frame = +1

Query  589   NNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGA  768
             N +R D    PNGDVY+G F G++PHG GKY  +DG+ YDG+W++ KMTG+G I W SGA
Sbjct  42    NAQRGD--TLPNGDVYVGNFDGLVPHGMGKYMWTDGSLYDGEWDKSKMTGRGMIQWPSGA  99

Query  769   TYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGH  948
             +Y+GD   G++ G GTF   DGSVYKG W+MN + G+G   Y NSD Y+G W EG+ DG+
Sbjct  100   SYEGDFRGGFIDGTGTFKGVDGSVYKGSWRMNKKQGMGTMVYSNSDSYEGLWNEGLPDGY  159

Query  949   GRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGT  1128
             G+YTW+ GN+Y G WK G+M+GRGVM+W NGD  D  W+ GL HG G  ++A G+ Y GT
Sbjct  160   GKYTWAAGNIYIGSWKSGSMNGRGVMQWINGDTLDCNWLSGLAHGKGYCKYASGACYIGT  219

Query  1129  WSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVK-------RS  1287
             W  G+KDG G  Y  G      KI  + E+    + +   S   +   KVK       ++
Sbjct  220   WDRGVKDGHGIFYQPGS-----KIPCNLEVSECATDNDGTSASSSSNEKVKVGLLFLLQN  274

Query  1288  ISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
             +  K  + RF     RIS     +  D      S   LP+D              E L N
Sbjct  275   LCNKWGLRRFFHRPRRISNGTTPIFVD-----DSGNHLPQDPP-----NKSLSSKEHLQN  324

Query  1465  ITV----AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYY  1632
               V     YEREY+QGVLI E+ K        S + ++   ++  +G    ++KG +SY+
Sbjct  325   SDVHKDLVYEREYIQGVLISEQPKGKHSGMLDSGETQENTWQKQERGPMETIYKGHRSYF  384

Query  1633  LMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDY  1812
             LMLNLQLGIRY+VGKITP+P+REVR +DFG +ARI MYFP +GS+ TPPH S++F+WKDY
Sbjct  385   LMLNLQLGIRYTVGKITPVPLREVRSNDFGPRARIIMYFPCEGSQYTPPHCSVNFFWKDY  444

Query  1813  CPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSEL  1992
             CP+VFRNLR +F ++AADYMMSIC  D L+EL SPGKSGSIFYLS D+RFVIKTL+KSEL
Sbjct  445   CPMVFRNLREMFHIDAADYMMSICGGDSLKELSSPGKSGSIFYLSQDERFVIKTLRKSEL  504

Query  1993  KVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDL  2172
             K+LLKMLP YY HVK ++NTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H +YDL
Sbjct  505   KILLKMLPKYYNHVKAYDNTLITKFFGVHRITLKAGKKVRFVVMGNMFCTELRIHRKYDL  564

Query  2173  KGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSL  2352
             KGS+ GR T K KI E TTLKDLDL +   +DK   + L +Q++LDS FLESQ IIDYS+
Sbjct  565   KGSTQGRSTKKQKINENTTLKDLDLAHAFHVDKSWRQALFRQIALDSMFLESQSIIDYSM  624

Query  2353  LLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISI--------LPRSLTLVTHEPSI  2508
             LLG+HFRAP HL       ++L   +S+ ++S    ++          +   LV HEP  
Sbjct  625   LLGIHFRAPNHLKTATSHQNTL---ESSGITSAMDCNVPLHCEDANSSKGFLLVAHEPG-  680

Query  2509  VSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEV  2688
              +T  G HIRG  +RA+  G  EVDL+LP TGR RVQLGVNMPA+A + ++         
Sbjct  681   -TTVGGSHIRGSMVRASEGGYEEVDLVLPDTGRFRVQLGVNMPARARKLLE-------ST  732

Query  2689  ELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERV  2868
             +  E YDVVLYLGIIDILQ YN  K++EH  KSL+FDP+SIS ++P LYSKRF+SFLERV
Sbjct  733   DAVEEYDVVLYLGIIDILQEYNTSKRVEHAVKSLKFDPLSISSVDPNLYSKRFVSFLERV  792

Query  2869  F  2871
             F
Sbjct  793   F  793



>sp|Q6EX42.2|PI5K1_ORYSJ RecName: Full=Phosphatidylinositol 4-phosphate 5-kinase 1; AltName: 
Full=1-phosphatidylinositol 4-phosphate kinase; AltName: 
Full=Diphosphoinositide kinase; AltName: Full=PIP5K; AltName: 
Full=PtdIns(4)P-5-kinase; Flags: Precursor [Oryza sativa 
Japonica Group]
Length=801

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/783 (52%), Positives = 519/783 (66%), Gaps = 47/783 (6%)
 Frame = +1

Query  610   KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
                PNGD+Y+G F G++PHG GKY  +DG  YDG+W++ KMTG+G I W SGA+Y+GD  
Sbjct  33    NTLPNGDIYVGSFDGLVPHGPGKYMWTDGALYDGEWDKSKMTGRGLIQWPSGASYEGDFR  92

Query  790   EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSN  969
              G++ G GTF   DGSVYKG W+MN +HG+G   Y NSD Y+G W EG+ D  G+YTW++
Sbjct  93    GGFIDGAGTFKGVDGSVYKGSWRMNKKHGMGTMVYSNSDTYEGFWNEGLPDEFGKYTWAD  152

Query  970   GNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKD  1149
             GN+Y G WK G M+G GVM+W NGD  D  W++GL HG G  ++A G+ Y GTW  GLKD
Sbjct  153   GNVYIGRWKSGKMNGSGVMQWINGDTLDCNWLNGLAHGKGYCKYASGACYIGTWDRGLKD  212

Query  1150  GRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKV--------KRSISEKIV  1305
             G GT Y  G      KI  + E+   L+     S   +   K+        ++      +
Sbjct  213   GHGTFYQPG-----SKIPCNLEVSDCLTSHDGTSASSSSNEKITIGLLFLLQKLCKNWRL  267

Query  1306  DRFARDSGRISRRAVSV----AGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
              RF     RIS     V    +G       S++    D  C L  +  D  +        
Sbjct  268   RRFLHRPRRISNGTTPVFDDNSGSHLCQDVSSKSFSADDQC-LQDSEVDKDS--------  318

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
              YEREY+QGVLI E+ K+ D    +S   ++   ++  KG    ++KG +SYYLMLNLQL
Sbjct  319   VYEREYVQGVLIMEQPKNEDSRMSESGIAQENNWEKQAKGPMETIYKGHRSYYLMLNLQL  378

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIRY+VGKITP+P+REVR +DFG +ARIKMYFP +GS+ TPPH S+DF+WKDYCP+VFRN
Sbjct  379   GIRYTVGKITPVPLREVRSNDFGPRARIKMYFPCEGSQYTPPHYSVDFFWKDYCPMVFRN  438

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELK------  1995
             LR +F ++AADYMMSIC  D L+EL SPGKSGSIFYLS D+RFVIKTL+K+ELK      
Sbjct  439   LREMFHIDAADYMMSICGGDSLKELSSPGKSGSIFYLSQDERFVIKTLRKTELKIGLMKY  498

Query  1996  ---VLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRY  2166
                +LLKMLP YY HVK ++NTLITKFFGV+RI+L+  +KVRFVVMGNMF TEL +H +Y
Sbjct  499   VLQILLKMLPKYYNHVKAYDNTLITKFFGVHRITLKPGRKVRFVVMGNMFCTELRIHRKY  558

Query  2167  DLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDY  2346
             DLKGS+ GR T K  I E TTLKDLDL Y   +DK   E L +Q++LD  FLESQ IIDY
Sbjct  559   DLKGSTQGRSTKKQNINENTTLKDLDLSYVFHVDKPWREALFRQIALDCMFLESQSIIDY  618

Query  2347  SLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTA--  2520
             S+LLG+HFRAP HL  +    ++L   +ST +S++   S+       ++ +  ++  A  
Sbjct  619   SMLLGIHFRAPNHLKRITSCQNAL---ESTGISAETECSVALHHEETISSKGFLLVAADE  675

Query  2521  PGP-----HIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQD-ETDPS  2682
             PGP     HIRG  +RA   G  EVDL+LPGTGR RVQLGVNMPA+A RKV++D   +  
Sbjct  676   PGPAVRGSHIRGSMVRAAEGGYEEVDLVLPGTGRFRVQLGVNMPARA-RKVQEDVNVEVE  734

Query  2683  EVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLE  2862
               +  E YDVVLYLGIIDILQ YN+ K++EH  KSL+FDP+SIS ++P LYS+RFISFLE
Sbjct  735   NRDTIEEYDVVLYLGIIDILQEYNVSKRVEHAVKSLKFDPLSISAVDPNLYSRRFISFLE  794

Query  2863  RVF  2871
             +VF
Sbjct  795   KVF  797



>ref|XP_006650453.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Oryza 
brachyantha]
Length=770

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/768 (52%), Positives = 511/768 (67%), Gaps = 30/768 (4%)
 Frame = +1

Query  610   KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
                PNGD+Y+G F G++PHG GKY  +DG  YDG+W++ KMTG+G I W SGA+Y+GD  
Sbjct  15    NTLPNGDIYVGSFDGLVPHGPGKYMWTDGALYDGEWDKSKMTGRGLIQWPSGASYEGDFR  74

Query  790   EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSN  969
              G++ G GTF   DGSVYKG W+MN +HG+G   Y NSD+Y+G W EG+ DG G YTW++
Sbjct  75    GGFIDGTGTFKGVDGSVYKGSWRMNKKHGIGTMVYSNSDIYEGLWNEGLPDGLGTYTWAD  134

Query  970   GNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKD  1149
             GN+YTG WK G MSGRGVM+W NGD  D  W++GL HG G  ++A G+ Y GTW  GLKD
Sbjct  135   GNIYTGRWKSGKMSGRGVMQWINGDTLDCNWLNGLAHGKGYCKYASGACYIGTWDRGLKD  194

Query  1150  GRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSIS---EKIVDRFAR  1320
             G G  Y  G  L  C +    E+   L+     S   +   K+   +    +K+   +  
Sbjct  195   GHGVFYEPGSKL-PCNL----EVSDCLTSHDGTSASSSSNEKITIGLLFLLQKLCKNWRL  249

Query  1321  DSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQG  1500
              S     R +S       + +S   L +D S   +   C    E   +  + Y REY+QG
Sbjct  250   RSFLHRPRRISNGTTPIFYDNSGNHLRQDVSSKSADDQCLQDDEV--DKDLVYGREYVQG  307

Query  1501  VLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKI  1680
             VL+ E+ ++ D       Q   +  +   +G    ++KG +SYYLMLNLQLGIRY+VGKI
Sbjct  308   VLVNEQPRNKDSRMSDIAQENMWEKQA--RGPMETIYKGHRSYYLMLNLQLGIRYTVGKI  365

Query  1681  TPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNA  1860
             TP+P+REVR +DFG +ARIKMYFP +GS+ TPPH S+DF+WKDYCP+VFRNLR +F ++A
Sbjct  366   TPVPLREVRSNDFGPRARIKMYFPCEGSQYTPPHYSVDFFWKDYCPMVFRNLREMFHIDA  425

Query  1861  ADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKD  2040
             ADYMMSIC  D L+EL SPGKSGSIFYLS D+RFVIKTL+K+ELK+LLKMLP YY HVK 
Sbjct  426   ADYMMSICGGDSLKELSSPGKSGSIFYLSQDERFVIKTLRKTELKILLKMLPKYYNHVKA  485

Query  2041  HENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEE  2220
             ++NTLITKFFGV+RI+L+  +KVRFVVMGNMF TEL +H +YDLKGS+ GR T K  I E
Sbjct  486   YDNTLITKFFGVHRITLKGGRKVRFVVMGNMFCTELRIHRKYDLKGSTQGRSTKKQNINE  545

Query  2221  GTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALL  2400
              TTLKDLDL Y   +DK   + L +Q++LD  FLESQ IIDYS+LLG+HFRAP HL ++ 
Sbjct  546   NTTLKDLDLSYVFHVDKPWRDALFRQIALDCMFLESQSIIDYSMLLGIHFRAPNHLRSIT  605

Query  2401  EPPDSLFKPKSTLVSSDGGISILPRS---------LTLVTHEPSIVSTAPGPHIRGKTLR  2553
                 S    +S+ +S     S+             L +  +EP    T  G HIRG  +R
Sbjct  606   ----SYHALESSGISPQTDYSVALHHEEKISSKGFLLVAANEPG--PTVRGSHIRGSMVR  659

Query  2554  ANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKV--KQDETDPSEVELFEVYDVVLYLG  2727
             A   G  EVDL+LPGTGR RVQLGVNMPA+A RKV    +      V+  E YDVVLYLG
Sbjct  660   AAEGGYEEVDLVLPGTGRFRVQLGVNMPARA-RKVHEDVNVEVVENVDTIEEYDVVLYLG  718

Query  2728  IIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             IIDILQ YN+ K++EH  KSL+FDP+SIS ++P LYS+RF+SFLE+VF
Sbjct  719   IIDILQEYNVSKRVEHAVKSLKFDPLSISAVDPNLYSRRFVSFLEKVF  766



>ref|XP_009355211.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X4 [Pyrus x bretschneideri]
Length=645

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/622 (60%), Positives = 461/622 (74%), Gaps = 16/622 (3%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK F NGDVY+G FKG LPHG GKYT  DGT Y+GDWEEGKMTGKG++IW+SGA Y GD 
Sbjct  7     EKAFSNGDVYVGNFKGTLPHGNGKYTWCDGTVYEGDWEEGKMTGKGKLIWTSGAQYVGDF  66

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GYLHG G F+  DGS Y+G W+MNIQHG+G+K+Y+NSD+Y+G WKEGV++G GRY WS
Sbjct  67    SGGYLHGDGIFNGPDGSFYQGSWRMNIQHGMGKKQYRNSDIYEGSWKEGVQEGSGRYLWS  126

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             +GN YTG WK G M GRGVMKW NGDL++G W++GLR G G YRFADG YYFGTWS GLK
Sbjct  127   SGNTYTGSWKGGKMCGRGVMKWENGDLYNGSWLNGLRDGCGVYRFADGGYYFGTWSRGLK  186

Query  1147  DGRGTLYPVG---------CALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEK  1299
             DG+GT YP G         C+      DG   + R L +    S +   +P VK S SEK
Sbjct  187   DGKGTFYPAGTKHPSLKEWCSSVGYSSDGSSSLSRHLLN----STEGNARPTVKCSFSEK  242

Query  1300  I-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVA  1476
             I +    R+S RIS +A+S+  +      S + +  D+   +S  + D + E   N T  
Sbjct  243   ISIGGILRNSRRISHKAMSLDKNWTDRYPSRDFIRYDSLSSMSQASEDIEHEMRDNNTSV  302

Query  1477  YEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLG  1656
             YEREY+QGV +RER  +   +S +S QR       + K SC+D+F   +SYYLMLNLQLG
Sbjct  303   YEREYVQGVFVREREYNHTEISRKSKQRNNVSV--MPKSSCIDMFGANRSYYLMLNLQLG  360

Query  1657  IRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNL  1836
             IRY+VGKITP+P+REVR SDFG++ARI+MYFPRKGS+ TPPH S+DFYWKDYCP+VFRNL
Sbjct  361   IRYTVGKITPVPVREVRPSDFGDRARIRMYFPRKGSQFTPPHYSVDFYWKDYCPMVFRNL  420

Query  1837  RRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLP  2016
             R +FKL+AA+YMMSIC D+GLRE+ SPGKSGSIFY+S DDRF +KTL+K+ELKV+LKMLP
Sbjct  421   REMFKLDAAEYMMSICGDNGLREISSPGKSGSIFYISHDDRFFVKTLRKTELKVMLKMLP  480

Query  2017  SYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRF  2196
              YY HV +HENTLITK FG++RI+L+  KKVRF+VMGNMF TEL +H RYDLKGS++GR 
Sbjct  481   RYYSHVDEHENTLITKKFGLHRITLKGGKKVRFMVMGNMFCTELRIHRRYDLKGSTIGRC  540

Query  2197  TDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRA  2376
             TD+DKI+E TTLKDLDL +E  MDKLL   L KQ+SLD +FL+SQ IIDYSLLLGLHFRA
Sbjct  541   TDEDKIDENTTLKDLDLKFEFHMDKLLRGELFKQISLDCKFLQSQQIIDYSLLLGLHFRA  600

Query  2377  PEHLTALLEPPDSLFKPKSTLV  2442
             PE      +PP ++   +S L 
Sbjct  601   PEDPKGFSQPPATMHNHESLLA  622


 Score = 78.2 bits (191),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = +1

Query  865   IQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGD  1044
             +++ V  K + N DVY G +K  +  G+G+YTW +G +Y G W++G M+G+G + W +G 
Sbjct  1     MEYAVSEKAFSNGDVYVGNFKGTLPHGNGKYTWCDGTVYEGDWEEGKMTGKGKLIWTSGA  60

Query  1045  LFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
              + G +  G  HG G +   DGS+Y G+W   ++ G G
Sbjct  61    QYVGDFSGGYLHGDGIFNGPDGSFYQGSWRMNIQHGMG  98



>emb|CBI23815.3| unnamed protein product [Vitis vinifera]
Length=590

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/637 (62%), Positives = 460/637 (72%), Gaps = 64/637 (10%)
 Frame = +1

Query  1024  MKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVGC---ALDK-  1191
             MKW NGDL++GFW+DG+RHGSG YRF DG YYFGTWS GLKDG GT YP G    +L K 
Sbjct  1     MKWENGDLYNGFWLDGVRHGSGFYRFVDGGYYFGTWSRGLKDGPGTYYPAGSRHPSLTKW  60

Query  1192  -CKIDGHKEIRRMLSHDSSISKKD--AVKPKVKRSISEKIVDRFARDSGRISRRAVSVAG  1362
                ID     + MLSH SS++ +   A+KP                   RIS RA+S+  
Sbjct  61    CSSIDYDDNRKTMLSHSSSLNSEGHGALKP------------------SRISHRAMSLDE  102

Query  1363  DAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLS  1542
             D ++  S+ E L  D S MLSH + + + E     T+ YEREYMQGVLI+E+I+S    S
Sbjct  103   DCSVCDSAREFLAHDTSGMLSHASDEDQHEMRDCCTLVYEREYMQGVLIKEKIRSSAVPS  162

Query  1543  HQSTQRRKFPAKEVRKGSCMDLFKG---RKSYYLMLNLQLGIRYSVGKITPIPMREVRQS  1713
              ++ QR KF AKE ++ SCM +F+    R+SYYLMLNLQLGIRY+VGKITP+PMREVR S
Sbjct  163   EKNKQRSKFHAKEAKQRSCMGIFEDHQRRRSYYLMLNLQLGIRYTVGKITPVPMREVRSS  222

Query  1714  DFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDD  1893
             DFG++ARI+MYFPRKGS+ TPPH SIDFYWKDYCP+VFRNLR +FKL+AADYMMSIC DD
Sbjct  223   DFGDRARIRMYFPRKGSQFTPPHYSIDFYWKDYCPMVFRNLREMFKLDAADYMMSICGDD  282

Query  1894  GLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFG  2073
             GLREL SPGKSGS+FYLS DDRF+IKTLKKSELKVLLKMLP+YY HV  HENTLITKFFG
Sbjct  283   GLRELPSPGKSGSLFYLSHDDRFLIKTLKKSELKVLLKMLPNYYNHVAAHENTLITKFFG  342

Query  2074  VYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMY  2253
             ++RI+LR  KKVRF+VMGNMF TEL +H RYDLKGSS GR+TDKDKI+  TTLKDLDL Y
Sbjct  343   LHRITLRGGKKVRFMVMGNMFCTELRIHRRYDLKGSSQGRYTDKDKIDSNTTLKDLDLSY  402

Query  2254  ELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLF----  2421
             E  MDK L ++L +Q+SLD  FLESQ IIDYSLLLGLHF APEHL  LLE P++      
Sbjct  403   EFHMDKSLRKSLFQQISLDCMFLESQQIIDYSLLLGLHFSAPEHLKTLLELPETNHSHGN  462

Query  2422  ---KPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLL  2592
                   S   +S G + I P  L LVTHEP+  STAPGPH+RG  LRA SVGD+EVDLLL
Sbjct  463   NPGSDGSYGATSIGDLWIPPSGLILVTHEPN-GSTAPGPHMRGNPLRAYSVGDKEVDLLL  521

Query  2593  PGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLE  2772
             PGTGRLRVQLGVNMPAQANRKV QDE +  EVELFEVYDVVLYLGIIDILQ         
Sbjct  522   PGTGRLRVQLGVNMPAQANRKVLQDEANSKEVELFEVYDVVLYLGIIDILQ---------  572

Query  2773  HKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA*P  2883
                                LYS+RFI+FLE+VF   P
Sbjct  573   -------------------LYSRRFINFLEKVFPEQP  590



>gb|KDP29195.1| hypothetical protein JCGZ_16584 [Jatropha curcas]
Length=831

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/779 (51%), Positives = 523/779 (67%), Gaps = 28/779 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E V  NG+ Y G   G +P GKGKY  SDG  YDG+W  G   G G+I W SGA Y+
Sbjct  53    RVGELVLTNGEHYCGSLLGNVPEGKGKYVWSDGCIYDGEWRRGMRHGNGKIQWPSGAAYE  112

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+ +S+   YKG W++N++HG+G + + N D+++G W +G  +G G+Y
Sbjct  113   GEFSGGYMHGTGTYIASNSMTYKGRWRLNLKHGLGYQVFPNGDIFEGSWIQGTPEGPGKY  172

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G M+G+G + W NGD F+G W++G+ HG G Y + DG  Y GTW++
Sbjct  173   TWANGNVYLGNMKGGKMTGKGTLTWINGDSFEGSWLNGMMHGFGVYTWNDGGSYAGTWTH  232

Query  1138  GLKDGRGTLYPVGC-----------ALDKCKI--DGHKEIRRMLSHDSSI---SKKDAVK  1269
             GLKDG+G+ YP G            AL K  +  D  K+    + H SS+   + K +  
Sbjct  233   GLKDGKGSFYPKGSRYPAIQERYLNALRKRGLLPDLRKQNHAHIHHASSVDMGNVKISGD  292

Query  1270  PKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
                + ++S K+         +   R VS+    +L  S  +V+  D+S  LS +  +G  
Sbjct  293   QGSRHTVSSKLSKGNLLTLEQSCNRNVSLERRWSLEVSIEKVIGHDSSLELSDSVFEGME  352

Query  1450  EQL-GNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGR  1620
             +++  N+    EREYMQGVLI E +   S    S ++ +R+K  AKEV++     + KG 
Sbjct  353   KEVETNVPPILEREYMQGVLINELVINNSFSSSSRRARRRQKKLAKEVKR-PGETIIKGH  411

Query  1621  KSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFY  1800
             +SY LMLNLQLGIRY+VGKITP+  REVR SDFG +A   M+FP+ GS+LTPPH+S DF 
Sbjct  412   RSYDLMLNLQLGIRYTVGKITPVQRREVRSSDFGPRASFWMHFPKDGSQLTPPHQSDDFK  471

Query  1801  WKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLK  1980
             WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGSIF+LS DDRF+IKTL+
Sbjct  472   WKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSIFFLSQDDRFMIKTLR  531

Query  1981  KSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHH  2160
             KSE+KVLLKMLP Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H 
Sbjct  532   KSEVKVLLKMLPDYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHR  591

Query  2161  RYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHII  2340
             R+DLKGSSLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+ +DS+FLE+QHI+
Sbjct  592   RFDLKGSSLGRSTDKIEIDENTTLKDLDLNYCFYLEPSWREALLKQIEIDSKFLEAQHIM  651

Query  2341  DYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SILPRSLTLVTHEPSIVS  2514
             DYSLLLG+H+RAP+HL +L+    SL      +++ D  I     P+ L LV H     S
Sbjct  652   DYSLLLGVHYRAPQHLQSLMSYRRSLRAEGLGVLAEDDTIEDENYPQGLLLVPHGTDDNS  711

Query  2515  TAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVEL  2694
                GPHIRG  LRA   GD EVDL+LPGT RL++QLGVNMPA+A +   ++E +      
Sbjct  712   VVVGPHIRGSRLRA--FGDEEVDLVLPGTARLQIQLGVNMPARAEQIPGKEEKE----TF  765

Query  2695  FEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
              E YDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P  YS RF+ F+++VF
Sbjct  766   HEAYDVVLYLGIIDILQEYNMSKKIEHAYKSLQFDSLSISAVDPTFYSSRFLEFIQKVF  824



>ref|XP_002265706.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Vitis 
vinifera]
 ref|XP_010653996.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Vitis 
vinifera]
Length=837

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/777 (50%), Positives = 509/777 (66%), Gaps = 31/777 (4%)
 Frame = +1

Query  616   FPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEG  795
              PNG+ Y G   G +P G GKY  SDG  Y+G W  G   G G+I WSSGA Y+G+   G
Sbjct  60    LPNGECYSGSLLGSVPEGPGKYVWSDGCVYEGGWRRGMRNGNGKIRWSSGAAYEGEFSGG  119

Query  796   YLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGN  975
             Y+HG GT+   D   Y G W++N++HG+G + Y N DV++G W +G  +G G+YTW+NGN
Sbjct  120   YMHGTGTYIGPDNMTYNGRWRLNLKHGLGYQNYPNGDVFEGSWIQGTPEGPGKYTWANGN  179

Query  976   MYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGR  1155
             +Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG YY GTW+ GLKDG+
Sbjct  180   VYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMMHGFGVYTWSDGGYYVGTWTRGLKDGK  239

Query  1156  GTLYPVGCALDKCKIDGHKEIRRM-----------LSHDSSISKKDAVKPKV------KR  1284
             G  YP G +L   +      +R+            +SH    S  D    KV      +R
Sbjct  240   GAFYPKGSSLPALQQLYINALRKRGLLPDLKKQFNVSHIHRASSVDMGNVKVGGNQVSRR  299

Query  1285  SISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
               S+K+      +  +   R V++    +L  S  +V+  D S  LS +  +G  ++   
Sbjct  300   GSSDKLSKGNLLNLDQSRNRNVALERRWSLEVSIEKVIGHDLSLGLSESVSEGGEKESVK  359

Query  1465  ITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
                  EREYMQGVLI E +        S  + +R+K   K+V++     + KG +SY LM
Sbjct  360   NAPILEREYMQGVLISEMVLDNRFSPSSRSAKRRQKKLTKDVKR-PGEAIIKGHRSYDLM  418

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             L+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+S DF WKDYCP
Sbjct  419   LSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMSFPKEGSQLTPPHQSEDFKWKDYCP  478

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DD F+IKTL+KSE+KV
Sbjct  479   MVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDHFMIKTLRKSEVKV  538

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LL+MLP+Y+ HV+ HENTLITKFFG++RI     +K RFVVMGNMF TEL +H R+DLKG
Sbjct  539   LLRMLPNYHHHVRSHENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRRFDLKG  598

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SSLGR  DK +I+E TTLKDLDL Y   ++    + L+ Q+ +DS+FLE+QHI+DYSLLL
Sbjct  599   SSLGRSADKVEIDENTTLKDLDLNYRFYLEPSWRDALLMQIEIDSKFLEAQHIMDYSLLL  658

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHEPSIVSTAPG  2526
             G+H+RAP+HL +L+    S+      +++ +      IS  P  L LV       S   G
Sbjct  659   GVHYRAPQHLRSLMSYNRSIGADGLGILAEEDSIEDDISSYPEGLVLVPRGSDDGSVVVG  718

Query  2527  PHIRGKTLRANS-VGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVE-LFE  2700
             PHIRG  LRA+S  G  EVDLLLPGT RL++QLGVNMPA+A +      T   EVE L E
Sbjct  719   PHIRGSRLRASSAAGGEEVDLLLPGTARLQIQLGVNMPARAEKI-----TGIQEVETLHE  773

Query  2701  VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
              YDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P  YSKRF+ F+++VF
Sbjct  774   TYDVVLYLGIIDILQEYNMGKKIEHAYKSLQFDSLSISAVDPTFYSKRFLEFIQKVF  830



>ref|XP_007027475.1| Phosphatidyl inositol monophosphate 5 kinase isoform 1 [Theobroma 
cacao]
 ref|XP_007027476.1| Phosphatidyl inositol monophosphate 5 kinase isoform 1 [Theobroma 
cacao]
 ref|XP_007027480.1| Phosphatidyl inositol monophosphate 5 kinase isoform 1 [Theobroma 
cacao]
 gb|EOY07977.1| Phosphatidyl inositol monophosphate 5 kinase isoform 1 [Theobroma 
cacao]
 gb|EOY07978.1| Phosphatidyl inositol monophosphate 5 kinase isoform 1 [Theobroma 
cacao]
 gb|EOY07982.1| Phosphatidyl inositol monophosphate 5 kinase isoform 1 [Theobroma 
cacao]
Length=825

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/778 (49%), Positives = 514/778 (66%), Gaps = 30/778 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PNGD Y G   G +P G+GKY    G  Y+G+W  G   G G+I W +G  YD
Sbjct  51    RVGELLLPNGDSYSGSLLGNVPEGRGKYVWQGGCVYEGEWSCGMRHGTGKIQWPTGTVYD  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  S+   YKG WK+N++HG+G + Y N DV++  W +G  +G G+Y
Sbjct  111   GEFSGGYMHGTGTYIGSNKLTYKGRWKLNLKHGLGYQVYPNGDVFEASWIQGTTEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG +Y GTW+ 
Sbjct  171   TWANGNVYLGNMKGGKMSGKGTLTWTNGDTFEGSWLNGMMHGFGVYTWSDGGFYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSISKKDAVK---  1269
             GLKDG+G+ YP    L   +              D  K++   + H SSI    ++K   
Sbjct  231   GLKDGKGSFYPKSSRLPALQEVYLNALRKRGLLPDLRKQVHAHIHHASSIDM-GSIKVGG  289

Query  1270  PKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
              +V    S K+ +    +  +   R VS+    +L  S  +V+  D+S  LS +  +G  
Sbjct  290   NRVSHRNSNKLSEGNLLNLEQSRNRNVSLERRWSLEVSIEKVIGHDSSFELSDSFTEGGE  349

Query  1450  EQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
             +         EREYMQGVLI E +   S    S ++ +R+K  AK++++     + KG +
Sbjct  350   KGSETNAPILEREYMQGVLISELVLNNSFSPSSRRAKRRQKKLAKDIKR-PGETIIKGHR  408

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITP+  REVR SDFG +A   M FP++GS+LTPPH+S DF W
Sbjct  409   SYDLMLSLQLGIRYTVGKITPVQRREVRASDFGPRASFWMNFPKEGSQLTPPHQSEDFKW  468

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGSIF+LS DDRF+IKTL+K
Sbjct  469   KDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSIFFLSQDDRFMIKTLRK  528

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE+KVLL+MLP+Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H R
Sbjct  529   SEVKVLLRMLPNYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRR  588

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             +DLKGSSLGR  D  +I+E TTLKDLDL Y   ++    E L++Q+ +DS+FLE+Q I+D
Sbjct  589   FDLKGSSLGRSADNVEIDENTTLKDLDLNYCFYLEPSWQEALLRQIEIDSKFLEAQRIMD  648

Query  2344  YSLLLGLHFRAPEHLTALL--EPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVST  2517
             YSLLLG+H+RAP+HL +L+     D L    S     +  IS  P+ L LV       S 
Sbjct  649   YSLLLGVHYRAPQHLRSLMSYNTADGL---GSVAEEEEDEISNYPQGLVLVPRGTDDNSV  705

Query  2518  APGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
               G HIRG+ LRA++ GD EVDLLLPGT RL++QLGVNMPA+A +   ++E         
Sbjct  706   VAGSHIRGRRLRASAAGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGKEENT-----FH  760

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             E YDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P  YS+RF++F+++VF
Sbjct  761   EAYDVVLYLGIIDILQEYNMTKKIEHAYKSLQFDSVSISAVDPTFYSQRFLNFIQKVF  818



>ref|XP_004304485.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Fragaria 
vesca subsp. vesca]
Length=830

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/783 (49%), Positives = 520/783 (66%), Gaps = 35/783 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PN + Y G   G +P GKGKY  SDG  Y+G+W  G   G G+I W SGA Y+
Sbjct  51    RVTELLLPNSETYAGPLLGNIPEGKGKYLWSDGCVYEGEWRRGMRHGIGKISWPSGAVYE  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  SD   YKG W++N++HG+G + Y N D+++G W +G+ +G G+Y
Sbjct  111   GEISGGYMHGAGTYIGSDNLNYKGRWRLNLKHGLGYQVYPNGDIFEGSWIQGLPEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW +GN+Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG +Y GTW+ 
Sbjct  171   TWQHGNVYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMMHGFGVYTWSDGGFYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKCK---------------IDGHKEIRRMLSHDSSISKKDAVKP  1272
             GLKDG+G+ YP G  L   +               +   K   +   H ++ ++ + VK 
Sbjct  231   GLKDGKGSFYPRGSRLPAVEELYLNALRKRGLLPDLRKQKLQNKSHIHHATSAELNNVKI  290

Query  1273  KVKRSISEKIVDRFAR----DSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCD  1440
                +       D+F++    +  +   + VS+    +L  S  +V+  D+S      T  
Sbjct  291   GEIQGSHASSADKFSKRNLLNLEQSHNKNVSLERRWSLEVSIEKVIAHDSSL-----TEG  345

Query  1441  GKAEQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFK  1614
             G+ +   NI +  EREYMQGVLI E +   S    + ++ +R+K  AK V++     + K
Sbjct  346   GENDAEANIPI-LEREYMQGVLISELVINNSFSSSTRRAKRRQKKLAKVVKR-PGEAIIK  403

Query  1615  GRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSID  1794
             G +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FPR+GS+LTPPH+S+D
Sbjct  404   GHRSYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNFPREGSQLTPPHQSVD  463

Query  1795  FYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKT  1974
             F WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKT
Sbjct  464   FRWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKT  523

Query  1975  LKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHM  2154
             L+KSE++VLL+MLPSY+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF TEL +
Sbjct  524   LRKSEVQVLLRMLPSYHNHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRI  583

Query  2155  HHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQH  2334
             H R+DLKGSSLGR  DK +I+E TTLKDLDL Y   ++    E+L+ Q+  DS+FLE+QH
Sbjct  584   HRRFDLKGSSLGRSADKIEIDENTTLKDLDLNYCFYLEPSWRESLLNQIETDSKFLEAQH  643

Query  2335  IIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHEP  2502
             I+DYSLLLG+H+RAP+HL +L+    S       +V+ +      I   P+ L L+    
Sbjct  644   IMDYSLLLGVHYRAPQHLRSLMAYNTSTRADGLGMVAEEEALEDEIYNYPQGLVLIPRGT  703

Query  2503  SIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPS  2682
                S   GPH+RG  LRA+S G  EVDLLLPGT RL+VQLGVNMP++A  +V +++ D  
Sbjct  704   DDGSVVAGPHVRGNRLRASSAGYEEVDLLLPGTARLQVQLGVNMPSRA-EQVMENQGD--  760

Query  2683  EVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLE  2862
             E     VYDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P  YS+RF+ F++
Sbjct  761   EQMFHGVYDVVLYLGIIDILQDYNMGKKIEHAYKSLQFDSLSISAVDPTFYSRRFLEFIQ  820

Query  2863  RVF  2871
             +VF
Sbjct  821   KVF  823



>ref|XP_002519450.1| phosphatidylinositol-4-phosphate 5-kinase, putative [Ricinus 
communis]
 gb|EEF42864.1| phosphatidylinositol-4-phosphate 5-kinase, putative [Ricinus 
communis]
Length=831

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/779 (49%), Positives = 506/779 (65%), Gaps = 27/779 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   PNG+ Y G   G +P G GKY  SDG TY+G+W  G   G G+I W SG  Y+
Sbjct  52    RVGELSLPNGESYSGSLLGNVPEGNGKYVWSDGCTYEGEWRRGMRHGNGKIQWPSGTAYE  111

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+       YKG W++N++HG+G + Y N D+++G W +G+ +G G+Y
Sbjct  112   GEFSGGYIHGTGTYIGFSSLTYKGRWRLNVKHGLGYQVYPNGDIFEGSWIQGIPEGPGKY  171

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G M+G+G   W NGD F+G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  172   TWANGNVYLGNMKGGKMTGKGTFTWINGDSFEGNWLNGMMHGFGVYTWSDGGCYVGTWTR  231

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSISKKDAVKPKV  1278
             GLKDG+G+ YP G      +              D  K+ +  + H SS+   + +K   
Sbjct  232   GLKDGKGSFYPTGSRFPAVQERYLNALRRRGVLPDLRKQNQAHIHHASSVDMAN-IKAGR  290

Query  1279  KRSISEKIVDRFARDS----GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
              +       D+ ++ S         + VS+    +L  S  +V+  ++S  LS    DG 
Sbjct  291   DQGPRRNSADKLSKGSLLTLEHSRNKNVSLERRWSLEVSIEKVIGHNSSLELSEYAFDGS  350

Query  1447  AEQL-GNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
              ++   N+    EREYMQGVLI E +   S   LS ++ +R+K  AKEV++     + KG
Sbjct  351   EKEFETNVPPILEREYMQGVLISELVLNNSFSSLSRRAKRRQKKLAKEVKR-PGETIIKG  409

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              +SY LML+LQLGIRY+VGKITP+  REVR SDFG +A   M FP+ GS+LTP H+S DF
Sbjct  410   HRSYDLMLSLQLGIRYTVGKITPVQRREVRASDFGSRASFWMNFPKDGSQLTPSHQSDDF  469

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
              WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGSIF+LS DDRF+IKTL
Sbjct  470   KWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSIFFLSQDDRFMIKTL  529

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMH  2157
             +KSE+KVLLK+LP Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H
Sbjct  530   RKSEVKVLLKILPDYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIH  589

Query  2158  HRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHI  2337
              R+DLKGSSLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+ +DS+FLE+QHI
Sbjct  590   RRFDLKGSSLGRSTDKIEIDENTTLKDLDLDYCFYLEPSWREALLKQIEIDSKFLEAQHI  649

Query  2338  IDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDG-GISILPRSLTLVTHEPSIVS  2514
             +DYSLLLG+H+RAP+HL +L        +    L   D       P+ L LV       S
Sbjct  650   MDYSLLLGVHYRAPQHLQSLTHNRSRRNEGLEVLAEEDTIEDENYPQGLVLVPRGTDDNS  709

Query  2515  TAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVEL  2694
                GPHIRG  LRA+S GD EVDLLLPGT RL++QLGVNMPA+A +    +E        
Sbjct  710   VVVGPHIRGSRLRASSAGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGSEEKQ----TF  765

Query  2695  FEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
              E YDVVLYLGIIDILQ YNM KK+E  YKSL+FD +SIS ++P  YS RF+ F+++VF
Sbjct  766   HEAYDVVLYLGIIDILQEYNMSKKIERAYKSLQFDSLSISSVDPTFYSSRFLEFIQKVF  824



>ref|XP_007203243.1| hypothetical protein PRUPE_ppa001465mg [Prunus persica]
 gb|EMJ04442.1| hypothetical protein PRUPE_ppa001465mg [Prunus persica]
Length=821

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/781 (49%), Positives = 513/781 (66%), Gaps = 40/781 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PN + Y G   G +P G+G+Y  SDG  Y+G+W  G   G G+IIW SGA Y+
Sbjct  51    RVRELLLPNKESYSGPVLGNIPEGRGRYAWSDGCIYEGEWRRGMRHGSGKIIWPSGAIYE  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  SD   YKG W++N++HG+G + Y N D ++G W +G+ +G G+Y
Sbjct  111   GEFSGGYMHGTGTYIGSDKMTYKGRWRLNLKHGLGYQVYPNGDAFEGSWIQGMPEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW NGN+Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG +Y GTW+ 
Sbjct  171   TWVNGNVYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMMHGFGVYTWSDGGFYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSI---SKKDAVK  1269
             GLKDG+G+ YP G  L   +              D  K+    + H +S+   + K    
Sbjct  231   GLKDGKGSFYPKGSRLPAAEELYLNALRKRGLLPDLRKQNNAHIHHATSVDMGNSKIGES  290

Query  1270  PKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
                 R  ++KI +R   +    S R VS+    +L  S  +V+         H + +G  
Sbjct  291   QGSHRVSADKISNRNLLNL-EPSHRNVSLERRWSLEVSFEKVI--------GHDSLEGGE  341

Query  1450  EQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
             +  G      EREYMQGVLI E +   S    S ++ +R+K  AK V++     + KG +
Sbjct  342   KDAGTGIPILEREYMQGVLISELVLNNSFTSSSRRAKRRQKKLAKVVKR-PGEAIIKGHR  400

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP+ GS+LTPPH+S+DF W
Sbjct  401   SYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNFPKDGSQLTPPHQSVDFRW  460

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+K
Sbjct  461   KDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRK  520

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE+KVLL+MLPSY+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H R
Sbjct  521   SEVKVLLRMLPSYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRR  580

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             +DLKGSSLGR  DK +I+E TTLKDLDL Y   ++    E L+ Q+ +DS+FLE+QHI+D
Sbjct  581   FDLKGSSLGRSADKIEIDENTTLKDLDLNYSFYLEPSWREALLNQIEIDSKFLEAQHIMD  640

Query  2344  YSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSS----DGGISILPRSLTLVTHEPSIV  2511
             YSLL+G+H+RAP+HL + +    S       +++     +  IS  P+ L L+       
Sbjct  641   YSLLMGVHYRAPQHLRSFMTYNRSTIADGLEILAEEETLEDEISNYPQGLVLIPRGTDDD  700

Query  2512  STAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVE  2691
             S   GPH+RG  LRA+S G  EVDLLLPGT RL++QLGVNMPA+A       E  P E +
Sbjct  701   SVVVGPHVRGSRLRASSAGYEEVDLLLPGTARLQIQLGVNMPARA-------EQVPGEKQ  753

Query  2692  LF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERV  2868
             +F EVYDVVLYLGIIDILQ Y+M KK+EH YKSL+FD +SIS ++P  YS RF+ F+ +V
Sbjct  754   IFPEVYDVVLYLGIIDILQDYSMGKKIEHAYKSLQFDSLSISAVDPTFYSHRFLEFIRKV  813

Query  2869  F  2871
             F
Sbjct  814   F  814



>ref|XP_010475979.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 isoform 
X2 [Camelina sativa]
Length=644

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/638 (59%), Positives = 457/638 (72%), Gaps = 22/638 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R+ ++ FPNGD Y G  KG+LP+GKGKY  SDGT Y+GDW++GK++GKG++ WSSGA Y+
Sbjct  4     RSGDREFPNGDFYSGEVKGLLPNGKGKYVWSDGTIYEGDWDQGKISGKGKLFWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHG+GT +S D S+Y G W+MN++HG+GRKEY NSD+YDG WKEG++DG G Y
Sbjct  64    GDFSGGYLHGYGTMTSPDDSIYSGTWRMNVRHGLGRKEYCNSDLYDGSWKEGLQDGRGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W+NGN Y G WKKG M  RGVM+W NGDL+DGFW++G RHGSG Y+FADG  Y+GTWS 
Sbjct  124   SWTNGNRYIGSWKKGKMCERGVMRWANGDLYDGFWLNGFRHGSGVYKFADGCLYYGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCK-----IDGHKEIRRMLSHDSSISKKDAVKPK-VKRSIS-E  1296
             GLKDG+G  YP G      K     ++     + +LS  +S++ ++      V RS+S E
Sbjct  184   GLKDGKGVFYPAGSKQPSLKKWCRSLEYDDTGKFVLSRSASVNVEELRSSNTVSRSLSVE  243

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCML-----SHTTCDGKAEQLG  1461
                   A+ SGRIS R      D    C      P D +C +     +  +  G++E   
Sbjct  244   TSAGEMAKHSGRISDRYTD---DIWRSCDP----PRDFTCHVPLSKSARFSGSGQSEGQD  296

Query  1462  NITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
                + YEREYMQGVLIRE I S    SH+   +     KEVR  S +   +G  +YYLML
Sbjct  297   KNRIVYEREYMQGVLIRETIMSSVDRSHKI--KPPLRPKEVRARSLLTFLRGEHNYYLML  354

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDFG+ AR KM+FPR GS  TPPH+SIDF WKDYCP+
Sbjct  355   NLQLGIRYTVGKITPVPRREVRASDFGKNARTKMFFPRDGSNFTPPHKSIDFSWKDYCPM  414

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSEL+VL
Sbjct  415   VFRNLREMFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYLSHDDRFVIKTLKKSELQVL  474

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L+MLP YY+HV  HENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGS
Sbjct  475   LRMLPKYYEHVGYHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGS  534

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             S GRFT+K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES +IIDYSLLLG
Sbjct  535   SQGRFTEKTKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCSFLESLNIIDYSLLLG  594

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPR  2475
             LHFRAP  L  +LEPP+++   + ++ S DG      R
Sbjct  595   LHFRAPGQLNDILEPPNAM-SDQESVSSVDGRCQCFKR  631



>ref|XP_006471083.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X1 [Citrus sinensis]
Length=584

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/590 (62%), Positives = 443/590 (75%), Gaps = 25/590 (4%)
 Frame = +1

Query  574   VIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQII  753
             ++IME+  R  +K F NGD+Y+G F+G LPHGKGKY   DGT Y+GDWEEGKMTGKG I+
Sbjct  4     LLIMEDTGRL-KKSFTNGDIYVGNFEGELPHGKGKYIWLDGTVYEGDWEEGKMTGKGYIV  62

Query  754   WSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEG  933
             W SGA Y+GD   GYL GFGTF+  DGSVY+G+W+MNI+HG+GRKEY NSD+YDG WKEG
Sbjct  63    WPSGAKYEGDFSGGYLDGFGTFTGHDGSVYRGNWRMNIRHGLGRKEYPNSDIYDGSWKEG  122

Query  934   VRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGS  1113
             V +G GRY+W++GN+Y G WK G MSGRGVMKW NGD++DG W++G RHGSG Y FADG 
Sbjct  123   VHEGSGRYSWNSGNIYIGSWKDGKMSGRGVMKWMNGDIYDGSWLNGYRHGSGVYMFADGG  182

Query  1114  YYFGTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSH-------------DSSISK  1254
             +Y GTWS GLKDG+G  YP G          H  +RRM S+              SSI+ 
Sbjct  183   HYSGTWSKGLKDGKGKFYPAGSK--------HPSLRRMCSNLGYDDNTKGLPSQGSSINS  234

Query  1255  K--DAVKPKVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLS  1425
             +  +  KP+VKRS+SE+I V    R SGRIS R  S+ G+ +    S + +  D S  L 
Sbjct  235   EGSETSKPRVKRSLSERISVGGLLRSSGRISHRTSSLDGNWSQRHPSVKSISNDFSSKLL  294

Query  1426  HTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMD  1605
             H + + +++      V YEREYMQGVL++E +++    + +   R K   KEV+K SC+D
Sbjct  295   HDSDESQSDVPDGSPVVYEREYMQGVLMKETVRNYTEQTRKGKPRNKHSVKEVKKKSCVD  354

Query  1606  LFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHR  1785
             +F+G +SYYLMLNLQLGIRY+VGKITP+PMREVR SDFG++ARI+MYFPRKGS+ TPPH 
Sbjct  355   IFEGHRSYYLMLNLQLGIRYTVGKITPVPMREVRSSDFGDRARIRMYFPRKGSQFTPPHN  414

Query  1786  SIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFV  1965
             SIDF WKDYCP+VFRNLR +FKL+AA+YMMSIC DDGLRE  SPGKSGSIFYLS DDRF 
Sbjct  415   SIDFSWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLRERSSPGKSGSIFYLSHDDRFF  474

Query  1966  IKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTE  2145
             IKTLKK+ELKVLL+ML  YY HVK HENTLITKFFG++RI+LR  +KVRFVVMGNMF TE
Sbjct  475   IKTLKKTELKVLLRMLHEYYIHVKKHENTLITKFFGLHRITLRGGRKVRFVVMGNMFCTE  534

Query  2146  LHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIK  2295
             L +H  YDLKGS++GR TDKDKI+E TTLKDLDL +E +MDKLL E L K
Sbjct  535   LRIHRSYDLKGSTVGRCTDKDKIKENTTLKDLDLSFEFQMDKLLREYLFK  584



>emb|CBI30171.3| unnamed protein product [Vitis vinifera]
Length=817

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/764 (51%), Positives = 507/764 (66%), Gaps = 25/764 (3%)
 Frame = +1

Query  616   FPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEG  795
              PNG+ Y G   G +P G GKY  SDG  Y+G W  G   G G+I WSSGA Y+G+   G
Sbjct  60    LPNGECYSGSLLGSVPEGPGKYVWSDGCVYEGGWRRGMRNGNGKIRWSSGAAYEGEFSGG  119

Query  796   YLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGN  975
             Y+HG GT+   D   Y G W++N++HG+G + Y N DV++G W +G  +G G+YTW+NGN
Sbjct  120   YMHGTGTYIGPDNMTYNGRWRLNLKHGLGYQNYPNGDVFEGSWIQGTPEGPGKYTWANGN  179

Query  976   MYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGR  1155
             +Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG YY GTW+ GLKDG+
Sbjct  180   VYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMMHGFGVYTWSDGGYYVGTWTRGLKDGK  239

Query  1156  GTLYPVGC---ALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARDS  1326
             G  YP G    AL +  I+  +  +R L  D    KK      + R+ S    +    D 
Sbjct  240   GAFYPKGSSLPALQQLYINALR--KRGLLPDL---KKQFNVSHIHRASSLSKGNLLNLDQ  294

Query  1327  GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGVL  1506
              R   R V++    +L  S  +V+  D S  LS +  +G  ++        EREYMQGVL
Sbjct  295   SR--NRNVALERRWSLEVSIEKVIGHDLSLGLSESVSEGGEKESVKNAPILEREYMQGVL  352

Query  1507  IRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKI  1680
             I E +        S  + +R+K   K+V++     + KG +SY LML+LQLGIRY+VGKI
Sbjct  353   ISEMVLDNRFSPSSRSAKRRQKKLTKDVKR-PGEAIIKGHRSYDLMLSLQLGIRYTVGKI  411

Query  1681  TPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNA  1860
             TPI  REVR SDFG +A   M FP++GS+LTPPH+S DF WKDYCP+VFRNLR +FK++A
Sbjct  412   TPIQRREVRASDFGPRASFWMSFPKEGSQLTPPHQSEDFKWKDYCPMVFRNLREMFKIDA  471

Query  1861  ADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKD  2040
             ADYMMSIC +D LREL SPGKSGS+F+LS DD F+IKTL+KSE+KVLL+MLP+Y+ HV+ 
Sbjct  472   ADYMMSICGNDALRELSSPGKSGSVFFLSQDDHFMIKTLRKSEVKVLLRMLPNYHHHVRS  531

Query  2041  HENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEE  2220
             HENTLITKFFG++RI     +K RFVVMGNMF TEL +H R+DLKGSSLGR  DK +I+E
Sbjct  532   HENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRRFDLKGSSLGRSADKVEIDE  591

Query  2221  GTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALL  2400
              TTLKDLDL Y   ++    + L+ Q+ +DS+FLE+QHI+DYSLLLG+H+RAP+HL +L+
Sbjct  592   NTTLKDLDLNYRFYLEPSWRDALLMQIEIDSKFLEAQHIMDYSLLLGVHYRAPQHLRSLM  651

Query  2401  EPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANS-V  2565
                 S+      +++ +      IS  P  L LV       S   GPHIRG  LRA+S  
Sbjct  652   SYNRSIGADGLGILAEEDSIEDDISSYPEGLVLVPRGSDDGSVVVGPHIRGSRLRASSAA  711

Query  2566  GDREVDLLLPGTG-RLRVQLGVNMPAQANRKVKQDETDPSEVE-LFEVYDVVLYLGIIDI  2739
             G  EVDLLLPGT  RL++QLGVNMPA+A +      T   EVE L E YDVVLYLGIIDI
Sbjct  712   GGEEVDLLLPGTASRLQIQLGVNMPARAEKI-----TGIQEVETLHETYDVVLYLGIIDI  766

Query  2740  LQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             LQ YNM KK+EH YKSL+FD +SIS ++P  YSKRF+ F+++VF
Sbjct  767   LQEYNMGKKIEHAYKSLQFDSLSISAVDPTFYSKRFLEFIQKVF  810



>ref|XP_008779141.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008779148.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X1 [Phoenix dactylifera]
Length=830

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/782 (49%), Positives = 522/782 (67%), Gaps = 31/782 (4%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             E V PNGD Y G   G +P G GKYT SDG  Y+G+W+ G   G G+I W SGA Y+G+ 
Sbjct  57    ELVLPNGDKYSGTLLGNMPEGSGKYTWSDGFIYEGEWKRGMRHGHGKITWPSGAVYEGEF  116

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+HG GT+   D   YKG WK+N++HG+G + Y N DV++G W +GV +G G+Y W+
Sbjct  117   SGGYMHGTGTYVGPDNLTYKGRWKLNLKHGLGYETYPNGDVFEGSWIQGVVEGPGKYVWA  176

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             N N+Y G  K+G MSG+G + W NGD ++G W+DG+ HG G Y + DG  Y GTW+ GLK
Sbjct  177   NENIYVGNMKRGKMSGKGTLTWKNGDKYEGNWLDGMIHGFGVYTWNDGGCYVGTWTRGLK  236

Query  1147  DGRGTLYPVGC---ALDKCKIDGHK------EIRRM-----LSHDSSISKKDAVKPKVKR  1284
             DG+G  YP GC   A+ +  I+  +      +++R      + H SSI   +    + K 
Sbjct  237   DGKGAFYPKGCKIPAVQELYINALRTRGMLLDLKRQNHGQRILHSSSIDMGNMKVSETKD  296

Query  1285  SIS--EKIVDRFARDS-GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQ  1455
             S S    I+ +    S G+   + VS+    +L  +  +V+  D S     +  +   + 
Sbjct  297   SGSGLSGILPKGNLISFGQSCSQRVSLERRWSLEVAIEKVIGHDTS---GESVLENDEKV  353

Query  1456  LGNITVAYEREYMQGVLIRERIKSVD--GLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
             +       EREY+QGVLI E + + D   LS ++ +R+K  A+++++     + KG +SY
Sbjct  354   VDTNVPILEREYVQGVLISEIVTNSDYPMLSKKAKRRQKKLARDIKQ-PGETIIKGHRSY  412

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
              LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP+ GS+LTPPH + DF WKD
Sbjct  413   DLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNFPKVGSQLTPPHHAEDFKWKD  472

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FK++AADYMMSIC +  LREL SPGKSGS+F+LS DDRF+IKTL+KSE
Sbjct  473   YCPMVFRNLREMFKIDAADYMMSICGNAALRELSSPGKSGSVFFLSQDDRFMIKTLRKSE  532

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             ++VLL+MLP+Y+ HV+ +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H R+D
Sbjct  533   VQVLLQMLPNYFHHVRTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHRRFD  592

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGSSLGR  DK +I+E TTLKDLDL Y   ++    + L+KQ+ +DS+FLE+QHI+DYS
Sbjct  593   LKGSSLGRSADKIEIDENTTLKDLDLNYCFYLEPSWRDALLKQIEIDSKFLETQHIMDYS  652

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVS----SDGGISILPRSLTLVTHEPSIVST  2517
             LLLG+H+RAP+HL +      S+   + T++S     +  I   P+ L LV H     S 
Sbjct  653   LLLGVHYRAPQHLQSRASHHRSVTADRLTVLSVEDVQEDEIFSYPQGLVLVPHGSDENSV  712

Query  2518  APGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
               GPHIRG  LRA++ G  EVDLLLPGT RL++QLGVNMPA+A     +D+T   E    
Sbjct  713   VVGPHIRGSRLRASAAGFEEVDLLLPGTARLQIQLGVNMPARAEHSPAEDKTQLHE----  768

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA  2877
             EVYDVVLYLGIIDILQ YNM KK+EH YKS++FD +SISV++P+ YS+RF+ F++ VF  
Sbjct  769   EVYDVVLYLGIIDILQEYNMTKKIEHAYKSIQFDSLSISVVDPEFYSQRFLRFIQTVFPE  828

Query  2878  *P  2883
              P
Sbjct  829   NP  830


 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 61/119 (51%), Gaps = 0/119 (0%)
 Frame = +1

Query  601  TDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDG  780
            T   V P+   Y G +K  L HG G  T  +G  ++G W +G + G G+ +W++   Y G
Sbjct  124  TGTYVGPDNLTYKGRWKLNLKHGLGYETYPNGDVFEGSWIQGVVEGPGKYVWANENIYVG  183

Query  781  DCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
            +   G + G GT +  +G  Y+G+W   + HG G   + +   Y G W  G++DG G +
Sbjct  184  NMKRGKMSGKGTLTWKNGDKYEGNWLDGMIHGFGVYTWNDGGCYVGTWTRGLKDGKGAF  242


 Score = 72.4 bits (176),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 55/111 (50%), Gaps = 1/111 (1%)
 Frame = +1

Query  877   VGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDG  1056
             VG     N D Y G     + +G G+YTWS+G +Y G WK+G   G G + W +G +++G
Sbjct  55    VGELVLPNGDKYSGTLLGNMPEGSGKYTWSDGFIYEGEWKRGMRHGHGKITWPSGAVYEG  114

Query  1057  FWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG-TLYPVGCALDKCKIDG  1206
              +  G  HG+G Y   D   Y G W   LK G G   YP G   +   I G
Sbjct  115   EFSGGYMHGTGTYVGPDNLTYKGRWKLNLKHGLGYETYPNGDVFEGSWIQG  165



>ref|XP_010098819.1| Phosphatidylinositol-4-phosphate 5-kinase 9 [Morus notabilis]
 gb|EXB75907.1| Phosphatidylinositol-4-phosphate 5-kinase 9 [Morus notabilis]
Length=841

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/792 (49%), Positives = 518/792 (65%), Gaps = 42/792 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E +  NG+ Y G   G +P G+GKY  SDG  Y+G+W  G   G G+I W SGA Y+
Sbjct  51    RAGELLLSNGESYSGSLLGNIPEGRGKYVWSDGCVYEGEWRRGMRHGNGRIQWPSGAFYE  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  SD   YKG W+++++HG+G + Y N DV +G W +G  +G G+Y
Sbjct  111   GEFSGGYIHGTGTYIGSDKITYKGRWRLSLKHGLGYQVYPNGDVSEGSWIQGTPEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W +GD F+G W++G+ HG G Y ++DG +Y GTW+ 
Sbjct  171   TWANGNVYLGNMKGGKMSGKGTLTWISGDSFEGSWLNGMMHGFGVYTWSDGGFYVGTWTR  230

Query  1138  GLKDGRGTLYPVGC-----------ALDKCKI--DGHKEIRRMLSHDSSISKKDAVKPKV  1278
             GLKDG+G+ YP G            AL K  +  D  K+    + H +S+   D    KV
Sbjct  231   GLKDGKGSFYPQGSWLPAGQELYLNALRKRGLLPDLRKQNNGHIHHAASV---DMGNTKV  287

Query  1279  ------KRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCD  1440
                   +R+ S+++  R   +  +   R VS+    +L  S  +++  ++S  +S    +
Sbjct  288   VDSHGSRRNTSDRLSKRNLLNLEQSRGRNVSLERRWSLEVSIEKLIGNNSSLGISEPISE  347

Query  1441  GKAEQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFK  1614
             G  +  G      EREYMQGVLI E +   S    S ++ +R K  AKEV+K     + K
Sbjct  348   GGDKDAGTNIPILEREYMQGVLISELVLTSSFSRTSRRAKRRHKKLAKEVKK-PGEAIIK  406

Query  1615  GRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSID  1794
             G +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+S D
Sbjct  407   GHRSYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNFPKEGSQLTPPHQSED  466

Query  1795  FYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKT  1974
             F WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKT
Sbjct  467   FKWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKT  526

Query  1975  LKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHM  2154
             L+KSE+KVLL+MLP Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +
Sbjct  527   LRKSEVKVLLRMLPDYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRI  586

Query  2155  HHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQH  2334
             H R+DLKGSSLGR  DK +I+E TTLKDLDL Y   ++    E L+KQ+ +D +FLE+QH
Sbjct  587   HRRFDLKGSSLGRSADKVEIDENTTLKDLDLNYCFYLEPSWREALLKQIEIDRKFLEAQH  646

Query  2335  IIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSS-------------DGGISILPR  2475
             I+DYSLLLG+H+RAP+HL  L+    S       +V+              +  IS  P+
Sbjct  647   IMDYSLLLGVHYRAPQHLWPLMSYRGSRRADGLGMVAEEDFADDVQITETLEDHISNYPQ  706

Query  2476  SLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRK  2655
              L LV       S   GPHIRG  LRA++ GD EVDLLLPGT RL++QLGVNMPA+A + 
Sbjct  707   GLVLVPRGEDDNSVVVGPHIRGSRLRASAAGDEEVDLLLPGTARLQIQLGVNMPARAEQV  766

Query  2656  VKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLY  2835
             + + E    E    +VYDVVLYLGIIDILQ YNM KK+EH YKS +FD +SIS ++P  Y
Sbjct  767   LGKQE----EKMFNQVYDVVLYLGIIDILQDYNMSKKIEHAYKSFQFDSLSISAVDPTFY  822

Query  2836  SKRFISFLERVF  2871
             S RF+ F+++VF
Sbjct  823   SHRFLEFIKKVF  834



>ref|XP_008241370.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Prunus 
mume]
 ref|XP_008241371.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Prunus 
mume]
Length=821

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/781 (49%), Positives = 513/781 (66%), Gaps = 40/781 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PN + Y G   G +P G+G+Y  SDG  Y+G+W  G   G G+IIW SGA Y+
Sbjct  51    RVRELLLPNKESYSGPVLGNIPEGRGRYAWSDGCIYEGEWRRGMRHGSGKIIWPSGAIYE  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  SD   YKG W++N++HG+G + Y N D ++G W +G+ +G G+Y
Sbjct  111   GEFSGGYMHGTGTYIGSDKMTYKGRWRLNLKHGLGYQVYPNRDAFEGSWIQGMPEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW NGN+Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG +Y GTW+ 
Sbjct  171   TWVNGNVYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMMHGFGVYTWSDGGFYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSI---SKKDAVK  1269
             GLKDG+G+ YP G  L   +              D  K+    + H +S+   + K    
Sbjct  231   GLKDGKGSFYPKGSRLPAVEELYLNALRKRGLLPDLRKQNNAHIHHATSVDMGNSKIGES  290

Query  1270  PKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
                 R  ++K+ +R   +    S R VS+    +L  S  +V+  D        + +G  
Sbjct  291   QGSHRVSADKLSNRNLLNL-EPSHRNVSLERRWSLEVSFEKVIGRD--------SLEGGE  341

Query  1450  EQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
             +  G      EREYMQGVLI E +   S    S ++ +R+K  AK V++     + KG +
Sbjct  342   KDAGTGIPILEREYMQGVLISELVMNNSFTSSSRRAKRRQKKLAKVVKR-PGEAIIKGHR  400

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP+ GS+LTPPH+S+DF W
Sbjct  401   SYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNFPKDGSQLTPPHQSVDFRW  460

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+K
Sbjct  461   KDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRK  520

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE+KVLL+MLPSY+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H R
Sbjct  521   SEVKVLLRMLPSYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRR  580

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             +DLKGSSLGR  DK +I+E TTLKDLDL Y   ++    E L+ Q+ +DS+FLE+QHI+D
Sbjct  581   FDLKGSSLGRSADKIEIDENTTLKDLDLNYSFYLEPSWREALLNQIEIDSKFLEAQHIMD  640

Query  2344  YSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSS----DGGISILPRSLTLVTHEPSIV  2511
             YSLL+G+H+RAP+HL + +    S       +++     +  IS  P+ L L+       
Sbjct  641   YSLLMGVHYRAPQHLRSFMTYNRSTTADGLEILAEEETLEDEISNYPQGLVLIPRGTDDD  700

Query  2512  STAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVE  2691
             S   GPH+RG  LRA+S G  EVDLLLPGT RL++QLGVNMPA+A       E  P E +
Sbjct  701   SVVVGPHVRGSRLRASSAGYEEVDLLLPGTARLQIQLGVNMPARA-------EQVPGEEQ  753

Query  2692  LF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERV  2868
             +F EVYDVVLYLGIIDILQ Y+M KK+EH YKSL+FD +SIS ++P  YS RF+ F+ +V
Sbjct  754   IFPEVYDVVLYLGIIDILQDYSMGKKIEHAYKSLQFDSLSISAVDPTFYSHRFLEFIRKV  813

Query  2869  F  2871
             F
Sbjct  814   F  814



>ref|XP_010458464.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7-like isoform 
X2 [Camelina sativa]
Length=645

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/638 (59%), Positives = 457/638 (72%), Gaps = 21/638 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R+ ++ FPNGD Y G  KG+LP+GKGKY  SDGT Y+GDW++GK++GKG++ WSSGA Y+
Sbjct  4     RSGDREFPNGDFYSGEVKGLLPNGKGKYVWSDGTIYEGDWDQGKISGKGKLFWSSGAKYE  63

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GYLHG+GT +S D SVY G W+MN++HG+GRKEY NSD+YDG WKEG++DG G Y
Sbjct  64    GDFSGGYLHGYGTMTSPDDSVYSGTWRMNVRHGLGRKEYCNSDLYDGSWKEGLQDGRGSY  123

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             +W+NGN Y G WKKG M  RGVM+W NGDL+DGFW++G RHGSG Y+FADG  Y+GTWS 
Sbjct  124   SWTNGNRYIGSWKKGKMCERGVMRWANGDLYDGFWLNGFRHGSGVYKFADGCLYYGTWSR  183

Query  1138  GLKDGRGTLYPVGCALDKCK-----IDGHKEIRRMLSHDSSISKKDAVKPK-VKRSIS-E  1296
             GLKDG+G  YP G      K     ++     + +LS  +S++ ++      V RS+S E
Sbjct  184   GLKDGKGVFYPAGSKQPSLKKWCRSLEYDDTGKFVLSRSASVNVEELRSSNTVTRSLSVE  243

Query  1297  KIVDRFARDSGRISRRAVSVAGDAALHCS-----STEVLPEDASCMLSHTTCDGKAEQLG  1461
                   A+ SGRIS R      D    C      +T  +P   S   S +   G++E   
Sbjct  244   TSAGEMAKHSGRISDRYTD---DIWRSCDPPRDFTTCHVPLSKSARFSGS---GQSEGQD  297

Query  1462  NITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
                + YEREYMQG+LIRE I S    SH+   +     KEVR  S +   +G  +YYLM+
Sbjct  298   KNRIVYEREYMQGILIRETIMSSVDRSHKI--KPPLRPKEVRARSLLTFLRGEHNYYLMV  355

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDFG+ AR KM+FPR GS  TPPH+SIDF WKDYCP+
Sbjct  356   NLQLGIRYTVGKITPVPRREVRASDFGKNARTKMFFPRDGSNFTPPHKSIDFSWKDYCPM  415

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFYLS DDRFVIKTLKKSEL+VL
Sbjct  416   VFRNLREMFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYLSHDDRFVIKTLKKSELQVL  475

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L+MLP YY+HV  HENTLITKFFGV+RI+L+  KKVRFVVMGNMF TEL +H RYDLKGS
Sbjct  476   LRMLPKYYEHVGYHENTLITKFFGVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGS  535

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             S GRFT+K KI+E TTLKDLDL YE  MDKLL E L KQ+ LD  FLES +IIDYSLLLG
Sbjct  536   SQGRFTEKTKIQEKTTLKDLDLAYEFHMDKLLREALFKQIYLDCSFLESLNIIDYSLLLG  595

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPR  2475
             LHFRAP  L  +LEPP+++   + ++ S DG      R
Sbjct  596   LHFRAPGQLNDILEPPNAM-SDQESVSSVDGRCQCFKR  632



>ref|XP_009347972.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Pyrus 
x bretschneideri]
 ref|XP_009347973.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Pyrus 
x bretschneideri]
Length=827

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/785 (49%), Positives = 510/785 (65%), Gaps = 42/785 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PN + Y G   G +P GKGKY  SDG  Y+G+W  G   G G+IIWSSGA Y+
Sbjct  51    RVRELLLPNRESYSGPVLGNIPEGKGKYVWSDGCIYEGEWRRGMRHGNGKIIWSSGAVYE  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  SD   YKG W++N++HG+G + Y N D ++G W +G+ +G G+Y
Sbjct  111   GEFSGGYMHGTGTYIGSDKLTYKGRWRLNLKHGLGYQVYPNGDAFEGSWMQGLPEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW NGN+Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG +Y GTW+ 
Sbjct  171   TWVNGNVYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMMHGFGVYTWSDGGFYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKC-----------------KIDGHKEIRRMLSHDSSISKKDAV  1266
             GLKDG+G+ YP G  L                    +   +  I    S D   +K    
Sbjct  231   GLKDGKGSFYPKGSRLPAVEELYLNALRKRGLLPDLRKQNNAHIHHAGSGDMGNAKIGES  290

Query  1267  KPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
                  R+ ++KI +R   +  + S R VS+    +L  S  +V+  D S +      +G+
Sbjct  291   LQGSHRASADKISNRNLLNLEQ-SHRNVSLERRWSLEVSFEKVIGHDPSLL------EGR  343

Query  1447  AEQLGNITVAYEREYMQGVLIRERI---KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
              +  G      EREYMQGVLI E +              +++K      R G    + KG
Sbjct  344   EKDSGTEIPILEREYMQGVLISELVINNSFSSSSRRAKRRQKKLAKVVKRPGEA--IIKG  401

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPHRS+DF
Sbjct  402   HRSYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNFPKEGSQLTPPHRSVDF  461

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
              WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL
Sbjct  462   RWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTL  521

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMH  2157
             +KSE++VLL+MLPSY+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H
Sbjct  522   RKSEVQVLLRMLPSYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIH  581

Query  2158  HRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHI  2337
              R+DLKGSSLGR  DK +I+E TTLKDLDL Y   ++    E L+ Q+  DS+FLE+QHI
Sbjct  582   RRFDLKGSSLGRSADKIEIDENTTLKDLDLNYSFYLEPSWREALMNQIETDSKFLEAQHI  641

Query  2338  IDYSLLLGLHFRAPEHLTALLEPPDS-------LFKPKSTLVSSDGGISILPRSLTLVTH  2496
             +DYSLL+G+H+RAP+HL +++   ++       +   + TL   +  IS  P+ L L+  
Sbjct  642   MDYSLLMGVHYRAPQHLRSVMSYNNTNRADGLGILAEEETL---EDEISNYPQGLVLIPR  698

Query  2497  EPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETD  2676
                  S   GPH+RG  LRA+S G  EVDLLLPGT R ++QLGVNMPA+A  +V  ++ D
Sbjct  699   GTDDASVVVGPHVRGSRLRASSAGYEEVDLLLPGTARFQIQLGVNMPARA-EQVPGEQGD  757

Query  2677  PSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISF  2856
               +    EVYDVVLYLGIIDILQ Y+M KK+EH YKSL+FD +SIS ++P  YS+RF+ F
Sbjct  758   --QQTFHEVYDVVLYLGIIDILQDYSMGKKIEHAYKSLQFDSLSISAVDPTFYSRRFLEF  815

Query  2857  LERVF  2871
             + +VF
Sbjct  816   IRKVF  820



>ref|XP_006493544.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X1 [Citrus sinensis]
 ref|XP_006493545.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X2 [Citrus sinensis]
 ref|XP_006493546.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X3 [Citrus sinensis]
Length=822

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/781 (50%), Positives = 521/781 (67%), Gaps = 37/781 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   PNG+ Y G   G LP G GKY  SDG  Y+G+W  G   G G+I W SG  Y+
Sbjct  52    RVGELALPNGESYSGSLLGNLPEGLGKYIWSDGCIYEGEWRRGMRHGNGKIRWPSGTVYE  111

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  SDG  YKG W++N++HG+G + Y N DV++G W +G  +G G+Y
Sbjct  112   GEFSGGYIHGTGTYIGSDGLTYKGRWRLNLKHGLGYQVYPNGDVFEGSWIQGAAEGPGKY  171

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N ++Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG  Y GTWS 
Sbjct  172   TWANRDVYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMMHGFGVYTWSDGGSYVGTWSR  231

Query  1138  GLKDGRGTLYPVGCAL--------DKCKIDG-----HKEIRRMLSHDSSISKKDAVKPK-  1275
             GLKDG+GT YP G  L        +  +I G      ++      H SS+   +A  P  
Sbjct  232   GLKDGKGTFYPNGIQLSVLQEPYLNALRIRGLLPDMRRQTHAHAHHASSVEMANAKVPGN  291

Query  1276  --VKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
                +R  ++KI      +  +  R  VS+    +L  S  +V+  D+S  LS +  +G  
Sbjct  292   RGSRRISADKISKGNLINLEQSHRGNVSLERRWSLEVSFEKVIGHDSSLELSESISEGME  351

Query  1450  EQLG-NITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGR  1620
             +    N+    EREY+QGVLI E +   S    S +  +R++   KEV++     + KG 
Sbjct  352   KASDKNVAPILEREYIQGVLISEFVLNNSFSQSSRREKRRQRKLVKEVKR-PGETIIKGH  410

Query  1621  KSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFY  1800
             +SY LML+LQLGIRY+VGKITP+  R+VR SDFG +A   M FP++GS+LTPPH+S DF 
Sbjct  411   RSYDLMLSLQLGIRYTVGKITPVQRRDVRASDFGPRASFWMNFPKEGSQLTPPHQSEDFK  470

Query  1801  WKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLK  1980
             WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGSIF+LS DDRF+IKTL+
Sbjct  471   WKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSIFFLSQDDRFMIKTLR  530

Query  1981  KSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHH  2160
             KSE+KVLL+MLP+Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H 
Sbjct  531   KSEVKVLLQMLPTYHDHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHR  590

Query  2161  RYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHII  2340
             R+DLKGSSLGR TD  +I+E TTLKDLDL Y   ++    E L+KQ+ +DS+FLE+Q I+
Sbjct  591   RFDLKGSSLGRSTDNIEIDENTTLKDLDLNYCFYLEPSWREDLLKQIEIDSKFLEAQQIM  650

Query  2341  DYSLLLGLHFRAPEH---LTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIV  2511
             DYSLLLG+H+RAP+H   LT + E    +   +   +S+  G+ ++PR     T + S++
Sbjct  651   DYSLLLGVHYRAPQHLRSLTTIREDGLGIVAEEEDEISNYQGLVLVPRG----TDDSSVI  706

Query  2512  STAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVE  2691
             +   GPHIRG  LRA+S GD EVDLLLPGT RL++QLGVNMPA+A +   + E      +
Sbjct  707   A---GPHIRGSRLRASSAGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGKQE------D  757

Query  2692  LF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERV  2868
             LF + YDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P  YS RF+ F+E+V
Sbjct  758   LFHQSYDVVLYLGIIDILQEYNMSKKIEHAYKSLQFDSISISAVDPTFYSHRFLEFIEKV  817

Query  2869  F  2871
             F
Sbjct  818   F  818



>ref|XP_010267271.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Nelumbo 
nucifera]
 ref|XP_010267272.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Nelumbo 
nucifera]
Length=828

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/781 (50%), Positives = 512/781 (66%), Gaps = 30/781 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PNG+ Y G   G +P G GKY  +DG  Y+G+W  G   G G I W SGA YD
Sbjct  51    RVGELLLPNGESYSGSLLGNMPEGSGKYVWADGCVYEGEWRRGMRNGVGNIQWPSGAVYD  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+S  D  +YKG W++N++HG+G + Y N DV++G W +GV +G G+Y
Sbjct  111   GEFSGGYMHGTGTYSGPDNIIYKGRWRLNLKHGLGCQTYPNGDVFEGSWIQGVIEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
              W+NGN+Y G  K G MSG+G + W NGD F+G W+DG+ HG G Y ++DG  Y GTW+ 
Sbjct  171   VWANGNVYLGNMKGGKMSGKGTLTWTNGDSFEGNWLDGMMHGFGIYAWSDGGCYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCAL------------------DKCKIDGHKEIRRMLSHDSSISKKDA  1263
             GLKDG G  YP G                     D  K + H  IR   S D   + K +
Sbjct  231   GLKDGTGAFYPKGNRFPAVQELYLNALRKRGLLPDLRKQNHHSHIRHASSVDMG-NVKVS  289

Query  1264  VKPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDG  1443
                  +R   +K+      +  +   R  S+    +L  S  +V+  D S     +T +G
Sbjct  290   SNQGSRRGSYDKLSKGNLINFEQSRSRNYSLERRWSLEVSIEKVIGHDLSLSSGESTLEG  349

Query  1444  KAEQLGNITVAYEREYMQGVLIRERI-KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGR  1620
               +         EREYMQGVLI E +  +    S ++ +R+K  AKEV++     + KG 
Sbjct  350   DEKDTKMSAPILEREYMQGVLISEVVLNNFSSSSRRARRRQKKLAKEVKR-PGETIIKGH  408

Query  1621  KSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFY  1800
             +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+S DF 
Sbjct  409   RSYDLMLSLQLGIRYTVGKITPIQRREVRTSDFGPRASFWMNFPKEGSQLTPPHQSEDFK  468

Query  1801  WKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLK  1980
             WKDYCP+VFRNLR LFK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+
Sbjct  469   WKDYCPMVFRNLRELFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLR  528

Query  1981  KSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHH  2160
             KSE+KVLL+MLP Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H 
Sbjct  529   KSEVKVLLRMLPDYHHHVRTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHR  588

Query  2161  RYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHII  2340
             R+DLKGSSLGR ++  +I+E TTLKDLDL +   ++    E+L++Q+ +DS+FLE+Q+I+
Sbjct  589   RFDLKGSSLGRSSENIEIDENTTLKDLDLNFCFYLEPSWRESLLQQIEIDSRFLETQNIM  648

Query  2341  DYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVS----SDGGISILPRSLTLVTHEPSI  2508
             DYSLLLG+H+RAP+HL +L+    SL      +V+     +  IS  P+SL L+      
Sbjct  649   DYSLLLGVHYRAPQHLLSLVSYQRSLSADGLGIVAEEDVQEDEISNYPQSLVLIPRGTDD  708

Query  2509  VSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEV  2688
              S   GPHIRG  LRA++ G  EVDLLLPGT RL++QLGVNMPA+A R   + + D    
Sbjct  709   GSVVVGPHIRGSRLRASAAGYEEVDLLLPGTARLQIQLGVNMPARAERIPTEGKPD----  764

Query  2689  ELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERV  2868
                EVYDVVLYLGIIDILQ YNM KK+EH YKS++FD +SIS ++P  YS+RF+ F+++V
Sbjct  765   -FGEVYDVVLYLGIIDILQEYNMSKKIEHAYKSIQFDSLSISAVDPIFYSRRFLEFIQKV  823

Query  2869  F  2871
             F
Sbjct  824   F  824



>ref|XP_006428473.1| hypothetical protein CICLE_v10011083mg [Citrus clementina]
 gb|ESR41713.1| hypothetical protein CICLE_v10011083mg [Citrus clementina]
Length=824

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/783 (50%), Positives = 521/783 (67%), Gaps = 39/783 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   PNG+ Y G   G LP G GKY  SDG  Y+G+W  G   G G+I W SG  Y+
Sbjct  52    RVGELALPNGESYSGSLLGNLPEGLGKYIWSDGCIYEGEWRRGMRHGNGKIRWPSGTVYE  111

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  SDG  YKG W++N++HG+G + Y N DV++G W +G  +G G+Y
Sbjct  112   GEFSGGYIHGTGTYIGSDGLTYKGRWRLNLKHGLGYQVYPNGDVFEGSWIQGAAEGPGKY  171

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N ++Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG  Y GTWS 
Sbjct  172   TWANRDVYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMMHGFGVYTWSDGGSYVGTWSR  231

Query  1138  GLKDGRGTLYPVGCAL--------DKCKIDG-----HKEIRRMLSHDSSISKKDAVKPK-  1275
             GLKDG+GT YP G  L        +  +I G      ++      H SS+   +A  P  
Sbjct  232   GLKDGKGTFYPNGIQLSVLQEPYLNALRIRGLLPDMRRQTHAHAHHASSVEMANAKVPGN  291

Query  1276  --VKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
                +R  ++KI      +  +  R  VS+    +L  S  +V+  D+S  LS +  +G  
Sbjct  292   RGSRRISADKISKGNLINLEQSHRGNVSLERRWSLEVSFEKVIGHDSSLELSESISEGME  351

Query  1450  EQLG-NITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGR  1620
             +    N+    EREY+QGVLI E +   S    S +  +R++   KEV++     + KG 
Sbjct  352   KASDKNVAPILEREYIQGVLISEFVLNNSFSQSSRREKRRQRKLVKEVKR-PGETIIKGH  410

Query  1621  KSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFY  1800
             +SY LML+LQLGIRY+VGKITP+  R+VR SDFG +A   M FP++GS+LTPPH+S DF 
Sbjct  411   RSYDLMLSLQLGIRYTVGKITPVQRRDVRASDFGPRASFWMNFPKEGSQLTPPHQSEDFK  470

Query  1801  WKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLK  1980
             WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGSIF+LS DDRF+IKTL+
Sbjct  471   WKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSIFFLSQDDRFMIKTLR  530

Query  1981  KSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHH  2160
             KSE+KVLL+MLP+Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H 
Sbjct  531   KSEVKVLLQMLPTYHDHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHR  590

Query  2161  RYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHII  2340
             R+DLKGSSLGR TD  +I+E TTLKDLDL Y   ++    E L+KQ+ +DS+FLE+Q I+
Sbjct  591   RFDLKGSSLGRSTDNIEIDENTTLKDLDLNYCFYLEPSWREDLLKQIEIDSKFLEAQQIM  650

Query  2341  DYSLLLGLHFRAPEHLTALLEPPDSLF-----KPKSTLVSSDGGISILPRSLTLVTHEPS  2505
             DYSLLLG+H+RAP+HL +L    +        + K   +S+  G+ ++PR     T + S
Sbjct  651   DYSLLLGVHYRAPQHLRSLTTIREDGLGIVAEEGKQDEISNYQGLVLVPRG----TDDSS  706

Query  2506  IVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSE  2685
             +++   GPHIRG  LRA+S GD EVDLLLPGT RL++QLGVNMPA+A +   + E     
Sbjct  707   VIA---GPHIRGSRLRASSAGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGKQE-----  758

Query  2686  VELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLE  2862
              +LF + YDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P  YS RF+ F+E
Sbjct  759   -DLFHQSYDVVLYLGIIDILQEYNMSKKIEHAYKSLQFDSISISAVDPTFYSHRFLEFIE  817

Query  2863  RVF  2871
             +VF
Sbjct  818   KVF  820



>ref|XP_008387525.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Malus 
domestica]
Length=827

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/785 (49%), Positives = 514/785 (65%), Gaps = 42/785 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PN + Y G   G +P GKGKY  SD   YDG+W  G   G G+IIWSSGA Y+
Sbjct  51    RVREXLLPNRESYSGPVLGNIPEGKGKYVWSDXCIYDGEWRRGMRHGNGKIIWSSGAIYE  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  SD   YKG W++N++HG+G + Y N D ++G W +G+ +G G+Y
Sbjct  111   GEFSGGYMHGTGTYXXSDKLTYKGRWRLNLKHGLGYQVYPNGDAFEGSWMQGLPEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW NGN+Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG +Y GTW+ 
Sbjct  171   TWVNGNVYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMMHGFGVYTWSDGGFYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSISKKDA-VKPK  1275
             GLKDG+G+ YP G  L   +              D  K+    + H  S    +A +  +
Sbjct  231   GLKDGKGSFYPKGSRLPAVEELYLNALRKRGLLPDLRKQNNAHIHHAGSGDMGNAKIGER  290

Query  1276  VK---RSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
             ++   R+ ++KI +R   +  + S R VS+    +L  S  +V+  D S +      +G+
Sbjct  291   LQGSHRASABKISNRNLLNLEQ-SHRNVSLERRWSLEVSFEKVIGHDPSLL------EGR  343

Query  1447  AEQLGNITVAYEREYMQGVLIRERI---KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
              +         EREYMQGVLI E +              +++K      R G    + KG
Sbjct  344   EKDSETEIPILEREYMQGVLISELVINNSFSSSSRRAKRRQKKLAKVVKRPGEA--IIKG  401

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPHRS+DF
Sbjct  402   HRSYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNFPKEGSQLTPPHRSVDF  461

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
              WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL
Sbjct  462   RWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTL  521

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMH  2157
             +KSE++VLL+MLPSY+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H
Sbjct  522   RKSEVQVLLRMLPSYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIH  581

Query  2158  HRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHI  2337
              R+DLKGSSLGR  DK +I+E TTLKDLDL Y   ++    E L+ Q+  DS+FLE+QHI
Sbjct  582   RRFDLKGSSLGRSADKIEIDENTTLKDLDLNYSFYLEPSWREALMNQIETDSKFLEAQHI  641

Query  2338  IDYSLLLGLHFRAPEHLTALLEPPDS-------LFKPKSTLVSSDGGISILPRSLTLVTH  2496
             +DYSLL+G+H+RAP+HL +++   ++       +   + TL   +  IS  P+ L L+  
Sbjct  642   MDYSLLMGVHYRAPQHLRSVMSYNNTNRADGLGILAEEETL---EDEISNYPQGLVLIPR  698

Query  2497  EPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETD  2676
                  S   GPH+RG  LRA+S G  EVDLLLPGT R ++QLGVNMPA+A  +V  ++ D
Sbjct  699   GTDDASVVVGPHVRGSRLRASSAGFEEVDLLLPGTARFQIQLGVNMPARA-EQVPGEQGD  757

Query  2677  PSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISF  2856
               +    EVYDVVLYLGIIDILQ Y+M KK+EH YKSL+FD +SIS ++P  YS+RF+ F
Sbjct  758   --QQTFHEVYDVVLYLGIIDILQDYSMGKKIEHAYKSLQFDSLSISAVDPTFYSRRFLEF  815

Query  2857  LERVF  2871
             + +VF
Sbjct  816   IRKVF  820



>ref|XP_011094578.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Sesamum 
indicum]
 ref|XP_011094579.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Sesamum 
indicum]
 ref|XP_011094580.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Sesamum 
indicum]
 ref|XP_011094582.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Sesamum 
indicum]
Length=838

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/784 (49%), Positives = 518/784 (66%), Gaps = 29/784 (4%)
 Frame = +1

Query  589   NNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGA  768
             N  R+ E + PNG+ Y G   G +P G G Y  +DG  Y+G+W  G   G G++ WSSGA
Sbjct  50    NAFRSGEILLPNGESYSGSLLGNMPEGSGDYVWADGCKYEGEWRRGVRHGYGKLQWSSGA  109

Query  769   TYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGH  948
              Y+G+   GY+HG GT++  D  +YKG W++N++HG+G + + N DV++G W +G  +G 
Sbjct  110   VYEGEFAGGYMHGTGTYTRPDNLIYKGRWRLNLKHGLGYQNFPNGDVFEGSWIQGTPEGP  169

Query  949   GRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGT  1128
             G+YTW+NGN+Y G  K G MSG+G + W NGD F+G W++G+ HG G Y + DG  Y GT
Sbjct  170   GKYTWANGNVYLGNMKGGKMSGKGTLTWINGDSFEGSWLNGMMHGFGVYTWTDGGCYVGT  229

Query  1129  WSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRM--------------LSHDSSISKKDAV  1266
             W+ GLKDG+GT YP G  L   +      +R+               + H +S+   D  
Sbjct  230   WTRGLKDGKGTFYPKGNRLPAGQQLYLNALRKQGLLPDFRKQNQVSHIQHATSVDMGDVK  289

Query  1267  KPKVKRSI---SEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTC  1437
               + + S+   S+K+      +  +     VS+    +L  S  +VL    S  +S    
Sbjct  290   VGRNQVSVRNSSDKLSKGSLLNMEQSRNTNVSLERRWSLEVSIEKVLGHARSSSVSEAML  349

Query  1438  DGKAEQLGNITVAYEREYMQGVLIRERIKS--VDGLSHQSTQRRKFPAKEVRKGSCMDLF  1611
             DG   +        EREYMQGVLI E + S      S ++ +R+K  A+E+++     + 
Sbjct  350   DGGDNEDDMNPPILEREYMQGVLISELVLSNRFSPSSRRAKRRQKRLAREIKR-PGEQII  408

Query  1612  KGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSI  1791
             KG +SY LML+LQLGIRY+VGKITPI  REVR +DFG +A   M FP++GS+LTPPH+S 
Sbjct  409   KGHRSYDLMLSLQLGIRYTVGKITPIHRREVRATDFGPRASFWMNFPKEGSQLTPPHQSE  468

Query  1792  DFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIK  1971
             DF WKDYCP+VFR+LR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IK
Sbjct  469   DFKWKDYCPMVFRDLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIK  528

Query  1972  TLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELH  2151
             TL+KSE+KVLL+MLP+Y++HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL 
Sbjct  529   TLRKSEVKVLLRMLPNYHRHVRRYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELR  588

Query  2152  MHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQ  2331
             +H R+DLKGSSLGR  DK +I+E T LKDLDL Y   ++      L++Q+ +DS+FLES+
Sbjct  589   IHRRFDLKGSSLGRSADKVEIDENTILKDLDLNYCFYLEPSWRVALLQQIEIDSKFLESE  648

Query  2332  HIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SILPRSLTLVTHEPS  2505
             +I+DYSLLLG+H+RAP+HL +L+     +      +V+ D  +   I P  L LV     
Sbjct  649   NIMDYSLLLGVHYRAPQHLRSLMSYSQRMSVDGLGIVAEDESMEDEISPEGLVLVPRGTD  708

Query  2506  IVSTAPGPHIRGKTLRA-NSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPS  2682
               S   GPHIRG  LRA +S GD+EVDLLLPGT RL++QLGVNMPA+A      D+T   
Sbjct  709   DSSVVVGPHIRGSRLRASSSTGDKEVDLLLPGTARLQIQLGVNMPARAEHIPGGDDT---  765

Query  2683  EVELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFL  2859
               E+F EVYDVVLYLGIIDILQ YN+ KK+EH YKS++FD +SIS ++P  YS+RF+ F+
Sbjct  766   --EMFHEVYDVVLYLGIIDILQEYNISKKIEHAYKSMQFDSVSISAVDPSFYSERFLDFI  823

Query  2860  ERVF  2871
             ++VF
Sbjct  824   KKVF  827



>gb|KHG10636.1| Phosphatidylinositol-4-phosphate 5-kinase 9 -like protein [Gossypium 
arboreum]
Length=825

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/778 (49%), Positives = 510/778 (66%), Gaps = 30/778 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PNGD Y G   G +P G+GKY    G  Y+G+W  G   G G+I W SG  YD
Sbjct  51    RVGELLLPNGDSYSGSLLGNMPEGQGKYVWQGGCVYEGEWRRGMRQGIGKIQWPSGTVYD  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  S+   YKG WK++++HG+G + Y N DV++G W +G  +G G+Y
Sbjct  111   GEFSGGYMHGTGTYIGSNKLTYKGRWKLSLKHGLGYQVYPNGDVFEGSWMQGTPEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W NGD F+G W++G+ HG G Y + DG  Y GTW+ 
Sbjct  171   TWANGNVYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMIHGFGVYTWRDGGCYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSISKKDAVK---  1269
             GLKDG+G+ YP G  L   +              D  K+    + H +S+    +VK   
Sbjct  231   GLKDGKGSFYPQGNRLPASQEVYLNALRKRGLLPDLRKQNHSHIHHAASVDM-GSVKVGG  289

Query  1270  PKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
              +V    S+K+ +    +  +   R VS+    +L  S  +V+  D+S  LS +  +G+ 
Sbjct  290   NRVSNRNSDKLSEGNLLNLQQSRNRNVSLERRWSLEVSIEKVIGHDSSLELSDSFKEGRE  349

Query  1450  EQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
                       EREYMQGVLI E +   S    S ++ +R K  AKEV++     + KG +
Sbjct  350   NGSETNAPILEREYMQGVLISELVLNNSFSPPSRRAKRRHKKLAKEVKR-PGEAIIKGHR  408

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITP+  REVR SDFG +A   M FP+ GS+LTP H+S DF W
Sbjct  409   SYDLMLSLQLGIRYTVGKITPVQRREVRASDFGPRASFWMNFPKVGSQLTPTHQSDDFKW  468

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGSIF+LS DDRF+IKTL+K
Sbjct  469   KDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSIFFLSQDDRFMIKTLRK  528

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE+KVLL+MLP+Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H R
Sbjct  529   SEVKVLLRMLPNYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRR  588

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             YDLKGSS GR  D  +I+E TTLKDLDL Y   ++    + L++Q+ +DS+FLE+Q I+D
Sbjct  589   YDLKGSSQGRSADNVEIDENTTLKDLDLNYCFFLEPSWRDALLRQIEIDSKFLEAQCIMD  648

Query  2344  YSLLLGLHFRAPEHLTALL--EPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVST  2517
             YSLLLG+H+RAP+HL +L+     D L    S     +  I+  P+ L LV       S 
Sbjct  649   YSLLLGVHYRAPQHLRSLMSYNRTDGL---GSVAEEEEDEITNYPQGLVLVPRGTDDNSV  705

Query  2518  APGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
               G HIRG+ LRA++VGD EVDLLLPGT RL++QLGVNMPA+A +   ++E         
Sbjct  706   VAGSHIRGRRLRASAVGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGKEEN-----MFH  760

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             E YDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P  YS+RF+ F+++VF
Sbjct  761   ESYDVVLYLGIIDILQEYNMTKKIEHAYKSLQFDSLSISAVDPTFYSQRFLQFIQKVF  818



>gb|KEH42149.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Medicago 
truncatula]
Length=821

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/789 (48%), Positives = 516/789 (65%), Gaps = 48/789 (6%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   PNG+ Y G   G +P G+GKY  SDG  YDG+W  G   G G+I W SG  Y+
Sbjct  44    RVRELSLPNGESYSGSLLGNVPEGQGKYVWSDGCVYDGEWRRGMRNGFGKIQWPSGVLYE  103

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG G++   +   YKG W+ N++HG+G + Y N D+++G W +G  +G G+Y
Sbjct  104   GEFSGGYIHGTGSYIGPECLTYKGRWRFNLKHGLGYQVYPNGDIFEGSWIQGNPEGPGKY  163

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W +GD F+G W++G+ HG G Y + DG  Y GTW+ 
Sbjct  164   TWANGNVYLGNMKGGTMSGKGTLTWVSGDSFEGSWLNGMMHGLGAYTWGDGGCYVGTWTR  223

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSISKKDAVKPKV  1278
             GLKDG+GT YP G  L   +              D  K+ +  + + +S+   +    + 
Sbjct  224   GLKDGKGTFYPKGSCLPSAQEVYLNALRKRGLLPDLRKQNQVHIHNTASVDMGNGRFGET  283

Query  1279  KRS--ISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAE  1452
             +R+  +     +    D  R   + VS+    +L  +  +V+  D+    + +   G  +
Sbjct  284   RRTGGVPSGTGNLLNLDQSR--SKNVSLERRWSLEVAIEKVIGHDSQFASTDSVFAGGNK  341

Query  1453  QLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKS  1626
             ++       EREYMQGVLI E +   S   L+ ++ Q +K  AK++++     + KG +S
Sbjct  342   EVNEKIPILEREYMQGVLISEVVLNNSFASLTRRAKQLKKKIAKDIKR-PGEQIIKGHRS  400

Query  1627  YYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWK  1806
             Y LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+S DF WK
Sbjct  401   YDLMLSLQLGIRYTVGKITPIQRREVRASDFGAKASFWMNFPKEGSQLTPPHQSEDFKWK  460

Query  1807  DYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKS  1986
             DYCP+VFRNLR LFK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL++S
Sbjct  461   DYCPMVFRNLRELFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRRS  520

Query  1987  ELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRY  2166
             E+KVLL+MLP Y+ HVK +ENTL+TKFFG++RI     +K RFVVMGNMF TEL +H R+
Sbjct  521   EVKVLLRMLPDYHHHVKSYENTLVTKFFGLHRIIPSSGQKFRFVVMGNMFCTELRIHRRF  580

Query  2167  DLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDY  2346
             DLKGSSLGR +DK +I+E TTLKDLDL Y   ++    E+L+KQ+  DS+FLE QHI+DY
Sbjct  581   DLKGSSLGRSSDKIEIDENTTLKDLDLNYCFYLEPSWRESLLKQIETDSKFLEEQHIMDY  640

Query  2347  SLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISIL-------------PRSLTL  2487
             SLLLG+H+RAP+     L PP S     S  +SSD G++IL             P+ L L
Sbjct  641   SLLLGVHYRAPQQ----LRPPVSF----SHSISSD-GLAILAEEDPLEDEVYNYPQGLVL  691

Query  2488  VTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQD  2667
             V       S   G H+RG  LRA++ GD EVDLLLPGT RL++QLGVNMPA+A +   ++
Sbjct  692   VPRGADDGSVVVGSHVRGSRLRASAAGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGKE  751

Query  2668  ETDPSEVELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKR  2844
             ET     ++F E YDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P  YS+R
Sbjct  752   ET-----QMFHEAYDVVLYLGIIDILQDYNMTKKIEHAYKSLQFDSLSISAVDPTFYSRR  806

Query  2845  FISFLERVF  2871
             F+ F+++VF
Sbjct  807   FLDFIQKVF  815


 Score = 53.9 bits (128),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 37/80 (46%), Gaps = 0/80 (0%)
 Frame = +1

Query  580  IMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWS  759
            I  N E   +  + NG+VY+G  KG    GKG  T   G +++G W  G M G G   W 
Sbjct  153  IQGNPEGPGKYTWANGNVYLGNMKGGTMSGKGTLTWVSGDSFEGSWLNGMMHGLGAYTWG  212

Query  760  SGATYDGDCFEGYLHGFGTF  819
             G  Y G    G   G GTF
Sbjct  213  DGGCYVGTWTRGLKDGKGTF  232



>ref|XP_011018813.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Populus 
euphratica]
 ref|XP_011018814.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Populus 
euphratica]
 ref|XP_011018815.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Populus 
euphratica]
Length=828

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/779 (50%), Positives = 513/779 (66%), Gaps = 30/779 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   PNG+ Y G   G  P G GKY  SDG  Y+G+W  G   G G+I W SG  Y+
Sbjct  52    RVGELCLPNGESYSGSLLGNAPEGNGKYVWSDGCVYEGEWRRGMRHGNGKIQWPSGTAYE  111

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  S+   YKG W++N++HG+G + Y N D+++G W +G  +G G+Y
Sbjct  112   GEFSGGYMHGAGTYVGSNNLTYKGRWRLNLKHGLGYQVYPNGDIFEGSWIQGSPEGLGKY  171

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G M+G+G + W NGD F+G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  172   TWANGNVYHGDMKGGKMTGKGTLTWTNGDSFEGSWLNGMMHGFGVYTWSDGGCYVGTWTR  231

Query  1138  GLKDGRGTLYPVGC-----------ALDKCKI--DGHKEIRRMLSHDSSISKKDAVKPKV  1278
             GLKDG+G+ YP G            AL K  +  D  K+   ++ H SS++  + VK   
Sbjct  232   GLKDGKGSFYPKGSRFQAAEERYLNALRKRGVLPDLRKQNHALIHHASSVNMGN-VKVGE  290

Query  1279  KRSISEKIVDRFARDS----GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
              +       D+ ++ +     +   + VS+    +L     +V+  D+S  LS     GK
Sbjct  291   NQGSRHNSSDKLSKGNLLTLEQSRNKNVSLERRWSLEVYIEKVIGHDSSLDLSEGL--GK  348

Query  1447  AEQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGR  1620
              E   N     EREYMQGVLI E +   S    S ++ +R+K  AKEV++     + KG 
Sbjct  349   -EFETNTPPILEREYMQGVLISELVLNSSFSSSSRRTKKRQKKLAKEVKR-PGEAIIKGH  406

Query  1621  KSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFY  1800
             +SY LML+LQLGIRY+VGKITP+  REVR SDFG +A   M FP+ GS+LTPPH+S DF 
Sbjct  407   RSYDLMLSLQLGIRYTVGKITPVQRREVRASDFGPRASFWMNFPKDGSQLTPPHQSEDFK  466

Query  1801  WKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLK  1980
             WKDYCP+VFRNLR +FK+++ADYMMSIC +D LREL SPGKSGSIF+LS DD F+IKTL+
Sbjct  467   WKDYCPMVFRNLREMFKIDSADYMMSICGNDALRELSSPGKSGSIFFLSQDDHFMIKTLR  526

Query  1981  KSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHH  2160
             KSE+KVLLKMLP Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H 
Sbjct  527   KSEVKVLLKMLPDYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHR  586

Query  2161  RYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHII  2340
             R+DLKGSSLGR T+  +IEE TTLKDLDL Y   ++    E L++Q+ +DS+FLE QHI+
Sbjct  587   RFDLKGSSLGRSTENVEIEENTTLKDLDLNYCFYLEPSWREALLQQIEIDSKFLEVQHIM  646

Query  2341  DYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SILPRSLTLVTHEPSIVS  2514
             DYSLLLG+H+RAP+HL +L+    S+      +++ +  I     P+ L LV       S
Sbjct  647   DYSLLLGVHYRAPQHLRSLMSYNRSITAEGLRVLAEEDTIEDENYPQGLVLVPRGTDDDS  706

Query  2515  TAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVEL  2694
                GPHIRG  LRA+S GD EVDLLLPGT RL++QLGVNMP++A +   ++E        
Sbjct  707   VVVGPHIRGSRLRASSAGDEEVDLLLPGTARLQIQLGVNMPSRAEQIPGEEEKQT----F  762

Query  2695  FEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
              E YDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P  YS+RF+ F+++VF
Sbjct  763   HEAYDVVLYLGIIDILQEYNMSKKIEHAYKSLQFDSLSISAVDPTFYSRRFLEFIQKVF  821


 Score = 70.9 bits (172),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  862   NIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNG  1041
             NI   VG     N + Y G       +G+G+Y WS+G +Y G W++G   G G ++W +G
Sbjct  48    NIAFRVGELCLPNGESYSGSLLGNAPEGNGKYVWSDGCVYEGEWRRGMRHGNGKIQWPSG  107

Query  1042  DLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG-TLYPVGCALDKCKIDGHKE  1215
               ++G +  G  HG+G Y  ++   Y G W   LK G G  +YP G   +   I G  E
Sbjct  108   TAYEGEFSGGYMHGAGTYVGSNNLTYKGRWRLNLKHGLGYQVYPNGDIFEGSWIQGSPE  166



>ref|XP_007144386.1| hypothetical protein PHAVU_007G152000g [Phaseolus vulgaris]
 gb|ESW16380.1| hypothetical protein PHAVU_007G152000g [Phaseolus vulgaris]
Length=821

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/792 (48%), Positives = 512/792 (65%), Gaps = 50/792 (6%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   PNG+ Y G   G +P G+GKY  SDG  YDG+W  G   G G+I W SG  Y+
Sbjct  51    RVGELSLPNGESYFGSLLGNIPEGQGKYVWSDGCVYDGEWRRGMTNGFGKIQWPSGVMYE  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+   +   Y G W++N++HG+G + Y N D+++G W +G  +G G+Y
Sbjct  111   GEFSGGYIHGTGTYIGPNNLTYNGRWRLNLKHGLGYQVYPNGDIFEGSWIQGTPEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W +GD F+G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  171   TWANGNVYLGNMKGGRMSGKGTLTWVSGDAFEGSWLNGMMHGLGAYTWSDGGCYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSISKKDAVKPKV  1278
             GLKDG+GT YP G  L   +              D  K+ +  + H +S+   D    + 
Sbjct  231   GLKDGKGTFYPKGSCLPSAQEIYLNALRKRGLLPDLRKQKQVHIHHAASVDMGDVKVGES  290

Query  1279  KRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQL  1458
             +R  S+K+      +  +   + +S+    +L  S  +V+  D+       + D  AE  
Sbjct  291   QRFSSDKLAKGNLLNLEQSRSKNISLERRWSLEVSIEKVIGHDSKL----GSTDSIAEN-  345

Query  1459  GNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYY  1632
             G+     EREYMQGVLI E +   S   +S ++ Q +K  AKE+++     + KG +SY 
Sbjct  346   GDKVPILEREYMQGVLISELVLNNSFSSMSRRAKQLQKKLAKEIKR-PGEAIIKGHRSYD  404

Query  1633  LMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDY  1812
             LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+S  F WKDY
Sbjct  405   LMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNFPKEGSQLTPPHQSEGFKWKDY  464

Query  1813  CPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSEL  1992
             CP+VFRNLR LFK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL++SE+
Sbjct  465   CPMVFRNLRELFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRRSEV  524

Query  1993  KVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDL  2172
             KVLL+MLP Y+ HVK ++NTL+TKFFG++RI     +K RFVVMGNMF TEL +H RYDL
Sbjct  525   KVLLRMLPDYHHHVKTYDNTLVTKFFGLHRIIPSSGQKFRFVVMGNMFCTELRIHRRYDL  584

Query  2173  KGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSL  2352
             KGSS GR +DK +I+E TTLKDLDL Y   ++    E+L+KQ+ +DS+FLE Q I+DYSL
Sbjct  585   KGSSCGRSSDKIEIDENTTLKDLDLNYCFYLEPSWRESLLKQIEIDSKFLELQQIMDYSL  644

Query  2353  LLGLHFRAPEHL-----------TALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHE  2499
             LLG+H+RAP+ L             +L   D L    S            P+ L LV   
Sbjct  645   LLGVHYRAPQQLRPYNQSRTIDGLPILAEEDPLEDESSN----------YPQGLVLVPRG  694

Query  2500  PSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDP  2679
                 S   G HIRG  LRA++ GD EVDLLLPGT RL++QLGVNMPA+A +   ++    
Sbjct  695   ADDNSVVVGSHIRGSRLRASAAGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGKE----  750

Query  2680  SEVELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISF  2856
              EV++F E YDVVLYLGIIDILQAYNM KK+EH YKS++FD +SIS ++P  YS+RF+ F
Sbjct  751   -EVQMFHEAYDVVLYLGIIDILQAYNMTKKIEHAYKSIQFDSLSISAVDPTFYSRRFLDF  809

Query  2857  LERVFRA*PHKF  2892
             +++VF   PH+ 
Sbjct  810   IQKVFP--PHEM  819



>ref|XP_010696315.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010696317.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Beta 
vulgaris subsp. vulgaris]
Length=835

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/787 (49%), Positives = 517/787 (66%), Gaps = 31/787 (4%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             M +  R  E V PNG+ Y G   G LP G GKY  SDG  Y+G+W  G   G G++ + S
Sbjct  49    MASGFRVGEIVLPNGESYSGSMLGNLPEGSGKYVWSDGCVYEGEWRRGMRQGCGKLSFPS  108

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+G+   GY+HG GT+       YKG W++N++HG+G + Y N DV++G W +   +
Sbjct  109   GAVYEGEFSGGYMHGQGTYICPGHMTYKGRWRLNVKHGLGYQVYANRDVFEGSWMQASPE  168

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G G+YTW+NGN+Y G  K G MSG+G + W NGD+F+G W++G+ HG G Y ++DG  Y 
Sbjct  169   GPGKYTWANGNVYLGNMKGGFMSGKGSLTWTNGDMFEGSWLNGMMHGVGVYTWSDGGCYV  228

Query  1123  GTWSNGLKDGRGTLYPVGC-----------ALDKCKIDGHKEIRRMLSHDSSISKKDAVK  1269
             GTW+ GLKDG+G  YP G            AL K  +    + +  +SH    S  +   
Sbjct  229   GTWTRGLKDGKGAYYPKGTKLPAAQELYLGALRKRGVLPDFKKQNQVSHLHQASSVNLEN  288

Query  1270  PKVKRSIS------EKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHT  1431
              KV RS        +K+  R   +  +   + +S+    +L  S  +V+  D S   S +
Sbjct  289   FKVGRSRESRRPPIDKLSKRNLLNLEQSREKNISLERRWSLEVSIEKVIGHDTSSSFSES  348

Query  1432  TCDGKAEQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMD  1605
               +G+ +++       EREYMQGVLI E +   S    S ++ +R++  AKEV++     
Sbjct  349   LAEGREKEVETNIPILEREYMQGVLISEMVVNNSFSPRSRRAKRRQRKLAKEVKR-PGEA  407

Query  1606  LFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHR  1785
             + KG +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+
Sbjct  408   IIKGHRSYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMSFPKEGSQLTPPHQ  467

Query  1786  SIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFV  1965
             S DF WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+
Sbjct  468   SDDFKWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFM  527

Query  1966  IKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTE  2145
             IKTL+KSE+KVLL+MLP Y+ HV+ ++NTLITKFFG++RI     +K RFVVMGNMF TE
Sbjct  528   IKTLRKSEVKVLLRMLPEYHHHVRTYDNTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTE  587

Query  2146  LHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLE  2325
             L +H R+D+KGSS GR  DK +I+E T LKDLDL Y   ++    E L+ Q+ +DS+FLE
Sbjct  588   LRIHRRFDVKGSSQGRSADKVEIDENTILKDLDLNYSFYLEPSWREALMNQIKIDSKFLE  647

Query  2326  SQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSS----DGGISILPRSLTLVT  2493
             SQHI+DYSLLLG+H+RAP+HL + +    S+      +V+     D G+   P+SL LV 
Sbjct  648   SQHIMDYSLLLGVHYRAPQHLRSNISGTRSMNSDGLGVVAEEDAWDDGMLSYPQSLVLVP  707

Query  2494  HEPSIVSTAPGPHIRGKTLRANS-VGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDE  2670
                   S   G HIRG  LRA S  G+ EVDLLLPGT RL++QLGVNMPA+A R +++  
Sbjct  708   RGDD-SSVVVGSHIRGSRLRATSAAGNEEVDLLLPGTARLQIQLGVNMPARAERSIEE--  764

Query  2671  TDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFI  2850
                SEV   EVYDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P  YS+RF+
Sbjct  765   ---SEVTCHEVYDVVLYLGIIDILQDYNMSKKIEHAYKSLQFDSLSISAVDPTFYSERFL  821

Query  2851  SFLERVF  2871
              F+++VF
Sbjct  822   GFVQKVF  828



>gb|EAY88067.1| hypothetical protein OsI_09497 [Oryza sativa Indica Group]
Length=824

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/787 (48%), Positives = 515/787 (65%), Gaps = 49/787 (6%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E    NGD+Y G   G  P G G+Y  SDG TYDG+W  G   G+G+ +W SGATY+
Sbjct  54    RVGEIRLSNGDIYFGTLLGNTPEGSGRYVWSDGCTYDGEWRRGMRHGQGKTMWPSGATYE  113

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY++G GT++ SD  VYKG WK+N +HG+G + Y N D++DG W +G  +GHG+Y
Sbjct  114   GEYSGGYIYGEGTYTGSDNIVYKGRWKLNRKHGLGCQTYPNGDMFDGSWIQGEIEGHGKY  173

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN Y G  K G MSG+G + W NGD ++G W+DG+ HG G Y + +  YY GTW+ 
Sbjct  174   TWANGNTYVGNMKNGKMSGKGTLTWKNGDSYEGNWLDGMMHGYGIYTWNECGYYVGTWTK  233

Query  1138  GLKDGRGTLYPVGCAL---DKCKIDGHK------EIRRM-----LSHDSSIS--------  1251
             GLKDG+GT YP GC +   D+  I+  +      +IRR      + H SS+         
Sbjct  234   GLKDGKGTFYPKGCRVPVNDELYINNLRNRGVLPDIRRQNHGSRILHSSSVDMGNMKVGL  293

Query  1252  KKDAVKPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHT  1431
              +++  P  +R+ SE+              + VS+    +L  +  + +  DA+     +
Sbjct  294   TRESSGPSSRRNSSEQP-----------HSKNVSLERRWSLEVAIEKFIGHDATG----S  338

Query  1432  TCDGKAEQLGNITVAY-EREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCM  1602
             +   ++E + +  +   EREYMQGVLI E +  +S    S ++ +R+K   +E +K    
Sbjct  339   SGLERSESINDSDLPMLEREYMQGVLISEVVLDRSFSDSSKKAKRRQKKIVRETKK-PGE  397

Query  1603  DLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPH  1782
              + KG +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GSRLTP H
Sbjct  398   TIIKGHRSYDLMLSLQLGIRYTVGKITPIQKREVRASDFGPRASFWMTFPKEGSRLTPSH  457

Query  1783  RSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRF  1962
              + DF WKDYCP+VFRNLR +FK++AADYM+SIC +  LREL SPGKSGS+F+LS DDRF
Sbjct  458   PAEDFKWKDYCPMVFRNLREMFKIDAADYMISICGNSALRELSSPGKSGSVFFLSQDDRF  517

Query  1963  VIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYT  2142
             +IKTL+KSE++VLL+MLP YY HV+ +ENTLITKFFG++R+     +K RFVVMGNMF T
Sbjct  518   MIKTLRKSEVQVLLRMLPKYYHHVRTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCT  577

Query  2143  ELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFL  2322
             EL +H R+DLKGSSLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+  DS+FL
Sbjct  578   ELRIHRRFDLKGSSLGRSTDKIEIDENTTLKDLDLNYSFYLEPSWREALLKQIETDSEFL  637

Query  2323  ESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS----ILPRSLTLV  2490
              +Q I+DYSLLLG+H+RAP+HL        S+   + T++S +          P  L LV
Sbjct  638   RTQRIMDYSLLLGVHYRAPQHLRTRASYHRSMAADRLTVLSEEDAQEDDAFNYPEGLVLV  697

Query  2491  THEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDE  2670
                    S   GPHIRG  LR+ + G  EVDLLLPGT RL++QLGVNMPA+A +  K++E
Sbjct  698   QRGGDENSVVVGPHIRGSRLRSTAAGFAEVDLLLPGTARLQIQLGVNMPARAEQNPKEEE  757

Query  2671  TDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFI  2850
             +        EVYDVVLYLGIIDILQ YNM KK+EH  KS+++D +SIS ++P+ YS+RF+
Sbjct  758   SK----SFREVYDVVLYLGIIDILQEYNMSKKIEHAVKSMQYDSISISAVDPQFYSERFL  813

Query  2851  SFLERVF  2871
              F++ VF
Sbjct  814   KFIQTVF  820



>ref|XP_008779154.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X2 [Phoenix dactylifera]
Length=826

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/782 (49%), Positives = 518/782 (66%), Gaps = 35/782 (4%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             E V PNGD Y G   G +P G GKYT SDG  Y+G+W+ G   G G+I W SGA Y+G+ 
Sbjct  57    ELVLPNGDKYSGTLLGNMPEGSGKYTWSDGFIYEGEWKRGMRHGHGKITWPSGAVYEGEF  116

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+HG GT+   D   YKG WK+N++HG+G + Y N DV++G W +GV +G G+Y W+
Sbjct  117   SGGYMHGTGTYVGPDNLTYKGRWKLNLKHGLGYETYPNGDVFEGSWIQGVVEGPGKYVWA  176

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             N N+Y G  K+G MSG+G + W NGD ++G W+DG+ HG G Y + DG  Y GTW+ GLK
Sbjct  177   NENIYVGNMKRGKMSGKGTLTWKNGDKYEGNWLDGMIHGFGVYTWNDGGCYVGTWTRGLK  236

Query  1147  DGRGTLYPVGC---ALDKCKIDGHK------EIRRM-----LSHDSSISKKDAVKPKVKR  1284
             DG+G  YP GC   A+ +  I+  +      +++R      + H SSI   +    + K 
Sbjct  237   DGKGAFYPKGCKIPAVQELYINALRTRGMLLDLKRQNHGQRILHSSSIDMGNMKVSETKD  296

Query  1285  SIS--EKIVDRFARDS-GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQ  1455
             S S    I+ +    S G+   + VS+    +L  +  +V+  D S     +  +   + 
Sbjct  297   SGSGLSGILPKGNLISFGQSCSQRVSLERRWSLEVAIEKVIGHDTS---GESVLENDEKV  353

Query  1456  LGNITVAYEREYMQGVLIRERIKSVD--GLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
             +       EREY+QGVLI E + + D   LS ++ +R+K  A+++++     + KG +SY
Sbjct  354   VDTNVPILEREYVQGVLISEIVTNSDYPMLSKKAKRRQKKLARDIKQ-PGETIIKGHRSY  412

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
              LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP+ GS+LTPPH + DF WKD
Sbjct  413   DLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNFPKVGSQLTPPHHAEDFKWKD  472

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FK++AADYMMSIC +  LREL SPGKSGS+F+LS DDRF+IKTL+KSE
Sbjct  473   YCPMVFRNLREMFKIDAADYMMSICGNAALRELSSPGKSGSVFFLSQDDRFMIKTLRKSE  532

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
                 ++MLP+Y+ HV+ +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H R+D
Sbjct  533   ----VQMLPNYFHHVRTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHRRFD  588

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGSSLGR  DK +I+E TTLKDLDL Y   ++    + L+KQ+ +DS+FLE+QHI+DYS
Sbjct  589   LKGSSLGRSADKIEIDENTTLKDLDLNYCFYLEPSWRDALLKQIEIDSKFLETQHIMDYS  648

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVS----SDGGISILPRSLTLVTHEPSIVST  2517
             LLLG+H+RAP+HL +      S+   + T++S     +  I   P+ L LV H     S 
Sbjct  649   LLLGVHYRAPQHLQSRASHHRSVTADRLTVLSVEDVQEDEIFSYPQGLVLVPHGSDENSV  708

Query  2518  APGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
               GPHIRG  LRA++ G  EVDLLLPGT RL++QLGVNMPA+A     +D+T   E    
Sbjct  709   VVGPHIRGSRLRASAAGFEEVDLLLPGTARLQIQLGVNMPARAEHSPAEDKTQLHE----  764

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA  2877
             EVYDVVLYLGIIDILQ YNM KK+EH YKS++FD +SISV++P+ YS+RF+ F++ VF  
Sbjct  765   EVYDVVLYLGIIDILQEYNMTKKIEHAYKSIQFDSLSISVVDPEFYSQRFLRFIQTVFPE  824

Query  2878  *P  2883
              P
Sbjct  825   NP  826


 Score = 74.7 bits (182),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 61/119 (51%), Gaps = 0/119 (0%)
 Frame = +1

Query  601  TDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDG  780
            T   V P+   Y G +K  L HG G  T  +G  ++G W +G + G G+ +W++   Y G
Sbjct  124  TGTYVGPDNLTYKGRWKLNLKHGLGYETYPNGDVFEGSWIQGVVEGPGKYVWANENIYVG  183

Query  781  DCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
            +   G + G GT +  +G  Y+G+W   + HG G   + +   Y G W  G++DG G +
Sbjct  184  NMKRGKMSGKGTLTWKNGDKYEGNWLDGMIHGFGVYTWNDGGCYVGTWTRGLKDGKGAF  242


 Score = 72.4 bits (176),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 55/111 (50%), Gaps = 1/111 (1%)
 Frame = +1

Query  877   VGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDG  1056
             VG     N D Y G     + +G G+YTWS+G +Y G WK+G   G G + W +G +++G
Sbjct  55    VGELVLPNGDKYSGTLLGNMPEGSGKYTWSDGFIYEGEWKRGMRHGHGKITWPSGAVYEG  114

Query  1057  FWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG-TLYPVGCALDKCKIDG  1206
              +  G  HG+G Y   D   Y G W   LK G G   YP G   +   I G
Sbjct  115   EFSGGYMHGTGTYVGPDNLTYKGRWKLNLKHGLGYETYPNGDVFEGSWIQG  165



>ref|XP_010916564.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform 
X2 [Elaeis guineensis]
Length=641

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/629 (59%), Positives = 454/629 (72%), Gaps = 10/629 (2%)
 Frame = +1

Query  586   ENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSG  765
             EN+ER  E+V  NGDVY+G   G+LPHG GKY  SDGT Y+G+WE+ KMTG+G+I W +G
Sbjct  13    ENSERHCEEVLANGDVYVGNLDGLLPHGTGKYIWSDGTLYEGEWEKSKMTGRGRIYWPAG  72

Query  766   ATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDG  945
             ATY+GD   G+LHG GTF    GSVYKG W+MNIQHG+G K Y NSD+Y+G W+EG+++G
Sbjct  73    ATYEGDICGGFLHGSGTFYGPGGSVYKGSWRMNIQHGMGTKTYPNSDIYEGLWREGLQEG  132

Query  946   HGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFG  1125
              GRYTWS+GN Y G WK G M+GRGVMKW NGDLFDG W+DGL HGSG Y++ADG+YYFG
Sbjct  133   IGRYTWSSGNTYIGNWKAGKMNGRGVMKWANGDLFDGVWLDGLEHGSGYYKYADGAYYFG  192

Query  1126  TWSNGLKDGRGTLYPVGCALDKCKI-------DGHKEIRRMLSHDSSISKKDAVKPKVKR  1284
             TWS GLKDGRGT YP G  L K K        DG + +    S  SS   ++    K + 
Sbjct  193   TWSRGLKDGRGTFYPAGSKLPKQKFSESVVCNDGAQSLC-TASLMSSEGLRNKPLHKKRY  251

Query  1285  SISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
             S+    +  +   SGRIS R  S  G      S+  VL +D+S  LS ++ DG  +   +
Sbjct  252   SLDGWNISSYFCHSGRISHRPTSFDGIWNFGDSACSVLSQDSSLTLSSSSDDGPHKLQHD  311

Query  1465  ITVAYEREYMQGVLIRERIKSVD-GLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
               + YEREY+QGVLI ER +S D G+ H      K   K+ R G    + KG KSYYLML
Sbjct  312   NVLVYEREYVQGVLIMERARSSDSGVKHTKKCHHKIRRKQPR-GPGEAIHKGHKSYYLML  370

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+PMREVR SDFG +ARI+MYFP KGS+ TPPH SIDF+WKDYCP+
Sbjct  371   NLQLGIRYTVGKITPVPMREVRSSDFGPRARIRMYFPSKGSQFTPPHHSIDFFWKDYCPM  430

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FK++AADYMMSIC  DGL+EL SPGKSGSIFYLS D+RFVIKTL+K ELK+L
Sbjct  431   VFRNLREMFKIDAADYMMSICGVDGLKELSSPGKSGSIFYLSQDERFVIKTLRKYELKIL  490

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             LKMLP YY HV  ++NTLITKFFG++RI+++  +KVRFVVMGNMF TEL +H RYDLKGS
Sbjct  491   LKMLPKYYNHVGIYDNTLITKFFGLHRITIKGARKVRFVVMGNMFCTELRIHRRYDLKGS  550

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             S GR T K  I E TTLKDLDL Y   ++    E+L +Q+SLD  FLESQ IIDYS+LLG
Sbjct  551   SQGRSTSKHNINENTTLKDLDLSYVFHLENSWRESLFRQISLDCMFLESQCIIDYSMLLG  610

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSS  2448
             LHFRAPEHL ALLE   +L    S+  ++
Sbjct  611   LHFRAPEHLKALLESQHTLQNSSSSQANN  639



>ref|XP_010940540.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Elaeis 
guineensis]
 ref|XP_010940541.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Elaeis 
guineensis]
 ref|XP_010940542.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Elaeis 
guineensis]
Length=830

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/782 (49%), Positives = 510/782 (65%), Gaps = 35/782 (4%)
 Frame = +1

Query  613   VFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFE  792
             + PNGD Y G   G +P   GKYT SDG  YDG W  G   G G+I W SGA Y+G+   
Sbjct  59    ILPNGDKYSGTLLGNMPEVSGKYTWSDGCIYDGQWRRGMRHGHGKITWPSGAVYEGEFSG  118

Query  793   GYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNG  972
             GY+HG GT+   D   YKG WK+N++HG+G + Y N DV++G W +GV +G G+Y W+N 
Sbjct  119   GYVHGTGTYVGPDNLTYKGRWKLNLKHGLGYETYPNGDVFEGSWIQGVVEGPGKYVWANE  178

Query  973   NMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDG  1152
             N+Y G  K+G MSG+G + W NGD ++G W+DG+ HG G Y + DG  Y GTW+ GLKDG
Sbjct  179   NIYVGNMKRGKMSGKGTLTWKNGDTYEGNWLDGMIHGFGVYTWNDGGCYVGTWTRGLKDG  238

Query  1153  RGTLYPVGC---ALDKCKIDG------------HKEIRRMLSHDSSISKKDAVKPKVKRS  1287
             +G  Y  GC   A  +  ID                 RR+L H SS+   +    + K S
Sbjct  239   KGAFYAKGCKIPAAQELYIDALSKRGLLPDLKRQNHGRRIL-HSSSVDMGNMKVSQTKNS  297

Query  1288  IS--EKIVDRFARDSGRIS-RRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQL  1458
              S    I+ +    S   S  + VS+    +L  +  +V+  D       +  +   + +
Sbjct  298   GSGLSGILPKGNLMSFEQSCSQKVSLERRWSLEVAIEKVIGNDT---FGESVLENDEKVV  354

Query  1459  GNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYY  1632
                    EREYMQGVLI E +   +   LS +  +R+K  A++++K     + KG +SY 
Sbjct  355   DKNVPILEREYMQGVLISEIVINSNYSMLSKKEKRRQKKLARDIKK-PGETIIKGHRSYD  413

Query  1633  LMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDY  1812
             LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP+ GS+LTPPH + DF WKDY
Sbjct  414   LMLSLQLGIRYTVGKITPIQRREVRASDFGPKASFWMNFPKAGSQLTPPHHAEDFKWKDY  473

Query  1813  CPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSEL  1992
             CP+VFRNLR +FK++AADYM+SIC +  LREL SPGKSGS+F+LS DDRF+IKTL+KSE+
Sbjct  474   CPMVFRNLREMFKIDAADYMISICGNAALRELSSPGKSGSVFFLSQDDRFMIKTLRKSEV  533

Query  1993  KVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDL  2172
             +VLL+MLP+YY HV+ +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H R+DL
Sbjct  534   QVLLRMLPNYYHHVRTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHRRFDL  593

Query  2173  KGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSL  2352
             KGSSLGR TDK +I+E TTLKDLDL Y   ++    + L+KQ+ +DS+FLE+QHI+DYSL
Sbjct  594   KGSSLGRSTDKIEIDENTTLKDLDLNYCFYLEPSWQDALLKQIEIDSKFLETQHIMDYSL  653

Query  2353  LLGLHFRAPEHLTALLEPPDSLFKPKSTLVS----SDGGISILPRSLTLVTHEPSIVSTA  2520
             LLG+H+RAP+HL +      S+   + T++S     +  +   P  L LV       S  
Sbjct  654   LLGVHYRAPQHLRSHASHHRSMTADRLTVLSEEDVQEDEMFSYPEGLVLVPRGSDENSVV  713

Query  2521  PGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF-  2697
              GPHIRG  LRA++ G  EVDLLLPGT RL++QLGVNMPA+A     +D+T     +LF 
Sbjct  714   VGPHIRGSRLRASAAGFEEVDLLLPGTARLQIQLGVNMPARAEHIPAEDKT-----QLFH  768

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA  2877
             EVYDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P+ YS+RF+ F++ VF  
Sbjct  769   EVYDVVLYLGIIDILQDYNMTKKIEHAYKSLQFDSLSISAVDPEFYSRRFLRFIQTVFPE  828

Query  2878  *P  2883
              P
Sbjct  829   NP  830


 Score = 80.5 bits (197),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            + +PNGDV+ G +   +  G GKY  ++   Y G+ + GKM+GKG + W +G TY+G+  
Sbjct  150  ETYPNGDVFEGSWIQGVVEGPGKYVWANENIYVGNMKRGKMSGKGTLTWKNGDTYEGNWL  209

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
            +G +HGFG ++ +DG  Y G W   ++ G G
Sbjct  210  DGMIHGFGVYTWNDGGCYVGTWTRGLKDGKG  240


 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 61/119 (51%), Gaps = 0/119 (0%)
 Frame = +1

Query  601  TDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDG  780
            T   V P+   Y G +K  L HG G  T  +G  ++G W +G + G G+ +W++   Y G
Sbjct  124  TGTYVGPDNLTYKGRWKLNLKHGLGYETYPNGDVFEGSWIQGVVEGPGKYVWANENIYVG  183

Query  781  DCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
            +   G + G GT +  +G  Y+G+W   + HG G   + +   Y G W  G++DG G +
Sbjct  184  NMKRGKMSGKGTLTWKNGDTYEGNWLDGMIHGFGVYTWNDGGCYVGTWTRGLKDGKGAF  242


 Score = 67.8 bits (164),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 55/111 (50%), Gaps = 1/111 (1%)
 Frame = +1

Query  877   VGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDG  1056
             VG+    N D Y G     + +  G+YTWS+G +Y G W++G   G G + W +G +++G
Sbjct  55    VGQLILPNGDKYSGTLLGNMPEVSGKYTWSDGCIYDGQWRRGMRHGHGKITWPSGAVYEG  114

Query  1057  FWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG-TLYPVGCALDKCKIDG  1206
              +  G  HG+G Y   D   Y G W   LK G G   YP G   +   I G
Sbjct  115   EFSGGYVHGTGTYVGPDNLTYKGRWKLNLKHGLGYETYPNGDVFEGSWIQG  165



>ref|XP_003535198.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Glycine 
max]
 gb|KHN39012.1| Phosphatidylinositol-4-phosphate 5-kinase 9 [Glycine soja]
Length=824

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/786 (49%), Positives = 514/786 (65%), Gaps = 35/786 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   PNG+ Y G   G +P G+GKY   DG  Y+G+W  G   G G+I W SG  YD
Sbjct  51    RVGELSLPNGESYSGSLLGNIPEGQGKYVWPDGCVYEGEWRRGMRNGYGKIQWPSGVMYD  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+   D   YKG W++N++HG+G + Y N D+++G W +G  +G G+Y
Sbjct  111   GEFSGGYIHGTGTYIGPDNLTYKGRWRLNVKHGLGYQVYPNGDIFEGSWIQGTPEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W +GD F+G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  171   TWANGNVYLGNMKGGRMSGKGTLTWVSGDSFEGSWLNGMMHGLGAYTWSDGGCYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSISKKDAVKPKV  1278
             GLKDG+GT YP G  L   +              D  K+ +  + H +S+   D    + 
Sbjct  231   GLKDGKGTFYPRGSCLPSAQEIYLNALRKRGLLPDLRKQKQIHIHHAASVDMGDVKVGES  290

Query  1279  KRS---ISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
             +RS    S+K+      +  +   + +S+    +L  S  +V+  D+       + D  A
Sbjct  291   QRSNRVSSDKLAKGNLLNLEQSRSKNISLERRWSLEVSIEKVIGHDSRL----GSTDSVA  346

Query  1450  EQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
             E  G+     EREYMQGVLI E +   S   +S ++ Q +K  AKE+++     + KG +
Sbjct  347   EN-GDKVPILEREYMQGVLISELVLNNSFSSMSRRAKQLQKKLAKEIKR-PGEAIIKGHR  404

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+S  F W
Sbjct  405   SYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNFPKEGSQLTPPHQSEGFKW  464

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR LFK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL++
Sbjct  465   KDYCPMVFRNLRELFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRR  524

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE+KVLL+MLP Y+ HVK ++NTLITKFFG++RI     +K RFVVMGNMF TEL +H R
Sbjct  525   SEVKVLLRMLPDYHHHVKTYDNTLITKFFGLHRIIPSSGQKFRFVVMGNMFCTELRIHRR  584

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             YDLKGSSLGR +DK +I+E TTLKDLDL Y   ++    E+L+KQ+ +DS+FLE Q I+D
Sbjct  585   YDLKGSSLGRSSDKIEIDENTTLKDLDLNYCFYLEPSWQESLLKQIEIDSKFLELQQIMD  644

Query  2344  YSLLLGLHFRAPEHLTALLE--PPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVST  2517
             YSLLLG+H+RAP+ L    +    D L          D G S  P+ L LV       S 
Sbjct  645   YSLLLGVHYRAPQQLHPYNQNRTADGLPILAEEDPLEDEG-SNYPQGLVLVPRGTDDDSV  703

Query  2518  APGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
               G HIRG  LRA++ GD EVDLLLPGT RL++QLGVNMPA+A +   ++     E+++F
Sbjct  704   VVGSHIRGSRLRASAAGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGKE-----EMQMF  758

Query  2698  -EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFR  2874
              E YDVVLYLGIIDILQ YNM KK+EH YKS++FD +SIS ++P  YS+RF+ F+++VF 
Sbjct  759   HEAYDVVLYLGIIDILQEYNMTKKIEHAYKSIQFDSLSISAVDPTFYSRRFLDFIQKVFP  818

Query  2875  A*PHKF  2892
               PH+ 
Sbjct  819   --PHEM  822



>ref|NP_001048560.1| Os02g0822500 [Oryza sativa Japonica Group]
 dbj|BAD22895.1| putative phosphatidylinositol-4-phosphate 5-kinase [Oryza sativa 
Japonica Group]
 dbj|BAF10474.1| Os02g0822500 [Oryza sativa Japonica Group]
 gb|EAZ25124.1| hypothetical protein OsJ_08924 [Oryza sativa Japonica Group]
 dbj|BAG93449.1| unnamed protein product [Oryza sativa Japonica Group]
Length=824

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/787 (48%), Positives = 514/787 (65%), Gaps = 49/787 (6%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E    N D+Y G   G  P G G+Y  SDG TYDG+W  G   G+G+ +W SGATY+
Sbjct  54    RVGEIRLSNRDIYFGTLLGNTPEGSGRYVWSDGCTYDGEWRRGMRHGQGKTMWPSGATYE  113

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY++G GT++ SD  VYKG WK+N +HG+G + Y N D++DG W +G  +GHG+Y
Sbjct  114   GEYSGGYIYGEGTYTGSDNIVYKGRWKLNRKHGLGCQTYPNGDMFDGSWIQGEIEGHGKY  173

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN Y G  K G MSG+G + W NGD ++G W+DG+ HG G Y + +  YY GTW+ 
Sbjct  174   TWANGNTYVGNMKNGKMSGKGTLTWKNGDSYEGNWLDGMMHGYGIYTWNECGYYVGTWTK  233

Query  1138  GLKDGRGTLYPVGCAL---DKCKIDGHK------EIRRM-----LSHDSSIS--------  1251
             GLKDG+GT YP GC +   D+  I+  +      +IRR      + H SS+         
Sbjct  234   GLKDGKGTFYPKGCRVPVNDELYINNLRNRGVLPDIRRQNHGSRILHSSSVDMGNMKVGL  293

Query  1252  KKDAVKPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHT  1431
              +++  P  +R+ SE+              + VS+    +L  +  + +  DA+     +
Sbjct  294   TRESSGPSSRRNSSEQP-----------HSKNVSLERRWSLEVAIEKFIGHDATG----S  338

Query  1432  TCDGKAEQLGNITVAY-EREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCM  1602
             +   ++E + +  +   EREYMQGVLI E +  +S    S ++ +R+K   +E +K    
Sbjct  339   SGLERSESINDSDLPMLEREYMQGVLISEVVLDRSFSDSSKKAKRRQKKIVRETKK-PGE  397

Query  1603  DLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPH  1782
              + KG +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GSRLTP H
Sbjct  398   TIIKGHRSYDLMLSLQLGIRYTVGKITPIQKREVRASDFGPRASFWMTFPKEGSRLTPSH  457

Query  1783  RSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRF  1962
              + DF WKDYCP+VFRNLR +FK++AADYM+SIC +  LREL SPGKSGS+F+LS DDRF
Sbjct  458   PAEDFKWKDYCPMVFRNLREMFKIDAADYMISICGNSALRELSSPGKSGSVFFLSQDDRF  517

Query  1963  VIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYT  2142
             +IKTL+KSE++VLL+MLP YY HV+ +ENTLITKFFG++R+     +K RFVVMGNMF T
Sbjct  518   MIKTLRKSEVQVLLRMLPKYYHHVRTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCT  577

Query  2143  ELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFL  2322
             EL +H R+DLKGSSLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+  DS+FL
Sbjct  578   ELRIHRRFDLKGSSLGRSTDKIEIDENTTLKDLDLNYSFYLEPSWREALLKQIETDSEFL  637

Query  2323  ESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS----ILPRSLTLV  2490
              +Q I+DYSLLLG+H+RAP+HL        S+   + T++S +          P  L LV
Sbjct  638   RTQRIMDYSLLLGVHYRAPQHLRTRASYHRSMAADRLTVLSEEDAQEDDAFNYPEGLVLV  697

Query  2491  THEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDE  2670
                    S   GPHIRG  LR+ + G  EVDLLLPGT RL++QLGVNMPA+A +  K++E
Sbjct  698   QRGGDENSVVVGPHIRGSRLRSTAAGFAEVDLLLPGTARLQIQLGVNMPARAEQNPKEEE  757

Query  2671  TDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFI  2850
             +        EVYDVVLYLGIIDILQ YNM KK+EH  KS+++D +SIS ++P+ YS+RF+
Sbjct  758   SK----SFREVYDVVLYLGIIDILQEYNMSKKIEHAVKSMQYDSISISAVDPQFYSERFL  813

Query  2851  SFLERVF  2871
              F++ VF
Sbjct  814   KFIQTVF  820



>dbj|BAJ97709.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=814

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/775 (49%), Positives = 505/775 (65%), Gaps = 47/775 (6%)
 Frame = +1

Query  616   FPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEG  795
              P+GD Y G   G  P G G+YT SDGT YDG+W  G   G+G+ +W SGA+Y+G+   G
Sbjct  60    LPSGDTYSGTLLGSTPEGSGRYTWSDGTIYDGEWRTGMRHGQGKTLWPSGASYEGEYAGG  119

Query  796   YLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGN  975
             Y++G GT++  D  VYKG WK+N +HG+G + Y N D++ G W +G   GHG+YTW NGN
Sbjct  120   YIYGEGTYTGQDNIVYKGRWKLNRKHGLGCQTYPNGDMFQGSWIQGEIQGHGKYTWENGN  179

Query  976   MYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGR  1155
              YTG  K G MSG+G   W NGD ++G W+DG+ HG G Y ++D  YY GTW+ GLKDG+
Sbjct  180   TYTGNMKNGKMSGKGTFTWKNGDSYEGNWLDGMMHGYGIYTWSDCGYYVGTWTRGLKDGK  239

Query  1156  GTLYPVGC---ALDKCKIDGHKEIR--------RMLSHDSSI---SKKDAVKPKVKRSIS  1293
             GTLYP GC   A D+  I   K +R        R  +H S I   S  D    KV  +  
Sbjct  240   GTLYPSGCRVPAGDELYI---KNLRNRGVLPDPRRQNHGSRILHSSSVDMGNMKVGINRE  296

Query  1294  EKIVDRFARDSGRIS---RRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
                  R + DS  +S   R ++ VA +  +   ++E          S    D +   L  
Sbjct  297   SASTRRNSSDSRNVSLERRWSLEVAIEKFIGNENSET---------SENIDDSELPIL--  345

Query  1465  ITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
                  EREYMQGVLI E +  +S  G S ++ +R+K   +E +K     + KG +SY LM
Sbjct  346   -----EREYMQGVLISEVVLDRSFSGSSKKAKRRQKKTVRETKK-PGEAIIKGHRSYDLM  399

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             L+LQLGIRY+VGKITPI  REVR SDFG +A   M FP+ GSRLTP H + DF WKDYCP
Sbjct  400   LSLQLGIRYTVGKITPIQKREVRASDFGPRASFWMNFPKDGSRLTPSHPAEDFKWKDYCP  459

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FK++AADYM+SIC +  LREL SPGKSGS+F+LS DDRF+IKTL+KSE++V
Sbjct  460   MVFRNLREMFKIDAADYMISICGNSALRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVQV  519

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LL+MLP+YY HV  +ENTLITKFFG++R+     +K RFV MGNMF TEL +H R+DLKG
Sbjct  520   LLRMLPNYYNHVHTYENTLITKFFGLHRVKPSSGQKFRFVAMGNMFCTELRIHRRFDLKG  579

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SSLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+  DS+FL+SQ I+DYSLLL
Sbjct  580   SSLGRSTDKIEIDENTTLKDLDLNYSFYLEPSWREALLKQIKTDSEFLKSQRIMDYSLLL  639

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS----ILPRSLTLVTHEPSIVSTAPG  2526
             G+H+RAP+HL        S+   + T++S +          P  L LV       S   G
Sbjct  640   GVHYRAPQHLRTRASYRRSMTAERLTVLSEEDAQEDDAFNYPEGLVLVQRSTDDNSVVVG  699

Query  2527  PHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVY  2706
             PHIRG  LR+++ G  EVDLLLPGT R+++QLG+NMPA+A +  K+ ++       +EVY
Sbjct  700   PHIRGSRLRSSAAGFGEVDLLLPGTARVQIQLGMNMPARAEQIPKEGDSK----SFYEVY  755

Query  2707  DVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             DVVLYLGIIDILQ YN+ KK+EH  KS+++D +SIS ++P+ YS+RF+ F++ VF
Sbjct  756   DVVLYLGIIDILQEYNITKKIEHAVKSMQYDSVSISAVDPEFYSERFLKFIQTVF  810


 Score = 79.7 bits (195),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            + +PNGD++ G +      G GKYT  +G TY G+ + GKM+GKG   W +G +Y+G+  
Sbjct  150  QTYPNGDMFQGSWIQGEIQGHGKYTWENGNTYTGNMKNGKMSGKGTFTWKNGDSYEGNWL  209

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
            +G +HG+G ++ SD   Y G W   ++ G G
Sbjct  210  DGMMHGYGIYTWSDCGYYVGTWTRGLKDGKG  240



>ref|XP_009385683.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Musa 
acuminata subsp. malaccensis]
Length=828

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/781 (50%), Positives = 510/781 (65%), Gaps = 31/781 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   P+GD Y G   G +P G GKY  S+G TY+G+W  G   G G+I+WSSGA YD
Sbjct  52    RVTEVTLPSGDKYCGTLLGNVPEGSGKYVWSNGCTYEGEWRRGMRHGHGKIMWSSGAVYD  111

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+S  D   YKG WK+N++HG+G + Y N D+++G W +GV +GHG+Y
Sbjct  112   GEFSGGYMHGNGTYSGPDNLTYKGRWKLNLRHGLGYQTYPNGDIFEGSWIQGVIEGHGKY  171

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
              W+N NMY G  K G MSG+G   W NGD ++G W+DG+ HG G Y + D   Y GTW+ 
Sbjct  172   AWANENMYIGNMKGGKMSGKGTFTWKNGDSYEGNWLDGMMHGFGVYTWVDSGCYVGTWTR  231

Query  1138  GLKDGRGTLYPVGCA--------LDKCKIDGHKEIRRMLSHDSSI---SKKDAVKPKVKR  1284
             GLKDG+G  YP G          L+  +  G     +  +H S I   S  D    KV  
Sbjct  232   GLKDGKGFFYPHGSKIPAGQELYLNALRKRGLLPDFKRQNHGSRILHASSVDMGNMKVGE  291

Query  1285  SISEKIVDRFARDSGRI-----SR-RAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
             +     V   +   G +     SR + VS+    +L  +  +V+  D + + S    D K
Sbjct  292   TRESGNVPTISVPKGHLINFEQSRAKHVSLERRWSLEVAIEKVIGHDMT-LESVAESDEK  350

Query  1447  AEQLGNITVAYEREYMQGVLIRERIKSVDGL--SHQSTQRRKFPAKEVRKGSCMDLFKGR  1620
             A    N+ +  EREYMQGVLI E + S   L    ++ +R+K   KE++K     + KG 
Sbjct  351   AVDT-NVPI-LEREYMQGVLISEVVISNSFLMSPRKAKRRQKRLMKEIKK-PGEAIIKGH  407

Query  1621  KSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFY  1800
             +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPHR+ DF 
Sbjct  408   RSYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNFPKEGSQLTPPHRAEDFK  467

Query  1801  WKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLK  1980
             WKDYCP+VFRNLR +FK++AADYMMSIC    LREL SPGKSGSIF+LS DDRF+IKTL+
Sbjct  468   WKDYCPMVFRNLREMFKIDAADYMMSICGSAALRELSSPGKSGSIFFLSQDDRFMIKTLR  527

Query  1981  KSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHH  2160
             KSE+KVLL+MLP+YY HV+ +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H 
Sbjct  528   KSEVKVLLRMLPNYYHHVRTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHR  587

Query  2161  RYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHII  2340
             R+DLKGSSLGR TD  +I+E TTLKDLDL Y   ++    + L+KQ+ +DS+FLE+Q I+
Sbjct  588   RFDLKGSSLGRSTDNVEIDENTTLKDLDLDYCFYLEPSWRDALLKQIEIDSKFLETQRIM  647

Query  2341  DYSLLLGLHFRAPEHLTALLEPPDSL----FKPKSTLVSSDGGISILPRSLTLVTHEPSI  2508
             DYSLLLG+H+RAP HL + +    ++       +    + +  I   P+ L LV      
Sbjct  648   DYSLLLGVHYRAPRHLQSYVSFHQNVTADGLTARPEEDTQEDEIFNYPQGLVLVPRVSDG  707

Query  2509  VSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEV  2688
              S   GPHIRG  LRA++ G  EVDLLLPGT RL++QLGVNMPA+A    + D T+    
Sbjct  708   NSVVVGPHIRGSRLRASAAGFVEVDLLLPGTARLQIQLGVNMPARAEHIPRDDGTEL---  764

Query  2689  ELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERV  2868
              + EVYDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P+ YS+RF+ F++ V
Sbjct  765   -IHEVYDVVLYLGIIDILQEYNMTKKIEHAYKSLQFDSISISAVDPEFYSQRFLKFIQTV  823

Query  2869  F  2871
             F
Sbjct  824   F  824



>ref|XP_006648146.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X1 [Oryza brachyantha]
Length=824

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/784 (49%), Positives = 507/784 (65%), Gaps = 39/784 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E    NGD+Y G   G  P G G+Y  SDG TYDG+W  G   G+G+ +W SGATY+
Sbjct  54    RVGELRLSNGDIYSGTLLGSTPEGSGRYVWSDGCTYDGEWRRGMRHGQGKTMWPSGATYE  113

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY++G GT++ +D  +YKG WK+N +HG+G + Y N D ++G W +G  +GHG+Y
Sbjct  114   GEYSGGYIYGEGTYTGADSIIYKGRWKLNRKHGLGFQTYPNGDTFEGSWIQGEIEGHGKY  173

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW NGN Y G  K G MSG+G + W NGD ++G W DG+ HG G Y + +  YY GTW+ 
Sbjct  174   TWVNGNTYIGNMKNGRMSGKGTLTWKNGDSYEGNWFDGVMHGYGIYTWKECGYYVGTWTK  233

Query  1138  GLKDGRGTLYPVGCAL---DKCKIDGHK------EIRRMLSHDSSISKKDAVKPKVKRSI  1290
             GLKDG+GT YP GC +   D+  I+  +      ++RR  +H S I    +V       +
Sbjct  234   GLKDGKGTFYPKGCRVPVSDELYINNLRNRGVLPDLRRQ-NHGSRIVHSSSV------DM  286

Query  1291  SEKIVDRFARDSGRISRRA---------VSVAGDAALHCSSTEVLPEDASCMLSHTTCDG  1443
                 V      SG  SRR          VS+    +L  +  + +  DAS       C+ 
Sbjct  287   GNMKVGLTRESSGASSRRNSMEQPHLKNVSLERRWSLEVAIEKFIGHDASGSSGLERCES  346

Query  1444  KAEQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
               +   +     EREYMQGVLI E +  +S    S ++ +R+K   +E ++     + KG
Sbjct  347   IND---SDLPMLEREYMQGVLISEVVLDRSFSDSSKKAKRRQKKMVRETKR-PGETIIKG  402

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GSRLTP H + DF
Sbjct  403   HRSYDLMLSLQLGIRYTVGKITPIQKREVRASDFGPRASFWMTFPKEGSRLTPSHSAEDF  462

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
              WKDYCP+VFRNLR +FK++AADYM+SIC +  LREL SPGKSGS+F+LS DDRF+IKTL
Sbjct  463   KWKDYCPMVFRNLREMFKIDAADYMISICGNSALRELSSPGKSGSVFFLSQDDRFMIKTL  522

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMH  2157
             +KSE++VLL+MLP+YY HV+ +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H
Sbjct  523   RKSEVQVLLRMLPNYYHHVRTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIH  582

Query  2158  HRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHI  2337
              R+DLKGSSLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+  DS+FL +Q I
Sbjct  583   RRFDLKGSSLGRSTDKIEIDENTTLKDLDLNYSFYLEPSWREALLKQIETDSEFLRTQRI  642

Query  2338  IDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS----ILPRSLTLVTHEPS  2505
             +DYSLLLG+H+RAP+HL        S+   + T++S +          P  L LV     
Sbjct  643   MDYSLLLGVHYRAPQHLRTRASYHRSMAADRLTVLSEEDAQEDDAFNYPEGLVLVQRGSG  702

Query  2506  IVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSE  2685
               S   GPHIRG  LR+++ G  EVDLLLPGT RL++QLGVNMPA+A +  K++E+    
Sbjct  703   ENSVVVGPHIRGSRLRSSAAGFGEVDLLLPGTARLQIQLGVNMPARAEQNPKEEESK---  759

Query  2686  VELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
                 EVYDVVLYLGIIDILQ YNM KK+EH  KS+++D +SIS ++P  YS+RF+ F++ 
Sbjct  760   -SFREVYDVVLYLGIIDILQDYNMTKKIEHAVKSMQYDSVSISAVDPHFYSERFLKFIQT  818

Query  2866  VFRA  2877
             VF A
Sbjct  819   VFPA  822



>ref|XP_010243193.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Nelumbo 
nucifera]
Length=826

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/783 (49%), Positives = 510/783 (65%), Gaps = 33/783 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PNG+ Y G  +G +P G G+Y  SDG  Y+G+W  G   G G+I W SGA Y+
Sbjct  48    RIGEFLLPNGESYSGSLQGNMPEGSGEYVWSDGCIYEGEWRRGVGNGNGKIQWPSGAIYE  107

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+S  D  VYKG W++N++HG+G + Y N DVY+G W +G  +G G+Y
Sbjct  108   GEFSGGYMHGMGTYSGPDKIVYKGRWRLNLKHGLGCQTYPNGDVYEGFWIQGTIEGPGKY  167

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
              W+NGN+Y G  K G MSG+G + W NGD F+G W+DG+ HG G Y + +G  Y GTW+ 
Sbjct  168   VWANGNVYLGNMKGGKMSGKGTLTWTNGDSFEGNWLDGMMHGFGMYTWINGGRYVGTWTK  227

Query  1138  GLKDGRGTLYPVGCA--------LDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVK----  1281
             GLKDG GT YP G          L+  +  G     R  +H S I    +V   V     
Sbjct  228   GLKDGTGTFYPKGSRFPAVQELYLNALRKRGLLPDLRKQNHGSHIYHASSVDMGVVKVDT  287

Query  1282  -----RSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
                  R  S KI        G+   +   +    +L  S  +V+  D S     +  +G 
Sbjct  288   NHGSWRGSSNKISKGNILSLGQSHSKNYYLERRWSLEVSIEKVIGHDLSLNSGGSVLEGD  347

Query  1447  AEQLGNITVAYEREYMQGVLIRERI-KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
              ++        EREYMQGVLI E +  +    S +  +R+K  AKEV++     + KG +
Sbjct  348   EKESEMNAPVLEREYMQGVLISEVVLNNFLSSSRRIRRRQKKLAKEVKQ-PGEAIIKGHR  406

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPHRS DF W
Sbjct  407   SYDLMLSLQLGIRYTVGKITPIQRREVRTSDFGPRASFWMSFPKEGSQLTPPHRSEDFKW  466

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR +FK++AADYMMSIC  D LREL SPGKSGS+F+LS DDRF+IKTL+K
Sbjct  467   KDYCPMVFRNLREMFKIDAADYMMSICGSDALRELSSPGKSGSVFFLSQDDRFMIKTLRK  526

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE+KVLL+MLP Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF  EL +H R
Sbjct  527   SEVKVLLRMLPDYHHHVRIYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCIELRIHRR  586

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             +DLKGSSLGR ++  +I+E TTLKDLDL Y   ++      L+KQ+ +DS+FLE+QHI+D
Sbjct  587   FDLKGSSLGRSSENIEIDENTTLKDLDLNYCFYLEPSWRLFLLKQIEIDSRFLETQHIMD  646

Query  2344  YSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDG--GISIL--PRSLTLVTHEPSIV  2511
             YSLLLG+H+RAP+HL +++    SL      +V+ +   G  +   P+SL L+    +  
Sbjct  647   YSLLLGVHYRAPQHLRSIMSYHQSLSADGLEIVAEEDVQGDEMFNYPQSLVLIPRGNNDD  706

Query  2512  STAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSE--  2685
             S   GPH+RG  LRA++ GD EVDLLLPGT RL++QLGVNMPA+A       E  P E  
Sbjct  707   SVIVGPHVRGSRLRASAAGDEEVDLLLPGTARLQIQLGVNMPARA-------EHIPGERK  759

Query  2686  VELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLE  2862
              +LF EVYDVVLY+GIIDILQ YNM KK+EH YKS++FD +SIS ++P  Y++RF+ F+ 
Sbjct  760   QQLFQEVYDVVLYVGIIDILQEYNMNKKIEHAYKSIQFDSISISAVDPTFYTQRFLEFIR  819

Query  2863  RVF  2871
             +VF
Sbjct  820   KVF  822



>gb|ACH90428.1| phosphatidylinositol phoshate kinase [Physcomitrella patens]
Length=910

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/786 (50%), Positives = 527/786 (67%), Gaps = 40/786 (5%)
 Frame = +1

Query  601   TDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDG  780
             T EKV  NGD Y+G ++G LP G GKY  +DG  Y+G+W  GK +G+G+I W SGATY+G
Sbjct  129   TGEKVLSNGDFYVGTWQGSLPEGPGKYLWADGCMYEGEWGRGKKSGQGKISWPSGATYEG  188

Query  781   DCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYT  960
             +   GY+HGFGT+  + G+ YKG W MN +HG GRK Y N DVY+G W +GV +G G+YT
Sbjct  189   EFMGGYMHGFGTYMGTGGTTYKGQWSMNDKHGQGRKRYANGDVYEGAWYKGVHEGVGKYT  248

Query  961   WSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNG  1140
             W++GN Y G W+ G M G+GV+ W +GD F G W+DGL HG G Y +ADGS Y GTWS G
Sbjct  249   WASGNEYNGEWRGGTMCGKGVLTWVSGDKFVGQWLDGLEHGRGVYVWADGSSYIGTWSRG  308

Query  1141  LKDGRGTLYPVGC----ALDKCKIDG-------HKEIRRMLSHDSSISKKDAVK--PKVK  1281
             LKDG+G  YP G     A     + G         E+R +    S  +  + +    ++ 
Sbjct  309   LKDGKGVFYPAGTRDLQATRNSDVGGVSSCAHFSGELRPLRWSRSRSTSSEKIPHFGELS  368

Query  1282  RS--ISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQ  1455
             RS  ++  I  R++ D    + + + + G  ++  S T  + ED    +   +     E 
Sbjct  369   RSGDLTNSIQRRWSIDG--PAEKGLGLEGYGSVRNSDT--ILED----VERGSDRKPLES  420

Query  1456  LGNIT-VAYEREYMQGVLIRERIK-SVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
             +G +      REY+QGVL+ E +K + + + H+  + R+  A+E+++     +FKG +SY
Sbjct  421   VGTLPPTVVVREYVQGVLMSELVKENAEAVGHKKRRPRR-SAREIKR-PGETIFKGHRSY  478

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
              LMLNLQLGIRY++GKITP P  E+  +DFG +A I M FP+ G+ +TP H S DF WKD
Sbjct  479   DLMLNLQLGIRYTIGKITPEPRHEIGPNDFGPRASIHMNFPKAGTPMTPIHSSSDFKWKD  538

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFR+LR +FK++AADYM+S+  DD LREL+SPGKSGS+FYLS DDRF+IKT+KK+E
Sbjct  539   YCPMVFRHLREMFKIDAADYMISLTGDDALRELVSPGKSGSVFYLSHDDRFIIKTMKKAE  598

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             +KVLL ML +Y+ HVK +ENTLITK FG++RI     +KVRFVVMGNMF TEL +H R+D
Sbjct  599   VKVLLSMLAAYHSHVKTYENTLITKIFGLHRIKPYGGQKVRFVVMGNMFCTELRIHRRFD  658

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGSS GR  DK +I+E TTLKDLDL YE R+D    ++L++QL  D +FLES+ I+DYS
Sbjct  659   LKGSSQGRSADKVEIDETTTLKDLDLKYEFRLDPSWRDSLLRQLEYDCKFLESRGIMDYS  718

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFK---PKSTLVSS---DGGISILP--RSLTLVTHEPS  2505
             +LLGLHFRAP++ T LL P  S  +   P  +  S+   +GG       R L LVT + S
Sbjct  719   MLLGLHFRAPQYRT-LLTPGASSARDVPPNESFTSTNLDEGGDEEWASNRGLMLVTRDAS  777

Query  2506  IVSTA-PGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQAN--RKVKQDETD  2676
              VS+  PG HIRG  LRA+  GD EVDLLLPGT RLR+QLGVNMPA+A    K   DE+ 
Sbjct  778   NVSSGTPGIHIRGSPLRASVAGDPEVDLLLPGTARLRIQLGVNMPARAECVHKKDSDESK  837

Query  2677  PSEVELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFIS  2853
             PSE +LF E +DVVLY GIIDILQ YN+ K++EH YK+ +FD +SIS +EPKLYSKRF  
Sbjct  838   PSEGQLFEESHDVVLYFGIIDILQNYNLSKRIEHAYKACQFDSISISAVEPKLYSKRFQE  897

Query  2854  FLERVF  2871
             F+ ++F
Sbjct  898   FIRQIF  903


 Score = 74.7 bits (182),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  583  MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
            M +      K + NGDVY G +   +  G GKYT + G  Y+G+W  G M GKG + W S
Sbjct  215  MNDKHGQGRKRYANGDVYEGAWYKGVHEGVGKYTWASGNEYNGEWRGGTMCGKGVLTWVS  274

Query  763  GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
            G  + G   +G  HG G +  +DGS Y G W   ++ G G
Sbjct  275  GDKFVGQWLDGLEHGRGVYVWADGSSYIGTWSRGLKDGKG  314



>gb|EMS63007.1| Phosphatidylinositol-4-phosphate 5-kinase 9 [Triticum urartu]
Length=814

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/775 (50%), Positives = 508/775 (66%), Gaps = 47/775 (6%)
 Frame = +1

Query  616   FPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEG  795
              P+GD Y G   G  P G G+YT SDGT YDG+W  G   G+G+ +W SGA+Y+G+   G
Sbjct  60    LPSGDTYSGTLLGSTPEGSGRYTWSDGTIYDGEWRTGMRHGQGKTLWPSGASYEGEYAGG  119

Query  796   YLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGN  975
             Y++G GT++  D  VYKG WK+N +HG+G + Y N D++ G W +G   GHG+YTW NGN
Sbjct  120   YIYGEGTYTGQDNIVYKGRWKLNRKHGLGCQTYPNGDMFQGSWIQGEIQGHGKYTWENGN  179

Query  976   MYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGR  1155
              YTG  K G MSG+G   W NGD ++G W+DG+ HG G Y ++D  YY GTW+ GLKDG+
Sbjct  180   TYTGNMKNGKMSGKGTFTWKNGDSYEGNWLDGMMHGYGIYTWSDCGYYVGTWTRGLKDGK  239

Query  1156  GTLYPVGC---ALDKCKIDGHKEIR--------RMLSHDSSI---SKKDAVKPKVKRSIS  1293
             GTLYP GC   A D+  I   K +R        R  +H S I   S  D    KV  +  
Sbjct  240   GTLYPSGCRVPAGDELYI---KNLRNRGVLPDPRRQNHGSRILHSSSVDMGNMKVGINRD  296

Query  1294  EKIVDRFARDSGRIS---RRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
                  R + DS  +S   R ++ VA +  +   ++E          S    D +   L  
Sbjct  297   SASSRRNSSDSRNVSLERRWSLEVAIEKFIGNENSET---------SENIDDSELPIL--  345

Query  1465  ITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
                  EREYMQGVLI E +  +S  G S ++ +R+K   +E +K     + KG +SY LM
Sbjct  346   -----EREYMQGVLISEVVLDRSFSGSSKKAKRRQKKTVRETKK-PGEAIIKGHRSYDLM  399

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             L+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GSRLTP H + DF WKDYCP
Sbjct  400   LSLQLGIRYTVGKITPIQKREVRASDFGPRASFWMNFPKEGSRLTPSHPAEDFKWKDYCP  459

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FK++AADYM+SIC +  LREL SPGKSGS+F+LS DDRF+IKTL+KSE++V
Sbjct  460   MVFRNLREMFKIDAADYMISICGNSALRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVQV  519

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LL+MLP+YY HV  +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H R+DLKG
Sbjct  520   LLRMLPNYYNHVHTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHRRFDLKG  579

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SSLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+  DS+FL+SQ I+DYSLLL
Sbjct  580   SSLGRSTDKIEIDENTTLKDLDLNYSFYLEPSWREALLKQIKTDSEFLKSQRIMDYSLLL  639

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS----ILPRSLTLVTHEPSIVSTAPG  2526
             G+H+RAP+HL        ++   + T++S +          P  L LV       S   G
Sbjct  640   GVHYRAPQHLRTRASYRRTMTAERLTVLSEEDAQEDDAFNYPEGLVLVQRANDENSVVVG  699

Query  2527  PHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVY  2706
             PHIRG  LR+++ G  EVDLLLPGT R+++QLGVNMPA+A +  K+D++       +EVY
Sbjct  700   PHIRGSRLRSSAAGFGEVDLLLPGTARVQIQLGVNMPARAEQIPKEDDSK----SFYEVY  755

Query  2707  DVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             DVVLYLGIIDILQ YN+ KK+EH  KS+++D +SIS ++P+ YS+RF+ F++ VF
Sbjct  756   DVVLYLGIIDILQEYNITKKIEHAVKSMQYDSVSISAVDPEFYSERFLKFIQTVF  810


 Score = 79.7 bits (195),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            + +PNGD++ G +      G GKYT  +G TY G+ + GKM+GKG   W +G +Y+G+  
Sbjct  150  QTYPNGDMFQGSWIQGEIQGHGKYTWENGNTYTGNMKNGKMSGKGTFTWKNGDSYEGNWL  209

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
            +G +HG+G ++ SD   Y G W   ++ G G
Sbjct  210  DGMMHGYGIYTWSDCGYYVGTWTRGLKDGKG  240



>ref|XP_007162796.1| hypothetical protein PHAVU_001G181400g [Phaseolus vulgaris]
 gb|ESW34790.1| hypothetical protein PHAVU_001G181400g [Phaseolus vulgaris]
Length=815

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/764 (49%), Positives = 507/764 (66%), Gaps = 16/764 (2%)
 Frame = +1

Query  613   VFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFE  792
             + PNG+ Y G   G +  G G Y   DG  Y+G+W  G   G G+I W SGA Y+GD   
Sbjct  50    LLPNGESYSGSLYGNVYEGHGTYVWFDGCVYEGEWRRGTRNGYGKIRWPSGAEYEGDFSG  109

Query  793   GYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNG  972
             GY+HG G +  SD   YKG W++N++HG+G + Y N D ++G W +G  +G G+YTW+NG
Sbjct  110   GYIHGTGRYIRSDKLTYKGRWRLNLKHGLGYEVYPNGDTFEGSWMQGTPEGPGKYTWTNG  169

Query  973   NMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDG  1152
             N+Y G  K G MSG+G + W NGD ++G W++G+ HG G Y  +DG  Y GTW+ GLKDG
Sbjct  170   NVYVGNMKGGIMSGKGTLTWINGDSYEGNWLNGMMHGFGVYTCSDGGCYVGTWAFGLKDG  229

Query  1153  RGTLYPVGCALDKCKIDGHKEIR-RMLSHDSSISKK--DAVKPKVKRSI---SEKIVDRF  1314
             +GT YP G  L   +      +R R L  D    K+  D   P+ + S    S+K+    
Sbjct  230   KGTFYPRGSRLPSVQEIYLSALRKRGLLPDLRKQKRVRDVEVPENQLSSYGSSDKLAKGN  289

Query  1315  ARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYM  1494
               +  + +RR VS+    +L  S  +V+  D++  L+ +  +   +++       EREYM
Sbjct  290   LLNLEQSNRRNVSLERRWSLEVSIEKVIGYDSALGLADSVPESSDKEVDTTIPILEREYM  349

Query  1495  QGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYS  1668
             QGVLI E +       +S ++ + +K  AKE ++   + + KG +SY LML+LQLGIRY+
Sbjct  350   QGVLISEVVLNNMFSSMSRRARRLQKKLAKETKRPGEI-IIKGHRSYDLMLSLQLGIRYT  408

Query  1669  VGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLF  1848
             VGKITPIP REVR SDFG +A   M FP++GS+LTP H S DF WKDYCP+VFRNLR +F
Sbjct  409   VGKITPIPTREVRISDFGTKASFWMNFPKEGSQLTPTHASEDFKWKDYCPMVFRNLREMF  468

Query  1849  KLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYK  2028
             K++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+ SE+KVLL+MLP Y+ 
Sbjct  469   KIDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRMSEVKVLLRMLPDYHH  528

Query  2029  HVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKD  2208
             HVK +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H R+DLKGSSLGR +DK 
Sbjct  529   HVKSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRRFDLKGSSLGRSSDKI  588

Query  2209  KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHL  2388
             +I+E TTLKDLDL Y   ++    E+L+KQ+ +DS+FLE+QHI+DYSLLLG+H+RAP+HL
Sbjct  589   EIDENTTLKDLDLNYCFYLEPSWRESLLKQIEIDSKFLEAQHIMDYSLLLGVHYRAPQHL  648

Query  2389  TALLEPPDSLFKPKSTLVSSDGGI---SILPRSLTLVTHEPSIVSTAPGPHIRGKTLRAN  2559
               L+            +++ +  +   +  P+ L LV       S   G H+RG  LRA+
Sbjct  649   RPLISYNQRRSVDGLAILAEEDPLEDEASYPQGLVLVPRGADDNSVVVGSHVRGSRLRAS  708

Query  2560  SVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDI  2739
             S GD EVDLLLPGT RL++QLGVNMP++A +   + E    + +L  VYDVVLYLGIIDI
Sbjct  709   SAGDEEVDLLLPGTARLQIQLGVNMPSRAEQISGKQE----QQKLHSVYDVVLYLGIIDI  764

Query  2740  LQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             LQ YNM KK+EH YKSL FD +SIS ++P  YS RF+ F+++VF
Sbjct  765   LQDYNMTKKIEHAYKSLHFDSLSISAVDPTFYSHRFLEFIQKVF  808


 Score = 86.3 bits (212),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            +V+PNGD + G +    P G GKYT ++G  Y G+ + G M+GKG + W +G +Y+G+  
Sbjct  141  EVYPNGDTFEGSWMQGTPEGPGKYTWTNGNVYVGNMKGGIMSGKGTLTWINGDSYEGNWL  200

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             G +HGFG ++ SDG  Y G W   ++ G G
Sbjct  201  NGMMHGFGVYTCSDGGCYVGTWAFGLKDGKG  231


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 58/114 (51%), Gaps = 1/114 (1%)
 Frame = +1

Query  877   VGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDG  1056
             VG+    N + Y G     V +GHG Y W +G +Y G W++G  +G G ++W +G  ++G
Sbjct  46    VGQLLLPNGESYSGSLYGNVYEGHGTYVWFDGCVYEGEWRRGTRNGYGKIRWPSGAEYEG  105

Query  1057  FWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG-TLYPVGCALDKCKIDGHKE  1215
              +  G  HG+G Y  +D   Y G W   LK G G  +YP G   +   + G  E
Sbjct  106   DFSGGYIHGTGRYIRSDKLTYKGRWRLNLKHGLGYEVYPNGDTFEGSWMQGTPE  159



>ref|XP_008442735.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Cucumis 
melo]
Length=832

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/787 (50%), Positives = 510/787 (65%), Gaps = 41/787 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E +  NG++Y G   G +P G GKY  SDG  Y+G+W  G   G G+I + SGA Y+
Sbjct  51    RVGELLLVNGELYSGSLLGNIPEGTGKYVWSDGCIYEGEWRRGMRHGNGKIRFPSGAVYE  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+   D   YKG WK+N++HG+G + Y N DV++G W +G  +G G+Y
Sbjct  111   GEFSGGYMHGTGTYIGPDNLTYKGRWKLNLKHGLGYQVYPNGDVFEGSWMQGTPEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W NGD F+G W+ G+ HG G Y ++DG  Y GTW+ 
Sbjct  171   TWANGNVYLGNMKAGGMSGKGTLTWINGDSFEGNWLGGMMHGFGVYMWSDGGCYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKC-----------------KIDGHKEIRRMLSHDSSISKKDAV  1266
             GLKDG+G+ YP G  L                    K   H  I    S D   + K   
Sbjct  231   GLKDGKGSFYPKGSRLPAVQEIYLKALRKRGLLPDLKNKNHAHIHHATSGDMG-NFKVGE  289

Query  1267  KPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
               +  R  S+KI      +  +   + VS+    +L  S  +VL  D S  LS     G 
Sbjct  290   NQQSSRVSSDKISKGNLLNLEQYRTKNVSLERRWSLEVSIEKVLGHDPSSGLSEYEFGGN  349

Query  1447  AEQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFP-AKEVRKGSCMDLFKG  1617
               ++       EREYMQGVLI E +   S    S +  +R++    KEV+K   M + KG
Sbjct  350   --EIDTKIPILEREYMQGVLISELVLDNSFTSPSSRRAKRKQRKLVKEVKKPGEM-IIKG  406

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+S DF
Sbjct  407   HRSYDLMLSLQLGIRYTVGKITPIQRREVRSSDFGPRASFWMNFPKEGSQLTPPHQSEDF  466

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
              WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL
Sbjct  467   KWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTL  526

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMH  2157
             +KSE+KVLL+MLP Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H
Sbjct  527   RKSEVKVLLRMLPDYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIH  586

Query  2158  HRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHI  2337
              R+DLKGSSLGR  DK +I+E T LKDLDL Y   ++    E L+KQ+ +DS+FLE Q+I
Sbjct  587   RRFDLKGSSLGRSADKVEIDENTILKDLDLNYSFYLEPTWREALLKQIEIDSKFLEEQNI  646

Query  2338  IDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSS----DGGISILPRSLTLV--THE  2499
             +DYSLLLG+H+RAP+ L + +    S+      +++     +  IS  P+ L LV  T +
Sbjct  647   MDYSLLLGVHYRAPQQLQSNMSYSRSMRADGLGILAEEDPFEDDISTYPQGLVLVPRTDD  706

Query  2500  PSIVSTAPGPHIRGKTLRANSV-GDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETD  2676
              S+V    GPHIRG  LRA+S  GD EVDLLLPGT RL++QLGVNMPA+A +   ++E  
Sbjct  707   NSVVV---GPHIRGSRLRASSATGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGKEEK-  762

Query  2677  PSEVELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFIS  2853
                 ++F E YDVVLYLGIIDILQ YNM KK+EH YKS++FD +SIS ++P  YSKRF+ 
Sbjct  763   ----QMFHEAYDVVLYLGIIDILQEYNMSKKIEHAYKSIQFDSLSISAVDPTFYSKRFLE  818

Query  2854  F-LERVF  2871
             F + RVF
Sbjct  819   FIISRVF  825



>ref|XP_004137849.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Cucumis 
sativus]
 gb|KGN59008.1| hypothetical protein Csa_3G743450 [Cucumis sativus]
Length=832

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/787 (50%), Positives = 511/787 (65%), Gaps = 41/787 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E +  NG++Y G   G +P G GKY  SDG  Y+G+W  G   G G+I + SGA Y+
Sbjct  51    RVGELLLVNGELYSGSLLGNIPEGTGKYVWSDGCIYEGEWRRGMRHGNGKIRFPSGAVYE  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+   D   YKG WK+N++HG+G + Y N DV++G W +G  +G G+Y
Sbjct  111   GEFSGGYMHGTGTYIGPDNLTYKGRWKLNLKHGLGYQVYPNGDVFEGSWMQGTPEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W NGD F+G W+ G+ HG G Y ++DG  Y GTW+ 
Sbjct  171   TWANGNVYLGNMKAGGMSGKGTLTWINGDSFEGNWLGGMMHGFGVYMWSDGGCYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKC-----------------KIDGHKEIRRMLSHDSSISKKDAV  1266
             GLKDG+G+ YP G  L                    K   H  I    S D   + K   
Sbjct  231   GLKDGKGSFYPKGSRLPAVQEIYLKALRKRGLLPDLKNKNHAHIHHATSGDMG-NFKVGQ  289

Query  1267  KPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
               +  R  S+KI      +  +   + VS+    +L  S  +VL  D S   S     G+
Sbjct  290   NQQSSRVSSDKISKGNLLNLEQYRTKNVSLERRWSLEVSIEKVLGHDPSSGFSEYEL-GR  348

Query  1447  AEQLGNITVAYEREYMQGVLIRERIKS---VDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
              E    I +  EREYMQGVLI E +         S ++ ++++   KEV+K   M + KG
Sbjct  349   NEIDTKIPI-LEREYMQGVLISELVLENSFTSPSSRRAKRKQRKLVKEVKKPGEM-IIKG  406

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+S DF
Sbjct  407   HRSYDLMLSLQLGIRYTVGKITPIQRREVRSSDFGPRASFWMNFPKEGSQLTPPHQSEDF  466

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
              WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL
Sbjct  467   KWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTL  526

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMH  2157
             +KSE+KVLL+MLP Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H
Sbjct  527   RKSEVKVLLRMLPDYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIH  586

Query  2158  HRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHI  2337
              R+DLKGSSLGR  DK +I+E T LKDLDL Y   ++    E L+KQ+ +DS+FLE Q+I
Sbjct  587   RRFDLKGSSLGRSADKVEIDENTILKDLDLNYSFFLEPTWREALLKQIEIDSKFLEEQNI  646

Query  2338  IDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSD----GGISILPRSLTLV--THE  2499
             +DYSLLLG+H+RAP+ L + +    S+      +++ D      IS  P+ L LV  T +
Sbjct  647   MDYSLLLGVHYRAPQQLQSHISYSRSMRADGLGILAEDDPFEDDISTYPQGLVLVPRTDD  706

Query  2500  PSIVSTAPGPHIRGKTLRANSV-GDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETD  2676
              S++    GPHIRG  LRA+S  GD EVDLLLPGT RL++QLGVNMPA+A +   ++E  
Sbjct  707   NSVIV---GPHIRGSRLRASSATGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGKEEK-  762

Query  2677  PSEVELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFIS  2853
                 ++F E YDVVLYLGIIDILQ YNM KK+EH YKS++FD +SIS ++P  YSKRF+ 
Sbjct  763   ----QMFHEAYDVVLYLGIIDILQEYNMSKKIEHAYKSMQFDSLSISAVDPTFYSKRFLE  818

Query  2854  F-LERVF  2871
             F + RVF
Sbjct  819   FIISRVF  825



>ref|XP_008787445.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Phoenix 
dactylifera]
Length=821

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/789 (49%), Positives = 511/789 (65%), Gaps = 45/789 (6%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             E + P+GD Y G   G +P G GKY  SDG  Y+G+W  G   G G+I   SGA Y G+ 
Sbjct  48    ELILPDGDTYCGTLLGNMPEGSGKYIWSDGCIYEGEWRRGMRHGHGKITCPSGAVYVGEF  107

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+HG GT+   D   YKG WK+N++HG+G + Y N DV++G W +GV +G G+Y W+
Sbjct  108   SGGYMHGSGTYIGPDNLTYKGRWKLNLKHGLGYQTYPNGDVFEGSWIQGVVEGPGKYVWA  167

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             N N+Y G  K G MSG+G + W NGD ++G W+DG+ HG G Y + DGS Y GTW+ GLK
Sbjct  168   NENIYIGNMKGGKMSGKGTLTWKNGDTYEGNWLDGMMHGFGVYTWNDGSSYVGTWTRGLK  227

Query  1147  DGRGTLYPVGCALDKCKIDGHKEI-------RRMLS------------HDSSISKKDAVK  1269
             DG+G  YP GC     KI   +E+       R +LS            H SS+   +   
Sbjct  228   DGQGAFYPKGC-----KIPAAQELYISALRKRALLSDLKRQNHGSRILHSSSVDMGNMKV  282

Query  1270  PKVKRS---ISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCD  1440
              + K S   +S+ +         +   + VS+    +L  +  +V+  D    +S  +  
Sbjct  283   SQTKGSGCGLSDNLPKGSLISFQQSRSQNVSLERRWSLEVAIEKVIGHD----ISGESVL  338

Query  1441  GKAEQLGNITVA-YEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLF  1611
                E++ +  V   EREYMQGVLI E +   S    S ++ +R+K  A++++K     + 
Sbjct  339   ENDEKVADTNVPIVEREYMQGVLISEIVINNSFPMSSKKAKRRQKKLARDIKK-PGETII  397

Query  1612  KGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSI  1791
             KG +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP+ GS+LTPPH + 
Sbjct  398   KGHRSYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPKASFWMSFPKAGSQLTPPHHAE  457

Query  1792  DFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIK  1971
             DF WKDYCP+VFRNLR +FK++AADYMMSIC +  LREL SPGKSGS+F+LS DDRF+IK
Sbjct  458   DFKWKDYCPLVFRNLREMFKIDAADYMMSICGNAALRELSSPGKSGSVFFLSQDDRFMIK  517

Query  1972  TLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELH  2151
             TL+KSE+KVLL+MLP+YY HV  +ENTLITKFFG++R+     +K RFVVMGNMF TEL 
Sbjct  518   TLRKSEVKVLLRMLPNYYDHVHRYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELR  577

Query  2152  MHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQ  2331
             +H R+DLKGSSLGR TDK +I+E TTLKDLDL Y   ++    + L+KQ+ +DS+FLE+Q
Sbjct  578   IHRRFDLKGSSLGRSTDKVEIDENTTLKDLDLNYCFYLEPSWRDALLKQIEIDSKFLETQ  637

Query  2332  HIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVS----SDGGISILPRSLTLVTHE  2499
              I+DYSLLLG+H+RAP+H  + L    S+   + T++S     +  I   P+ L L+   
Sbjct  638   SIMDYSLLLGVHYRAPQHWRSHLSYCQSVMADRLTVLSEEDVQEDEIFNYPQGLVLIPRG  697

Query  2500  PSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDP  2679
                 S   GPHIRG  LRA + G  EVDLLLPGT RL++QLGVNMPA+A     +D+T  
Sbjct  698   NDENSVVVGPHIRGSRLRAPAAGFEEVDLLLPGTARLQIQLGVNMPARAEHIPPEDKT--  755

Query  2680  SEVELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISF  2856
                +LF EVYDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P  YSKRF+ F
Sbjct  756   ---QLFHEVYDVVLYLGIIDILQEYNMTKKIEHAYKSLQFDSLSISAVDPVFYSKRFLRF  812

Query  2857  LERVFRA*P  2883
             +  VF   P
Sbjct  813   IRTVFPESP  821


 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 65/153 (42%), Gaps = 11/153 (7%)
 Frame = +1

Query  760   SGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVR  939
             SG+  D +    +  G    SSS           +I   VG     + D Y G     + 
Sbjct  17    SGSAGDKEYLLSFASGQDALSSS----------AHIGSTVGELILPDGDTYCGTLLGNMP  66

Query  940   DGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYY  1119
             +G G+Y WS+G +Y G W++G   G G +   +G ++ G +  G  HGSG Y   D   Y
Sbjct  67    EGSGKYIWSDGCIYEGEWRRGMRHGHGKITCPSGAVYVGEFSGGYMHGSGTYIGPDNLTY  126

Query  1120  FGTWSNGLKDGRG-TLYPVGCALDKCKIDGHKE  1215
              G W   LK G G   YP G   +   I G  E
Sbjct  127   KGRWKLNLKHGLGYQTYPNGDVFEGSWIQGVVE  159



>ref|XP_003542542.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X1 [Glycine max]
 gb|KHN48235.1| Phosphatidylinositol-4-phosphate 5-kinase 9 [Glycine soja]
Length=822

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/795 (49%), Positives = 515/795 (65%), Gaps = 55/795 (7%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   PNG+ Y G F G +P G+GKY  SDG  Y+G+W  G   G G+I W SG  Y+
Sbjct  51    RVGELSLPNGESYSGSFLGNIPEGQGKYVWSDGCVYEGEWRRGMRNGYGKIQWPSGVMYE  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG G +   D   YKG W++N++HG+G + Y N D+++G W +G  +G G+Y
Sbjct  111   GEFSGGYIHGTGAYIGPDSLTYKGRWRLNLKHGLGYQVYPNGDIFEGSWIQGAPEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W +GD F+G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  171   TWANGNVYLGNMKGGRMSGKGTLTWISGDSFEGSWLNGMMHGLGVYTWSDGGCYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSISKKDAVKPKV  1278
             GLKDG+GT YP G  L   +              D  K+ +  + H +S+   D    + 
Sbjct  231   GLKDGKGTFYPRGSCLPSAQEIYLNALRKRGLLPDLRKQKQVHIHHAASVDMGDVKVGES  290

Query  1279  KRS---ISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
             +RS    S+K+      +  +   + +S+    +L  S  +++  D+       + D  A
Sbjct  291   QRSNRVSSDKLAKGNLLNLEQSRSKNISLERRWSLEVSIEKLIGHDSKL----GSTDSVA  346

Query  1450  EQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
             E  G+     EREYMQGVLI E +   S   +S ++ Q +K  AKE+++     + KG +
Sbjct  347   EN-GDKVPILEREYMQGVLISELVLNNSFSSMSRRAKQLQKKIAKEIKR-PGEAIIKGHR  404

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+S  F W
Sbjct  405   SYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNFPKEGSQLTPPHQSEGFKW  464

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR LFK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL++
Sbjct  465   KDYCPMVFRNLRELFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRR  524

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE+KVLL+MLP Y+ HVK ++NTLITKFFG++RI     +K RFVVMGNMF TEL +H R
Sbjct  525   SEVKVLLRMLPDYHHHVKTYDNTLITKFFGLHRIIPSSGQKFRFVVMGNMFCTELRIHRR  584

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             YDLKGSSLGR +DK +I+E TTLKDLDL Y   ++    E+L+KQ+ +DS+FLE Q I+D
Sbjct  585   YDLKGSSLGRSSDKIEIDENTTLKDLDLNYCFYLEPSWRESLLKQIEIDSKFLELQQIMD  644

Query  2344  YSLLLGLHFRAPEHL-----------TALLEPPDSLFKPKSTLVSSDGGISILPRSLTLV  2490
             YSLLLG+H+RAP+ L            A+L   D L          D G S  P+ L LV
Sbjct  645   YSLLLGVHYRAPQQLHPYNQSRNADGLAILAEEDPL---------EDEG-SNYPQGLVLV  694

Query  2491  THEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDE  2670
                    S   G HIRG  LRA   GD EVDLLLPGT RL++QLGVNMPA+A +   ++ 
Sbjct  695   PRGGDDDSVVVGSHIRGSRLRA--AGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGKE-  751

Query  2671  TDPSEVELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRF  2847
                 EV++F E YDVVLYLGIIDILQ YNM KK+EH YKS++FD +SIS ++P  YS+RF
Sbjct  752   ----EVQMFHEAYDVVLYLGIIDILQEYNMTKKIEHAYKSIQFDSLSISAVDPTFYSRRF  807

Query  2848  ISFLERVFRA*PHKF  2892
             + F++++F   PH+ 
Sbjct  808   LDFIQKMFP--PHEM  820



>ref|XP_003570442.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Brachypodium 
distachyon]
Length=820

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/777 (49%), Positives = 508/777 (65%), Gaps = 33/777 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  +   P+GD Y G   G  P G G+YT SDG  YDG+W  G   G+G+  W SGATY+
Sbjct  54    RVTDIRLPSGDAYSGTLLGSTPEGSGRYTWSDGCIYDGEWRRGMRHGQGKTTWPSGATYE  113

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY++G GT++  D  VYKG WK+N +HG+G + Y N D++ G W +G   GHG+Y
Sbjct  114   GEYAGGYIYGEGTYTGHDNIVYKGRWKLNRKHGLGCQTYPNGDMFQGSWIQGEIQGHGKY  173

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW NGN YTG  K G MSG+G   W NGD ++G W+DG+ HG G Y + D  YY GTW+ 
Sbjct  174   TWGNGNTYTGNMKNGKMSGKGTFTWKNGDSYEGNWLDGMMHGYGIYTWNDCGYYVGTWTR  233

Query  1138  GLKDGRGTLYPVGC---ALDKCKIDGHK------EIRRMLSHDSSISKKDAVK-PKVKRS  1287
             GLKDG+GTLYP GC   A D+  I+  +      ++RR  +H S I    +V    +K  
Sbjct  234   GLKDGKGTLYPRGCRVPASDELYINNLRNRGVLPDLRRQ-NHGSRILHSSSVDMGNMKVG  292

Query  1288  ISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVL---PEDASCMLSHTTCDGKAEQL  1458
             ++       +R +     + VS+    +L  +  + +     D S + S+   D     +
Sbjct  293   LNRGSSGSSSRRNSSEQPKNVSLERRWSLEVAIEKFIGHETSDNSGLESYENTDDSDLPI  352

Query  1459  GNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYY  1632
                    EREYMQGVLI E +  +S  G S ++ +R+K   K V K     + KG +SY 
Sbjct  353   ------LEREYMQGVLISEVVLNRSFSGSSKKAKRRQK---KMVIKKPGEAIIKGHRSYD  403

Query  1633  LMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDY  1812
             LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GSRLTP H + DF WKDY
Sbjct  404   LMLSLQLGIRYTVGKITPIQKREVRASDFGPRASFWMNFPKQGSRLTPSHPAEDFKWKDY  463

Query  1813  CPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSEL  1992
             CP+VFRNLR +FK++AADYM+SIC +  LREL SPGKSGS+F+LS DDRF+IKTL+KSE+
Sbjct  464   CPMVFRNLREMFKIDAADYMISICGNAALRELSSPGKSGSVFFLSQDDRFMIKTLRKSEV  523

Query  1993  KVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDL  2172
             +VLL+MLP+YY HV  +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H R+DL
Sbjct  524   QVLLRMLPNYYHHVHTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHRRFDL  583

Query  2173  KGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSL  2352
             KGSSLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+  DS+FL+SQ I+DYSL
Sbjct  584   KGSSLGRSTDKIEIDENTTLKDLDLNYCFYLEPSWREALLKQIQTDSEFLKSQRIMDYSL  643

Query  2353  LLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS----ILPRSLTLVTHEPSIVSTA  2520
             LLG+H+RAP+HL        S+   + T++S +          P  L LV       S  
Sbjct  644   LLGVHYRAPQHLRTRASYRRSMTAERLTVLSEEDAQEDDAFNYPEGLVLVQRGNDENSVV  703

Query  2521  PGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFE  2700
              GPHIRG  LR+++ G  EVDLLLPGT R+++QLGVNMPA+A +  K+DE+       +E
Sbjct  704   VGPHIRGSRLRSSAAGFGEVDLLLPGTARVQIQLGVNMPARAEQIPKEDESK----SFYE  759

Query  2701  VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VYDVVLYLGIIDILQ YN+ KK+EH  KSL++D +SIS ++P+ YS+RF+ F++ VF
Sbjct  760   VYDVVLYLGIIDILQEYNITKKIEHAVKSLQYDSVSISAVDPEFYSERFLKFIQTVF  816



>ref|XP_006381373.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
 gb|ERP59170.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
Length=829

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/780 (50%), Positives = 512/780 (66%), Gaps = 31/780 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   PNG+ Y G   G  P G GKY  SDG  Y+G+W  G   G G+I W SG  Y+
Sbjct  52    RVGELGLPNGESYSGSLLGNAPEGNGKYVWSDGCVYEGEWRRGMRHGNGKIQWPSGTAYE  111

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  S+   YKG W++N++HG+G + Y N D+++G W +G  +G G+Y
Sbjct  112   GEFSGGYMHGAGTYVGSNNLTYKGRWRLNLKHGLGYQVYPNGDIFEGSWIQGGPEGPGKY  171

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N N+Y G  K G M+G+G + W NGD F+G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  172   TWANRNVYHGDMKGGKMTGKGTLTWTNGDSFEGSWLNGMMHGFGVYTWSDGGCYVGTWTR  231

Query  1138  GLKDGRGTLYPVGC-----------ALDKCKI--DGHKEIRRMLSHDSSISKKDAVKPKV  1278
             GLKDG+G+ YP G            AL K  +  D  K+   ++ H SS++  + VK   
Sbjct  232   GLKDGKGSFYPKGSRFQAVEEWYLNALRKRGVLPDLRKQNHALIHHASSVNMGN-VKVGE  290

Query  1279  KRSISEKIVDRFARDS----GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
              +       D+ ++ +     +   + VS+    +L     +V+  D+S  LS     GK
Sbjct  291   NQGSRHNSSDKLSKGNLLTLEQSRNKNVSLERRWSLEVYIEKVIGHDSSLDLSEGL--GK  348

Query  1447  AEQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGR  1620
              E   N     EREYMQGVLI E +   S    S ++ +R+K  AKEV++     + KG 
Sbjct  349   -EFETNTPPILEREYMQGVLISELVLNSSFSSSSRRTKRRQKKLAKEVKR-PGEAIIKGH  406

Query  1621  KSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFY  1800
             +SY LML+LQLGIRY+VGKITP+  REVR SDFG +A   M FP+ GS+LTPPH+S DF 
Sbjct  407   RSYDLMLSLQLGIRYTVGKITPVQRREVRASDFGPRASFWMNFPKDGSQLTPPHQSEDFK  466

Query  1801  WKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLK  1980
             WKDYCP+VFRNLR +FK+++ADYMMSIC +D LREL SPGKSGSIF+LS DD F+IKTL+
Sbjct  467   WKDYCPMVFRNLREMFKIDSADYMMSICGNDALRELSSPGKSGSIFFLSQDDHFMIKTLR  526

Query  1981  KSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHH  2160
             KSE+KVLLKMLP Y+ HV+ HENTLITKFFG++RI     +K RFVVMGNMF TEL +H 
Sbjct  527   KSEVKVLLKMLPDYHHHVRSHENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHR  586

Query  2161  RYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHII  2340
             R+DLKGSSLGR T+  +IEE TTLKDLDL Y   ++    E L++Q+ +DS+FLE QHI+
Sbjct  587   RFDLKGSSLGRSTENVEIEENTTLKDLDLNYCFYLEPSWREALLQQIEIDSKFLEVQHIM  646

Query  2341  DYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SILPRSLTLVTHEPSIVS  2514
             DYSLLLG+H+RAP+HL +L+    S+      +++ +  I     P+ L LV       S
Sbjct  647   DYSLLLGVHYRAPQHLRSLMSYNRSISAEGLGVLAEEDTIEDENYPQGLVLVPRGTGDDS  706

Query  2515  TAPGPHIRGKTLRANSVGDREVDLLLPGTG-RLRVQLGVNMPAQANRKVKQDETDPSEVE  2691
                GPHIRG  LRA+S GD EVDLLLPGT  RL++QLGVNMPA+A +   ++E       
Sbjct  707   VVVGPHIRGSRLRASSAGDEEVDLLLPGTASRLQIQLGVNMPARAEQIPGEEEKQT----  762

Query  2692  LFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
               E YDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P  YS+RF+ F+++VF
Sbjct  763   FHEAYDVVLYLGIIDILQEYNMSKKIEHAYKSLQFDSLSISAVDPTFYSRRFLEFIQKVF  822


 Score = 69.7 bits (169),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  862   NIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNG  1041
             N+   VG     N + Y G       +G+G+Y WS+G +Y G W++G   G G ++W +G
Sbjct  48    NLAFRVGELGLPNGESYSGSLLGNAPEGNGKYVWSDGCVYEGEWRRGMRHGNGKIQWPSG  107

Query  1042  DLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG-TLYPVGCALDKCKIDGHKE  1215
               ++G +  G  HG+G Y  ++   Y G W   LK G G  +YP G   +   I G  E
Sbjct  108   TAYEGEFSGGYMHGAGTYVGSNNLTYKGRWRLNLKHGLGYQVYPNGDIFEGSWIQGGPE  166



>ref|XP_004161258.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-phosphate 
5-kinase 9-like [Cucumis sativus]
Length=832

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/787 (49%), Positives = 510/787 (65%), Gaps = 41/787 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E +  NG++Y G   G +P G GKY  SDG  Y+G+W  G   G G+I + SGA Y+
Sbjct  51    RVGELLLVNGELYSGSLLGNIPEGTGKYVWSDGCIYEGEWRRGMRHGNGKIXFPSGAVYE  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+   D   YKG WK+N++HG+G + Y N DV++G W +G  +G  +Y
Sbjct  111   GEFXGGYMHGTGTYIGPDNLTYKGRWKLNLKHGLGYQVYPNGDVFEGSWMQGTPEGPXKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W NGD F+G W+ G+ HG G Y ++DG  Y GTW+ 
Sbjct  171   TWANGNVYLGNMKAGGMSGKGTLTWINGDSFEGNWLGGMMHGFGVYMWSDGGCYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKC-----------------KIDGHKEIRRMLSHDSSISKKDAV  1266
             GLKDG+G+ YP G  L                    K   H  I    S D   + K   
Sbjct  231   GLKDGKGSFYPKGSRLPAVQEIYLKALRKRGLLPDLKNKNHAHIHHATSGDMG-NFKVGQ  289

Query  1267  KPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
               +  R  S+KI      +  +   + VS+    +L  S  +VL  D S   S     G+
Sbjct  290   NQQSSRVSSDKISKGNLLNLEQYRTKNVSLERRWSLEVSIEKVLGHDPSSGFSEYEL-GR  348

Query  1447  AEQLGNITVAYEREYMQGVLIRERIKS---VDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
              E    I +  EREYMQGVLI E +         S ++ ++++   KEV+K   M + KG
Sbjct  349   NEIDTKIPI-LEREYMQGVLISELVLENSFTSPSSRRAKRKQRKLVKEVKKPGEM-IIKG  406

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+S DF
Sbjct  407   HRSYDLMLSLQLGIRYTVGKITPIQRREVRSSDFGPRASFWMNFPKEGSQLTPPHQSEDF  466

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
              WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL
Sbjct  467   KWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTL  526

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMH  2157
             +KSE+KVLL+MLP Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H
Sbjct  527   RKSEVKVLLRMLPDYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIH  586

Query  2158  HRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHI  2337
              R+DLKGSSLGR  DK +I+E T LKDLDL Y   ++    E L+KQ+ +DS+FLE Q+I
Sbjct  587   RRFDLKGSSLGRSADKVEIDENTILKDLDLNYSFFLEPTWREALLKQIEIDSKFLEEQNI  646

Query  2338  IDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSD----GGISILPRSLTLV--THE  2499
             +DYSLLLG+H+RAP+ L + +    S+      +++ D      IS  P+ L LV  T +
Sbjct  647   MDYSLLLGVHYRAPQQLQSHISYSRSMRADGLGILAEDDPFEDDISTYPQGLVLVPRTDD  706

Query  2500  PSIVSTAPGPHIRGKTLRANSV-GDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETD  2676
              S++    GPHIRG  LRA+S  GD EVDLLLPGT RL++QLGVNMPA+A +   ++E  
Sbjct  707   NSVIV---GPHIRGSRLRASSATGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGKEEK-  762

Query  2677  PSEVELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFIS  2853
                 ++F E YDVVLYLGIIDILQ YNM KK+EH YKS++FD +SIS ++P  YSKRF+ 
Sbjct  763   ----QMFHEAYDVVLYLGIIDILQEYNMSKKIEHAYKSMQFDSLSISAVDPTFYSKRFLE  818

Query  2854  F-LERVF  2871
             F + RVF
Sbjct  819   FIISRVF  825



>gb|EMT07835.1| Phosphatidylinositol-4-phosphate 5-kinase 9 [Aegilops tauschii]
Length=814

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/775 (50%), Positives = 508/775 (66%), Gaps = 47/775 (6%)
 Frame = +1

Query  616   FPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEG  795
              P+GD Y G   G  P G G+YT SDGT YDG+W  G   G+G+ +W SGA+Y+G+   G
Sbjct  60    LPSGDTYSGTLLGSTPEGSGRYTWSDGTIYDGEWRTGMRHGQGKTLWPSGASYEGEYAGG  119

Query  796   YLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGN  975
             Y++G GT++  D  VYKG WK+N +HG+G + Y N D++ G W +G   GHG+YTW NGN
Sbjct  120   YIYGEGTYTGQDNIVYKGRWKLNRKHGLGCQMYPNGDMFQGSWIQGEIQGHGKYTWENGN  179

Query  976   MYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGR  1155
              YTG  K G MSG+G   W NGD ++G W+DG+ HG G Y ++D  YY GTW+ GLKDG+
Sbjct  180   TYTGNMKNGKMSGKGTFTWKNGDSYEGNWLDGMMHGYGIYTWSDCGYYVGTWTRGLKDGK  239

Query  1156  GTLYPVGC---ALDKCKIDGHKEIR--------RMLSHDSSI---SKKDAVKPKVKRSIS  1293
             GTLYP GC   A D+  I   K +R        R  +H S I   S  D    KV  +  
Sbjct  240   GTLYPSGCRVPAGDELYI---KNLRNRGVLPDPRRQNHGSRILHSSSVDMGNMKVGINRD  296

Query  1294  EKIVDRFARDSGRIS---RRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
                  R + DS  +S   R ++ VA +  +   ++E          S    D +   L  
Sbjct  297   SASSRRNSSDSRNVSLERRWSLEVAIEKFIGNENSET---------SENIDDSELPIL--  345

Query  1465  ITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
                  EREYMQGVLI E +  +S  G S ++ +R+K   +E +K     + KG +SY LM
Sbjct  346   -----EREYMQGVLISEVVLDRSFSGSSKKAKRRQKKTVRETKK-PGEAIIKGHRSYDLM  399

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             L+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GSRLTP H + DF WKDYCP
Sbjct  400   LSLQLGIRYTVGKITPIQKREVRASDFGPRASFWMNFPKEGSRLTPSHPAEDFKWKDYCP  459

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FK++AADYM+SIC +  LREL SPGKSGS+F+LS DDRF+IKTL+KSE++V
Sbjct  460   MVFRNLREMFKIDAADYMISICGNSALRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVQV  519

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LL+MLP+YY HV  +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H R+DLKG
Sbjct  520   LLRMLPNYYNHVHTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHRRFDLKG  579

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SSLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+  DS+FL+SQ I+DYSLLL
Sbjct  580   SSLGRSTDKIEIDENTTLKDLDLNYSFYLEPSWREALLKQIKTDSEFLKSQRIMDYSLLL  639

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS----ILPRSLTLVTHEPSIVSTAPG  2526
             G+H+RAP+HL        ++   + T++S +          P  L LV       S   G
Sbjct  640   GVHYRAPQHLRTRASYRRTMTAERLTVLSEEDAQEDDAFNYPEGLVLVQRANDENSVVVG  699

Query  2527  PHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVY  2706
             PHIRG  LR+++ G  EVDLLLPGT R+++QLGVNMPA+A +  K++++       +EVY
Sbjct  700   PHIRGSRLRSSAAGFGEVDLLLPGTARVQIQLGVNMPARAEQIPKEEDSK----SFYEVY  755

Query  2707  DVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             DVVLYLGIIDILQ YN+ KK+EH  KS+++D +SIS ++P+ YS+RF+ F++ VF
Sbjct  756   DVVLYLGIIDILQEYNITKKIEHAVKSMQYDSVSISAVDPEFYSERFLKFIQTVF  810


 Score = 79.7 bits (195),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            +++PNGD++ G +      G GKYT  +G TY G+ + GKM+GKG   W +G +Y+G+  
Sbjct  150  QMYPNGDMFQGSWIQGEIQGHGKYTWENGNTYTGNMKNGKMSGKGTFTWKNGDSYEGNWL  209

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
            +G +HG+G ++ SD   Y G W   ++ G G
Sbjct  210  DGMMHGYGIYTWSDCGYYVGTWTRGLKDGKG  240



>ref|XP_001758268.1| predicted protein [Physcomitrella patens]
 gb|EDQ77090.1| predicted protein [Physcomitrella patens]
Length=776

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/784 (50%), Positives = 523/784 (67%), Gaps = 39/784 (5%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EKV  NGD Y+G ++G LP G GKY  +DG  Y+G+W  GK +G+G+I W SGATY+G+ 
Sbjct  2     EKVLSNGDFYVGTWQGSLPEGPGKYLWADGCMYEGEWGRGKKSGQGKISWPSGATYEGEF  61

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+HGFGT+  + G+ YKG W MN +HG GRK Y N DVY+G W +GV +G G+YTW+
Sbjct  62    MGGYMHGFGTYMGTGGTTYKGQWSMNDKHGQGRKRYANGDVYEGAWYKGVHEGVGKYTWA  121

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             +GN Y G W+ G M G+GV+ W +GD F G W+DGL HG G Y +ADGS Y GTWS GLK
Sbjct  122   SGNEYNGEWRGGTMCGKGVLTWVSGDKFVGQWLDGLEHGRGVYVWADGSSYIGTWSRGLK  181

Query  1147  DGRGTLYPVGC----ALDKCKIDG-------HKEIRRMLSHDSSISKKDAVK--PKVKRS  1287
             DG+G  YP G     A     + G         E+R +    S  +  + +    ++ RS
Sbjct  182   DGKGVFYPAGTRDLQATRNSDVGGVSSCAHFSGELRPLRWSRSRSTSSEKIPHFGELSRS  241

Query  1288  --ISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLG  1461
               ++  I  R++ D    + + + + G  ++  S T  + ED          +       
Sbjct  242   GDLTNSIQRRWSIDG--PAEKGLGLEGYGSVRNSDT--ILEDVERGSDRKPLESVGTLPP  297

Query  1462  NITVAYEREYMQGVLIRERIK-SVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
              + V   REY+QGVL+ E +K + + + H+  + R+  A+E+++     +FKG +SY LM
Sbjct  298   TVVV---REYVQGVLMSELVKENAEAVGHKKRRPRR-SAREIKR-PGETIFKGHRSYDLM  352

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             LNLQLGIRY++GKITP P  E+  +DFG +A I M FP+ G+ +TP H S DF WKDYCP
Sbjct  353   LNLQLGIRYTIGKITPEPRHEIGPNDFGPRASIHMNFPKAGTPMTPIHSSSDFKWKDYCP  412

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFR+LR +FK++AADYM+S+  DD LREL+SPGKSGS+FYLS DDRF+IKT+KK+E+KV
Sbjct  413   MVFRHLREMFKIDAADYMISLTGDDALRELVSPGKSGSVFYLSHDDRFIIKTMKKAEVKV  472

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LL ML +Y+ HVK +ENTLITK FG++RI     +KVRFVVMGNMF TEL +H R+DLKG
Sbjct  473   LLSMLAAYHSHVKTYENTLITKIFGLHRIKPYGGQKVRFVVMGNMFCTELRIHRRFDLKG  532

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SS GR  DK +I+E TTLKDLDL YE R+D    ++L++QL  D +FLES+ I+DYS+LL
Sbjct  533   SSQGRSADKVEIDETTTLKDLDLKYEFRLDPSWRDSLLRQLEYDCKFLESRGIMDYSMLL  592

Query  2359  GLHFRAPEHLTALLEPPDSLFK---PKSTLVSS---DGGISILP--RSLTLVTHEPSIVS  2514
             GLHFRAP++ T LL P  S  +   P  +  S+   +GG       R L LVT + S VS
Sbjct  593   GLHFRAPQYRT-LLTPGASSARDVPPNESFTSTNLDEGGDEEWASNRGLMLVTRDASNVS  651

Query  2515  TA-PGPHIRGKTLRANSVGDREVDLLLPGTG-RLRVQLGVNMPAQAN--RKVKQDETDPS  2682
             +  PG HIRG  LRA+  GD EVDLLLPGT  RLR+QLGVNMPA+A    K   DE+ PS
Sbjct  652   SGTPGIHIRGSPLRASVAGDPEVDLLLPGTARRLRIQLGVNMPARAECVHKKDSDESKPS  711

Query  2683  EVELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFL  2859
             E +LF E +DVVLY GIIDILQ YN+ K++EH YK+ +FD +SIS +EPKLYSKRF  F+
Sbjct  712   EGQLFEESHDVVLYFGIIDILQNYNLSKRIEHAYKACQFDSISISAVEPKLYSKRFQEFI  771

Query  2860  ERVF  2871
              ++F
Sbjct  772   RQIF  775


 Score = 74.3 bits (181),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  583  MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
            M +      K + NGDVY G +   +  G GKYT + G  Y+G+W  G M GKG + W S
Sbjct  86   MNDKHGQGRKRYANGDVYEGAWYKGVHEGVGKYTWASGNEYNGEWRGGTMCGKGVLTWVS  145

Query  763  GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
            G  + G   +G  HG G +  +DGS Y G W   ++ G G
Sbjct  146  GDKFVGQWLDGLEHGRGVYVWADGSSYIGTWSRGLKDGKG  185



>ref|XP_008802080.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform 
X5 [Phoenix dactylifera]
Length=640

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/628 (59%), Positives = 450/628 (72%), Gaps = 8/628 (1%)
 Frame = +1

Query  586   ENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSG  765
             E++ER  EKV PNGDVY+G F G+ PHG GKY  SDGT Y+G+WE+ KMTG+G+I W SG
Sbjct  13    EDSERHREKVLPNGDVYVGNFDGLFPHGTGKYIWSDGTLYEGEWEKSKMTGRGRIYWPSG  72

Query  766   ATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDG  945
             ATY+GD   G+LHG GTF   DGSVYKG W+MNIQHG+G K Y NS +Y+G WKEG+++G
Sbjct  73    ATYEGDICGGFLHGSGTFYGLDGSVYKGSWRMNIQHGMGTKTYPNSGIYEGLWKEGLQEG  132

Query  946   HGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFG  1125
              GRYTWSN N Y G WK G MSGRGVMKW NGDLFDG W+DGL+HGSG Y++ADG+YYFG
Sbjct  133   IGRYTWSNRNTYIGNWKAGKMSGRGVMKWENGDLFDGVWLDGLKHGSGYYKYADGAYYFG  192

Query  1126  TWSNGLKDGRGTLYPVGCALDKCKI-------DGHKEIRRMLSHDSSISKKDAVKPKVKR  1284
             TWS GLKDGRG  Y  G  L K K        DG + +    S  SS   ++    K + 
Sbjct  193   TWSRGLKDGRGIFYAAGSKLPKQKFSESVVCNDGAQSLCPA-SLMSSEGLRNKPLHKKRY  251

Query  1285  SISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
             S        +   SGRIS R VS  G   L  S+  VL +D+S  LS ++ +G+ +   +
Sbjct  252   SFDGWNTSSYFCRSGRISHRPVSFEGIWNLSDSAGSVLSQDSSLTLSSSSDEGQHKLQHD  311

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLN  1644
               + YEREY QG+LI ER +S D    + T+      ++   G    + KG KSYYLMLN
Sbjct  312   NVLVYEREYAQGILIMERTRSSDSGVKRKTKWHHKIQRKQPSGPGEAIHKGHKSYYLMLN  371

Query  1645  LQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIV  1824
             LQLGIRY+VGKITP+PMREVR SDFG +ARI+MYFP KGS+ TPPH SIDF+WKDYCP+V
Sbjct  372   LQLGIRYTVGKITPVPMREVRSSDFGPRARIQMYFPSKGSQFTPPHHSIDFFWKDYCPMV  431

Query  1825  FRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLL  2004
             FRNLR +FK++AADYMMSIC  D L+EL SPGKSGSIFYLS D+RFVIKTL+K ELK+LL
Sbjct  432   FRNLREMFKIDAADYMMSICGGDDLKELSSPGKSGSIFYLSQDERFVIKTLRKYELKILL  491

Query  2005  KMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSS  2184
             KMLP YY HV  ++NTLITKFFG++ I+++  +KVRFVVMGNMF T LH+H RYDLKGSS
Sbjct  492   KMLPKYYNHVGIYDNTLITKFFGLHTITIKGVRKVRFVVMGNMFCTGLHIHRRYDLKGSS  551

Query  2185  LGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGL  2364
              GR T K  I E TTLKDLDL Y   +++   ++L +Q+SLD  FLESQ IIDYS+LLGL
Sbjct  552   QGRSTSKHNINENTTLKDLDLSYVFHLERSWRDSLFRQISLDCMFLESQCIIDYSMLLGL  611

Query  2365  HFRAPEHLTALLEPPDSLFKPKSTLVSS  2448
             HFRAPEHL ALLE   +L    S+  ++
Sbjct  612   HFRAPEHLKALLECQHTLQNSSSSQANN  639



>gb|KHN18690.1| Phosphatidylinositol-4-phosphate 5-kinase 9 [Glycine soja]
Length=818

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/763 (49%), Positives = 512/763 (67%), Gaps = 18/763 (2%)
 Frame = +1

Query  622   NGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEGYL  801
             NG+ Y G   G +  G G Y   DG  Y+G+W  G   G G++ W SGA Y+GD   GY+
Sbjct  54    NGESYSGSLYGNVSEGHGTYVWCDGCVYEGEWRRGMRNGYGKLRWPSGAVYEGDFSGGYI  113

Query  802   HGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMY  981
             HG GT+  SD   YKG W++N++HG+G + Y N D ++G W +G ++G G+YTW+NGN+Y
Sbjct  114   HGTGTYIRSDKLKYKGRWRLNLKHGLGFQVYPNGDTFEGSWMQGTQEGPGKYTWTNGNVY  173

Query  982   TGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGT  1161
              G  K G MSG+G + W NGD ++G W++G+ HG G Y ++DG  Y GTW+ GLKDG+GT
Sbjct  174   VGNMKGGIMSGKGTLTWINGDSYEGNWLNGMMHGFGVYTWSDGGCYVGTWTFGLKDGKGT  233

Query  1162  LYPVGCALDKCKIDGHKEIR-RMLSHDSSISK--KDAVKPKVKRSISEKIVDRFARDS--  1326
              YP G  L   +      +R R L  D    K  +D   P+   S S    D+FA+ +  
Sbjct  234   FYPRGSRLPWVQEIYLSALRKRGLLPDLRKQKQVRDVKVPENHMS-SHVSSDKFAKGNLL  292

Query  1327  --GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQG  1500
                  +RR VS+    +L  S  +V+  D++   + +  + +  ++  +    EREYMQG
Sbjct  293   NLEESNRRNVSLERRWSLEVSIEKVIGYDSALRFAESVPESRDGEVDAMIPILEREYMQG  352

Query  1501  VLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVG  1674
             VLI E +       +S ++ + +K   KE+++     + KG +SY LML+LQLGIRY+VG
Sbjct  353   VLISEVVLNNMFSSMSRRARRLQKKLVKEIKR-PGEAIIKGHRSYDLMLSLQLGIRYTVG  411

Query  1675  KITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKL  1854
             KITPIP R VR SDFG +A   M FP++GS+LTP H+S DF WKDYCP+VFRNLR LFK+
Sbjct  412   KITPIPTRGVRASDFGPKASFWMDFPKEGSQLTPTHQSDDFKWKDYCPMVFRNLRELFKI  471

Query  1855  NAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHV  2034
             +AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL++SE+KVLL+MLP Y+ HV
Sbjct  472   DAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRRSEVKVLLRMLPDYHHHV  531

Query  2035  KDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKI  2214
             K +ENTLITKFFG++RI     +K RFVVMGNMF T+L +H R+DLKGSSLGR +DK +I
Sbjct  532   KSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTDLRIHRRFDLKGSSLGRSSDKIEI  591

Query  2215  EEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTA  2394
             +E TTLKDLDL Y   ++    E+L+KQ+ +DS+FLE+QHI+DYSLLLG+H+RAP+HL +
Sbjct  592   DESTTLKDLDLNYSFYLEPSWRESLLKQIEIDSKFLEAQHIMDYSLLLGVHYRAPQHLRS  651

Query  2395  LLEPPDSLFKPKSTLVSSDGGIS---ILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSV  2565
              +    S       +++ +  +      P+ L LV       S   G H+RG  LRA+S 
Sbjct  652   HVSYNQSRSVDGLAMLAEEDPLEDEVFYPQGLVLVPRGGDDDSVVVGSHMRGSRLRASSA  711

Query  2566  GDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF-EVYDVVLYLGIIDIL  2742
             GD EVDLLLPGT RL++QLGVNMP++A + + + +    E ++F EVYDVVLYLGIIDIL
Sbjct  712   GDEEVDLLLPGTARLQIQLGVNMPSRAEQILGKQK---QEKQMFHEVYDVVLYLGIIDIL  768

Query  2743  QAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             Q YNM K++EH YKSL+FD +SIS ++P  YS RF+ F+++VF
Sbjct  769   QDYNMTKRIEHAYKSLQFDSLSISAVDPTFYSHRFLEFIQKVF  811


 Score = 81.6 bits (200),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            +V+PNGD + G +      G GKYT ++G  Y G+ + G M+GKG + W +G +Y+G+  
Sbjct  142  QVYPNGDTFEGSWMQGTQEGPGKYTWTNGNVYVGNMKGGIMSGKGTLTWINGDSYEGNWL  201

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             G +HGFG ++ SDG  Y G W   ++ G G
Sbjct  202  NGMMHGFGVYTWSDGGCYVGTWTFGLKDGKG  232


 Score = 70.9 bits (172),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 60/114 (53%), Gaps = 1/114 (1%)
 Frame = +1

Query  877   VGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDG  1056
             VG+    N + Y G     V +GHG Y W +G +Y G W++G  +G G ++W +G +++G
Sbjct  47    VGQLLLFNGESYSGSLYGNVSEGHGTYVWCDGCVYEGEWRRGMRNGYGKLRWPSGAVYEG  106

Query  1057  FWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG-TLYPVGCALDKCKIDGHKE  1215
              +  G  HG+G Y  +D   Y G W   LK G G  +YP G   +   + G +E
Sbjct  107   DFSGGYIHGTGTYIRSDKLKYKGRWRLNLKHGLGFQVYPNGDTFEGSWMQGTQE  160



>ref|XP_006299081.1| hypothetical protein CARUB_v10015222mg [Capsella rubella]
 gb|EOA31979.1| hypothetical protein CARUB_v10015222mg [Capsella rubella]
Length=816

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/773 (49%), Positives = 510/773 (66%), Gaps = 24/773 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R    + P+G+ Y G   G +P G GKY  SDG  YDG+W  G   G G++IW+SGA Y+
Sbjct  46    RVKTLLLPDGESYCGSLLGNVPEGPGKYVWSDGCVYDGEWRRGVRHGIGKMIWASGAWYE  105

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  ++   YKG W++N++HG+G ++Y N DV++G W +G+ +G G+Y
Sbjct  106   GEFAGGYMHGSGTYVDANKLTYKGRWRLNLKHGLGYQDYPNGDVFEGSWIQGLGEGPGKY  165

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N N+Y G  K G MSG+G + W  GD ++G W++G+ HG G Y + DG  Y GTW+ 
Sbjct  166   TWANKNVYLGDMKGGKMSGKGTLTWVTGDSYEGSWLNGMMHGVGVYTWRDGGCYVGTWTR  225

Query  1138  GLKDGRGTLYPVGC---ALDKCKIDGHK------EIRRMLSHDSSISKKDAVKPKVKRSI  1290
             GLKDG+G+ Y  G    A+ +  ++  +      +++R     SS++ ++ ++  V RS 
Sbjct  226   GLKDGKGSFYSAGTRVPAVQEFYLNALRKRGVLPDLKRQNQVASSVNMEN-LRVGVNRSK  284

Query  1291  SEK--IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
               K  +++     +GR     VS+    +L  S  +V+  D S + +     G + Q   
Sbjct  285   LSKGSLINLEQSRNGR-----VSLERRWSLEVSIEKVIGHDYSDLSTAVLDSGSSVQYNA  339

Query  1465  ITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
                  EREYMQGVLI E +        S ++ ++ K   KE +K   + + KG +SY LM
Sbjct  340   NIPILEREYMQGVLISELVVNNGFSRTSRRAKKKHKRLVKEAKKPGEV-VIKGHRSYDLM  398

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             LNLQLGIRY+VGKITPI  REVR +DFG +A   M FPR GS +TPPHRS DF WKDYCP
Sbjct  399   LNLQLGIRYTVGKITPIQRREVRTADFGPRASFWMNFPRAGSTMTPPHRSEDFKWKDYCP  458

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+KV
Sbjct  459   MVFRNLREMFKIDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVKV  518

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LL+MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF+T+L +H R+DLKG
Sbjct  519   LLRMLPDYHHHVKTYENTLITKFFGLHRIRPSSGQKFRFVVMGNMFFTDLRIHRRFDLKG  578

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SSLGR  DK +I+E T LKDLDL Y   ++    E L++QL +DS+FLE+Q+I+DYSLLL
Sbjct  579   SSLGRSADKVEIDENTILKDLDLSYNFFLEPSWREGLLRQLEIDSKFLEAQNIMDYSLLL  638

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--ILPRSLTLVTHEPSIVSTAPGPH  2532
             G+H RAP+HL + L    S+       V+ D  I   +L     LV       +   GPH
Sbjct  639   GVHHRAPQHLRSQLVRSQSITTDALESVAEDDTIEDDMLSYHEGLVLVPRGSENIVTGPH  698

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG  LRA++VGD EVDLLLPGT RL++Q GVNMPA+A     ++E D     L +  DV
Sbjct  699   IRGSRLRASAVGDEEVDLLLPGTARLQIQQGVNMPARAELIPGREEKDKQ--ILHDCCDV  756

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VLYLGIIDILQ YNM KK+EH YKSL FD +SIS ++P  YS+RF+ F+++VF
Sbjct  757   VLYLGIIDILQEYNMTKKIEHAYKSLHFDSLSISAVDPTFYSQRFLEFIKKVF  809



>ref|XP_003521419.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X1 [Glycine max]
 ref|XP_006577040.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X2 [Glycine max]
Length=818

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/766 (49%), Positives = 512/766 (67%), Gaps = 24/766 (3%)
 Frame = +1

Query  622   NGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEGYL  801
             NG+ Y G   G +  G G Y   DG  Y+G+W  G   G G++ W SGA Y+GD   GY+
Sbjct  54    NGESYSGSLYGNVSEGHGTYVWCDGCVYEGEWRRGMRNGYGKLRWPSGAVYEGDFSGGYI  113

Query  802   HGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMY  981
             HG GT+  SD   YKG W++N++HG+G + Y N D ++G W +G ++G G+YTW+NGN+Y
Sbjct  114   HGTGTYIRSDKLKYKGRWRLNLKHGLGFQVYPNGDTFEGSWMQGTQEGPGKYTWTNGNVY  173

Query  982   TGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGT  1161
              G  K G MSG+G + W NGD ++G W++G+ HG G Y ++DG  Y GTW+ GLKDG+GT
Sbjct  174   VGNMKGGIMSGKGTLTWINGDSYEGNWLNGMMHGFGVYTWSDGGCYVGTWTFGLKDGKGT  233

Query  1162  LYPVGCALDKCKIDGHKEIR-RMLSHDSSISK--KDAVKPKVKRSISEKIVDRFARDS--  1326
              YP G  L   +      +R R L  D    K  +D   P+   S S    D+FA+ +  
Sbjct  234   FYPRGSRLPWVQEIYLSALRKRGLLPDLRKQKQVRDVKVPENHMS-SHVSSDKFAKGNLL  292

Query  1327  --GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQG  1500
                  +RR VS+    +L  S  +V+  D++   + +  + +  ++  +    EREYMQG
Sbjct  293   NLEESNRRNVSLERRWSLEVSIEKVIGYDSALRFAESVPESRDGEVDAMIPILEREYMQG  352

Query  1501  VLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVG  1674
             VLI E +       +S ++ + +K   KE+++     + KG +SY LML+LQLGIRY+VG
Sbjct  353   VLISEVVLNNMFSSMSRRARRLQKKLVKEIKR-PGEAIIKGHRSYDLMLSLQLGIRYTVG  411

Query  1675  KITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKL  1854
             KITPIP R VR SDFG +A   M FP++GS+LTP H+S DF WKDYCP+VFRNLR LFK+
Sbjct  412   KITPIPTRGVRASDFGPKASFWMDFPKEGSQLTPTHQSDDFKWKDYCPMVFRNLRELFKI  471

Query  1855  NAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHV  2034
             +AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL++SE+KVLL+MLP Y+ HV
Sbjct  472   DAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRRSEVKVLLRMLPDYHHHV  531

Query  2035  KDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKI  2214
             K +ENTLITKFFG++RI     +K RFVVMGNMF T+L +H R+DLKGSSLGR +DK +I
Sbjct  532   KSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTDLRIHRRFDLKGSSLGRSSDKIEI  591

Query  2215  EEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTA  2394
             +E TTLKDLDL Y   ++    E+L+KQ+ +DS+FLE+QHI+DYSLLLG+H+RAP+HL +
Sbjct  592   DESTTLKDLDLNYSFYLEPSWRESLLKQIEIDSKFLEAQHIMDYSLLLGVHYRAPQHLRS  651

Query  2395  LLEPPDSLFKPKSTLVSSDGGIS---ILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSV  2565
              +    S       +++ +  +      P+ L LV       S   G H+RG  LRA+S 
Sbjct  652   HVSYNQSRSVDGLAMLAEEDPLEDEVFYPQGLVLVPRGGDDDSVVVGSHMRGSRLRASSA  711

Query  2566  GDREVDLLLPGTGRLRVQLGVNMPAQANR---KVKQDETDPSEVELF-EVYDVVLYLGII  2733
             GD EVDLLLPGT RL++QLGVNMP++A +   K KQ      E ++F EVYDVVLYLGII
Sbjct  712   GDEEVDLLLPGTARLQIQLGVNMPSRAEQISGKQKQ------EKQMFHEVYDVVLYLGII  765

Query  2734  DILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             DILQ YNM K++EH YKSL+FD +SIS ++P  YS RF+ F+++VF
Sbjct  766   DILQDYNMTKRIEHAYKSLQFDSLSISAVDPTFYSHRFLEFIQKVF  811


 Score = 81.6 bits (200),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            +V+PNGD + G +      G GKYT ++G  Y G+ + G M+GKG + W +G +Y+G+  
Sbjct  142  QVYPNGDTFEGSWMQGTQEGPGKYTWTNGNVYVGNMKGGIMSGKGTLTWINGDSYEGNWL  201

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             G +HGFG ++ SDG  Y G W   ++ G G
Sbjct  202  NGMMHGFGVYTWSDGGCYVGTWTFGLKDGKG  232


 Score = 70.9 bits (172),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 60/114 (53%), Gaps = 1/114 (1%)
 Frame = +1

Query  877   VGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDG  1056
             VG+    N + Y G     V +GHG Y W +G +Y G W++G  +G G ++W +G +++G
Sbjct  47    VGQLLLFNGESYSGSLYGNVSEGHGTYVWCDGCVYEGEWRRGMRNGYGKLRWPSGAVYEG  106

Query  1057  FWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG-TLYPVGCALDKCKIDGHKE  1215
              +  G  HG+G Y  +D   Y G W   LK G G  +YP G   +   + G +E
Sbjct  107   DFSGGYIHGTGTYIRSDKLKYKGRWRLNLKHGLGFQVYPNGDTFEGSWMQGTQE  160



>ref|XP_006648147.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X2 [Oryza brachyantha]
Length=822

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/780 (48%), Positives = 508/780 (65%), Gaps = 33/780 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E    NGD+Y G   G  P G G+Y  SDG TYDG+W  G   G+G+ +W SGATY+
Sbjct  54    RVGELRLSNGDIYSGTLLGSTPEGSGRYVWSDGCTYDGEWRRGMRHGQGKTMWPSGATYE  113

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY++G GT++ +D  +YKG WK+N +HG+G + Y N D ++G W +G  +GHG+Y
Sbjct  114   GEYSGGYIYGEGTYTGADSIIYKGRWKLNRKHGLGFQTYPNGDTFEGSWIQGEIEGHGKY  173

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW NGN Y G  K G MSG+G + W NGD ++G W DG+ HG G Y + +  YY GTW+ 
Sbjct  174   TWVNGNTYIGNMKNGRMSGKGTLTWKNGDSYEGNWFDGVMHGYGIYTWKECGYYVGTWTK  233

Query  1138  GLKDGRGTLYPVGCAL---DKCKIDGHK------EIRRM-----LSHDSSISKKDAVKPK  1275
             GLKDG+GT YP GC +   D+  I+  +      ++RR      + H SS+   + +K  
Sbjct  234   GLKDGKGTFYPKGCRVPVSDELYINNLRNRGVLPDLRRQNHGSRIVHSSSVDMGN-MKVG  292

Query  1276  VKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQ  1455
             + R  S     R + +   +  + VS+    +L  +  + +  DAS       C+   + 
Sbjct  293   LTRESSGASSRRNSMEQPHL--KNVSLERRWSLEVAIEKFIGHDASGSSGLERCESIND-  349

Query  1456  LGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
               +     EREYMQGVLI E +  +S    S ++ +R+K   +E ++     + KG +SY
Sbjct  350   --SDLPMLEREYMQGVLISEVVLDRSFSDSSKKAKRRQKKMVRETKR-PGETIIKGHRSY  406

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
              LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GSRLTP H + DF WKD
Sbjct  407   DLMLSLQLGIRYTVGKITPIQKREVRASDFGPRASFWMTFPKEGSRLTPSHSAEDFKWKD  466

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FK++AADYM+SIC +  LREL SPGKSGS+F+LS DDRF+IKTL+KSE
Sbjct  467   YCPMVFRNLREMFKIDAADYMISICGNSALRELSSPGKSGSVFFLSQDDRFMIKTLRKSE  526

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
               VLL+MLP+YY HV+ +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H R+D
Sbjct  527   --VLLRMLPNYYHHVRTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHRRFD  584

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGSSLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+  DS+FL +Q I+DYS
Sbjct  585   LKGSSLGRSTDKIEIDENTTLKDLDLNYSFYLEPSWREALLKQIETDSEFLRTQRIMDYS  644

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS----ILPRSLTLVTHEPSIVST  2517
             LLLG+H+RAP+HL        S+   + T++S +          P  L LV       S 
Sbjct  645   LLLGVHYRAPQHLRTRASYHRSMAADRLTVLSEEDAQEDDAFNYPEGLVLVQRGSGENSV  704

Query  2518  APGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
               GPHIRG  LR+++ G  EVDLLLPGT RL++QLGVNMPA+A +  K++E+        
Sbjct  705   VVGPHIRGSRLRSSAAGFGEVDLLLPGTARLQIQLGVNMPARAEQNPKEEESK----SFR  760

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA  2877
             EVYDVVLYLGIIDILQ YNM KK+EH  KS+++D +SIS ++P  YS+RF+ F++ VF A
Sbjct  761   EVYDVVLYLGIIDILQDYNMTKKIEHAVKSMQYDSVSISAVDPHFYSERFLKFIQTVFPA  820



>ref|XP_010050436.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Eucalyptus 
grandis]
 ref|XP_010050442.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Eucalyptus 
grandis]
 ref|XP_010050449.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Eucalyptus 
grandis]
 ref|XP_010050455.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Eucalyptus 
grandis]
 gb|KCW89327.1| hypothetical protein EUGRSUZ_A01618 [Eucalyptus grandis]
Length=828

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/776 (49%), Positives = 501/776 (65%), Gaps = 32/776 (4%)
 Frame = +1

Query  616   FPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEG  795
              PNG+ Y G   G  P G G Y  SDG  Y+GDW  G   G G+I W SG  Y+G+   G
Sbjct  55    LPNGESYSGSLLGNAPEGFGTYVWSDGCIYEGDWRRGMRHGNGKISWPSGTVYEGEFSGG  114

Query  796   YLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGN  975
             Y+HG GT+   +   YKG W++N++HG+G + + N DV++G W +G+ +G G+Y+W+NGN
Sbjct  115   YIHGEGTYIGIEKLTYKGRWRLNLKHGLGYQIFPNGDVFEGSWIQGMAEGPGKYSWANGN  174

Query  976   MYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGR  1155
             +Y G  K G MSG+G + W NG+LF+G W++G+ HG G Y + DG  Y GTW+ GLKDG+
Sbjct  175   VYFGNMKGGKMSGKGTLTWVNGNLFEGSWLNGMMHGFGVYTWNDGGCYVGTWTRGLKDGK  234

Query  1156  GTLYPVGC-----------------ALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKR  1284
             G+ YP G                   L   K   H  I    S D    K        + 
Sbjct  235   GSFYPKGSRFPPVQELYLNAMRKRGLLPDMKKPNHSHIHHASSVDMGHMKVGGDWGVHRH  294

Query  1285  SISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
             S S+K+      +  +     VS+    +L  S  +V+  D+S   S +  DG  E   +
Sbjct  295   SSSDKMSKGNLLNLEQSRGSNVSLQRRWSLEVSIEKVIGHDSSLGSSESFLDGGEEAEAD  354

Query  1465  ITVAYEREYMQGVLIRERI---KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYL  1635
             I +  EREYMQGVLI E +   K          +++KF  + +  G    +FKG +SY L
Sbjct  355   IPI-LEREYMQGVLISEVVLDNKFSPSSRRARRRQKKFAKEAIMLGEA--IFKGHRSYDL  411

Query  1636  MLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYC  1815
             ML+LQLGIRY+VGKITPI  REVR SDFG +A   M FPR+GS+LTPPH+S DF WKDYC
Sbjct  412   MLSLQLGIRYTVGKITPIQKREVRASDFGPRASFWMNFPREGSQLTPPHQSEDFKWKDYC  471

Query  1816  PIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELK  1995
             P+VFRNLR +FK++AADYM+SIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+K
Sbjct  472   PMVFRNLREMFKIDAADYMISICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVK  531

Query  1996  VLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLK  2175
             VLL+MLP+YY HV+ ++NTLITKFFG++RI     +K RFVVMGNMF TEL +H R+DLK
Sbjct  532   VLLRMLPNYYHHVQTYDNTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRRFDLK  591

Query  2176  GSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLL  2355
             GSSLGR  DK +I+E T LKDLDL Y   +     E L++Q+ +D++FLE+QHI+DYSLL
Sbjct  592   GSSLGRSADKVEIDENTILKDLDLNYCFYLQPSWQEALMQQIEIDAKFLEAQHIMDYSLL  651

Query  2356  LGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISI--LPRSLTLVTHEPSIVSTAPGP  2529
             LG+H+RAP+HL   +     +      +++ +  +     P+ L LV       S   GP
Sbjct  652   LGVHYRAPQHLRPNVSYNQGMTADGLGILAEEDTLEDERYPQGLVLVPRGTEDDSIVVGP  711

Query  2530  HIRGKTLRANS-VGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF-EV  2703
             HIRG  LRA+S  GD EVDLLLPGT RL++QLGVNMPA+A +   ++E      ++F E 
Sbjct  712   HIRGSRLRASSAAGDEEVDLLLPGTARLQIQLGVNMPARAEQIPGKEEK-----QIFHEA  766

Query  2704  YDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             YDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P+ YS RF+ F+++VF
Sbjct  767   YDVVLYLGIIDILQEYNMSKKIEHAYKSLQFDSLSISAVDPRFYSHRFLEFIKKVF  822


 Score = 81.6 bits (200),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            ++FPNGDV+ G +   +  G GKY+ ++G  Y G+ + GKM+GKG + W +G  ++G   
Sbjct  145  QIFPNGDVFEGSWIQGMAEGPGKYSWANGNVYFGNMKGGKMSGKGTLTWVNGNLFEGSWL  204

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             G +HGFG ++ +DG  Y G W   ++ G G
Sbjct  205  NGMMHGFGVYTWNDGGCYVGTWTRGLKDGKG  235



>ref|XP_011077292.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Sesamum 
indicum]
 ref|XP_011077293.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Sesamum 
indicum]
 ref|XP_011077294.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Sesamum 
indicum]
Length=824

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/780 (49%), Positives = 505/780 (65%), Gaps = 24/780 (3%)
 Frame = +1

Query  589   NNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGA  768
             N  R  E + P+G+ Y G   G +P G G Y  SDG  Y+G+W  G   G G++ W SGA
Sbjct  47    NGFRAREILLPDGESYSGSLLGNVPEGSGNYIWSDGCKYEGEWRSGMRHGYGKLRWPSGA  106

Query  769   TYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGH  948
              Y+G+   GY+HG G ++  D   YKG W++N++HG+G + + N DV++G W +G  +G 
Sbjct  107   LYEGEFSGGYMHGSGMYTRPDNMTYKGRWRLNLKHGLGYQNFPNGDVFEGSWIQGTPEGP  166

Query  949   GRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGT  1128
             G+Y W+NGN+Y G  K G MSG+G + W +GD ++G W++G+ HG G Y ++DG  Y GT
Sbjct  167   GKYIWANGNVYMGNMKSGKMSGKGTLTWISGDSYEGSWLNGMMHGFGIYTWSDGGCYVGT  226

Query  1129  WSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRM-----------LSHDSSISKKDAVKPK  1275
             W+ GLKDG+GT YP G  +   K      +R+             SH    +  D+ K  
Sbjct  227   WTRGLKDGKGTFYPRGSRVPTGKQLYLNAMRKRGVLPDLRQENRASHFHQATSGDSRKGS  286

Query  1276  VKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQ  1455
                S S+K       D  R      S+    +L  S  +V+  +    +S T  +G   +
Sbjct  287   GWNS-SDKTSKGSLIDLQRSRTTNASLERRWSLEVSIEKVIGNERLPSVSDTVLEGGDNE  345

Query  1456  LGNITVAYEREYMQGVLIRERIKS--VDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
              G      EREYMQGVLI E + S      S Q+ +R K  AKE++K     + KG +SY
Sbjct  346   YGINNPILEREYMQGVLISELVLSNRFSLSSKQAKRREKKLAKEIKK-PGEQIIKGHRSY  404

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
              LMLNLQLGIRY+VGKITP+  REVR +DFG +A   M FP++GS+LTP H S DF WKD
Sbjct  405   DLMLNLQLGIRYTVGKITPVHRREVRTTDFGPRASFWMTFPKEGSQLTPSHPSDDFKWKD  464

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE
Sbjct  465   YCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRKSE  524

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             +KVLL+MLP+Y+ HV+ ++NTLITKFFG++RI     +K RFVVMGNMF TEL +H R+D
Sbjct  525   VKVLLRMLPNYHLHVRRYDNTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRRFD  584

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGSSLGR  DK +I+E T LKDLDL Y   ++    + L++Q+  DS+FLESQHI+DYS
Sbjct  585   LKGSSLGRSADKVEIDENTILKDLDLNYCFYLEPSWRDALLQQIETDSKFLESQHIMDYS  644

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SILPRSLTLVTHEPSIVSTAP  2523
             LLLG+++RAP+HL +L+     +      +V+ D  +   I P+ L LV       S   
Sbjct  645   LLLGVNYRAPQHLCSLMSYGRHVSVDGLGIVAEDEAMEDEISPQGLVLVPRGADDSSVVV  704

Query  2524  GPHIRGKTLRA-NSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF-  2697
             G HIRG  LRA +S G  EVDLLLPGT RL++QLGVNMPA+A     +DET     E+F 
Sbjct  705   GSHIRGSRLRASSSTGGEEVDLLLPGTARLQIQLGVNMPARAEHVPGKDET-----EMFH  759

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA  2877
             EVYDVVLYLGIIDILQ YN  KK+EH YKS++FD +SIS + P  YS+RF+ F+++VF A
Sbjct  760   EVYDVVLYLGIIDILQEYNTSKKIEHAYKSIQFDSVSISAVNPTFYSQRFLEFIKKVFPA  819



>ref|XP_009793190.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Nicotiana 
sylvestris]
Length=818

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/805 (48%), Positives = 514/805 (64%), Gaps = 37/805 (5%)
 Frame = +1

Query  517   LCAVRREVYRNSYGMGI*CVIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDG  696
             L A+    Y      G  C+     N R  E + PNG+ Y G   G +P G GKY  SDG
Sbjct  24    LDAIHDNNYITKLTNGEVCLSSETTNFRVGELLLPNGESYSGSLLGNIPEGSGKYIWSDG  83

Query  697   TTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHG  876
               YDG+W  G   G G++ + SGA YDG+   GY+HG GT+   D   Y+G W++N++HG
Sbjct  84    CQYDGEWRHGMRHGHGKLEFPSGAVYDGEFSGGYMHGEGTYIGPDKVTYRGRWRLNLKHG  143

Query  877   VGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDG  1056
             +G + Y N D+++G W +G  +G G+YTW+NGN+Y G  K G +SG+G + W NGD ++G
Sbjct  144   LGYQMYPNGDIFEGSWIQGTPEGPGKYTWANGNVYFGNMKGGKISGKGTLTWINGDSYEG  203

Query  1057  FWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVGC-----------ALDKCKID  1203
              W++G  HG G Y +++GS Y GTW++ LKDG+GT YP G            AL K  + 
Sbjct  204   SWLNGTMHGVGVYTWSEGSCYIGTWTHSLKDGKGTFYPSGSRLTAGQELYLNALRKRGLL  263

Query  1204  GHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARDSGRISR-RAVSVAGDA--AL  1374
                  +  +SH    +  D    K+          R  R+     + R  +VA +   +L
Sbjct  264   PDMRKQNQVSHIHHAASVDMGNVKLVSGNQGSYDKRPERNLLNFEQSRPTNVALERRWSL  323

Query  1375  HCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVA-YEREYMQGVLIRERIKSVDGLSHQS  1551
               +  +V+  D          DG  E   N++    EREYMQGVLI E + + D  S  S
Sbjct  324   EVAIEKVIGHD---------LDGDMED--NMSAPILEREYMQGVLISEVVLN-DRFSPPS  371

Query  1552  TQRRKFPAKEVR--KGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGE  1725
              + R+   K  R  K     + KG +SY LML+LQLGIRY+VGKITPI  RE+R SDFG 
Sbjct  372   GRARRRQRKLARELKRPGEAIIKGHRSYDLMLSLQLGIRYTVGKITPIQRREIRASDFGP  431

Query  1726  QARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRE  1905
             +A   MYFP++GS+LTP H+S DF WKDYCP+VFRNLR +FK++AADYMMSIC +D LRE
Sbjct  432   RASFWMYFPKEGSQLTPTHQSEDFKWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRE  491

Query  1906  LLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRI  2085
             L SPGKSGS+F+LS DDRF+IKTL+KSE+KVLL+MLP+Y++HVK HENTLITKFFG++RI
Sbjct  492   LSSPGKSGSVFFLSQDDRFMIKTLRKSEVKVLLQMLPNYHRHVKTHENTLITKFFGLHRI  551

Query  2086  SLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRM  2265
                  +K RFVVMGNMF TEL +H R+DLKGSSLGR  DK +I+E T LKDLDL Y   +
Sbjct  552   KPSSGQKFRFVVMGNMFCTELRIHRRFDLKGSSLGRSADKVEIDENTILKDLDLNYCFYL  611

Query  2266  DKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVS  2445
             +    E L++Q+ +DS+FLE QHI+DYSLLLG+H+RAP+HL +L+            +V+
Sbjct  612   EPSWREALLRQIEIDSKFLEEQHIMDYSLLLGVHYRAPQHLQSLISCSGRTTVDGLEIVA  671

Query  2446  SDGGI--SILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSV-GDREVDLLLPGTGRLRV  2616
              +  +   I P+ L LV    S  S   GPH+RG  LRA+S  GD EVDLLLPGT RL++
Sbjct  672   EEESLEDEISPQGLVLVP-RGSDDSVVVGPHVRGSRLRASSATGDAEVDLLLPGTARLQI  730

Query  2617  QLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRF  2796
             QLGVNMPA+A    K+ +T        EVYDVVLYLGIIDILQ YN+ KKLEH YKS++F
Sbjct  731   QLGVNMPARAEYIPKEGQTQV----FHEVYDVVLYLGIIDILQDYNISKKLEHAYKSIQF  786

Query  2797  DPMSISVIEPKLYSKRFISFLERVF  2871
             D +SIS ++P  YS+RF+ F+ +VF
Sbjct  787   DSVSISAVDPTFYSERFLEFIRKVF  811



>ref|XP_006407623.1| hypothetical protein EUTSA_v10020082mg [Eutrema salsugineum]
 gb|ESQ49076.1| hypothetical protein EUTSA_v10020082mg [Eutrema salsugineum]
Length=814

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/775 (49%), Positives = 509/775 (66%), Gaps = 28/775 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PNG+ Y G   G +P G GKY  SDG  YDG+W  G   G G++ W+SGA YD
Sbjct  46    RVRELLLPNGESYSGSLLGNVPEGSGKYVWSDGCVYDGEWRRGMRHGSGKMRWASGAWYD  105

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  ++   YKG W++N++HG+G + Y N D ++G W +G+ +G G+Y
Sbjct  106   GEFSGGYMHGTGTYMDANNLTYKGRWRLNLKHGLGYQVYPNGDAFEGSWIQGLGEGPGKY  165

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W  GD ++G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  166   TWANGNVYLGDMKGGKMSGKGTLTWITGDSYEGSWLNGMMHGLGVYTWSDGGCYVGTWTR  225

Query  1138  GLKDGRGTLYPVGC---ALDKCKIDGHK------EIRRMLSHDSSISKKDAVKPKVKRSI  1290
             GLKDG+G+ Y  G    A+ +  ++  +      ++RR     SS++ ++ ++  V R  
Sbjct  226   GLKDGKGSFYSAGTRVPAVQEFYLNALRKRGVLPDLRRQNQVASSVNMEN-LRVGVNRDK  284

Query  1291  SEK--IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCD--GKAEQL  1458
               K  +++     +GR     VS+    +L  S  +V+  D S  LS    D  G  +  
Sbjct  285   LSKGSLMNLEQSRNGR-----VSLERRWSLEVSIEKVIGHDYSD-LSEAALDSGGSVQYK  338

Query  1459  GNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYY  1632
              NI +  EREYMQGVLI E +        S ++ ++ K   KE +K   + + KG +SY 
Sbjct  339   ANIPI-LEREYMQGVLISELVVNNGFSRTSRRAKRKHKRLVKEAKKPGEV-VIKGHRSYD  396

Query  1633  LMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDY  1812
             LML+LQLGIRY+VGKITPI  REVR +DFG +A   M FPR GS +TPPH S DF WKDY
Sbjct  397   LMLSLQLGIRYTVGKITPIQRREVRTADFGPRASFWMNFPRAGSTMTPPHHSEDFKWKDY  456

Query  1813  CPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSEL  1992
             CP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+
Sbjct  457   CPMVFRNLREMFKIDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEV  516

Query  1993  KVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDL  2172
             KVLL+MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF+T+L +H R+DL
Sbjct  517   KVLLRMLPDYHHHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFFTDLRIHRRFDL  576

Query  2173  KGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSL  2352
             KGSSLGR  +K +I+E T LKDLDL Y   ++    E L++QL +DS+FLE Q+I+DYSL
Sbjct  577   KGSSLGRSANKVEIDENTILKDLDLNYHFFLEPSWREGLLRQLEIDSKFLEDQNIMDYSL  636

Query  2353  LLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--ILPRSLTLVTHEPSIVSTAPG  2526
             LLG+H RAPEHL + L    S+       V+ D  I   +L     LV       +   G
Sbjct  637   LLGVHHRAPEHLRSQLVRSRSITTDALESVAEDDTIEDDMLSYHQGLVLVPGGSDNIVTG  696

Query  2527  PHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVY  2706
             PHIRG  LRA++ GD EVDLLLPGT RL++Q GVNMPA+A     ++E D     L E  
Sbjct  697   PHIRGSRLRASAAGDEEVDLLLPGTARLQIQQGVNMPARAELIPGREEKDKQ--ILHECC  754

Query  2707  DVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             DVVLYLGIIDILQ YNM KK+EH YKSL FD +SIS ++P  YS+RF+ F+++VF
Sbjct  755   DVVLYLGIIDILQEYNMTKKIEHAYKSLHFDSLSISAVDPTFYSQRFLEFIKKVF  809



>ref|XP_004982696.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Setaria 
italica]
Length=823

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/777 (49%), Positives = 510/777 (66%), Gaps = 31/777 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E  FPNGD+Y G   G  P G G+Y  SDG  Y+G+W  G   G+G+  W SGATY+
Sbjct  55    RVGEIRFPNGDIYSGTLLGNTPEGSGQYIWSDGCIYEGEWRRGMRHGQGKTRWPSGATYE  114

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY++G GT++  D  +YKG WK+N +HG+G + Y N D+++G W +G  +GHG+Y
Sbjct  115   GEYSGGYVYGEGTYTGPDNIIYKGRWKLNRKHGLGCQTYPNGDMFEGSWIQGEIEGHGKY  174

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N   Y G  K G MSG+G + W NGD ++G W+DG+ HG G Y + +  YY GTW+ 
Sbjct  175   TWANECTYVGNMKNGKMSGKGTLTWKNGDSYEGNWLDGMMHGYGIYTWNECGYYVGTWTR  234

Query  1138  GLKDGRGTLYPVGCA--------LDKCKIDGHKEIRRMLSHDSSISKKDAVK-PKVKRSI  1290
             GLKDG+GT YP GC         ++K +  G     R  SH+S I    +V    +K  +
Sbjct  235   GLKDGKGTFYPKGCRVPVNDELYINKLRNRGVLPDARRQSHNSRILHSASVDMGNMKVGM  294

Query  1291  SEKIVDRFARDSG-RISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNI  1467
             + +  D + R+S  +   + VS+    +L  +  + +  ++S      + +  ++    I
Sbjct  295   TRQSSDVYKRNSTEQPPLKNVSLERRWSLEVAIEKFIGHESSESSGLESLENLSDSRLPI  354

Query  1468  TVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVR--KGSCMDLFKGRKSYYLML  1641
                 EREYMQGVLI E +            +R+   K VR  K     + KG +SY LML
Sbjct  355   ---LEREYMQGVLISEVVLDSSFSDSSKKAKRR-QKKTVRDTKKPGETIIKGHRSYDLML  410

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             +LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GSRLTP H + DF WKDYCP+
Sbjct  411   SLQLGIRYTVGKITPIQKREVRASDFGPKASFWMNFPKEGSRLTPSHSAEDFKWKDYCPM  470

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FK++AADYM+SIC +  LREL SPGKSGS+F+LS DDRF+IKTL+KSE++VL
Sbjct  471   VFRNLREMFKIDAADYMISICGNSALRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVQVL  530

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L+MLP+YY HV  +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H R+DLKGS
Sbjct  531   LRMLPNYYHHVHTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHRRFDLKGS  590

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             SLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+  DS+FL +Q I+DYSLLLG
Sbjct  591   SLGRSTDKIEIDENTTLKDLDLNYSFYLEPSWREALLKQIETDSEFLRTQRIMDYSLLLG  650

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVS-----SDGGISILPRSLTLV--THEPSIVSTA  2520
             +H+RAP+HL        S+   + T+VS      D  ++  P  L LV  + E S+V   
Sbjct  651   VHYRAPQHLRTRASYRRSMAADRLTVVSEKDAQEDDALN-YPEGLVLVQSSGENSVVV--  707

Query  2521  PGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFE  2700
              GPHIRG  LRA++ G  EVDLLLPGT RL++QLGVNMPA+A +  K+DE+ P      E
Sbjct  708   -GPHIRGSRLRASAAGFGEVDLLLPGTARLQIQLGVNMPARAEQIPKEDESKP----FRE  762

Query  2701  VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             V+DVVLYLGIIDILQ YNM KK+EH  KS+++D +SIS ++P+ YS+RF+ F++ VF
Sbjct  763   VFDVVLYLGIIDILQDYNMTKKIEHAVKSMQYDSVSISAVDPQFYSERFLKFIQTVF  819



>ref|XP_008644741.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Zea 
mays]
 ref|XP_008644742.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Zea 
mays]
 gb|AFW68463.1| putative phosphatidylinositol-4-phosphate 5-kinase family protein 
[Zea mays]
Length=823

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/782 (49%), Positives = 522/782 (67%), Gaps = 40/782 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E  F NGD+Y G   G  P G G+Y  SDG TYDG+W +G   G+G+  W SGATY+
Sbjct  54    RVGEIRFANGDIYSGTLLGNTPEGSGQYRWSDGCTYDGEWNKGMRHGQGKTEWPSGATYE  113

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY++G GT+   D  +YKG WK+N +HG+G + Y N D+++G W +G   GHG+Y
Sbjct  114   GEYSGGYVYGEGTYKGPDKIIYKGRWKLNHKHGLGHQTYPNGDMFEGSWIQGEIVGHGKY  173

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NG+ Y G  K G MSG+G + W NGD ++G W+DG+ HG G Y + +  YY GTW+ 
Sbjct  174   TWANGDTYVGNMKSGKMSGKGTLTWKNGDSYEGNWIDGMMHGYGIYTWNECGYYIGTWTR  233

Query  1138  GLKDGRGTLYPVGCAL---DKCKIDGHK------EIRRM-----LSHDSSISKKDAVKPK  1275
             GLKDG+G  +P GC +   D+  I+  +      +IRR      + H SS+   + +K  
Sbjct  234   GLKDGKGKFFPKGCRVPVNDEMYINNLRNRGVLPDIRRQNHGSRILHSSSVDMGN-MKVG  292

Query  1276  VKRSISEKIVDRFARDSG-RISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAE  1452
             + R  S+ +   F R+S  + S + VS+    +L  +  + +  ++S      + +  ++
Sbjct  293   MARQSSDVL---FKRNSAEQSSLKNVSLERRWSLEVAIEKFIGHESSESSGLESLENLSD  349

Query  1453  QLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKS  1626
                 I    EREYMQGVLI E +  +S    S ++ +R+K   ++ +K     + KG +S
Sbjct  350   SRLPI---LEREYMQGVLISEVVLDRSFSDSSKKTKRRQKKTVRDTKK-PGETIIKGHRS  405

Query  1627  YYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWK  1806
             Y LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GSRLTP H + DF WK
Sbjct  406   YDLMLSLQLGIRYTVGKITPIQKREVRASDFGPRASFWMNFPKEGSRLTPSHSAEDFKWK  465

Query  1807  DYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKS  1986
             DYCP+VFRNLR +FK++AADYM+SIC +  LR+L SPGKSGS+F+LS DDRF+IKTL+KS
Sbjct  466   DYCPMVFRNLREMFKIDAADYMISICGNSALRQLSSPGKSGSVFFLSQDDRFMIKTLRKS  525

Query  1987  ELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRY  2166
             E++VLL+MLP+YY HV+ +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H R+
Sbjct  526   EVQVLLRMLPNYYDHVRTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHRRF  585

Query  2167  DLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDY  2346
             DLKGSSLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+  DS FL +Q I+DY
Sbjct  586   DLKGSSLGRSTDKIEIDENTTLKDLDLNYSFYLEPSWREALLKQIETDSDFLRTQRIMDY  645

Query  2347  SLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVS-----SDGGISILPRSLTLV--THEPS  2505
             SLLLG+H+RAP+HL        S+   + T+VS      D  +S  P  L LV  + E S
Sbjct  646   SLLLGVHYRAPQHLRTRASYHRSMAADRLTVVSEEDAQEDDALS-HPEGLVLVQSSGENS  704

Query  2506  IVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSE  2685
             ++    GPHIRG  LRA++ G  EVDLLLPGT RL++QLGVNMPA+A +  K+DE+ P  
Sbjct  705   VIV---GPHIRGSRLRASAAGFGEVDLLLPGTARLQIQLGVNMPARAEQTPKEDESKP--  759

Query  2686  VELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
                 EVYDVVLYLGIIDILQ YNM KK+EH  KS+++D +SIS ++P+ YS+RF++F++ 
Sbjct  760   --FREVYDVVLYLGIIDILQEYNMTKKIEHAVKSMQYDSVSISAVDPQFYSERFLNFIQT  817

Query  2866  VF  2871
             VF
Sbjct  818   VF  819



>ref|XP_006354393.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006354394.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X2 [Solanum tuberosum]
Length=813

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/785 (48%), Positives = 512/785 (65%), Gaps = 40/785 (5%)
 Frame = +1

Query  571   CVIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQI  750
             C+     N R  E + PNG+ Y G   G +P G GKY  SDG  Y G+W  G   G G++
Sbjct  44    CLTSESTNFRVGELLLPNGESYSGSLLGNIPEGSGKYRWSDGCRYVGEWRHGITHGHGKL  103

Query  751   IWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKE  930
              + SGA YDG+   GY+HG GT+   D  +Y+G W+ N++HG+G + Y N ++++G W +
Sbjct  104   EFPSGAVYDGEFSGGYMHGEGTYIGPDKVIYRGRWRFNLKHGLGYQMYPNGNIFEGSWMQ  163

Query  931   GVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADG  1110
             G  +G G+YTW+NGN+Y G  K G +SG+G + W NGD ++G W++G  HG G Y ++DG
Sbjct  164   GTPEGPGKYTWANGNVYFGNMKGGKISGKGTLTWINGDSYEGNWLNGAMHGVGMYTWSDG  223

Query  1111  SYYFGTWSNGLKDGRGTLYPVGC-----------ALDKCKIDGHKEIRRMLSHDSSISKK  1257
             S Y GTW++ LKDG+GT YP G            AL K  +      +  +SH    +  
Sbjct  224   SCYIGTWTHSLKDGKGTFYPSGSRLTAGQELYLNALRKRGLLPDMRKQSQVSHIHHAASV  283

Query  1258  DAVKPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTC  1437
             D    KV    S K+ +R   + G+     VS+    +L  +  +V+  +          
Sbjct  284   DMGSVKV----SGKLPERNLLNFGQSRPTNVSLERRWSLEVAIEKVIGHN---------L  330

Query  1438  DGKAEQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLF  1611
             DG  E   +  +  EREYMQG+LI E +  +     S ++ +R+K   +E+++     + 
Sbjct  331   DGDMEDAMSAPI-LEREYMQGILISEVVLNERFSPPSGRARRRQKRFVRELKR-PGEAII  388

Query  1612  KGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSI  1791
             KG +SY LML+LQLGIRY+VGKITPI  R++R SDFG +A   MYFP+ GS+LTP H+S 
Sbjct  389   KGHRSYDLMLSLQLGIRYTVGKITPIQRRDIRNSDFGPRASFWMYFPKGGSQLTPTHQSE  448

Query  1792  DFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIK  1971
             DF WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IK
Sbjct  449   DFKWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIK  508

Query  1972  TLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELH  2151
             TL+KSE+KVLL+MLP+Y++HVK +ENTLITKFFG++RI     +K RFVVMGNMF TEL 
Sbjct  509   TLRKSEVKVLLRMLPNYHRHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELR  568

Query  2152  MHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQ  2331
             +H R+DLKGSSLGR  DK +I+E T LKDLDL Y   ++    E L+KQ+ +DS+FLE +
Sbjct  569   IHRRFDLKGSSLGRSADKVEIDENTILKDLDLNYCFYLEPSWREALLKQIEIDSKFLEEE  628

Query  2332  HIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SILPRSLTLVTH--E  2499
             +I+DYSLLLG+H+RAP+HL +L+            +V+ +  +   I P+ L LV    E
Sbjct  629   NIMDYSLLLGVHYRAPQHLQSLISCSGRTTADGLEIVAEEESLEDEISPQGLVLVPRGSE  688

Query  2500  PSIVSTAPGPHIRGKTLRANSV-GDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETD  2676
              S+V    GPH+RG  LRA+S  GD EVDLLLPGT R ++QLGVNMPA+A    K+ +T 
Sbjct  689   DSVVV---GPHVRGSRLRASSATGDAEVDLLLPGTARFQIQLGVNMPARAEYIPKEGQTQ  745

Query  2677  PSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISF  2856
                    EVYDVVLYLGIIDILQ YNM KKLEH YKS++FD +SIS ++P  YS+RF+ F
Sbjct  746   V----FHEVYDVVLYLGIIDILQEYNMSKKLEHAYKSIQFDSVSISAVDPTYYSERFLEF  801

Query  2857  LERVF  2871
             + +VF
Sbjct  802   IRKVF  806



>ref|NP_187603.1| phosphatidyl inositol monophosphate 5 kinase [Arabidopsis thaliana]
 ref|NP_001030666.1| phosphatidyl inositol monophosphate 5 kinase [Arabidopsis thaliana]
 ref|NP_001189852.1| phosphatidyl inositol monophosphate 5 kinase [Arabidopsis thaliana]
 sp|Q8L850.2|PI5K9_ARATH RecName: Full=Phosphatidylinositol 4-phosphate 5-kinase 9; Short=AtPIP5K9; 
AltName: Full=1-phosphatidylinositol 4-phosphate 
kinase 9; AltName: Full=Diphosphoinositide kinase 9; AltName: 
Full=PtdIns(4)P-5-kinase 9 [Arabidopsis thaliana]
 gb|AAF23244.1|AC015985_2 putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis 
thaliana]
 emb|CAH18644.1| putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis 
thaliana]
 dbj|BAF01646.1| putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis 
thaliana]
 gb|AEE74832.1| phosphatidyl inositol monophosphate 5 kinase [Arabidopsis thaliana]
 gb|AEE74833.1| phosphatidyl inositol monophosphate 5 kinase [Arabidopsis thaliana]
 gb|AEE74834.1| phosphatidyl inositol monophosphate 5 kinase [Arabidopsis thaliana]
Length=815

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/773 (49%), Positives = 507/773 (66%), Gaps = 24/773 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E V P+G+ Y G   G +P G GKY  SDG  YDG+W  G   G G + W+SGA+YD
Sbjct  46    RVRELVLPDGESYSGSLLGNVPEGPGKYIWSDGCVYDGEWRRGMRHGIGNMRWASGASYD  105

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  ++   YKG W++N++HG+G + Y N DV++G W +G+ +G G+Y
Sbjct  106   GEFSGGYMHGSGTYVDANKLTYKGRWRLNLKHGLGYQVYPNGDVFEGSWIQGLGEGPGKY  165

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N N+Y G  K G MSG+G + W  GD ++G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  166   TWANKNVYLGDMKGGKMSGKGTLTWVTGDSYEGSWLNGMMHGVGVYTWSDGGCYVGTWTR  225

Query  1138  GLKDGRGTLYPVGCA--------LDKCKIDG-HKEIRRMLSHDSSISKKDAVKPKVKRSI  1290
             GLKDG+G+ Y  G          L+  +  G   ++RR     SS++ ++ ++  V R+ 
Sbjct  226   GLKDGKGSFYSAGTRVPVVQEFYLNALRKRGVLPDMRRQNQVASSVNMEN-LRVGVNRNK  284

Query  1291  SEK--IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
               K  +++     +GR     VS+    +L  S  +V+    S + +     G + Q   
Sbjct  285   LSKGSLINLEQSRNGR-----VSLERRWSLEVSIEKVIGHGYSDLSTAVLDSGSSVQYKA  339

Query  1465  ITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
                  EREYMQGVLI E +        S ++ ++ K   KE +K   + + KG +SY LM
Sbjct  340   NIPILEREYMQGVLISELVVNNGFSRTSRRAKRKHKRLVKEAKKPGEV-VIKGHRSYDLM  398

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             L+LQLGIRY+VGKITPI  R+VR +DFG +A   M FPR GS +TPPH S DF WKDYCP
Sbjct  399   LSLQLGIRYTVGKITPIQRRQVRTADFGPRASFWMTFPRAGSTMTPPHHSEDFKWKDYCP  458

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+KV
Sbjct  459   MVFRNLREMFKIDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVKV  518

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LL+MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF+T+L +H R+DLKG
Sbjct  519   LLRMLPDYHHHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFFTDLRIHRRFDLKG  578

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SSLGR  DK +I+E T LKDLDL Y   ++    E L++QL +DS+FLE+Q+I+DYSLLL
Sbjct  579   SSLGRSADKVEIDENTILKDLDLNYSFFLETSWREGLLRQLEIDSKFLEAQNIMDYSLLL  638

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--ILPRSLTLVTHEPSIVSTAPGPH  2532
             G+H RAP+HL + L    S+       V+ D  I   +L     LV       +T  GPH
Sbjct  639   GVHHRAPQHLRSQLVRSQSITTDALESVAEDDTIEDDMLSYHEGLVLVPRGSENTVTGPH  698

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG  LRA++VGD EVDLLLPGT RL++Q GVNMPA+A  ++     D  +  L +  DV
Sbjct  699   IRGSRLRASAVGDEEVDLLLPGTARLQIQQGVNMPARA--ELIPGREDKEKQILHDCCDV  756

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VLYLGIIDILQ YNM KK+EH YKSL FD +SIS ++P  YS+RF+ F+++VF
Sbjct  757   VLYLGIIDILQEYNMTKKIEHAYKSLHFDSLSISAVDPTFYSQRFLEFIKKVF  809



>ref|XP_009620729.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Nicotiana 
tomentosiformis]
 ref|XP_009620730.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Nicotiana 
tomentosiformis]
Length=818

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/804 (48%), Positives = 512/804 (64%), Gaps = 35/804 (4%)
 Frame = +1

Query  517   LCAVRREVYRNSYGMGI*CVIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDG  696
             L A+    Y      G  C+     N R  E + PNG+ Y G   G +P G GKY  +DG
Sbjct  24    LDAIHDNNYITKLTNGEVCLASETTNFRVGELLLPNGESYSGSLLGNIPEGSGKYIWTDG  83

Query  697   TTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHG  876
               Y+G+W  G   G G++ + SGA YDG+   GY+H  GT+   D   Y+G W++N++HG
Sbjct  84    CQYEGEWRHGMRHGHGKLEFPSGAVYDGEFSGGYMHSEGTYIGPDKVTYRGRWRLNLKHG  143

Query  877   VGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDG  1056
             +G + Y N D+++G W +G  +G G+YTW+NGN+Y G  K G +SG+G + W NGD ++G
Sbjct  144   LGYQMYPNGDIFEGSWIQGTPEGPGKYTWANGNVYFGNMKGGKISGKGTLTWINGDSYEG  203

Query  1057  FWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVGC-----------ALDKCKID  1203
              W++G  HG G Y +++GS Y GTW++ LKDG+GT YP G            AL K  + 
Sbjct  204   SWLNGTMHGVGVYTWSEGSCYIGTWTHSLKDGKGTFYPSGSRLTAGQELYLNALRKRGLL  263

Query  1204  GHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARDSGRISR-RAVSVAGDA--AL  1374
                  +  +SH    +  D    K+          R  R+     + R  +VA +   +L
Sbjct  264   PDMRKQNQVSHIHHAASVDMGNVKLVSGNQGSYDKRPERNLLNFEQSRPTNVALERRWSL  323

Query  1375  HCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQST  1554
               +  +V+  D          DG  E   +  +  EREYMQGVLI E + + D  S  S 
Sbjct  324   EVAIEKVIGHD---------FDGDIEDDMSAPI-LEREYMQGVLISEVVLN-DRFSPPSG  372

Query  1555  QRRKFPAKEVR--KGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQ  1728
             + R+   K  R  K     + KG +SY LML+LQLGIRY+VGKITPI  RE+R SDFG +
Sbjct  373   RARRRQRKLARELKRPGEAIIKGHRSYDLMLSLQLGIRYTVGKITPIQRREIRASDFGPR  432

Query  1729  ARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLREL  1908
             A   MYFP++GS+LTP H+S DF WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL
Sbjct  433   ASFWMYFPKEGSQLTPTHQSEDFKWKDYCPMVFRNLREMFKIDAADYMMSICGNDALREL  492

Query  1909  LSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRIS  2088
              SPGKSGS+F+LS DDRF+IKTL+KSE+KVLL+MLP+Y++HV+ HENTLITKFFG++RI 
Sbjct  493   SSPGKSGSVFFLSQDDRFMIKTLRKSEVKVLLQMLPNYHRHVRTHENTLITKFFGLHRIK  552

Query  2089  LRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMD  2268
                 +K RFVVMGNMF TEL +H R+DLKGSSLGR  DK +I+E T LKDLDL Y   ++
Sbjct  553   PSSGQKFRFVVMGNMFCTELRIHRRFDLKGSSLGRSADKVEIDENTILKDLDLNYCFYLE  612

Query  2269  KLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSS  2448
                 E L++Q+ +DS+FLE QHI+DYSLLLG+H+RAP+HL +L+            +V+ 
Sbjct  613   PSWREALLRQIEIDSKFLEEQHIMDYSLLLGVHYRAPQHLQSLISCSGRTTVDGLEIVAE  672

Query  2449  DGGI--SILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSV-GDREVDLLLPGTGRLRVQ  2619
             +  +   I P+ L LV    S  S   GPH+RG  LRA+S  GD EVDLLLPGT RL++Q
Sbjct  673   EESLEDEISPQGLVLVP-RGSDDSVVVGPHVRGSRLRASSATGDAEVDLLLPGTARLQIQ  731

Query  2620  LGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFD  2799
             LGVNMPA+A    K+ +T        EVYDVVLYLGIIDILQ YN+ KKLEH YKS++FD
Sbjct  732   LGVNMPARAEYIPKEGQTQV----FHEVYDVVLYLGIIDILQDYNISKKLEHAYKSIQFD  787

Query  2800  PMSISVIEPKLYSKRFISFLERVF  2871
              +SIS ++P  YS+RF+ F+ +VF
Sbjct  788   SVSISAVDPTFYSERFLEFIRKVF  811



>gb|AAM53300.1| putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis 
thaliana]
Length=815

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/773 (49%), Positives = 506/773 (65%), Gaps = 24/773 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E V P+G+ Y G   G +P G GKY  SDG  YDG+W  G   G G + W+SGA+YD
Sbjct  46    RVRELVLPDGESYSGSLLGNVPEGPGKYIWSDGCVYDGEWRRGMRHGIGNMRWASGASYD  105

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  ++   YKG W++N++HG+G + Y N DV++G W +G+ +G G+Y
Sbjct  106   GEFSGGYMHGSGTYVDANKLTYKGRWRLNLKHGLGYQVYPNGDVFEGSWIQGLGEGPGKY  165

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N N+Y G  K G MSG+G + W  GD ++G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  166   TWANKNVYLGDMKGGKMSGKGTLTWVTGDSYEGSWLNGMMHGVGVYTWSDGGCYVGTWTR  225

Query  1138  GLKDGRGTLYPVGCA--------LDKCKIDG-HKEIRRMLSHDSSISKKDAVKPKVKRSI  1290
             GLKDG+G+ Y  G          L+  +  G   ++RR     SS++ ++ ++  V R+ 
Sbjct  226   GLKDGKGSFYSAGTRVPVVQEFYLNALRKRGVLPDMRRQNQVASSVNMEN-LRVGVNRNK  284

Query  1291  SEK--IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
               K  +++     +GR     VS+    +L  S  +V+    S + +     G + Q   
Sbjct  285   LSKGSLINLEQSRNGR-----VSLERRWSLEVSIEKVIGHGYSDLSTAVLDSGSSVQYKA  339

Query  1465  ITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
                  EREYMQGVLI E +        S ++ ++ K   KE +K   + + KG +SY LM
Sbjct  340   NIPILEREYMQGVLISELVVNNGFSRTSRRAKRKHKRLVKEAKKPGEV-VIKGHRSYDLM  398

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             L+LQLGIRY+VGKITPI  R+VR +DFG +A   M FPR GS +TPPH S DF WKDYCP
Sbjct  399   LSLQLGIRYTVGKITPIQRRQVRTADFGPRASFWMTFPRAGSTMTPPHHSEDFKWKDYCP  458

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FK++AADYMMSIC  D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+KV
Sbjct  459   MVFRNLREMFKIDAADYMMSICGKDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVKV  518

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LL+MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF+T+L +H R+DLKG
Sbjct  519   LLRMLPDYHHHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFFTDLRIHRRFDLKG  578

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SSLGR  DK +I+E T LKDLDL Y   ++    E L++QL +DS+FLE+Q+I+DYSLLL
Sbjct  579   SSLGRSADKVEIDENTILKDLDLNYSFFLETSWREGLLRQLEIDSKFLEAQNIMDYSLLL  638

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--ILPRSLTLVTHEPSIVSTAPGPH  2532
             G+H RAP+HL + L    S+       V+ D  I   +L     LV       +T  GPH
Sbjct  639   GVHHRAPQHLRSQLVRSQSITTDALESVAEDDTIEDDMLSYHEGLVLVPRGSENTVTGPH  698

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG  LRA++VGD EVDLLLPGT RL++Q GVNMPA+A  ++     D  +  L +  DV
Sbjct  699   IRGSRLRASAVGDEEVDLLLPGTARLQIQQGVNMPARA--ELIPGREDKEKQILHDCCDV  756

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VLYLGIIDILQ YNM KK+EH YKSL FD +SIS ++P  YS+RF+ F+++VF
Sbjct  757   VLYLGIIDILQEYNMTKKIEHAYKSLHFDSLSISAVDPTFYSQRFLEFIKKVF  809



>ref|XP_009797891.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Nicotiana 
sylvestris]
 ref|XP_009797892.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Nicotiana 
sylvestris]
 ref|XP_009797894.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Nicotiana 
sylvestris]
 ref|XP_009797895.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Nicotiana 
sylvestris]
Length=821

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/780 (49%), Positives = 503/780 (64%), Gaps = 36/780 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  +   PNG+ Y G   G +P G GKY  SDG  Y+G+W  G   G G++ W + A YD
Sbjct  53    RVRDIFLPNGESYSGSLLGNIPEGSGKYIWSDGCRYEGEWRHGMRHGHGKLEWPTSAVYD  112

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G    GY+HG GT+ + D   Y+G W++N++HG+G + Y N D+++G W +G  +G G+Y
Sbjct  113   GQFSGGYMHGEGTYIAPDKVTYRGRWRLNLKHGLGYQVYPNGDIFEGSWIQGTPEGPGKY  172

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y+G  K GN SG+G + W +GD ++G W++G  HG G Y ++DGS Y GTW++
Sbjct  173   TWANGNVYSGNMKGGNFSGKGTLTWMSGDSYEGSWLNGTMHGVGAYTWSDGSCYIGTWTH  232

Query  1138  GLKDGRGTLYPVGC-----------ALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKR  1284
             G+KDG+GT YP G            AL K  +    + ++ +SH S  S  D    KV  
Sbjct  233   GIKDGKGTFYPSGSRLTAGQELYLNALRKRGLLPDLKKQKRVSHISHASSVDMGNVKVSG  292

Query  1285  SISEKIVDRFARDSGRISRRAVSVAGDAALHCS-STEVLPEDASCMLSHTTCDGKAEQLG  1461
             + S    +R ++  G I R   S   + +L    S EV  E           D     +G
Sbjct  293   NHS---YNRLSK--GNILRHEQSQPSNVSLERRWSLEVAIEKV------IGNDIDGVDIG  341

Query  1462  NI--TVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGS---CMDLFKGRKS  1626
             N   +   EREYMQGVLI E + + D  S QS +  K   +++ + S      + KG + 
Sbjct  342   NNMNSPILEREYMQGVLISEVVLN-DRFSPQSRRAAKRRQRKIARESKRPGEAIIKGHRR  400

Query  1627  YYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWK  1806
             Y +ML+LQLGIRYSVGKITP+  REV  SDFG  +   MYFP++GS+LTP H+S DF WK
Sbjct  401   YDVMLSLQLGIRYSVGKITPVQRREVGASDFGACSSFWMYFPKEGSQLTPSHQSEDFKWK  460

Query  1807  DYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKS  1986
             DYCP+VFRNLR +FK++ ADYMMSIC +  LREL SPGKSGS+F+LS DDRF+IKTL+KS
Sbjct  461   DYCPVVFRNLREMFKIDTADYMMSICGNAALRELSSPGKSGSVFFLSQDDRFMIKTLRKS  520

Query  1987  ELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRY  2166
             E+KVLL+MLP Y++HVK +ENTLITKFFG++RI     +K  FVVMGNMF TEL +H R+
Sbjct  521   EVKVLLRMLPDYHRHVKAYENTLITKFFGLHRIKPSSGQKFCFVVMGNMFCTELRIHRRF  580

Query  2167  DLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDY  2346
             DLKGSSLGR  DK +I+E T LKDLDL Y   ++    E L+KQ+ +DS+FLE QHI+DY
Sbjct  581   DLKGSSLGRSADKVEIDENTILKDLDLNYCFYLEPSWQEALLKQIEIDSKFLEEQHIMDY  640

Query  2347  SLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SILPRSLTLVTHEPSIVSTA  2520
             SLLLG+H+RAP+HL + +             V+ D  +   I P+ L LV       S A
Sbjct  641   SLLLGVHYRAPQHLRSPISCSGRTTAEGLGNVAEDESLEDEISPQGLVLVPRGADDNSVA  700

Query  2521  PGPHIRGKTLRANSV-GDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
              GPH+RG  LRA S  GD EVDLLLPGT RL++QLGVNMPA+A    ++DE         
Sbjct  701   VGPHVRGSRLRAASATGDEEVDLLLPGTARLQIQLGVNMPARAEYIPRKDEAR----MFL  756

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA  2877
             +VYDVVLYLGIIDILQ YN+RKK+EH YKS++FD MSIS +EP  YS+RF+ F+ +VF A
Sbjct  757   KVYDVVLYLGIIDILQEYNLRKKIEHAYKSIQFDSMSISAVEPTFYSQRFLQFIRKVFPA  816



>emb|CDP15295.1| unnamed protein product [Coffea canephora]
Length=828

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/778 (48%), Positives = 506/778 (65%), Gaps = 36/778 (5%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             E + PNG+ Y G     +P G GKY  S+G  Y+G+W  G   G G++ W SGA Y+GD 
Sbjct  57    ELLLPNGESYSGSLLSSVPEGSGKYIWSEGCKYEGEWRCGMRHGYGKLQWPSGAVYEGDF  116

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+HG GT++      YKG W+++++HG+G + Y N DV++G W +G  +G G+YTW+
Sbjct  117   SGGYMHGTGTYTGRGKITYKGRWRLSLKHGLGHQVYPNGDVFEGAWIQGSPEGPGKYTWA  176

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN+Y G  K GNMSG+G + W NGD ++G W++G+ HG G Y ++DG  Y GTW+ GLK
Sbjct  177   NGNVYLGNLKGGNMSGKGTLTWTNGDSYEGNWLNGMMHGFGIYTWSDGGCYIGTWTRGLK  236

Query  1147  DGRGTLYPVG-----------CALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVK----  1281
             DG+G  YP G            AL K  +      +  +SH    S  D    KV     
Sbjct  237   DGKGAFYPKGGRLPAGQEMYLNALRKRGLLPDLSKQNQVSHIHHTSSVDLGVVKVGGNQG  296

Query  1282  --RSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQ  1455
               R+ S K  +    +  +     VS+    +L  +  +V+  D S        DG+  +
Sbjct  297   SCRNSSYKSANGNLLNLEQSRSTNVSLERRWSLEVAIEKVIGYDFSL-------DGREYE  349

Query  1456  LGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
                 +   EREYMQGVLI E +   S    S +  +R+K  A+E+++     + KG +SY
Sbjct  350   DDRNSPILEREYMQGVLISELVINDSFSPSSKRVRRRQKKLAREMKR-VGETIIKGHRSY  408

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
              LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+S DF WKD
Sbjct  409   DLMLSLQLGIRYTVGKITPIQRREVRASDFGTRASFWMNFPKEGSQLTPPHQSEDFKWKD  468

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE
Sbjct  469   YCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRKSE  528

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             +KVLL+MLPSY+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H R+D
Sbjct  529   VKVLLRMLPSYHHHVQKYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRRFD  588

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGSSLGR  DK +I+E T LKDLDL Y   ++    E+L+ Q+ +DS+FLESQHI+DYS
Sbjct  589   LKGSSLGRSADKVEIDENTILKDLDLNYCFFLEPSWRESLLTQIEIDSKFLESQHIMDYS  648

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SILPRSLTLVTHEPSIVSTAP  2523
             LLLG+H+RAP+HL +L+     +      +V+ +  +   I P+ L LV           
Sbjct  649   LLLGVHYRAPQHLRSLMSTSRRMTADGLEIVAEEEAMEDEISPQGLILVPRGGDDNGVVV  708

Query  2524  GPHIRGKTLRANSV-GDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF-  2697
             G HIRG  LR +S  G+ EVDLLLPGT RL++QLGVNMPA+A      D+      ++F 
Sbjct  709   GSHIRGSRLRTSSATGNEEVDLLLPGTARLQIQLGVNMPARAEHTPGNDDN-----QIFH  763

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             E YDVVLYLGIIDILQ YN+ KK+EH YKS++FD +SIS ++P  YS+RF+ F+++VF
Sbjct  764   EAYDVVLYLGIIDILQEYNITKKIEHAYKSIQFDSISISAVDPTFYSQRFLEFIQKVF  821


 Score = 64.7 bits (156),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 54/119 (45%), Gaps = 1/119 (1%)
 Frame = +1

Query  862   NIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNG  1041
             N    VG     N + Y G     V +G G+Y WS G  Y G W+ G   G G ++W +G
Sbjct  50    NPSFTVGELLLPNGESYSGSLLSSVPEGSGKYIWSEGCKYEGEWRCGMRHGYGKLQWPSG  109

Query  1042  DLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG-TLYPVGCALDKCKIDGHKE  1215
              +++G +  G  HG+G Y       Y G W   LK G G  +YP G   +   I G  E
Sbjct  110   AVYEGDFSGGYMHGTGTYTGRGKITYKGRWRLSLKHGLGHQVYPNGDVFEGAWIQGSPE  168



>ref|XP_008643631.1| PREDICTED: LOC100281652 isoform X1 [Zea mays]
 ref|XP_008643632.1| PREDICTED: LOC100281652 isoform X1 [Zea mays]
 ref|XP_008643633.1| PREDICTED: LOC100281652 isoform X1 [Zea mays]
 ref|XP_008643634.1| PREDICTED: LOC100281652 isoform X1 [Zea mays]
 ref|XP_008643636.1| PREDICTED: LOC100281652 isoform X1 [Zea mays]
 ref|XP_008643637.1| PREDICTED: LOC100281652 isoform X1 [Zea mays]
 gb|AFW69681.1| putative phosphatidylinositol-4-phosphate 5-kinase family protein 
[Zea mays]
Length=806

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/779 (47%), Positives = 502/779 (64%), Gaps = 27/779 (3%)
 Frame = +1

Query  586   ENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSG  765
              ++ R  E + PNGD Y G   G  PHG G Y  SDG  Y+GDW  G   G+G+ +W +G
Sbjct  34    NSDSRVGELILPNGDTYRGALSGNTPHGPGCYIWSDGCVYEGDWRRGLRHGRGKTLWPTG  93

Query  766   ATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHG-VGRKEYQNSDVYDGCWKEGVRD  942
             ATY GD   GY++G GT+++   S Y+G WK+N++HG +G + Y N D + G W  G   
Sbjct  94    ATYTGDYSGGYIYGQGTYTAGLNS-YRGGWKLNLKHGHLGLQTYPNGDTFQGSWVHGQMQ  152

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             GHG YTW+NGN Y G  K G MSG+G++ W NGD F+G W+DG  HG G Y + D  YY 
Sbjct  153   GHGTYTWANGNTYVGAMKDGVMSGKGILTWNNGDSFEGNWLDGAMHGYGIYTWKDSGYYV  212

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKI  1302
             GTW+ G+KDG+GT YP    +    ID  +  R +L    S +    +       +++ +
Sbjct  213   GTWTRGVKDGKGTFYPKCRGIPVTDIDDLRN-RGVLPGAESQTHGSRILHSASSDMADMV  271

Query  1303  VDRFARDSGRISRRAVSVAGDAA----------LHCSSTEVLPEDASCMLSHTTCDGKAE  1452
               R     G  S R+++     +          L  +  + L  + +   +   C+ KA+
Sbjct  272   ASRNQDSVGISSVRSLNFEKTRSTNVLLERRWSLGVAIEKFLGRETNESSAIERCENKAD  331

Query  1453  QLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKS  1626
                N+ +  EREYMQGVLI E +   S      + ++R+K   K+++K     + KG +S
Sbjct  332   S--NLPI-LEREYMQGVLISEVVVDASFSNPLKRVSRRQKKIVKDIKK-PGQTIIKGHRS  387

Query  1627  YYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWK  1806
             Y LML+LQLGIRY+VGKITPI  REVR SD+G +A   M FP+ GSRLTP H + +F WK
Sbjct  388   YDLMLSLQLGIRYTVGKITPIQRREVRASDYGSRASFWMNFPKNGSRLTPSHHADNFKWK  447

Query  1807  DYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKS  1986
             DYCP+VFRNLR +FK++AADYM+SIC  D LREL SPGKSGS+F+LS DDRF+IKTL+KS
Sbjct  448   DYCPMVFRNLREMFKIDAADYMVSICGSDALRELSSPGKSGSVFFLSQDDRFMIKTLRKS  507

Query  1987  ELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRY  2166
             E++VLL+MLP YY HV+ +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H R+
Sbjct  508   EVQVLLRMLPEYYHHVRTYENTLITKFFGLHRVKPSSSQKFRFVVMGNMFCTELRIHRRF  567

Query  2167  DLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDY  2346
             DLKGSSLGR TDK KI+E TTLKDLDL Y   ++    +TL+ Q+  DS+FL+   I+DY
Sbjct  568   DLKGSSLGRSTDKVKIDENTTLKDLDLNYSFYLEPSWRQTLLAQIETDSKFLKQHAIMDY  627

Query  2347  SLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--IL--PRSLTLVTHEPSIVS  2514
             SLLLG+HFRAP+ L        ++   +  ++S +G +   +L  P  L LV        
Sbjct  628   SLLLGVHFRAPQSLRTQASFHQAILPDRLAVLSEEGALEEDVLNSPEGLVLVQRASDQND  687

Query  2515  TAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVEL  2694
                G HIRG  LR++S    EVDLLLPGT RL++QLGVNMPA+A + V+ D+++ +    
Sbjct  688   VVIGSHIRGARLRSSSASFEEVDLLLPGTARLQIQLGVNMPARAKQTVEDDDSEDNG---  744

Query  2695  FEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
              +VYDVVLYLGIIDILQ Y++RKK+EH YK ++++ +SISV+EP LYS+RF+ F++ +F
Sbjct  745   -QVYDVVLYLGIIDILQEYSIRKKIEHAYKCIQYNSLSISVVEPSLYSERFLKFIQTIF  802



>gb|EYU41591.1| hypothetical protein MIMGU_mgv1a001420mg [Erythranthe guttata]
Length=822

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/782 (49%), Positives = 505/782 (65%), Gaps = 54/782 (7%)
 Frame = +1

Query  616   FPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEG  795
              PNG+ Y G   G  P G G Y  SDG+ Y G+W  G   G G++ W SGA Y G+   G
Sbjct  58    LPNGESYSGSLLGNTPEGAGDYLWSDGSKYSGEWSRGMRNGTGKLQWPSGALYSGEFSGG  117

Query  796   YLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGN  975
             Y+HG GT++  D + YKG W++N++HG+G + + N D+++G W +G  +G G+Y W+NGN
Sbjct  118   YIHGTGTYTRPDNTTYKGRWRLNLKHGLGYQNFPNGDIFEGSWMQGTPEGPGKYVWNNGN  177

Query  976   MYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGR  1155
             +Y G  K G MSG+G + W NGD F+G W +G  HG G Y ++DGS + GTW+ GLKDG+
Sbjct  178   VYLGNMKNGKMSGKGTLTWTNGDSFEGSWSNGTMHGFGIYTWSDGSCFVGTWTRGLKDGK  237

Query  1156  GTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVD--------R  1311
             GT YP G  L      G +     L       +K  + P VK+      VD        +
Sbjct  238   GTFYPKGNTLPA----GQQLYLNAL-------RKQGLLPDVKKQNQVSSVDVRKQNPSDK  286

Query  1312  FARDS--GRISRR---AVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN----  1464
             FA++   G I +     VS+    +L  S  +V+    S  ++    +G  E   N    
Sbjct  287   FAKEGLFGNIEQSRPTNVSLERRWSLEVSIEKVIGHVRSSSVTDNGLEG-GEYNNNEDDL  345

Query  1465  ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAK---EVRKGSCMDLFKGRKSYYL  1635
              T   EREYMQGVLI E + S D  S  S + ++   +   E+++     + KG +SY L
Sbjct  346   NTPILEREYMQGVLISELVLS-DRFSPSSRRAKRRQRRLAREIKR-PGEQILKGHRSYDL  403

Query  1636  MLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYC  1815
             ML+LQLGIRY+VGKITPI  REVR +DFG +A   M FP++GS+LTP H+S DF WKDYC
Sbjct  404   MLSLQLGIRYTVGKITPIQRREVRVTDFGPRASFWMTFPKEGSQLTPSHQSEDFKWKDYC  463

Query  1816  PIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELK  1995
             P+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+K
Sbjct  464   PMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVK  523

Query  1996  VLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLK  2175
             VLL+MLP Y+ HV+ HENTLITKFFG++RI     +K RFVVMGNMF TEL +H R+DLK
Sbjct  524   VLLRMLPKYHHHVRIHENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRRFDLK  583

Query  2176  GSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLL  2355
             GSSLGR  DK +I+E T LKDLDL Y   ++    ++L++Q+ +DS+FLES++I+DYSLL
Sbjct  584   GSSLGRSADKVEIDESTILKDLDLNYCFYLEPSWRDSLLQQIEIDSKFLESENIMDYSLL  643

Query  2356  LGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--------ILPRSLTLVTHEPSIV  2511
             LG+H+RAP+HL +L+      +  +S  V   G ++        I P  L LV       
Sbjct  644   LGVHYRAPQHLRSLMS-----YSQRSISVDGLGIVAEDECMEDEISPEGLVLVPRGTDDN  698

Query  2512  STAPGPHIRGKTLRA-NSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEV  2688
             S   GPHIRG  LRA +S GD EVDLLLPGT RL++QLGVNMPA+A      D T     
Sbjct  699   SVVVGPHIRGSRLRASSSTGDEEVDLLLPGTARLQIQLGVNMPARAEHIPGHDRT-----  753

Query  2689  ELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             E+F EVYDVVLYLGIIDILQ YN+ KK+EH YKS +FD +SIS ++P  YS RF+ F+++
Sbjct  754   EMFHEVYDVVLYLGIIDILQEYNIGKKIEHAYKSAQFDSLSISAVDPTFYSARFLEFIQK  813

Query  2866  VF  2871
             VF
Sbjct  814   VF  815



>ref|XP_010464651.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Camelina 
sativa]
Length=816

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/772 (48%), Positives = 504/772 (65%), Gaps = 22/772 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R    + P+ + Y G   G +P G GKY  SDG  YDG+W  G   G G++IW+SGA Y+
Sbjct  47    RVRNLLLPDAESYCGSLLGNVPEGSGKYVWSDGCVYDGEWRRGMRHGIGKMIWASGAWYE  106

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  ++   YKG W++N++HG+G + Y N D+++G W +G+ +G G+Y
Sbjct  107   GEFSGGYMHGSGTYVDANNLTYKGRWRLNLKHGLGYQVYPNGDIFEGSWIQGLGEGPGKY  166

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N N+Y G  K G MSG+G + W  GD ++G W++G+ HG G Y + DG  Y GTW+ 
Sbjct  167   TWANKNVYLGDMKGGKMSGKGTLTWVTGDSYEGSWLNGMMHGVGVYTWRDGGCYVGTWTR  226

Query  1138  GLKDGRGTLYPVGC---ALDKCKIDGHK------EIRRMLSHDSSISKKDAVKPKVKRSI  1290
             GLKDG+G+ Y  G    A+ +  ++  +      ++RR     SS++ ++         +
Sbjct  227   GLKDGKGSFYSAGTRVPAVQEFYLNALRKRGVLPDLRRQNQVASSVNMENLRVGVNHNKL  286

Query  1291  SE-KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNI  1467
             S+  +++     +GR     VS+    +L  S  +V+  D S + +     G + Q    
Sbjct  287   SKGSLINLEQSRNGR-----VSLERRWSLEVSIEKVIGHDYSDLSTAVLDSGSSVQYNAN  341

Query  1468  TVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
                 EREYMQGVLI E +        S ++ ++ K   KE +K   + + KG +SY LML
Sbjct  342   IPILEREYMQGVLISELVVNNGFSRTSRRAKRKHKRLVKEAKKPGEV-VIKGHRSYDLML  400

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITPI  REVR +DFG +A   M FPR GS +TPPH S DF WKDYCP+
Sbjct  401   NLQLGIRYTVGKITPIQRREVRTADFGPRASFWMNFPRAGSTMTPPHHSEDFKWKDYCPM  460

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+KVL
Sbjct  461   VFRNLREMFKIDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVKVL  520

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L+MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF+T+L +H R+DLKGS
Sbjct  521   LRMLPDYHHHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFFTDLRIHRRFDLKGS  580

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             SLGR  +K +I+E T LKDLDL Y   ++    E L++QL +DS+FLE+Q+I+DYSLLLG
Sbjct  581   SLGRSANKVEIDENTILKDLDLSYNYFLEPSWREGLLRQLEIDSKFLEAQNIMDYSLLLG  640

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--ILPRSLTLVTHEPSIVSTAPGPHI  2535
             +H RAP+HL + L    S+       V+ D  I   +L     LV        T  GPHI
Sbjct  641   VHHRAPQHLRSQLVRSQSITTDALESVAEDDTIEDDMLSYHEGLVLVPRGSDDTVTGPHI  700

Query  2536  RGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVV  2715
             RG  LRA++VGD EVDLLLPGT RL++Q GVNMPA+A     ++E +     L +  DVV
Sbjct  701   RGSRLRASAVGDEEVDLLLPGTARLQIQQGVNMPARAELIPGREEKEKQ--ILHDCCDVV  758

Query  2716  LYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             LYLGIIDILQ YNM KK+EH YKSL FD +SIS ++P  YS+RF+ F+++VF
Sbjct  759   LYLGIIDILQEYNMTKKIEHAYKSLHFDSLSISAVDPTFYSQRFLEFIKKVF  810



>ref|XP_010558195.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Tarenaya 
hassleriana]
 ref|XP_010558197.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Tarenaya 
hassleriana]
Length=826

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/782 (49%), Positives = 505/782 (65%), Gaps = 36/782 (5%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   P+G+ Y G   G +P G GKY  SDG  Y+G+W  G   G G++I SSGA YD
Sbjct  50    RVGELSLPDGECYSGSLLGNIPEGSGKYIWSDGCIYEGEWRRGMRHGNGKMIRSSGAWYD  109

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+ S+D   YKG W++N++HG+G + Y N DV++G W +G+ +G G+Y
Sbjct  110   GEFSGGYMHGTGTYVSADNLTYKGRWRLNLKHGLGYQVYPNGDVFEGSWIQGMAEGPGKY  169

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G M G+G + W NGD ++G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  170   TWANGNVYLGDMKGGKMLGKGTLTWINGDSYEGSWLNGMMHGFGVYTWSDGGCYVGTWTR  229

Query  1138  GLKDGRGTLYPVG--------CALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSIS  1293
             GLKDG+G+ YP G        C LD  +  G     R  +  +S    ++++  +     
Sbjct  230   GLKDGKGSFYPAGSKVPDVQECYLDALRKRGVLPDFRKQNQVASSVNMNSIRVGMNHGTG  289

Query  1294  EKIVDRFARDS------GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCD-GKAE  1452
                 D+ ++ S       R  R  VS+    +L  S  +V+  D S  LS    D G   
Sbjct  290   LGSTDKLSKGSLMNLEQSRNGR--VSLERRWSLEVSIEKVIAHDYSSDLSKPGLDSGNVR  347

Query  1453  QLGNITVAYEREYMQGVLIRERIKSVDGL---SHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
                N+ V  EREYMQGVLI E + + +G    S ++ +R +   KE +K   + + KG +
Sbjct  348   NKSNVPV-LEREYMQGVLISELVVN-NGFTRPSKRAKRRHRRLVKESKKPGEV-IIKGHR  404

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITPI  REVR+SDFG +A   M FP+ GS +TPPH S DF W
Sbjct  405   SYDLMLSLQLGIRYTVGKITPIQRREVRKSDFGPRASFWMNFPKAGSSMTPPHHSEDFKW  464

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFR+LR LFK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+K
Sbjct  465   KDYCPMVFRDLRELFKIDAADYMMSICGNDSLRELSSPGKSGSVFFLSQDDRFMIKTLRK  524

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE+KVL++MLP Y+ HVK +ENTLITKFFG++R+     KK RFVVMGNMF TEL +H R
Sbjct  525   SEVKVLVRMLPDYHHHVKKYENTLITKFFGLHRVKPSSGKKFRFVVMGNMFCTELRIHRR  584

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             +DLKGSSLGR   K +I+E T LKDLDL Y   ++    E L+KQ+ +DS+FLE+++I+D
Sbjct  585   FDLKGSSLGRSAYKVEIDENTILKDLDLNYCFYLEPSWREALLKQIEVDSKFLEAENIMD  644

Query  2344  YSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS------ILPRSLTLVTHEPS  2505
             YSLLLG+H RAP++L + +    S+       V+ D  I         P+ L LV  E  
Sbjct  645   YSLLLGVHHRAPQYLRSGMVRSRSMTGDGLESVAEDDTIEDDMFMLSYPQGLVLVPRETD  704

Query  2506  IVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSE  2685
              V    GPHIRG  LRA + GD EVDLLLPGT R+++QLGVNMPA+A     ++E     
Sbjct  705   DVVV--GPHIRGSRLRAPAAGDEEVDLLLPGTARVQIQLGVNMPARAEVIAGKEEH----  758

Query  2686  VELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
                 E YDVVLYLGIIDILQ YN+ K++EH +KS  FDP SIS ++P  YS RF+ F+ R
Sbjct  759   -MFHECYDVVLYLGIIDILQDYNLSKRMEHAFKSFHFDPRSISSVDPSFYSLRFLRFIRR  817

Query  2866  VF  2871
             VF
Sbjct  818   VF  819



>ref|XP_004246603.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Solanum 
lycopersicum]
 ref|XP_010325957.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Solanum 
lycopersicum]
 ref|XP_010325958.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Solanum 
lycopersicum]
Length=813

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/784 (48%), Positives = 509/784 (65%), Gaps = 38/784 (5%)
 Frame = +1

Query  571   CVIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQI  750
             C+     N R  E + PNG+ Y G   G +P G GKY  SDG  Y G+W  G   G G++
Sbjct  44    CLTSESTNFRVGELLLPNGESYSGSLLGNIPEGSGKYRWSDGCRYVGEWRHGITHGHGKL  103

Query  751   IWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKE  930
              + SGA YDG+   GY+HG GT+   D  +Y+G W+ N++HG+G + Y N D+++G W +
Sbjct  104   EFPSGAVYDGEFSGGYMHGEGTYIGPDKVIYRGRWRFNLKHGLGYQMYPNGDIFEGSWMQ  163

Query  931   GVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADG  1110
             G  +G G+YTW NGN+Y G  K G +SG+G + W NGD ++G W++   HG G Y ++DG
Sbjct  164   GTPEGPGKYTWDNGNVYFGNMKGGKISGKGTLTWINGDSYEGSWLNCAMHGVGMYTWSDG  223

Query  1111  SYYFGTWSNGLKDGRGTLYPVGC-----------ALDKCKIDGHKEIRRMLSHDSSISKK  1257
             S Y GTW++ LKDG+GT YP G            AL K  +      +  +SH    +  
Sbjct  224   SCYIGTWTHSLKDGKGTFYPSGSRLTAGQELYLNALRKRGLLPDMRKQSQVSHIHHAASV  283

Query  1258  DAVKPKVKRSISEKIVDRFARDSGRISRRA-VSVAGDAALHCSSTEVLPEDASCMLSHTT  1434
             D    KV   + E+ +  F++     SR   VS+    +L  +  +V+  +         
Sbjct  284   DMGNVKVSGKLPERNLLNFSQ-----SRPTNVSLERRWSLEVAIEKVIGHN---------  329

Query  1435  CDGKAEQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDL  1608
              DG  E   +  +  EREYMQG+LI E +  +     S ++ +R+K   +E+++     +
Sbjct  330   LDGDMEDAMSAPI-LEREYMQGILISEVVLNERFSPPSGRARRRQKRFVRELKR-PGEAI  387

Query  1609  FKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRS  1788
              KG +SY LML+LQLGIRY+VGKITPI  R++R SDFG +A   MYFP+ GS+LTP H+S
Sbjct  388   IKGHRSYDLMLSLQLGIRYTVGKITPIQRRDIRTSDFGPRASFWMYFPKGGSQLTPTHQS  447

Query  1789  IDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVI  1968
              DF WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+I
Sbjct  448   EDFKWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMI  507

Query  1969  KTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTEL  2148
             KTL+KSE+KVLL+MLP+Y++HVK +ENTLITKFFG++RI     +K RFVVMGNMF TEL
Sbjct  508   KTLRKSEVKVLLRMLPNYHRHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTEL  567

Query  2149  HMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLES  2328
              +H R+DLKGSSLGR  DK +I+E T LKDLDL Y   ++    E L++Q+ +DS+FLE 
Sbjct  568   RIHRRFDLKGSSLGRSADKVEIDENTILKDLDLNYCFYLEPSWREALLRQIEIDSKFLEE  627

Query  2329  QHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SILPRSLTLVTHEP  2502
             ++I+DYSLLLG+H+RAP+HL +L+            +V+ +  +   I P+ L LV    
Sbjct  628   ENIMDYSLLLGVHYRAPQHLQSLISCSGRTTADGLEIVAEEESLEDEISPQGLVLVPR-G  686

Query  2503  SIVSTAPGPHIRGKTLRANSV-GDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDP  2679
             S  S   GPH+RG  LRA+S  GD EVDLLLPGT R ++QLGVNMPA+A    K+ ET  
Sbjct  687   SDDSVVVGPHVRGSRLRASSATGDAEVDLLLPGTARFQIQLGVNMPARAEYIPKEGETQV  746

Query  2680  SEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFL  2859
                   EVYDVVLYLGIIDILQ YNM KKLEH YKS++FD +SIS ++P  YS+RF+ F+
Sbjct  747   ----FHEVYDVVLYLGIIDILQEYNMSKKLEHAYKSIQFDSVSISAVDPTYYSERFLEFI  802

Query  2860  ERVF  2871
              +VF
Sbjct  803   RKVF  806



>ref|NP_001148043.1| LOC100281652 [Zea mays]
 gb|ACG29570.1| phosphatidylinositol-4-phosphate 5-kinase 9 [Zea mays]
Length=803

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/779 (47%), Positives = 502/779 (64%), Gaps = 27/779 (3%)
 Frame = +1

Query  586   ENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSG  765
              ++ R  E + PNGD Y G   G  PHG G Y  SDG  Y+GDW  G   G+G+ +W +G
Sbjct  31    NSDSRVGELILPNGDTYRGALSGNTPHGPGCYIWSDGCVYEGDWRRGLRHGRGKTLWPTG  90

Query  766   ATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHG-VGRKEYQNSDVYDGCWKEGVRD  942
             ATY GD   GY++G GT+++   S Y+G WK+N++HG +G + Y N D + G W  G   
Sbjct  91    ATYTGDYSGGYIYGQGTYTAGLNS-YRGGWKLNLKHGHLGLQTYPNGDTFQGSWVHGQMQ  149

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             GHG YTW+NGN Y G  K G MSG+G++ W NGD F+G W+DG  HG G Y + D  YY 
Sbjct  150   GHGTYTWANGNTYVGAMKDGVMSGKGILTWNNGDSFEGNWLDGAMHGYGIYTWKDSGYYV  209

Query  1123  GTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKI  1302
             GTW+ G+KDG+GT YP    +    ID  +  R +L    S +    +       +++ +
Sbjct  210   GTWTRGVKDGKGTFYPKCRGIPVTDIDDLRN-RGVLPGAESQTHGSRILHSASSDMADMV  268

Query  1303  VDRFARDSGRISRRAVSVAGDAA----------LHCSSTEVLPEDASCMLSHTTCDGKAE  1452
               R     G  S R+++     +          L  +  + L  + +   +   C+ KA+
Sbjct  269   ASRNQDSVGISSVRSLNFEKTRSTNVLLERRWSLGVAIEKFLGRETNESSAIERCENKAD  328

Query  1453  QLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKS  1626
                N+ +  EREYMQGVLI E +   S      + ++R+K   K+++K     + KG +S
Sbjct  329   S--NLPI-LEREYMQGVLISEVVVDASFSNPLKRVSRRQKKIVKDIKK-PGQTIIKGHRS  384

Query  1627  YYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWK  1806
             Y LML+LQLGIRY+VGKITPI  REVR SD+G +A   M FP+ GSRLTP H + +F WK
Sbjct  385   YDLMLSLQLGIRYTVGKITPIQRREVRASDYGSRASFWMNFPKNGSRLTPSHHADNFKWK  444

Query  1807  DYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKS  1986
             DYCP+VFRNLR +FK++AADYM+SIC  D LREL SPGKSGS+F+LS DDRF+IKTL+KS
Sbjct  445   DYCPMVFRNLREMFKIDAADYMVSICGSDALRELSSPGKSGSVFFLSQDDRFMIKTLRKS  504

Query  1987  ELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRY  2166
             E++VLL+MLP YY HV+ +ENTLITKFFG++R+     +K RFVVMGNMF TEL +H R+
Sbjct  505   EVQVLLRMLPEYYHHVRTYENTLITKFFGLHRVKPSSSQKFRFVVMGNMFCTELRIHRRF  564

Query  2167  DLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDY  2346
             DLKGSSLGR TDK KI+E TTLKDLDL Y   ++    +TL+ Q+  DS+FL+   I+DY
Sbjct  565   DLKGSSLGRSTDKVKIDENTTLKDLDLNYSFYLEPSWRQTLLAQIETDSKFLKQHAIMDY  624

Query  2347  SLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--IL--PRSLTLVTHEPSIVS  2514
             SLLLG+HFRAP+ L        ++   +  ++S +G +   +L  P  L LV        
Sbjct  625   SLLLGVHFRAPQSLRTQASFHQAILPDRLAVLSEEGALEEDVLNSPEGLVLVQRASDQND  684

Query  2515  TAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVEL  2694
                G HIRG  LR++S    +VDLLLPGT RL++QLGVNMPA+A + V+ D+++ +    
Sbjct  685   VVIGSHIRGARLRSSSASFEKVDLLLPGTARLQIQLGVNMPARAKQTVEDDDSEDNG---  741

Query  2695  FEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
              +VYDVVLYLGIIDILQ Y++RKK+EH YK ++++ +SISV+EP LYS+RF+ F++ +F
Sbjct  742   -QVYDVVLYLGIIDILQEYSIRKKIEHAYKCIQYNSLSISVVEPSLYSERFLKFIQTIF  799



>ref|XP_010486568.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Camelina 
sativa]
 ref|XP_010486569.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Camelina 
sativa]
Length=816

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/773 (48%), Positives = 506/773 (65%), Gaps = 24/773 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R    + P+ + Y G   G +P G GKY  SDG  YDG+W  G   G G++IW+SGA Y+
Sbjct  47    RVRTLLLPDAESYCGSLLGNVPEGSGKYVWSDGCVYDGEWRRGMRHGIGKMIWASGAWYE  106

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  ++   YKG W++N++HG+G + Y N DV++G W +G+ +G G+Y
Sbjct  107   GEFSGGYMHGSGTYVDANKLTYKGRWRLNLKHGLGYQVYPNGDVFEGSWIQGLGEGPGKY  166

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N N+Y G  K G MSG+G + W  GD ++G W++G+ HG G Y + DG  Y GTW+ 
Sbjct  167   TWANKNVYLGDMKGGKMSGKGTLTWVTGDSYEGSWLNGMMHGVGVYTWRDGGCYVGTWTR  226

Query  1138  GLKDGRGTLYPVGC---ALDKCKIDGHK------EIRRMLSHDSSISKKDAVKPKVKRSI  1290
             GLKDG+G+ Y  G    A+ +  ++  +      ++RR     SS++ ++ ++  V  S 
Sbjct  227   GLKDGKGSFYSAGTRVPAVQEFYLNALRKRGVLPDLRRQNQVASSVNMEN-LRVGVNHSK  285

Query  1291  SEK--IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
               K  +++     +GR     VS+    +L  S  +V+  D S + +     G + Q   
Sbjct  286   LSKGSLINLEQSRNGR-----VSLERRWSLEVSIEKVIGHDYSDLSTAVLDSGSSVQYNA  340

Query  1465  ITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
                  EREYMQGVLI E +        S ++ ++ K   KE +K   + + KG +SY LM
Sbjct  341   NIPILEREYMQGVLISELVVNNGFSRTSRRAKRKHKRLVKEAKKPGEV-VIKGHRSYDLM  399

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             LNLQLGIRY+VGKITPI  REVR +DFG +A   M FPR GS +TPPH S DF WKDYCP
Sbjct  400   LNLQLGIRYTVGKITPIQRREVRTADFGPRASFWMNFPRAGSTMTPPHHSEDFKWKDYCP  459

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+KV
Sbjct  460   MVFRNLREMFKIDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVKV  519

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LL+MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF+T+L +H R+DLKG
Sbjct  520   LLRMLPDYHHHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFFTDLRIHRRFDLKG  579

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SSLGR  +K +I+E T LKDLDL Y   ++    E L++QL +DS+FLE+Q+I+DYSLLL
Sbjct  580   SSLGRSANKVEIDENTILKDLDLSYNYFLEPSWREGLLRQLEIDSKFLEAQNIMDYSLLL  639

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--ILPRSLTLVTHEPSIVSTAPGPH  2532
             G+H RAP+HL + L    S+       V+ D  I   +L     LV        T  GPH
Sbjct  640   GVHHRAPQHLRSQLVRSQSITTDALESVAEDDTIEDDMLSYHEGLVLVPRGSDDTVTGPH  699

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG  LRA++VGD EVDLLLPGT RL++Q GVNMPA+A     ++E +     L +  DV
Sbjct  700   IRGSRLRASAVGDEEVDLLLPGTARLQIQQGVNMPARAELIPGREEKEKQ--ILHDCCDV  757

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VLYLGIIDILQ YNM KK+EH YKSL FD +SIS ++P  YS+RF+ F+++VF
Sbjct  758   VLYLGIIDILQEYNMTKKIEHAYKSLHFDSLSISAVDPTFYSQRFLEFIKKVF  810



>ref|XP_002993810.1| hypothetical protein SELMODRAFT_449229 [Selaginella moellendorffii]
 gb|EFJ05102.1| hypothetical protein SELMODRAFT_449229 [Selaginella moellendorffii]
Length=821

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/771 (47%), Positives = 506/771 (66%), Gaps = 30/771 (4%)
 Frame = +1

Query  601   TDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDG  780
             +DEK  PNGD Y+G   G LP G+GKY  ++G+ Y+G WE+GK +G+G+ +W SGA Y+G
Sbjct  60    SDEKALPNGDRYVGALVGNLPEGRGKYIWANGSWYEGQWEKGKKSGRGKFVWPSGAFYEG  119

Query  781   DCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYT  960
             +   G++ G G F + +G+VYKG+W MN++HG+GR  Y N D Y+G WK G++DG G+Y 
Sbjct  120   EFAGGFMQGLGNFRAPNGAVYKGNWSMNLKHGLGRLRYANGDKYEGAWKHGLQDGFGKYV  179

Query  961   WSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNG  1140
             W+N N+Y G WK G M+G+GV++W  GD F+G W++G+ HG G Y +ADGS + GTWS G
Sbjct  180   WTNKNVYVGDWKAGVMTGKGVLRWGMGDAFNGEWLNGMEHGRGVYYWADGSIFVGTWSRG  239

Query  1141  LKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFAR  1320
             LKDG+G  YP G          +  + ++  + ++   KD       ++   ++  RF  
Sbjct  240   LKDGKGVFYPAGTLPLDMSTRENLMLNKVEEYLATGIAKDWTSVGSWKNGRRELDSRFIT  299

Query  1321  DSGRIS-----RRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYER  1485
              SG  +     ++ V +    +L      VL  ++  +      + + + +  +    ER
Sbjct  300   SSGSGNLDQQIKKNVWLGRRWSLEGPLERVLGLESFFIGGEAILEEEKDDVPEVAPILER  359

Query  1486  EYMQGVLIRERIKSVDG---LSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLG  1656
             EY QGVLI E +K   G         +RR+ P +  R G    +FKG +SY LML LQ+G
Sbjct  360   EYAQGVLINEIVKQPIGSVLSKSSRRKRRRQPREPKRPGET--IFKGHRSYDLMLTLQIG  417

Query  1657  IRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNL  1836
             IRY+VGK+TP P   +   DFG +A ++M FP+ GS++TP HR++DF WKDYCP VF+ L
Sbjct  418   IRYTVGKVTPEPCNNIGPLDFGSKASVRMKFPKMGSQVTPCHRTVDFAWKDYCPRVFKRL  477

Query  1837  RRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLP  2016
             R +FK++AADYM+SIC +  LREL SPGKSGS+F+LS DDRF+IKT++KSE+KVLL+ML 
Sbjct  478   REMFKIDAADYMLSICGNSALRELPSPGKSGSVFFLSNDDRFMIKTMRKSEVKVLLRMLR  537

Query  2017  SYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRF  2196
             SYY HV  ++NTLITKFFG++R+  +  +KVRFVVMGNMF T+L +H RYDLKGS  GR 
Sbjct  538   SYYNHVSSYDNTLITKFFGLHRVKPQGGQKVRFVVMGNMFCTDLRIHRRYDLKGSLQGRC  597

Query  2197  TDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRA  2376
             T +  I+E TTLKDLDL Y   ++    + LIKQ++ D +FLESQHI+DYSLLLGLHFRA
Sbjct  598   TGEADIDENTTLKDLDLDYVFHLEPSWRDALIKQIASDCKFLESQHIMDYSLLLGLHFRA  657

Query  2377  PEHLTALLEPPDSLFKPKSTLVSSDGGISILP-RSLTLVTHEPSIVSTAPGPHIRGKTLR  2553
             P             ++P    +  DG     P RSL LV  +    + +   HIRGK L 
Sbjct  658   PH-----------FYQPSKGTI-PDGEEEWTPARSLVLVPRDQGKRTMS--SHIRGKPLT  703

Query  2554  ANSVGD----REVDLLLPGTGRLRVQLGVNMPAQANRKV-KQDETDPSEVELFEVYDVVL  2718
             A  + +     EVDLLLPGT RL++QLGVNMPA+A+RK  K++E++  E  L EV+DVVL
Sbjct  704   AAGIAEADDNAEVDLLLPGTARLQIQLGVNMPARADRKPRKKEESNDEEESLDEVHDVVL  763

Query  2719  YLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             YLG+IDILQ Y++ K++EH YKSL+FDP+SIS IEP  YS+RF  FL ++F
Sbjct  764   YLGVIDILQEYDVGKRIEHAYKSLQFDPVSISAIEPASYSQRFQDFLCKIF  814



>ref|XP_010478747.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Camelina 
sativa]
Length=815

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/772 (48%), Positives = 504/772 (65%), Gaps = 22/772 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R    + P+ + Y G   G +P G GKY  SDG  YDG+W  G   G G++IW+SGA Y+
Sbjct  46    RVRTLLLPDAESYCGSLLGNVPEGSGKYVWSDGCVYDGEWRRGMRHGIGKMIWASGAWYE  105

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  ++   YKG W++N++HG+G + Y N DV++G W +G+ +G G+Y
Sbjct  106   GEFSGGYMHGSGTYVDANKLTYKGRWRLNLKHGLGYQVYPNGDVFEGSWIQGLGEGPGKY  165

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N N+Y G  K G MSG+G + W  GD ++G W++G+ HG G Y + DG  Y GTW+ 
Sbjct  166   TWANKNVYLGDMKGGKMSGKGTLTWVTGDSYEGSWLNGMMHGVGVYTWRDGGCYVGTWTR  225

Query  1138  GLKDGRGTLYPVGC---ALDKCKIDGHK------EIRRMLSHDSSISKKDAVKPKVKRSI  1290
             GLKDG+G+ Y  G    A+ +  ++  +      ++RR     SS++ ++         +
Sbjct  226   GLKDGKGSFYSAGTRVPAVQEFYLNALRKRGVLPDLRRQNQVASSVNMENLRVGVNHNKL  285

Query  1291  SE-KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNI  1467
             S+  +++     +GR     VS+    +L  S  +V+  D S + +     G + Q    
Sbjct  286   SKGSLINLEQSRNGR-----VSLERRWSLEVSIEKVIGHDYSDLSTAVLDSGSSVQYNAN  340

Query  1468  TVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
                 EREYMQGVLI E +        S ++ ++ K   KE +K   + + KG +SY LML
Sbjct  341   IPILEREYMQGVLISELVVNNGFSRTSRRAKRKHKRLVKEAKKPGEV-VIKGHRSYDLML  399

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITPI  REVR +DFG +A   M FPR GS +TPPH S DF WKDYCP+
Sbjct  400   NLQLGIRYTVGKITPIQRREVRTADFGPRASFWMNFPRAGSTMTPPHHSEDFKWKDYCPM  459

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+KVL
Sbjct  460   VFRNLREMFKIDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVKVL  519

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L+MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF+T+L +H R+DLKGS
Sbjct  520   LRMLPDYHHHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFFTDLRIHRRFDLKGS  579

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             SLGR  +K +I+E T LKDLDL Y   ++    E L++QL +DS+FLE+Q+I+DYSLLLG
Sbjct  580   SLGRSANKVEIDENTILKDLDLSYNYFLEPSWREGLLRQLEIDSKFLEAQNIMDYSLLLG  639

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--ILPRSLTLVTHEPSIVSTAPGPHI  2535
             +H RAP+HL + L    S+       V+ D  I   +L     LV        T  GPHI
Sbjct  640   VHHRAPQHLRSQLVRSQSITTDALESVAEDDTIEDDMLSYHEGLVLVPRGSDDTVTGPHI  699

Query  2536  RGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVV  2715
             RG  LRA++VGD EVDLLLPGT RL++Q GVNMPA+A     ++E +     L +  DVV
Sbjct  700   RGSRLRASAVGDEEVDLLLPGTARLQIQQGVNMPARAELIPGREEKEKQ--ILHDCCDVV  757

Query  2716  LYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             LYLGIIDILQ YNM KK+EH YKSL FD +SIS ++P  YS+RF+ F+++VF
Sbjct  758   LYLGIIDILQEYNMTKKIEHAYKSLHFDSLSISAVDPTFYSQRFLEFIKKVF  809



>ref|XP_002967980.1| hypothetical protein SELMODRAFT_88573 [Selaginella moellendorffii]
 gb|EFJ31327.1| hypothetical protein SELMODRAFT_88573 [Selaginella moellendorffii]
Length=770

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/769 (50%), Positives = 510/769 (66%), Gaps = 42/769 (5%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK   NGD Y G F+G +P G GKY  SDG  Y+G W +GK TG+G+I W SGATY+GD 
Sbjct  28    EKNLSNGDFYAGSFEGGIPEGDGKYLWSDGCMYEGQWGKGKKTGRGKISWPSGATYEGDF  87

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+HG GTF+ +DG+ YKG WKMN+++G+GRK Y N DVY+G WK+G ++G GRY W+
Sbjct  88    MCGYMHGSGTFTGTDGTTYKGSWKMNLKNGLGRKRYANGDVYEGSWKDGAQEGPGRYVWA  147

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G M GRGV+ W +GD +DG W+DGL +G G Y ++DG+ Y G WS GLK
Sbjct  148   NGNEYMGDWKGGLMCGRGVLTWASGDCYDGQWLDGLENGHGVYTWSDGTVYNGNWSKGLK  207

Query  1147  DGRGTLYPVGC-ALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARD  1323
             DG+G  YP G  ++D    D +  + + ++         A +     S+      R   D
Sbjct  208   DGKGVYYPPGSFSVDTAGFDRNATVGKQVA---------ATRRNRAPSLDFDQAIRQQHD  258

Query  1324  SGRI-SRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQG  1500
              G + S  A     + AL   S E + +              +E+        EREY+QG
Sbjct  259   FGPMKSYSAEQTTLEKALQADSAERIFD--------------SEEYHGADPVVEREYVQG  304

Query  1501  VLIRERIKSVDG---LSHQSTQRR-KFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYS  1668
             VLI E +K V      + +ST+RR K   KE+++     + KG +SY LMLNLQLGIRY+
Sbjct  305   VLINEIVKKVPANVASTPKSTKRRYKKHVKEIKR-PGETIIKGHRSYDLMLNLQLGIRYT  363

Query  1669  VGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLF  1848
             VGKITP P  ++  S+FG +AR +M FPR GS+LTP H+S+DF WKDYCP+VFR+LR LF
Sbjct  364   VGKITPEPKHDIEPSNFGRKARFRMNFPRAGSQLTPSHQSVDFKWKDYCPMVFRHLRELF  423

Query  1849  KLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYK  2028
             K++AADYM+S+C +D LREL SPGKSGS+FYLS DDRF+IKT++KSE++VLL ML SYY 
Sbjct  424   KIDAADYMLSLCGNDALRELSSPGKSGSVFYLSHDDRFIIKTMRKSEVEVLLDMLASYYD  483

Query  2029  HVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKD  2208
             HV  HENTLITKFFG++RI  +  +KVRFVVMGNMF T+L +H R+DLKGSSLGR T+  
Sbjct  484   HVLVHENTLITKFFGLHRIKPQGGRKVRFVVMGNMFCTDLRIHRRFDLKGSSLGRSTENV  543

Query  2209  KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHL  2388
              I+E TTLKDLDL +   ++    +T ++Q+ LD++FLESQ I+DYSLLLG+HFRAP++ 
Sbjct  544   DIDENTTLKDLDLDFVFHLEPTWRDTFMRQIELDAKFLESQRIMDYSLLLGVHFRAPQYP  603

Query  2389  TALLEPPDSLFKPKSTLVSSDGGISI----LPRSLTLVTHEPSIV----STAPGPHIRGK  2544
              + +     +  P    V +   +S+      +SL LV H  S      +T PG H+RG 
Sbjct  604   ASDIGTSYQVCSPHIKFVLTFLSVSVEEDWPSKSLVLVAHGASPTGESGATTPGSHVRGS  663

Query  2545  TLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYL  2724
              L+    G+ EVDLLLPGT RLR+QLGVNMPA+A+R+   D     E    EVYDVVLY 
Sbjct  664   PLKP--AGNEEVDLLLPGTARLRIQLGVNMPARADREAPHDGG--QEESFGEVYDVVLYF  719

Query  2725  GIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             G+IDILQ Y++ K +EH YKSL+FD +SIS ++P +Y+KRF  F+E+VF
Sbjct  720   GVIDILQRYDITKWVEHTYKSLQFDAVSISAVDPSMYAKRFQDFIEKVF  768



>ref|XP_002884763.1| PIP5K9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61022.1| PIP5K9 [Arabidopsis lyrata subsp. lyrata]
Length=815

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/773 (48%), Positives = 509/773 (66%), Gaps = 24/773 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + P+G+ Y G   G +P G GKY  SDG  YDG+W  G   G G++ W+SGA+Y+
Sbjct  46    RVRELLLPDGESYSGSLLGNVPEGPGKYIWSDGCVYDGEWRRGMRHGIGKMRWASGASYE  105

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  ++   YKG W++N++HG+G + Y N DV++G W +G+ +G G+Y
Sbjct  106   GEFSGGYMHGSGTYVDANKLTYKGRWRLNLKHGLGYQVYPNGDVFEGSWIQGLGEGPGKY  165

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N N+Y G  K G MSG+G + W  GD ++G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  166   TWANKNVYLGDMKGGKMSGKGTLTWVTGDSYEGSWLNGMMHGVGVYTWSDGGCYVGTWTR  225

Query  1138  GLKDGRGTLYPVGC---ALDKCKIDGHK------EIRRMLSHDSSISKKDAVKPKVKRSI  1290
             GLKDG+G+ Y  G    A+ +  ++  +      ++RR     SS++ ++ ++  V R+ 
Sbjct  226   GLKDGKGSFYSAGTRVPAVQEFYLNALRKRGVLPDLRRQNQVASSVNMEN-LRVGVNRNK  284

Query  1291  SEK--IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
               K  +++     +GR     VS+    +L  S  +V+    S + +     G + Q   
Sbjct  285   LSKGSLINLEQSRNGR-----VSLERRWSLEVSIEKVIGHGYSDLSTAVLDSGSSVQYKA  339

Query  1465  ITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
                  EREYMQGVLI E +        S ++ ++ K   KE +K   + + KG +SY LM
Sbjct  340   NVPILEREYMQGVLISELVVNNGFSRTSRRAKRKHKRLVKEAKKPGEV-VIKGHRSYDLM  398

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             L+LQLGIRY+VGKITPI  R+VR +DFG +A   M FPR GS +TPPH S DF WKDYCP
Sbjct  399   LSLQLGIRYTVGKITPIQRRQVRTADFGPRASFWMNFPRAGSTMTPPHHSEDFKWKDYCP  458

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+KV
Sbjct  459   MVFRNLREMFKIDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVKV  518

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LL+MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF+T+L +H R+DLKG
Sbjct  519   LLRMLPDYHHHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFFTDLRIHRRFDLKG  578

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             SSLGR  DK +I+E T LKDLDL Y   ++    E L++QL +DS+FLE+Q+I+DYSLLL
Sbjct  579   SSLGRSADKVEIDENTILKDLDLNYNFFLEPSWREDLLRQLEIDSKFLEAQNIMDYSLLL  638

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--ILPRSLTLVTHEPSIVSTAPGPH  2532
             G+H RAP+HL + L    S+       V+ D  I   +L     LV       +   GPH
Sbjct  639   GVHHRAPQHLRSQLVRSQSITTDALESVAEDDTIEDDMLSYHEGLVLVPRGSENIVTGPH  698

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG  LRA++ GD EVDLLLPGT RL++Q GVNMPA+A  ++     D  +  L++  DV
Sbjct  699   IRGSRLRASAAGDEEVDLLLPGTARLQIQQGVNMPARA--ELIPGREDKEKQILYDCCDV  756

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VLYLGIIDILQ YNM KK+EH YKSL FD +SIS ++P  YS+RF+ F+++VF
Sbjct  757   VLYLGIIDILQEYNMTKKIEHAYKSLHFDSLSISAVDPTFYSQRFLEFIKKVF  809



>ref|XP_010543450.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010543451.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010543452.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X1 [Tarenaya hassleriana]
Length=823

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/781 (48%), Positives = 508/781 (65%), Gaps = 34/781 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E +  NG+ Y G     +P G GKY  SDG  ++G+W  G   G G++ W SGA Y+
Sbjct  50    RVGELLLTNGECYSGSLLRNVPEGSGKYIWSDGCFFEGEWRRGMRHGNGKMGWHSGALYE  109

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  ++   YKG W++N++HG+G + Y N D+++G W +GV +G G+Y
Sbjct  110   GEFSGGYMHGTGTYIGANNMTYKGRWRLNLKHGLGYQVYPNGDIFEGSWIQGVAEGPGKY  169

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W +GD ++G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  170   TWANGNVYLGDMKAGKMSGKGTLTWTSGDSYEGSWLNGMMHGFGVYTWSDGGCYVGTWTR  229

Query  1138  GLKDGRGTLYPVG--------CALDKCKIDG-HKEIRRMLSHDSSISKKDAVKPKVKRSI  1290
             GLKDG+G+ YP G        C LD  +  G   +++R     SS++  + ++  + R  
Sbjct  230   GLKDGKGSFYPAGSKVPDVQECYLDALRKRGVLPDLKRQNQVASSVNVGN-IRVGMNRGN  288

Query  1291  SEKIVDRFARDS------GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCD-GKA  1449
                  DR ++ S       R  R  VS+    +L  S  +V+  D S  LS  + D G  
Sbjct  289   RLGSTDRLSKGSLINLEQSRNGR--VSLERRWSLEVSIEKVIAHDYSSDLSEPSLDSGNI  346

Query  1450  EQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
             +   N+ +  EREYMQGVLI E +   +    S ++ +R K   KE +K   + + KG +
Sbjct  347   QNKSNLPI-LEREYMQGVLISELVVNNAFSRPSRRAKRRHKRLVKEAKKPGEV-IIKGHR  404

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP+ GS +TPPH S DF W
Sbjct  405   SYDLMLSLQLGIRYTVGKITPIQRREVRTSDFGPRASFWMNFPKDGSSMTPPHHSEDFKW  464

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFR+LR LFK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+K
Sbjct  465   KDYCPMVFRDLRELFKIDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRK  524

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE+KVL++MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H R
Sbjct  525   SEVKVLIRMLPDYHHHVKKYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRR  584

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             +DLKGSSLGR     +I+E + LKDLDL Y   ++    E L+KQ+ +DS+FLE+Q+I+D
Sbjct  585   FDLKGSSLGRSAYNVEIDENSILKDLDLNYSFYLEPSWREALLKQIEIDSKFLEAQNIMD  644

Query  2344  YSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS----ILPRSLTLVTHEPSIV  2511
             YSLLLG+H RAP+HL + +    S+       V+ D  +       P+ L LV  E   V
Sbjct  645   YSLLLGVHHRAPQHLRSQMVRTRSMTADGLESVAEDDTVEDDMLSYPQGLVLVPRETEDV  704

Query  2512  STAPGPHIRGKTLRANSVGDREVDLLLPG-TGRLRVQLGVNMPAQANRKVKQDETDPSEV  2688
                 GPHIRG  LRA++ GD EVDLLLPG T RL++QLGVNMPA+A  K  ++E      
Sbjct  705   VVV-GPHIRGSRLRASAAGDEEVDLLLPGTTARLQIQLGVNMPARAEVKPGKEEK-----  758

Query  2689  ELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERV  2868
                E YDVVLYLGIIDILQ YNM K++EH +KS +FD +SIS ++P  YS RF+SF++  
Sbjct  759   MFHECYDVVLYLGIIDILQEYNMGKRIEHAFKSFQFDSLSISAVDPTFYSHRFLSFIDEA  818

Query  2869  F  2871
             F
Sbjct  819   F  819



>gb|ACH90427.1| phosphatidylinositol phoshate kinase [Physcomitrella patens]
 dbj|BAG72195.1| phosphatidylinositol phosphate kinase [Physcomitrella patens]
Length=923

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/780 (49%), Positives = 513/780 (66%), Gaps = 30/780 (4%)
 Frame = +1

Query  601   TDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDG  780
             T EK   NGD Y+G ++G LP G GKY  +DG  Y+G+W  GK +GKG+I W SGATY+G
Sbjct  146   TGEKELSNGDFYVGTWQGSLPEGTGKYLWADGCMYEGEWGRGKKSGKGKISWPSGATYEG  205

Query  781   DCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYT  960
             +   GY+HG GT+  + G+ YKG W MN++HG GRK Y N DVY+G WK+GV++G G+YT
Sbjct  206   EFIGGYMHGVGTYMGTGGTTYKGQWSMNVKHGQGRKRYANGDVYEGTWKQGVQEGVGKYT  265

Query  961   WSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNG  1140
             W++GN Y G W+ G M G GV+ W +GD FDG W+DGL HG G Y +ADGS Y GTWS G
Sbjct  266   WASGNEYNGEWRGGTMCGNGVLTWTSGDKFDGQWLDGLEHGRGVYVWADGSSYNGTWSRG  325

Query  1141  LKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFAR  1320
             LKDG+G  YP G    +   +    +   + H   +      + +   S         ++
Sbjct  326   LKDGKGVFYPAGTRDLQAVRNNDGGVASHVYHSGELRPLRWSRSRSISSERIPYGGELSK  385

Query  1321  D---SGRISRR---------AVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
                 S  I RR            + G+ ++   +T+ + E     +     +        
Sbjct  386   GGDFSNSIQRRRSMDGPLERGFGLEGNGSVR--TTDTILEGVERGVERPLLETPGALPPT  443

Query  1465  ITVAYEREYMQGVLIRERIK-SVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
             + V   REY+QGVL+ E +K S D + H+  + R+  AK++++     +FKG +SY LML
Sbjct  444   VVV---REYVQGVLMSELVKDSADAVGHKKRRPRR-SAKDIKR-PGETIFKGHRSYDLML  498

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP P  E+  +DFG +A I M FP+ G+ LTP H S DF WKDYCP+
Sbjct  499   NLQLGIRYTVGKITPEPRHEIGPNDFGPRASIHMNFPKSGTPLTPTHNSSDFKWKDYCPM  558

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFR+LR +FK++AADYM+S+C DD LREL+SPGKSGS+FYLS DDRF+IKT+KK+E+KVL
Sbjct  559   VFRHLREMFKIDAADYMLSLCGDDALRELVSPGKSGSVFYLSHDDRFIIKTMKKAEVKVL  618

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGS  2181
             L ML +Y+ HVK ++NTLITKFFG++RI     +KVRFVVMGNMF TEL +H R+DLKGS
Sbjct  619   LNMLAAYHLHVKTYDNTLITKFFGLHRIKPYGGQKVRFVVMGNMFCTELRIHRRFDLKGS  678

Query  2182  SLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             S GR  DK +I+E TTLKDLDL YE R+D    ++L++QL  D +FLE++ I+DYS+LLG
Sbjct  679   SQGRSADKVEIDETTTLKDLDLDYEFRLDPSWRDSLLRQLEYDCKFLEARGIMDYSMLLG  738

Query  2362  LHFRAPEHLTALLEPPDSL--FKPKSTLVSS---DGGISILP--RSLTLVTHEPSIVSTA  2520
             LHFRAP++   L   P S     P  +  S+   +GG       R + LV  + +  S+ 
Sbjct  739   LHFRAPQYRAPLSPGPSSTPDVPPSESFTSTALDEGGDEEWASNRGIVLVARDAAHGSSG  798

Query  2521  -PGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANR-KVKQDETDPSEVEL  2694
              PG HIRG  LRA+  GD EVDLLLPGT RLR+QLGVNMPA+A R   K DE+  SE + 
Sbjct  799   TPGIHIRGSPLRASVAGDPEVDLLLPGTARLRIQLGVNMPARAERVHKKDDESKTSEGQF  858

Query  2695  F-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             F E +DVVLY GIIDILQ Y++ K++EH YK+ +FD +SIS +EPKLYSKRF  F+ ++F
Sbjct  859   FGESHDVVLYFGIIDILQNYSLSKRIEHAYKACQFDSISISAVEPKLYSKRFQEFIRQIF  918



>ref|XP_004966576.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Setaria 
italica]
Length=807

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/780 (48%), Positives = 500/780 (64%), Gaps = 35/780 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PNGD+Y G   G  P G G Y  SDG  Y+G+W  G   G G+++W +GATY+
Sbjct  37    RVGELILPNGDIYRGTLLGTTPDGSGSYIWSDGCVYEGEWRGGLRHGHGKMLWPTGATYE  96

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             GD   GY++G GT+   + S YKG WK+N++HG+G + Y N D ++G W +G   GHG Y
Sbjct  97    GDYSGGYIYGEGTYIGLNNSTYKGGWKLNLKHGLGLQTYPNGDRFEGSWTQGQVQGHGMY  156

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN Y GI K G MSG+G+  W +GD F+G W+DG+ HG G Y + D  YY GTW+ 
Sbjct  157   TWANGNTYVGIMKNGVMSGKGIFTWKHGDSFEGNWLDGVMHGHGVYTWKDCGYYVGTWTR  216

Query  1138  GLKDGRGTLYPVGCAL---DKCKIDGHKEIRRMLS------------HDSSISKKDAVKP  1272
             G+KDG+GT YP    +   D+  ID  ++ R +L             H SS    D +  
Sbjct  217   GVKDGKGTFYPRCREILLPDELSIDALRK-RGVLPGVESQIHGSRTLHSSSFDMADVMAR  275

Query  1273  KVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAE  1452
               + S     +   A +  R   + VS+    +L  +  + +  + +   +  +C+ K +
Sbjct  276   GNQDSAGVSSIRSLAFEETR--SKNVSLERRWSLGVAIEKFIGRETNESSAAQSCENKTD  333

Query  1453  QLGNITVAYEREYMQGVLIRERIKSVDGLSH---QSTQRRKFPAKEVRKGSCMDLFKGRK  1623
                N+ +  EREYMQGVLI E +      SH   +S+  +K   K+++K     + KG +
Sbjct  334   S--NLPI-LEREYMQGVLISEVLVDTS-FSHSFKRSSHCQKKIVKDIKK-PGQTIIKGHR  388

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITPI  REVR SD+G +A   M FP+ GSRLTP H + DF W
Sbjct  389   SYDLMLSLQLGIRYTVGKITPILRREVRASDYGPRASFWMSFPKNGSRLTPSHHADDFKW  448

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR +FK++AADYM+SIC  D LREL SPGKSGS+F+LS DDRF+IKTL+K
Sbjct  449   KDYCPMVFRNLREMFKIDAADYMVSICGSDALRELSSPGKSGSVFFLSQDDRFMIKTLRK  508

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE++VLL+MLP YY HV+ +ENTLITKFFG++R+     +K  FVVMGNMF TEL +H R
Sbjct  509   SEVQVLLRMLPEYYYHVRTYENTLITKFFGLHRVKPSSGQKFHFVVMGNMFCTELRIHRR  568

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             +DLKGSSLGR TDK  I+E TTLKDLDL Y   ++    +TL+KQ+  DS+FL +  I+D
Sbjct  569   FDLKGSSLGRSTDKITIDENTTLKDLDLSYSFYVEPSWRDTLLKQIETDSKFLRNHAIMD  628

Query  2344  YSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLTLVTHEPSIV  2511
             YSLLLG+H+RAP+ L        ++   +  ++S +G     I      L LV       
Sbjct  629   YSLLLGVHYRAPQKLRTQASFNHTIVPDRLAVLSEEGALEEDIMNCSEGLVLVQRASDQN  688

Query  2512  STAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVE  2691
                 GPHIRG  LR+ S    EVDLLLPGT RL++QLGVNMPA+A +  K+D+ +     
Sbjct  689   DVVIGPHIRGARLRS-SASFEEVDLLLPGTTRLQIQLGVNMPARAEQTTKEDDRE----S  743

Query  2692  LFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
               +VYDVVLYLGIIDILQ YN+RKK+EH YKS++++ +SISV+EP  YS+RF+ F+  +F
Sbjct  744   FGQVYDVVLYLGIIDILQEYNLRKKIEHTYKSIKYNSLSISVVEPNFYSERFLKFIRTIF  803


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 50/108 (46%), Gaps = 1/108 (1%)
 Frame = +1

Query  856   KMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWF  1035
             K+N    VG     N D+Y G       DG G Y WS+G +Y G W+ G   G G M W 
Sbjct  31    KVNPGSRVGELILPNGDIYRGTLLGTTPDGSGSYIWSDGCVYEGEWRGGLRHGHGKMLWP  90

Query  1036  NGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG-TLYPVG  1176
              G  ++G +  G  +G G Y   + S Y G W   LK G G   YP G
Sbjct  91    TGATYEGDYSGGYIYGEGTYIGLNNSTYKGGWKLNLKHGLGLQTYPNG  138



>ref|XP_002963939.1| hypothetical protein SELMODRAFT_230263 [Selaginella moellendorffii]
 gb|EFJ34272.1| hypothetical protein SELMODRAFT_230263 [Selaginella moellendorffii]
Length=764

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/770 (51%), Positives = 511/770 (66%), Gaps = 50/770 (6%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK   NGD Y G F+G +P G GKY  SDG  Y+G W +GK TG+G+I W SGATY+GD 
Sbjct  28    EKNLSNGDFYAGSFEGGIPEGDGKYLWSDGCMYEGQWGKGKKTGRGKISWPSGATYEGDF  87

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+HG GTF+ +DG+ YKG WKMN+++G+GRK Y N DVY+G WK+G ++G GRY W+
Sbjct  88    MCGYMHGSGTFTGTDGTTYKGSWKMNLKNGLGRKRYANGDVYEGSWKDGAQEGPGRYVWA  147

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G M GRGV+ W +GD +DG W+DGL +G G Y ++DG+ Y G WS GLK
Sbjct  148   NGNEYMGDWKGGLMCGRGVLTWASGDCYDGQWLDGLENGHGVYTWSDGTVYNGNWSKGLK  207

Query  1147  DGRGTLYPVGC-ALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKI--VDRFA  1317
             DG+G  YP G  ++D    D +  + + L+            P+  R+ S       R  
Sbjct  208   DGKGVYYPPGSFSVDTAGFDRNATVGKQLA-----------GPRRNRAPSLDFDQAIRQQ  256

Query  1318  RDSGRI-SRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYM  1494
              D G + S  A     + AL   S E + +              +++        EREY+
Sbjct  257   HDFGPMKSYSAEQTTLEKALQADSAERIFD--------------SDEYHGADPVVEREYV  302

Query  1495  QGVLIRERIKSVDG---LSHQSTQRR-KFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIR  1662
             QGVLI E +K V      + +ST+RR K   KE+++     + KG +SY LMLNLQLGIR
Sbjct  303   QGVLINEIVKKVPANVASTPKSTKRRYKKHVKEIKR-PGETIIKGHRSYDLMLNLQLGIR  361

Query  1663  YSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRR  1842
             Y+VGKITP P  ++  S+FG +AR +M FPR GS+LTP H+S+DF WKDYCP+VFR+LR 
Sbjct  362   YTVGKITPEPKHDIEPSNFGRKARFRMNFPRAGSQLTPSHQSVDFKWKDYCPMVFRHLRE  421

Query  1843  LFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSY  2022
             LFK++AADYM+S+C +D LREL SPGKSGS+FYLS DDRF+IKT++KSE++VLL ML SY
Sbjct  422   LFKIDAADYMLSLCGNDALRELSSPGKSGSVFYLSHDDRFIIKTMRKSEVEVLLDMLASY  481

Query  2023  YKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTD  2202
             Y HV  HENTLITKFFG++RI  +  +KVRFVVMGNMF T+L +H R+DLKGSSLGR T+
Sbjct  482   YDHVLVHENTLITKFFGLHRIKPQGGRKVRFVVMGNMFCTDLRIHRRFDLKGSSLGRSTE  541

Query  2203  KDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPE  2382
                I+E TTLKDLDL +   ++    +T ++Q+ LD++FLESQ I+DYSLLLG+HFRAP+
Sbjct  542   NVDIDENTTLKDLDLDFVFHLEPTWRDTFMRQIELDAKFLESQRIMDYSLLLGVHFRAPQ  601

Query  2383  HLTALLEPPDSL---FKPKSTLVSSDGGISILPRSLTLVTHEPSIV----STAPGPHIRG  2541
             +  A+  P   L   F   S  V  D       ++L LV H  S      +T PG H+RG
Sbjct  602   Y-PAVFSPFARLLLFFTFLSVSVEED----WPSKNLVLVAHGASPTGESGATTPGSHVRG  656

Query  2542  KTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLY  2721
               L+    G+ EVDLLLPGT RLR+QLGVNMPA+A+R+   D     E    EVYDVVLY
Sbjct  657   SPLKP--AGNEEVDLLLPGTARLRIQLGVNMPARADREAPHDGG--QEESFGEVYDVVLY  712

Query  2722  LGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
              G+IDILQ Y++ K +EH YKSL+FD +SIS ++PK+Y+KRF  F+E+VF
Sbjct  713   FGVIDILQRYDITKWVEHTYKSLQFDAVSISAVDPKVYAKRFQDFIEKVF  762



>emb|CDY54607.1| BnaA05g28620D [Brassica napus]
Length=816

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/775 (49%), Positives = 497/775 (64%), Gaps = 29/775 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   PNG+ Y G   G +P G GKY  SDG+ Y G+W  G   G G++ W+SGA Y+
Sbjct  49    RNRELSLPNGESYDGTLLGNVPEGSGKYLWSDGSVYVGEWRRGMRHGNGKMRWASGACYE  108

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT++ ++   YKG W++N++HG+G + Y N DV++G W +G+ +G G+Y
Sbjct  109   GEFSGGYMHGTGTYTDANNLTYKGRWRLNLKHGLGYQVYPNGDVFEGSWIQGLGEGPGKY  168

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW NGN+Y G  K G MSG+G + W  GD ++G W++G+ HG G Y + DG  Y GTW+ 
Sbjct  169   TWGNGNIYLGDMKGGKMSGKGTLTWITGDSYEGSWLNGMMHGFGVYTWRDGGSYVGTWTR  228

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEIRRM-----LSHDSSISKKDAVKPKVKR------  1284
             GLKDG+G+ Y  G  +   +      +R+      L   S ++   +V  +  R      
Sbjct  229   GLKDGKGSFYSAGTRVPAVQEFYLNALRKRGVLPDLRRQSQVAAASSVNMESLRVGGGGN  288

Query  1285  SISE-KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLG  1461
              +S+  +++     +GR     VS+    +L  S  +V+  D S +       G  E   
Sbjct  289   KLSKGSLINLEQSRNGR-----VSLERRWSLEVSIEKVIGHDYSDL---ERGSGTEEYSA  340

Query  1462  NITVAYEREYMQGVLIRERI---KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYY  1632
             N  +  EREYMQGVLI ER+         S ++ ++ K   KE +K   + + KG +SY 
Sbjct  341   NRPI-LEREYMQGVLISERVVVDNRFSPTSKRAKRKHKRLFKEAKKPGEV-VIKGHRSYD  398

Query  1633  LMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDY  1812
             LMLNLQLGIRY+VGKITPI  REVR +DFG +A   M FPR GS +TPPH S DF WKDY
Sbjct  399   LMLNLQLGIRYTVGKITPIQRREVRTADFGPRASFWMSFPRAGSAMTPPHHSEDFKWKDY  458

Query  1813  CPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSEL  1992
             CP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+
Sbjct  459   CPMVFRNLREMFKMDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEV  518

Query  1993  KVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDL  2172
             KVLL+MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF+T+L +H R+DL
Sbjct  519   KVLLRMLPYYHHHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFFTDLRIHRRFDL  578

Query  2173  KGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSL  2352
             KGS LGR  DK +I+E T LKDLDL Y   ++    E L+KQL +DS+FL  Q+I+DYSL
Sbjct  579   KGSKLGRSADKVEIDENTILKDLDLNYSFFLEPSWREGLLKQLEIDSKFLVEQNIMDYSL  638

Query  2353  LLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--ILPRSLTLVTHEPSIVSTAPG  2526
             LLG+H RAPEHL   L    S+       V+ D  I   +L     LV       +   G
Sbjct  639   LLGVHHRAPEHLRTQLVRSRSITADALESVAEDDTIEDDMLSYHQGLVLVPGGSDNVVTG  698

Query  2527  PHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVY  2706
             PHIRG  LRA++VGD EVDLLLPGT RL++Q GVNMPA+A      +E D     L +  
Sbjct  699   PHIRGSRLRASAVGDEEVDLLLPGTARLQIQQGVNMPARAELIPGTEEKD--RQILHDCC  756

Query  2707  DVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             DVVLYLGIIDILQ YNM KK+EH YKSL FD  SIS ++P  YS+RF+ F+E+VF
Sbjct  757   DVVLYLGIIDILQEYNMTKKIEHAYKSLHFDSKSISAVDPTYYSQRFLDFIEKVF  811



>ref|XP_009146887.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Brassica 
rapa]
Length=817

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/776 (49%), Positives = 497/776 (64%), Gaps = 30/776 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   PNG+ Y G   G +P G GKY  SDG+ Y G+W  G   G G++ W+SGA Y+
Sbjct  49    RNRELSLPNGESYDGTLLGNVPEGSGKYAWSDGSVYVGEWRRGMRHGNGKMRWASGACYE  108

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT++ ++   YKG W++N++HG+G + Y N DV++G W +G+ +G G+Y
Sbjct  109   GEFSGGYMHGTGTYTDANNLTYKGRWRLNLKHGLGYQVYPNGDVFEGSWIQGLGEGPGKY  168

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW NGN+Y G  K G MSG+G + W  GD ++G W++G+ HG G Y + DG  Y GTW+ 
Sbjct  169   TWGNGNVYLGDMKGGKMSGKGTLTWITGDSYEGSWLNGMMHGFGVYTWRDGGCYVGTWTR  228

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEIRRM-----LSHDSSISKKDAVKPKVKR------  1284
             GLKDG+G+ Y  G  +   +      +R+      L   S ++   +V  +  R      
Sbjct  229   GLKDGKGSFYSAGTRVPAVQEFYLNALRKRGVLPDLRRQSQVAAASSVNMESLRVGGGGN  288

Query  1285  -SISE-KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQL  1458
               +S+  +++     +GR     VS+    +L  S  +V+  D S +       G  E  
Sbjct  289   NKLSKGSLINLEQSRNGR-----VSLERRWSLEVSIEKVIGHDYSDL---ERGSGTEEYS  340

Query  1459  GNITVAYEREYMQGVLIRERI---KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
              N  +  EREYMQGVLI ER+         S ++ ++ K   KE +K   + + KG +SY
Sbjct  341   ANRPI-LEREYMQGVLISERVVVDNRFSPTSKRAKRKHKRLFKEAKKPGEV-VIKGHRSY  398

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
              LMLNLQLGIRY+VGKITPI  REVR +DFG +A   M FPR GS +TPPH S DF WKD
Sbjct  399   DLMLNLQLGIRYTVGKITPIQRREVRTADFGPRASFWMSFPRAGSAMTPPHHSEDFKWKD  458

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE
Sbjct  459   YCPMVFRNLREMFKMDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSE  518

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             +KVLL+MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF+T+L +H R+D
Sbjct  519   VKVLLRMLPYYHHHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFFTDLRIHRRFD  578

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGS LGR  DK +I+E T LKDLDL Y   ++    E L+KQL +DS+FL  Q+I+DYS
Sbjct  579   LKGSKLGRSADKVEIDENTILKDLDLNYSFFLEPSWREGLLKQLEIDSKFLVEQNIMDYS  638

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--ILPRSLTLVTHEPSIVSTAP  2523
             LLLG+H RAPEHL   L    S+       V+ D  I   +L     LV       +   
Sbjct  639   LLLGVHHRAPEHLRTQLVRSRSITADALESVAEDDTIEDDMLSYHQGLVLVPGGSDNVVT  698

Query  2524  GPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEV  2703
             GPHIRG  LRA++VGD EVDLLLPGT RL++Q GVNMPA+A      +E D     L + 
Sbjct  699   GPHIRGSRLRASAVGDEEVDLLLPGTARLQIQQGVNMPARAELIPGTEEKD--RQILHDC  756

Query  2704  YDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
              DVVLYLGIIDILQ YNM KK+EH YKSL FD  SIS ++P  YS+RF+ F+E+VF
Sbjct  757   CDVVLYLGIIDILQEYNMTKKIEHAYKSLHFDSKSISAVDPTYYSQRFLDFIEKVF  812



>ref|XP_001781776.1| predicted protein [Physcomitrella patens]
 gb|EDQ53424.1| predicted protein [Physcomitrella patens]
Length=775

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/782 (49%), Positives = 509/782 (65%), Gaps = 36/782 (5%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK   NGD Y+G ++G LP G GKY  +DG  Y+G+W  GK +GKG+I W SGATY+G+ 
Sbjct  2     EKELSNGDFYVGTWQGSLPEGTGKYLWADGCMYEGEWGRGKKSGKGKISWPSGATYEGEF  61

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+HG GT+  + G+ YKG W MN++HG GRK Y N DVY+G WK+GV++G G+YTW+
Sbjct  62    IGGYMHGVGTYMGTGGTTYKGQWSMNVKHGQGRKRYANGDVYEGTWKQGVQEGVGKYTWA  121

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             +GN Y G W+ G M G GV+ W +GD FDG W+DGL HG G Y +ADGS Y GTWS GLK
Sbjct  122   SGNEYNGEWRGGTMCGNGVLTWTSGDKFDGQWLDGLEHGRGVYVWADGSSYNGTWSRGLK  181

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARD-  1323
             DG+G  YP G    +   +    +   + H   +      + +   S         ++  
Sbjct  182   DGKGVFYPAGTRDLQAVRNNDGGVASHVYHSGELRPLRWSRSRSISSERIPYGGELSKGG  241

Query  1324  --SGRISRR---------AVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNIT  1470
               S  I RR            + G+ ++   +T+ + E     +     +        + 
Sbjct  242   DFSNSIQRRRSMDGPLERGFGLEGNGSVR--TTDTILEGVERGVERPLLETPGALPPTVV  299

Query  1471  VAYEREYMQGVLIRERIK-SVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNL  1647
             V   REY+QGVL+ E +K S D + H+  + R+  AK++++     +FKG +SY LMLNL
Sbjct  300   V---REYVQGVLMSELVKDSADAVGHKKRRPRR-SAKDIKR-PGETIFKGHRSYDLMLNL  354

Query  1648  QLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVF  1827
             QLGIRY+VGKITP P  E+  +DFG +A I M FP+ G+ LTP H S DF WKDYCP+VF
Sbjct  355   QLGIRYTVGKITPEPRHEIGPNDFGPRASIHMNFPKSGTPLTPTHNSSDFKWKDYCPMVF  414

Query  1828  RNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLK  2007
             R+LR +FK++AADYM+S+C DD LREL+SPGKSGS+FYLS DDRF+IKT+KK+E+KVLL 
Sbjct  415   RHLREMFKIDAADYMLSLCGDDALRELVSPGKSGSVFYLSHDDRFIIKTMKKAEVKVLLN  474

Query  2008  MLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSL  2187
             ML +Y+ HVK ++NTLITKFFG++RI     +KVRFVVMGNMF TEL +H R+DLKGSS 
Sbjct  475   MLAAYHLHVKTYDNTLITKFFGLHRIKPYGGQKVRFVVMGNMFCTELRIHRRFDLKGSSQ  534

Query  2188  GRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLH  2367
             GR  DK +I+E TTLKDLDL YE R+D    ++L++QL  D +FLE++ I+DYS+LLGLH
Sbjct  535   GRSADKVEIDETTTLKDLDLDYEFRLDPSWRDSLLRQLEYDCKFLEARGIMDYSMLLGLH  594

Query  2368  FRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILP----------RSLTLVTHEPSIVST  2517
             FRAP++   L   P S   P   L      +   P          R + LV  + +  S+
Sbjct  595   FRAPQYRAPLSPGPSS--TPDEVLNIVVTALFCEPVGGDEEWASNRGIVLVARDAAHGSS  652

Query  2518  A-PGPHIRGKTLRANSVGDREVDLLLPGTG-RLRVQLGVNMPAQANR-KVKQDETDPSEV  2688
               PG HIRG  LRA+  GD EVDLLLPGT  RLR+QLGVNMPA+A R   K DE+  SE 
Sbjct  653   GTPGIHIRGSPLRASVAGDPEVDLLLPGTARRLRIQLGVNMPARAERVHKKDDESKTSEG  712

Query  2689  ELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
             + F E +DVVLY GIIDILQ Y++ K++EH YK+ +FD +SIS +EPKLYSKRF  F+ +
Sbjct  713   QFFGESHDVVLYFGIIDILQNYSLSKRIEHAYKACQFDSISISAVEPKLYSKRFQEFIRQ  772

Query  2866  VF  2871
             +F
Sbjct  773   IF  774


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 59/116 (51%), Gaps = 23/116 (20%)
 Frame = +1

Query  880   GRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGF  1059
             G KE  N D Y G W+  + +G G+Y W++G MY G W +G  SG+G + W +G  ++G 
Sbjct  1     GEKELSNGDFYVGTWQGSLPEGTGKYLWADGCMYEGEWGRGKKSGKGKISWPSGATYEGE  60

Query  1060  WVDG-----------------------LRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
             ++ G                       ++HG G  R+A+G  Y GTW  G+++G G
Sbjct  61    FIGGYMHGVGTYMGTGGTTYKGQWSMNVKHGQGRKRYANGDVYEGTWKQGVQEGVG  116



>ref|XP_006493547.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X4 [Citrus sinensis]
Length=728

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/735 (50%), Positives = 497/735 (68%), Gaps = 37/735 (5%)
 Frame = +1

Query  736   GKGQIIWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYD  915
             G G+I W SG  Y+G+   GY+HG GT+  SDG  YKG W++N++HG+G + Y N DV++
Sbjct  4     GNGKIRWPSGTVYEGEFSGGYIHGTGTYIGSDGLTYKGRWRLNLKHGLGYQVYPNGDVFE  63

Query  916   GCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCY  1095
             G W +G  +G G+YTW+N ++Y G  K G MSG+G + W NGD F+G W++G+ HG G Y
Sbjct  64    GSWIQGAAEGPGKYTWANRDVYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMMHGFGVY  123

Query  1096  RFADGSYYFGTWSNGLKDGRGTLYPVGCAL--------DKCKIDG-----HKEIRRMLSH  1236
              ++DG  Y GTWS GLKDG+GT YP G  L        +  +I G      ++      H
Sbjct  124   TWSDGGSYVGTWSRGLKDGKGTFYPNGIQLSVLQEPYLNALRIRGLLPDMRRQTHAHAHH  183

Query  1237  DSSISKKDAVKPK---VKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPED  1407
              SS+   +A  P     +R  ++KI      +  +  R  VS+    +L  S  +V+  D
Sbjct  184   ASSVEMANAKVPGNRGSRRISADKISKGNLINLEQSHRGNVSLERRWSLEVSFEKVIGHD  243

Query  1408  ASCMLSHTTCDGKAEQLG-NITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAK  1578
             +S  LS +  +G  +    N+    EREY+QGVLI E +   S    S +  +R++   K
Sbjct  244   SSLELSESISEGMEKASDKNVAPILEREYIQGVLISEFVLNNSFSQSSRREKRRQRKLVK  303

Query  1579  EVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRK  1758
             EV++     + KG +SY LML+LQLGIRY+VGKITP+  R+VR SDFG +A   M FP++
Sbjct  304   EVKR-PGETIIKGHRSYDLMLSLQLGIRYTVGKITPVQRRDVRASDFGPRASFWMNFPKE  362

Query  1759  GSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIF  1938
             GS+LTPPH+S DF WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGSIF
Sbjct  363   GSQLTPPHQSEDFKWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSIF  422

Query  1939  YLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFV  2118
             +LS DDRF+IKTL+KSE+KVLL+MLP+Y+ HV+ +ENTLITKFFG++RI     +K RFV
Sbjct  423   FLSQDDRFMIKTLRKSEVKVLLQMLPTYHDHVRSYENTLITKFFGLHRIKPSSGQKFRFV  482

Query  2119  VMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQ  2298
             VMGNMF TEL +H R+DLKGSSLGR TD  +I+E TTLKDLDL Y   ++    E L+KQ
Sbjct  483   VMGNMFCTELRIHRRFDLKGSSLGRSTDNIEIDENTTLKDLDLNYCFYLEPSWREDLLKQ  542

Query  2299  LSLDSQFLESQHIIDYSLLLGLHFRAPEH---LTALLEPPDSLFKPKSTLVSSDGGISIL  2469
             + +DS+FLE+Q I+DYSLLLG+H+RAP+H   LT + E    +   +   +S+  G+ ++
Sbjct  543   IEIDSKFLEAQQIMDYSLLLGVHYRAPQHLRSLTTIREDGLGIVAEEEDEISNYQGLVLV  602

Query  2470  PRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQAN  2649
             PR     T + S+++   GPHIRG  LRA+S GD EVDLLLPGT RL++QLGVNMPA+A 
Sbjct  603   PRG----TDDSSVIA---GPHIRGSRLRASSAGDEEVDLLLPGTARLQIQLGVNMPARAE  655

Query  2650  RKVKQDETDPSEVELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEP  2826
             +   + E      +LF + YDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS ++P
Sbjct  656   QIPGKQE------DLFHQSYDVVLYLGIIDILQEYNMSKKIEHAYKSLQFDSISISAVDP  709

Query  2827  KLYSKRFISFLERVF  2871
               YS RF+ F+E+VF
Sbjct  710   TFYSHRFLEFIEKVF  724


 Score = 80.5 bits (197),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            +V+PNGDV+ G +      G GKYT ++   Y G+ + GKM+GKG + W++G +++G   
Sbjct  54   QVYPNGDVFEGSWIQGAAEGPGKYTWANRDVYLGNMKGGKMSGKGTLTWTNGDSFEGSWL  113

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             G +HGFG ++ SDG  Y G W   ++ G G
Sbjct  114  NGMMHGFGVYTWSDGGSYVGTWSRGLKDGKG  144



>emb|CDY41570.1| BnaC05g43070D [Brassica napus]
Length=818

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/773 (49%), Positives = 497/773 (64%), Gaps = 30/773 (4%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             E   PNG+ Y G   G +P G GKY  SDG+ YDG+W  G   G G++ W+SGA Y+G+ 
Sbjct  53    ELSLPNGESYDGTLLGNVPEGSGKYAWSDGSVYDGEWRRGMRHGNGKMRWASGACYEGEF  112

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+HG GT++ ++   YKG W++N++HG+G + Y N DV +G W +G  +G G+YTW 
Sbjct  113   SGGYMHGTGTYTDANSLTYKGRWRLNLKHGLGYQVYPNGDVLEGSWIQGWGEGPGKYTWG  172

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN+Y G  K G MSG+G + W  GD ++G W++G+ HG G Y + DG  Y GTW+ GLK
Sbjct  173   NGNIYLGDMKGGKMSGKGTLTWITGDSYEGSWLNGMMHGFGVYTWRDGGCYVGTWTRGLK  232

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRM-----LSHDSSISKKDAVKPKVKR-------SI  1290
             DG+G+ Y  G  +   +      +R+      L   S ++   +V  +  R        +
Sbjct  233   DGKGSFYSAGTRVPAVQEFYLNALRKRGVLPDLRRQSQVAAASSVNMESLRVGGGGNNKL  292

Query  1291  SE-KIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNI  1467
             S+  +++     +GR     VS+    +L  S  +V+  D S +   ++ +   E   N 
Sbjct  293   SKGSLINLEQSRNGR-----VSLERRWSLEVSIEKVIGHDYSDLDRGSSTE---EYSANR  344

Query  1468  TVAYEREYMQGVLIRERI---KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
              +  EREYMQGVLI ER+         S ++ ++ K   KE +K   + + KG +SY LM
Sbjct  345   PI-LEREYMQGVLISERVVVDNRFSPTSKRAKRKNKRLFKEAKKPGEV-VIKGHRSYDLM  402

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             L+LQLGIRY+VGKITPI  REVR +DFG +A   M FPR GS +TPPH S DF WKDYCP
Sbjct  403   LSLQLGIRYTVGKITPIQRREVRTADFGPRASFWMSFPRAGSAMTPPHHSEDFKWKDYCP  462

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+KV
Sbjct  463   MVFRNLREMFKMDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVKV  522

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKG  2178
             LL+MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF+T+L +H R+DLKG
Sbjct  523   LLRMLPYYHHHVKTYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFFTDLRIHRRFDLKG  582

Query  2179  SSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
             S LGR  DK +I+E T LKDLDL Y   ++    E L+KQL +DS+FL  Q+I+DYSLLL
Sbjct  583   SRLGRSADKVEIDENTILKDLDLNYSFFLEPSWREGLLKQLEIDSKFLVEQNIMDYSLLL  642

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS--ILPRSLTLVTHEPSIVSTAPGPH  2532
             G+H RAPEHL   L    S+       V+ D  I   +L     LV       +   GPH
Sbjct  643   GVHHRAPEHLRTQLVRSRSITADALESVAEDDTIEDDMLSYHQGLVLVPGGSDNVVTGPH  702

Query  2533  IRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDV  2712
             IRG  LRA++VGD EVDLLLPGT RL++Q GVNMPA+A      +E D     L +  DV
Sbjct  703   IRGSRLRASAVGDEEVDLLLPGTARLQIQQGVNMPARAELIPGTEEKD--RQILHDCCDV  760

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VLYLGIIDILQ YNM KK+EH YKSL FD  SIS ++P  YS+RF+ F+E+VF
Sbjct  761   VLYLGIIDILQEYNMTKKIEHAYKSLHFDSKSISAVDPTYYSQRFLDFIEKVF  813



>ref|XP_003560277.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Brachypodium 
distachyon]
Length=802

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/782 (48%), Positives = 498/782 (64%), Gaps = 49/782 (6%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTT-YDGDWEEGKMTGKGQIIWSSGATY  774
             R  E    NGD+Y G   G +P G G+Y  SD    Y+G+W  G   G+G+ +W SGA Y
Sbjct  42    RAGELKLSNGDIYSGALSGEIPEGSGRYIWSDSCCMYEGEWRRGMRHGQGRTLWPSGAIY  101

Query  775   DGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGR  954
              G+   GY+ G GT+  S  S YKG WK+N +HG+G + + N D++ G W +G  +GHGR
Sbjct  102   QGEYSGGYMDGEGTYVGS--SSYKGRWKLNRKHGLGLQTFPNGDIFQGSWVQGQMEGHGR  159

Query  955   YTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWS  1134
             YTW+NGN Y G  + G MSG+G++ W NGD F G W+DG+ HG G Y + D  YY GTW+
Sbjct  160   YTWANGNTYVGTMRNGLMSGKGILTWNNGDSFQGSWLDGMMHGYGLYTWEDSGYYLGTWT  219

Query  1135  NGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSIS--KKDAVKPKVK---RSISEK  1299
              G KDG+GT YP  C             R   +H   I+  +K  V P +    RS S  
Sbjct  220   RGFKDGKGTFYPKCC-------------RVPAAHQLYINDLRKRGVLPDISNILRSSSFD  266

Query  1300  IVDRFARDS-GRISRRAVSV----AGDAALH------CSSTEVLPEDASCMLSHTTCDGK  1446
             + +   R+S G +SRR +S     +  A+L        +  +++  +AS      +C+  
Sbjct  267   MTEGTNRESAGALSRRNLSFEQPPSKKASLQRRWSIGVAIEKLIGHEASASSEIQSCENM  326

Query  1447  AEQLGNITVAYEREYMQGVLIRERIKSVDGL-SHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
             A+   N  +  EREY QGVLI E + +   L S ++ +RR+       K     + KG +
Sbjct  327   ADS--NFPI-LEREYAQGVLISEVVLNKSFLDSSKNVKRRQRKIVRDIKRPGETIIKGHR  383

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITPI  REVR SD+G +A   M FP++GSRLTP HR+IDF W
Sbjct  384   SYDLMLSLQLGIRYTVGKITPIQRREVRASDYGPRASFWMNFPKEGSRLTPSHRAIDFKW  443

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR +FK++ ADYM+SIC  D LREL SPGKSGSIF+LS DDRF+IKTL+K
Sbjct  444   KDYCPMVFRNLREMFKIDTADYMISICGSDALRELSSPGKSGSIFFLSQDDRFMIKTLRK  503

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE++VLL+MLP YY+HV  +ENTL+TKFFG++R+     +K RFVVMGNMF TEL +H R
Sbjct  504   SEVQVLLRMLPEYYRHVHTYENTLVTKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHRR  563

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             +DLKGSSLGR TDK +I+E TTLKDLDL Y   ++    +TL+KQ+  DS+FL +Q I+D
Sbjct  564   FDLKGSSLGRSTDKIEIDENTTLKDLDLNYSFYLEHSWRDTLLKQIETDSEFLRNQDIMD  623

Query  2344  YSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS-----ILPRSLTLVTH-EPS  2505
             YSLLLG H+R  ++L       +++   + T++S    +           L LV      
Sbjct  624   YSLLLGFHYRGRQNLERGASCHENIVPDRLTVLSEQDAVEEDSAYNYREGLVLVQRGSDQ  683

Query  2506  IVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSE  2685
                 A GPHIRG  LR++S    EVDLLLPGT RL++QLGVNMPA+A       E +  E
Sbjct  684   KGKVAVGPHIRGSRLRSSSASFEEVDLLLPGTARLQIQLGVNMPARA-------EKEDGE  736

Query  2686  VELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
                 +VYDVVLY+GIIDILQ YNMRKK+EH YKS+++DP+SISV+EPK Y +RF+ F+  
Sbjct  737   KSFRQVYDVVLYIGIIDILQEYNMRKKIEHAYKSIKYDPLSISVVEPKFYCERFLRFIHT  796

Query  2866  VF  2871
             +F
Sbjct  797   IF  798



>ref|XP_009611134.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Nicotiana 
tomentosiformis]
 ref|XP_009611135.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Nicotiana 
tomentosiformis]
Length=821

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/797 (47%), Positives = 503/797 (63%), Gaps = 36/797 (5%)
 Frame = +1

Query  547   NSYGMGI*CVIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEG  726
             N +  G  C      + R  +   PNG+ Y G   G +P G GKY  SDG  Y+G+W  G
Sbjct  36    NKWTNGEVCHTSGSTSFRVRDIFLPNGESYSGSLLGNIPEGSGKYIWSDGCRYEGEWRHG  95

Query  727   KMTGKGQIIWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSD  906
                G G++ W + A YDG    GY+HG G + + D   Y+G W++N++HG+G + Y N D
Sbjct  96    MRHGHGKLEWPTSAVYDGHFSGGYMHGEGAYIAPDKVTYRGRWRLNLKHGLGHQVYPNGD  155

Query  907   VYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGS  1086
             +++G W +G  +G G+YTW+NGN+Y+G  K GN SG+G + W +GD ++G W++G  HG 
Sbjct  156   IFEGSWIQGTPEGPGKYTWANGNVYSGNMKGGNFSGKGTLTWMSGDSYEGSWLNGTMHGV  215

Query  1087  GCYRFADGSYYFGTWSNGLKDGRGTLYPVGC-----------ALDKCKIDGHKEIRRMLS  1233
             G Y ++DG  Y GTW++G+KDG+GT YP G            AL K  +      ++ +S
Sbjct  216   GAYTWSDGGCYIGTWTHGIKDGKGTFYPSGSRLTAGQELYLNALRKRGLLPDLRKQKRVS  275

Query  1234  HDSSISKKDAVKPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCS-STEVLPEDA  1410
             H S  S  D    K+  + S    +R  +  G I +   S   +  L    S EV  E  
Sbjct  276   HISHASSVDIGNVKLSGNHS---YNRLPK--GNILKHEQSKPSNVTLERRWSLEVAIEKV  330

Query  1411  SCMLSHTTCDGKAEQLGN--ITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEV  1584
                      D     +GN   T   EREYMQGVLI E + + D  S QS +  K   +++
Sbjct  331   ------IGNDIDGVDIGNDMNTPILEREYMQGVLISEVVLN-DRFSPQSRRAAKRRQRKL  383

Query  1585  RKGS---CMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPR  1755
              + S      + KG + Y +ML+LQLGIRYSVGKITP+  REV  SDFG  +   MYFP+
Sbjct  384   ARESKRPGEAIIKGHRRYDVMLSLQLGIRYSVGKITPVQRREVGASDFGACSSFWMYFPK  443

Query  1756  KGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSI  1935
             +GS+LTP H+S DF WKDYCP+VFRNLR +FK++ ADYMMSIC +D LREL SPGKSGS+
Sbjct  444   EGSQLTPSHQSEDFKWKDYCPVVFRNLREMFKIDTADYMMSICGNDALRELSSPGKSGSV  503

Query  1936  FYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRF  2115
             F+LS DDRF+IKTL+KSE+KVLL+MLP Y++HVK +ENTLITKFFG++RI     +K  F
Sbjct  504   FFLSQDDRFMIKTLRKSEVKVLLRMLPDYHRHVKAYENTLITKFFGLHRIKPSSGQKFCF  563

Query  2116  VVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIK  2295
             VVMGNMF TEL +H R+DLKGSSLGR  DK +I+E T LKDLDL Y   ++    E L+K
Sbjct  564   VVMGNMFCTELRIHRRFDLKGSSLGRSADKVEIDENTILKDLDLNYCFYLEPSWQEALLK  623

Query  2296  QLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SIL  2469
             Q+ +DS+FLE QHI+DYSLLLG+H+RAP+HL + +             V+ D  +   I 
Sbjct  624   QIEIDSKFLEEQHIMDYSLLLGVHYRAPQHLRSPISCSGRTTAEGLGNVAEDESLEDEIS  683

Query  2470  PRSLTLVTHEPSIVSTAPGPHIRGKTLRANSV-GDREVDLLLPGTGRLRVQLGVNMPAQA  2646
             P+ L LV       +   GPH+RG  LRA S  GD EVDLLLPGT RL++QLGVNMPA+A
Sbjct  684   PQGLVLVPRGADDNNVVVGPHVRGSRLRAASATGDEEVDLLLPGTARLQIQLGVNMPARA  743

Query  2647  NRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEP  2826
                 ++DE     +   +VYDVVLYLGIIDILQ YN+ KK+E+ YKS++FD MSIS +EP
Sbjct  744   EYMPRKDEA----LVFLKVYDVVLYLGIIDILQEYNLSKKIEYAYKSIQFDSMSISAVEP  799

Query  2827  KLYSKRFISFLERVFRA  2877
               YS+RF+ F+ +VF A
Sbjct  800   TFYSQRFLQFIRKVFPA  816



>ref|XP_002993971.1| hypothetical protein SELMODRAFT_449262 [Selaginella moellendorffii]
 gb|EFJ04955.1| hypothetical protein SELMODRAFT_449262 [Selaginella moellendorffii]
Length=821

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/771 (47%), Positives = 505/771 (65%), Gaps = 30/771 (4%)
 Frame = +1

Query  601   TDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDG  780
             +DEK  PNGD Y+G   G LP G+GKY  ++G+ Y+G WE+GK +G+G+ +W SGA Y+G
Sbjct  60    SDEKALPNGDRYVGALVGNLPEGRGKYVWANGSWYEGQWEKGKKSGRGKFVWPSGAFYEG  119

Query  781   DCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYT  960
             +   G++ G G F + +G+VYKG+W MN++HG+GR  Y N D Y+G WK G++DG G+Y 
Sbjct  120   EFAGGFMQGLGNFRAPNGAVYKGNWSMNLKHGLGRLRYANGDKYEGAWKHGLQDGFGKYV  179

Query  961   WSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNG  1140
             W+N N+Y G WK G M+G+GV++W  GD F+G W++G+ HG G Y +ADGS + GTWS G
Sbjct  180   WTNKNVYVGDWKAGVMTGKGVLRWGMGDAFNGEWLNGMEHGRGVYYWADGSIFVGTWSRG  239

Query  1141  LKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFAR  1320
             LKDG+G  YP G          +  + ++  + ++   KD       ++   ++  RF  
Sbjct  240   LKDGKGVFYPAGTLPLDMSTRENLMLNKVEEYLATGIAKDWTSVGSWKNGRRELDSRFIT  299

Query  1321  DSGRIS-----RRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYER  1485
              SG  +     ++ V +    +L      VL  ++  +      + + + +  +    ER
Sbjct  300   SSGSGNLDQQIKKNVWLGRRWSLEGPLERVLGLESFFIGGEAILEEEKDDVPEVAPILER  359

Query  1486  EYMQGVLIRERIKSVDG---LSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLG  1656
             EY QGVLI E +K   G         +RR+ P +  R G    +FKG +SY LML LQ+G
Sbjct  360   EYAQGVLINEIVKQPIGSVLSKSSRRKRRRQPREPKRPGET--IFKGHRSYDLMLTLQIG  417

Query  1657  IRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNL  1836
             IRY+VGK+TP P   +   DFG +A ++M FP+ GS++TP HR++DF WKDYCP VF+ L
Sbjct  418   IRYTVGKVTPEPCNNIGPLDFGSKASVRMKFPKMGSQVTPCHRTVDFAWKDYCPRVFKRL  477

Query  1837  RRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLP  2016
             R +FK++AADYM+SIC +  LREL SPGKSGS+F+LS DDRF+IKT++KSE+KVLL+ML 
Sbjct  478   REMFKIDAADYMLSICGNSALRELPSPGKSGSVFFLSNDDRFMIKTMRKSEVKVLLRMLR  537

Query  2017  SYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRF  2196
             SYY HV  ++NTLITKFFG++R+  +  +KVRFVVMGNMF T+L +H RYDLKGS  GR 
Sbjct  538   SYYNHVSSYDNTLITKFFGLHRVKPQGGQKVRFVVMGNMFCTDLRIHRRYDLKGSLQGRC  597

Query  2197  TDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRA  2376
             T +  I+E TTLKDLDL Y   ++    + LIKQ++ D +FLESQHI+DYSLLLGLHFRA
Sbjct  598   TGEADIDENTTLKDLDLDYVFHLEPSWRDALIKQIASDCKFLESQHIMDYSLLLGLHFRA  657

Query  2377  PEHLTALLEPPDSLFKPKSTLVSSDGGISILP-RSLTLVTHEPSIVSTAPGPHIRGKTLR  2553
             P             ++P    +  DG     P RSL LV  +    + +   HIRGK L 
Sbjct  658   PH-----------FYQPSKGTI-PDGEEEWTPARSLVLVPRDQGKRTMS--SHIRGKPLT  703

Query  2554  ANSVG----DREVDLLLPGTGRLRVQLGVNMPAQANRKVK-QDETDPSEVELFEVYDVVL  2718
             A  +     + EVDLLLPGT RL++QLGVNMPA+A+RK + ++E +  E  L EV+DVVL
Sbjct  704   AAGIAEADDNAEVDLLLPGTARLQIQLGVNMPARADRKPRKKEENNDEEESLDEVHDVVL  763

Query  2719  YLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             YLG+IDILQ Y++ K++EH YKSL+FDP+SIS IEP  YS+RF  F+ ++F
Sbjct  764   YLGVIDILQEYDVGKRIEHAYKSLQFDPVSISAIEPASYSQRFQDFVCKIF  814



>ref|XP_006428472.1| hypothetical protein CICLE_v10011083mg [Citrus clementina]
 gb|ESR41712.1| hypothetical protein CICLE_v10011083mg [Citrus clementina]
Length=730

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/737 (50%), Positives = 497/737 (67%), Gaps = 39/737 (5%)
 Frame = +1

Query  736   GKGQIIWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYD  915
             G G+I W SG  Y+G+   GY+HG GT+  SDG  YKG W++N++HG+G + Y N DV++
Sbjct  4     GNGKIRWPSGTVYEGEFSGGYIHGTGTYIGSDGLTYKGRWRLNLKHGLGYQVYPNGDVFE  63

Query  916   GCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCY  1095
             G W +G  +G G+YTW+N ++Y G  K G MSG+G + W NGD F+G W++G+ HG G Y
Sbjct  64    GSWIQGAAEGPGKYTWANRDVYLGNMKGGKMSGKGTLTWTNGDSFEGSWLNGMMHGFGVY  123

Query  1096  RFADGSYYFGTWSNGLKDGRGTLYPVGCAL--------DKCKIDG-----HKEIRRMLSH  1236
              ++DG  Y GTWS GLKDG+GT YP G  L        +  +I G      ++      H
Sbjct  124   TWSDGGSYVGTWSRGLKDGKGTFYPNGIQLSVLQEPYLNALRIRGLLPDMRRQTHAHAHH  183

Query  1237  DSSISKKDAVKPK---VKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPED  1407
              SS+   +A  P     +R  ++KI      +  +  R  VS+    +L  S  +V+  D
Sbjct  184   ASSVEMANAKVPGNRGSRRISADKISKGNLINLEQSHRGNVSLERRWSLEVSFEKVIGHD  243

Query  1408  ASCMLSHTTCDGKAEQLG-NITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAK  1578
             +S  LS +  +G  +    N+    EREY+QGVLI E +   S    S +  +R++   K
Sbjct  244   SSLELSESISEGMEKASDKNVAPILEREYIQGVLISEFVLNNSFSQSSRREKRRQRKLVK  303

Query  1579  EVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRK  1758
             EV++     + KG +SY LML+LQLGIRY+VGKITP+  R+VR SDFG +A   M FP++
Sbjct  304   EVKR-PGETIIKGHRSYDLMLSLQLGIRYTVGKITPVQRRDVRASDFGPRASFWMNFPKE  362

Query  1759  GSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIF  1938
             GS+LTPPH+S DF WKDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGSIF
Sbjct  363   GSQLTPPHQSEDFKWKDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSIF  422

Query  1939  YLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFV  2118
             +LS DDRF+IKTL+KSE+KVLL+MLP+Y+ HV+ +ENTLITKFFG++RI     +K RFV
Sbjct  423   FLSQDDRFMIKTLRKSEVKVLLQMLPTYHDHVRSYENTLITKFFGLHRIKPSSGQKFRFV  482

Query  2119  VMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQ  2298
             VMGNMF TEL +H R+DLKGSSLGR TD  +I+E TTLKDLDL Y   ++    E L+KQ
Sbjct  483   VMGNMFCTELRIHRRFDLKGSSLGRSTDNIEIDENTTLKDLDLNYCFYLEPSWREDLLKQ  542

Query  2299  LSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLF-----KPKSTLVSSDGGIS  2463
             + +DS+FLE+Q I+DYSLLLG+H+RAP+HL +L    +        + K   +S+  G+ 
Sbjct  543   IEIDSKFLEAQQIMDYSLLLGVHYRAPQHLRSLTTIREDGLGIVAEEGKQDEISNYQGLV  602

Query  2464  ILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQ  2643
             ++PR     T + S+++   GPHIRG  LRA+S GD EVDLLLPGT RL++QLGVNMPA+
Sbjct  603   LVPRG----TDDSSVIA---GPHIRGSRLRASSAGDEEVDLLLPGTARLQIQLGVNMPAR  655

Query  2644  ANRKVKQDETDPSEVELF-EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVI  2820
             A +   + E      +LF + YDVVLYLGIIDILQ YNM KK+EH YKSL+FD +SIS +
Sbjct  656   AEQIPGKQE------DLFHQSYDVVLYLGIIDILQEYNMSKKIEHAYKSLQFDSISISAV  709

Query  2821  EPKLYSKRFISFLERVF  2871
             +P  YS RF+ F+E+VF
Sbjct  710   DPTFYSHRFLEFIEKVF  726


 Score = 80.5 bits (197),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            +V+PNGDV+ G +      G GKYT ++   Y G+ + GKM+GKG + W++G +++G   
Sbjct  54   QVYPNGDVFEGSWIQGAAEGPGKYTWANRDVYLGNMKGGKMSGKGTLTWTNGDSFEGSWL  113

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             G +HGFG ++ SDG  Y G W   ++ G G
Sbjct  114  NGMMHGFGVYTWSDGGSYVGTWSRGLKDGKG  144



>ref|XP_008664788.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Zea 
mays]
 ref|XP_008664789.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Zea 
mays]
 ref|XP_008664790.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Zea 
mays]
Length=823

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/785 (47%), Positives = 499/785 (64%), Gaps = 46/785 (6%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E  F NGDVY G   G  P G G+Y  SDG TYDG+W  G   G+G+  W SGATY+
Sbjct  54    RVGEIRFGNGDVYSGTLLGNTPEGSGQYRWSDGCTYDGEWTRGMRHGQGKTQWPSGATYE  113

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY++G GT++  D  +YKG WK+N +HG+G + Y N D ++G W +G   GHG+Y
Sbjct  114   GEYSRGYVYGEGTYTGPDKIIYKGRWKLNRKHGLGYQTYPNGDTFEGSWIQGEIVGHGKY  173

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N + Y G  K G MSG+G + W NGD ++G W+DG+ HG G Y + +  YY GTW+ 
Sbjct  174   TWANEDTYVGNMKSGRMSGKGTLTWKNGDSYEGNWIDGMMHGYGIYTWNECGYYIGTWTR  233

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKR-SISEKIVDRF  1314
             GLKDG+G  YP GC   +  ++    I+ +        +   V P ++R +   +I+   
Sbjct  234   GLKDGKGKFYPEGC---RVPVNDELYIKNL--------RNRGVLPDIRRQNHGSRILHSS  282

Query  1315  ARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCM-------------LSHTTCDGKA-E  1452
             + D G +       + D     + TE  P     +             + H + +    E
Sbjct  283   SVDMGNMKVGITRQSSDVLYKRNPTEQPPLKNVSLERRWSLEVAIEKFIGHESIESSGQE  342

Query  1453  QLGNITVA----YEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFK  1614
              L N++ +     EREYMQGVLI E +  +S    S ++ +R+K   ++ ++     + K
Sbjct  343   SLENLSDSRMPILEREYMQGVLISEVVLDRSFSDSSKKTKRRQKKMVRDTKR-PGEAIIK  401

Query  1615  GRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSID  1794
             G +SY LML+LQ+GIRY+VGKITPI  REV  SDFG  A   M F ++GSRLTP H + D
Sbjct  402   GHRSYDLMLSLQIGIRYTVGKITPIQKREVHASDFGPTASFWMNFSKEGSRLTPSHSAED  461

Query  1795  FYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKT  1974
             F WKDYCP+VFRNLR +FK++AADYM+SIC +  LR+L SPGKSGS+F+LS DDRF+IKT
Sbjct  462   FKWKDYCPMVFRNLREMFKIDAADYMISICGNSALRQLSSPGKSGSVFFLSQDDRFMIKT  521

Query  1975  LKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHM  2154
             L++SE++VLL+MLP YY HV+ +ENTLITKFFG++R+     +  RFVVMGNMF TEL +
Sbjct  522   LRESEVQVLLRMLPKYYDHVRTYENTLITKFFGLHRVKPSSGQMFRFVVMGNMFCTELRI  581

Query  2155  HHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQH  2334
             H R+DLKGSSLGR TDK +I+E TTLKDLDL Y   ++    E L+KQ+  DS FL +Q 
Sbjct  582   HRRFDLKGSSLGRSTDKIEIDENTTLKDLDLNYSFYLEPSWREALLKQIETDSDFLRTQR  641

Query  2335  IIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGIS----ILPRSLTLV--TH  2496
             I+DYSLLLG+H+RAP+HL        S+   + T+VS +          P  L LV  + 
Sbjct  642   IMDYSLLLGVHYRAPQHLRTRASYHRSMAADRLTVVSEEDAQEEDALSHPEGLVLVQSSG  701

Query  2497  EPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETD  2676
             E S+V    GPHIRG  LRA++ G  EVDLLLPGT RL++QLGVNMPA+A +  K+D + 
Sbjct  702   ENSVVV---GPHIRGSRLRASAAGFGEVDLLLPGTARLQIQLGVNMPARAEQISKEDGSK  758

Query  2677  PSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISF  2856
                    EVYDVVLYLGIIDILQ YN  KK+EH  KS+++D +SIS + P+ YS+RF+ F
Sbjct  759   ----SFREVYDVVLYLGIIDILQEYNKSKKIEHAVKSMQYDSVSISAVNPRFYSERFLKF  814

Query  2857  LERVF  2871
             ++ VF
Sbjct  815   IQTVF  819



>ref|XP_006349524.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Solanum 
tuberosum]
Length=825

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/780 (48%), Positives = 488/780 (63%), Gaps = 32/780 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  +   PNGD Y G   G +P G GKY  SDG+ Y+G+W  G   G G++ W +GA YD
Sbjct  53    RIRDLFLPNGDSYSGSLLGNIPEGSGKYVWSDGSRYEGEWRHGMRHGHGKLEWPTGAVYD  112

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG G   + D   Y+G W+ N++HG+G + Y N D + G W  G  +G G+Y
Sbjct  113   GEFSGGYMHGDGMHIAPDKVTYRGRWRFNLKHGLGYQVYPNGDFFRGSWIRGTPEGPGKY  172

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
              W NGN+Y G  K G +SG+G++ W NGD ++G W++G+ HG G Y + DG  Y GTW++
Sbjct  173   KWGNGNVYVGNMKGGTLSGKGILTWINGDSYEGSWLNGMMHGLGAYTWRDGGCYIGTWTH  232

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSISKKDAVKPKV  1278
             GLKDG+GT YP G  L   +              D  K+ R    + SS    + VK   
Sbjct  233   GLKDGKGTFYPSGSRLTAGQEFYLNALRKQGLLPDLRKQKRVSHIYHSSSVDTENVKVSG  292

Query  1279  KRSISEKIVDRFARDSGRISRRAVSVAGDAALHCS-STEVLPEDASCMLSHTTCDGKAEQ  1455
              +  S    DR ++  G IS    S   +  L    S EV  E     +     DG    
Sbjct  293   NKGSSRHSYDRLSK--GDISNLEQSHPTNVTLERRWSLEVAIEK----VIGNDIDGVDTG  346

Query  1456  LGNITVAYEREYMQGVLIRERI---KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKS  1626
                 T   EREYMQGVLI E +   +          ++RK  ++  R G    + KG + 
Sbjct  347   NDMNTPILEREYMQGVLISEVVLNDRFSPARRAAKRRQRKLASESKRPGEA--IIKGHRR  404

Query  1627  YYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWK  1806
             Y +ML+LQLGIRYS GK+TP   REV  SDFG  A  +MYFP+KGS+LTP H+S +F WK
Sbjct  405   YNVMLSLQLGIRYSAGKVTPGQRREVGASDFGACACSRMYFPKKGSQLTPSHQSENFKWK  464

Query  1807  DYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKS  1986
             DYCP+VFRNLR LFK++ ADYMMSIC  D LREL SPGKSGS+F+LS D RF+IKTL+KS
Sbjct  465   DYCPVVFRNLRELFKIDTADYMMSICGSDALRELSSPGKSGSVFFLSQDGRFMIKTLRKS  524

Query  1987  ELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRY  2166
             E+KVLL+MLP+Y++HVK +ENTLITKFFG++ I   R + +RFVVMGNMF TEL +H R+
Sbjct  525   EVKVLLQMLPNYHRHVKAYENTLITKFFGLHMIKPSRGQMLRFVVMGNMFCTELRIHRRF  584

Query  2167  DLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDY  2346
             DLKGSSLGR  +K +I+E T LKDLDL Y   ++    E L+KQ+ +DS+FLE QHI+DY
Sbjct  585   DLKGSSLGRSANKVEIDENTILKDLDLNYCFYLEPSWREALLKQVEIDSKFLEQQHIMDY  644

Query  2347  SLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SILPRSLTLVTHEPSIVSTA  2520
             SLLLG+H+RAP+HL + +            +V+ D      I P+ L L+          
Sbjct  645   SLLLGVHYRAPQHLRSPISCSGCTATEGLGIVADDESPEDEISPQGLVLIPRGADDNCVV  704

Query  2521  PGPHIRGKTLRANSV-GDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
              G H+RG+ LRA+S  GD+EVDLLLPGT RL++QLGVNMPA+A+    + +T        
Sbjct  705   VGSHVRGRRLRASSATGDKEVDLLLPGTARLQIQLGVNMPARADHIPGKGDTQ----MFL  760

Query  2698  EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVFRA  2877
             EVYDVVLY+GIIDILQ YN+RKK+EH YKS+ FD MSIS +EP  YS+RF+ F+ +VF A
Sbjct  761   EVYDVVLYVGIIDILQEYNLRKKIEHAYKSVLFDSMSISAVEPTFYSQRFLQFIRKVFPA  820



>gb|EPS72854.1| hypothetical protein M569_01903, partial [Genlisea aurea]
Length=600

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/589 (60%), Positives = 425/589 (72%), Gaps = 35/589 (6%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             MEN+ R +E +F NGDVYIG FKG++PHGKGKY  S+GT YDGDW EGKM+GKG+I+W S
Sbjct  39    MENDRRDEEMLFSNGDVYIGAFKGMIPHGKGKYFWSEGTIYDGDWLEGKMSGKGKILWPS  98

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
               TY+GD   GY +GFG  +  DG+VY+G WK N QHG+GRK Y NSD YDGCW+EGVR+
Sbjct  99    QCTYEGDFSAGYFNGFGILTRPDGAVYRGSWKTNSQHGIGRKMYPNSDSYDGCWREGVRE  158

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWF-NGDLFDGFWVDGLRHGSGCYRFADGSYY  1119
             G GRY WS+GN Y G WK G MSGRGVMK   NGD FDGFW +GLRHGSG  RF+DGSYY
Sbjct  159   GSGRYAWSDGNTYIGNWKNGKMSGRGVMKLSSNGDFFDGFWSNGLRHGSGFCRFSDGSYY  218

Query  1120  FGTWSNGLKDGRGTLYPVGCA-LDKCKIDGHKEIR-RMLSHDSSISKKDAVKPKVKRSIS  1293
             FGTWS GLKDG GTLYP G   + K K++GH E R R LS   S   ++     V+R++S
Sbjct  219   FGTWSKGLKDGPGTLYPAGSKHIGKLKLEGHVERRERQLSGYFSSQSEEGSLRGVRRTLS  278

Query  1294  EKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
             +KI   F + S + +  +    G+       TE+L +D                  + +V
Sbjct  279   DKISSSFRKGSPKSASMSFHDDGE-------TELLSDD------------------DKSV  313

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEV--RKGSCMDLFKGRKSYYLMLNL  1647
             AYEREY+QGVLIRER  +    SH+   + KF AK+V  R+ S M +F   + +YLML+L
Sbjct  314   AYEREYIQGVLIRERAVNYSKRSHR---KLKF-AKDVKTRRFSGM-MFADLRRHYLMLSL  368

Query  1648  QLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVF  1827
             QLGIR++VGKITPIP REVR SDF E AR+K+ FPR+GSR TP H S+DF WKDYCP+VF
Sbjct  369   QLGIRHTVGKITPIPKREVRSSDFSENARLKIGFPRQGSRSTPSHSSVDFEWKDYCPMVF  428

Query  1828  RNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLK  2007
             RNLR LFKLNAA+Y+MSIC  DGL+EL SPGKSGS+FYLS D RFVIKTLKKSELK LLK
Sbjct  429   RNLRELFKLNAAEYIMSICGVDGLQELSSPGKSGSLFYLSHDGRFVIKTLKKSELKALLK  488

Query  2008  MLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSL  2187
             MLP YY HVK +ENTLITKFFG +RI LR  KKVRFVVMGNMF TELH+H RYDLKGSS 
Sbjct  489   MLPHYYDHVKAYENTLITKFFGAHRIVLRHGKKVRFVVMGNMFCTELHIHRRYDLKGSSQ  548

Query  2188  GRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQH  2334
             GRFTD+D+I+E TTLKDLDL YE  MD LL E+L + +    +   SQH
Sbjct  549   GRFTDEDRIDESTTLKDLDLRYEFHMDVLLRESLFRYIYSPCRLALSQH  597



>tpg|DAA49412.1| TPA: putative phosphatidylinositol-4-phosphate 5-kinase family 
protein [Zea mays]
Length=841

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/803 (46%), Positives = 499/803 (62%), Gaps = 64/803 (8%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E  F NGDVY G   G  P G G+Y  SDG TYDG+W  G   G+G+  W SGATY+
Sbjct  54    RVGEIRFGNGDVYSGTLLGNTPEGSGQYRWSDGCTYDGEWTRGMRHGQGKTQWPSGATYE  113

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY++G GT++  D  +YKG WK+N +HG+G + Y N D ++G W +G   GHG+Y
Sbjct  114   GEYSRGYVYGEGTYTGPDKIIYKGRWKLNRKHGLGYQTYPNGDTFEGSWIQGEIVGHGKY  173

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+N + Y G  K G MSG+G + W NGD ++G W+DG+ HG G Y + +  YY GTW+ 
Sbjct  174   TWANEDTYVGNMKSGRMSGKGTLTWKNGDSYEGNWIDGMMHGYGIYTWNECGYYIGTWTR  233

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKR-SISEKIVDRF  1314
             GLKDG+G  YP GC   +  ++    I+ +        +   V P ++R +   +I+   
Sbjct  234   GLKDGKGKFYPEGC---RVPVNDELYIKNL--------RNRGVLPDIRRQNHGSRILHSS  282

Query  1315  ARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCM-------------LSHTTCDGKA-E  1452
             + D G +       + D     + TE  P     +             + H + +    E
Sbjct  283   SVDMGNMKVGITRQSSDVLYKRNPTEQPPLKNVSLERRWSLEVAIEKFIGHESIESSGQE  342

Query  1453  QLGNITVA----YEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFK  1614
              L N++ +     EREYMQGVLI E +  +S    S ++ +R+K   ++ ++     + K
Sbjct  343   SLENLSDSRMPILEREYMQGVLISEVVLDRSFSDSSKKTKRRQKKMVRDTKRPGEA-IIK  401

Query  1615  GRKSYYLMLNLQLGIRY------------------SVGKITPIPMREVRQSDFGEQARIK  1740
             G +SY LML+LQ+GIRY                  +VGKITPI  REV  SDFG  A   
Sbjct  402   GHRSYDLMLSLQIGIRYGLDHLKYVVPFAWYIERYTVGKITPIQKREVHASDFGPTASFW  461

Query  1741  MYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPG  1920
             M F ++GSRLTP H + DF WKDYCP+VFRNLR +FK++AADYM+SIC +  LR+L SPG
Sbjct  462   MNFSKEGSRLTPSHSAEDFKWKDYCPMVFRNLREMFKIDAADYMISICGNSALRQLSSPG  521

Query  1921  KSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRR  2100
             KSGS+F+LS DDRF+IKTL++SE++VLL+MLP YY HV+ +ENTLITKFFG++R+     
Sbjct  522   KSGSVFFLSQDDRFMIKTLRESEVQVLLRMLPKYYDHVRTYENTLITKFFGLHRVKPSSG  581

Query  2101  KKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLH  2280
             +  RFVVMGNMF TEL +H R+DLKGSSLGR TDK +I+E TTLKDLDL Y   ++    
Sbjct  582   QMFRFVVMGNMFCTELRIHRRFDLKGSSLGRSTDKIEIDENTTLKDLDLNYSFYLEPSWR  641

Query  2281  ETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI  2460
             E L+KQ+  DS FL +Q I+DYSLLLG+H+RAP+HL        S+   + T+VS +   
Sbjct  642   EALLKQIETDSDFLRTQRIMDYSLLLGVHYRAPQHLRTRASYHRSMAADRLTVVSEEDAQ  701

Query  2461  S----ILPRSLTLV--THEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQL  2622
                    P  L LV  + E S+V    GPHIRG  LRA++ G  EVDLLLPGT RL++QL
Sbjct  702   EEDALSHPEGLVLVQSSGENSVVV---GPHIRGSRLRASAAGFGEVDLLLPGTARLQIQL  758

Query  2623  GVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDP  2802
             GVNMPA+A +  K+D +        EVYDVVLYLGIIDILQ YN  KK+EH  KS+++D 
Sbjct  759   GVNMPARAEQISKEDGSK----SFREVYDVVLYLGIIDILQEYNKSKKIEHAVKSMQYDS  814

Query  2803  MSISVIEPKLYSKRFISFLERVF  2871
             +SIS + P+ YS+RF+ F++ VF
Sbjct  815   VSISAVNPRFYSERFLKFIQTVF  837



>emb|CAD27794.1| phosphatidylinositol-4-phosphate 5-kinase [Oryza sativa Japonica 
Group]
Length=690

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/704 (51%), Positives = 462/704 (66%), Gaps = 47/704 (7%)
 Frame = +1

Query  847   GHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVM  1026
             G W+MN +HG+G   Y NSD Y+G W EG+ D  G+YTW++GN+Y G WK G M+G GVM
Sbjct  1     GSWRMNKKHGMGTMVYSNSDTYEGFWNEGLPDEFGKYTWADGNVYIGRWKSGKMNGSGVM  60

Query  1027  KWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVGCALDKCKIDG  1206
             +W NGD  D  W++GL HG G  ++A G+ Y GTW  GLKDG GT Y  G      KI  
Sbjct  61    QWINGDTLDCNWLNGLAHGKGYCKYASGACYIGTWDRGLKDGHGTFYQPGS-----KIPC  115

Query  1207  HKEIRRMLSHDSSISKKDAVKPKV--------KRSISEKIVDRFARDSGRISRRAVSV--  1356
             + E+   L+     S   +   K+        ++      + RF     RIS     V  
Sbjct  116   NLEVSDCLTSHDGTSASSSSNEKITIGLLFLLQKLCKNWRLRRFLHRPRRISNGTTPVFD  175

Query  1357  --AGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSV  1530
               +G       S++    D  C L  +  D  +         YEREY+QGVLI E+ K+ 
Sbjct  176   DNSGSHLCQDVSSKSFSADDQC-LQDSEVDKDS--------VYEREYVQGVLIMEQPKNE  226

Query  1531  DGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQ  1710
             D    +S   ++   ++  KG    ++KG +SYYLMLNLQLGIRY+VGKITP+P+REVR 
Sbjct  227   DSRMSESGIAQENNWEKQAKGPMETIYKGHRSYYLMLNLQLGIRYTVGKITPVPLREVRS  286

Query  1711  SDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCD  1890
             +DFG +ARIKMYFP +GS+ TPPH S+DF+WKDYCP+VFRNLR +F ++AADYMMSIC  
Sbjct  287   NDFGPRARIKMYFPCEGSQYTPPHYSVDFFWKDYCPMVFRNLREMFHIDAADYMMSICGG  346

Query  1891  DGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELK---------VLLKMLPSYYKHVKDH  2043
             D L+EL SPGKSGSIFYLS D+RFVIKTL+K+ELK         +LLKMLP YY HVK +
Sbjct  347   DSLKELSSPGKSGSIFYLSQDERFVIKTLRKTELKIGLMKYVLQILLKMLPKYYNHVKAY  406

Query  2044  ENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEG  2223
             +NTLITKFFGV+RI+L+  +KVRFVVMGNMF TEL +H +YDLKGS+ GR T K  I E 
Sbjct  407   DNTLITKFFGVHRITLKPGRKVRFVVMGNMFCTELRIHRKYDLKGSTQGRSTKKQNINEN  466

Query  2224  TTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLE  2403
             TTLKDLDL Y   +DK   E L +Q++LD  FLESQ IIDYS+LLG+HFRAP HL  +  
Sbjct  467   TTLKDLDLSYVFHVDKPWREALFRQIALDCMFLESQSIIDYSMLLGIHFRAPNHLKRITS  526

Query  2404  PPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTA--PGP-----HIRGKTLRANS  2562
               ++L   +ST +S++   S+       ++ +  ++  A  PGP     HIRG  +RA  
Sbjct  527   CQNAL---ESTGISAETECSVALHHEETISSKGFLLVAADEPGPAVRGSHIRGSMVRAAE  583

Query  2563  VGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQD-ETDPSEVELFEVYDVVLYLGIIDI  2739
              G  EVDL+LPGTGR RVQLGVNMPA+A RKV++D   +    +  E YDVVLYLGIIDI
Sbjct  584   GGYEEVDLVLPGTGRFRVQLGVNMPARA-RKVQEDVNVEVENRDTIEEYDVVLYLGIIDI  642

Query  2740  LQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             LQ YN+ K++EH  KSL+FDP+SIS ++P LYS+RFISFLE+VF
Sbjct  643   LQEYNVSKRVEHAVKSLKFDPLSISAVDPNLYSRRFISFLEKVF  686


 Score = 69.7 bits (169),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 46/90 (51%), Gaps = 0/90 (0%)
 Frame = +1

Query  613  VFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFE  792
            V+ N D Y G +   LP   GKYT +DG  Y G W+ GKM G G + W +G T D +   
Sbjct  15   VYSNSDTYEGFWNEGLPDEFGKYTWADGNVYIGRWKSGKMNGSGVMQWINGDTLDCNWLN  74

Query  793  GYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
            G  HG G    + G+ Y G W   ++ G G
Sbjct  75   GLAHGKGYCKYASGACYIGTWDRGLKDGHG  104



>gb|EYU38576.1| hypothetical protein MIMGU_mgv1a025592mg, partial [Erythranthe 
guttata]
Length=704

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/759 (47%), Positives = 479/759 (63%), Gaps = 72/759 (9%)
 Frame = +1

Query  625   GDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEGYLH  804
             G+ Y G   G  P G G YT SDG+TY+G W  G   G G++ W SGA Y+G+   GY++
Sbjct  1     GEQYSGSLVGNSPEGSGTYTWSDGSTYEGQWRFGVRHGYGKLQWPSGAFYEGEFSGGYIN  60

Query  805   GFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYT  984
             G G+++ SD +VY G W++N++HG+G + Y N D+++G W +G   GHG+YTW+NGN+Y 
Sbjct  61    GSGSYTRSDRAVYNGRWRLNLKHGLGYQTYPNGDIFEGSWIKGAPQGHGKYTWTNGNVYM  120

Query  985   GIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFAD---GSYYFGTWSNGLKDGR  1155
             G    G +SG+G + W NGD ++G W+DG  HG G Y +     G  Y GTW+ GLKDG+
Sbjct  121   GNVNGGKISGKGTLTWTNGDSYEGSWLDGHMHGFGVYTWVKLYGGGTYVGTWTRGLKDGK  180

Query  1156  GTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARDSGRI  1335
             GT YP G              R++L     +      K  +   + ++  +    ++  +
Sbjct  181   GTFYPKG--------------RKILESSQQMYLNALRKRGLLPDLRKQNNNNRVVNNVSL  226

Query  1336  SRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV---AYEREYMQGVL  1506
              RR            S +E++ E           D   E + NI +     EREYMQGVL
Sbjct  227   ERR-----------WSMSEIVLEGG--------VDDDDEMM-NIDIDMPILEREYMQGVL  266

Query  1507  IRERIKSVDGLSHQSTQRR-KFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKIT  1683
             I E +     LS +  +RR K  A+E+++     + KG +SY LML+LQLGIRYSVG+IT
Sbjct  267   ISELV-----LSDRFCKRREKRLAREIKR-PGEQIIKGHRSYDLMLSLQLGIRYSVGRIT  320

Query  1684  PIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAA  1863
             PIPMREVR +DF  ++     FP++GS  TPPH+S DF WKDYCPIVFRNLR +FK++AA
Sbjct  321   PIPMREVRTADFDPRSGYMRSFPKEGSPQTPPHQSEDFKWKDYCPIVFRNLRAMFKIDAA  380

Query  1864  DYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDH  2043
             DYMMSIC +D LREL SPGKSGSIF++S DDRF+IKTL+KSE+KVLL+ML +Y+ H   +
Sbjct  381   DYMMSICGNDALRELSSPGKSGSIFFMSQDDRFMIKTLRKSEVKVLLRMLQNYHLHQCRY  440

Query  2044  ENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEG  2223
             ENTL+TKFFG++RI     +K RFVVMGNMF TEL +H R+DLKGSSLGR  +K +I+E 
Sbjct  441   ENTLLTKFFGLHRIIPSSGQKFRFVVMGNMFCTELRIHRRFDLKGSSLGRSANKVEIDEN  500

Query  2224  TTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLE  2403
             T LKDLDL Y   ++    ++L++Q+ +DS+FLES+ I+DYSLLLG+H+RAP++L     
Sbjct  501   TILKDLDLNYCFYLEPSWRDSLLQQIEIDSKFLESEQIMDYSLLLGIHYRAPQNLQD---  557

Query  2404  PPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRA---NSVGDR  2574
                                 I PR L LV      VS   G HIRG  LRA   ++ GD 
Sbjct  558   -------------------EISPRGLVLVPRGSDDVSVIVGSHIRGSRLRATTSSTFGDE  598

Query  2575  EVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYN  2754
             EVDLLLPGT RL++QLGVNMPA+A      D          E YDVVLYLGIIDILQ YN
Sbjct  599   EVDLLLPGTARLQIQLGVNMPARAEHIPGHDGGSTHRQMFHEAYDVVLYLGIIDILQEYN  658

Query  2755  MRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
               KK+EH YKS++F+ +SIS ++P  YS+RF+ F+++VF
Sbjct  659   TTKKIEHAYKSVKFNSVSISAVDPTFYSQRFLGFIKKVF  697


 Score = 76.3 bits (186),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            + +PNGD++ G +    P G GKYT ++G  Y G+   GK++GKG + W++G +Y+G   
Sbjct  88   QTYPNGDIFEGSWIKGAPQGHGKYTWTNGNVYMGNVNGGKISGKGTLTWTNGDSYEGSWL  147

Query  790  EGYLHGFGTFSSSD---GSVYKGHWKMNIQHGVG  882
            +G++HGFG ++      G  Y G W   ++ G G
Sbjct  148  DGHMHGFGVYTWVKLYGGGTYVGTWTRGLKDGKG  181



>ref|XP_004249584.2| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X1 [Solanum lycopersicum]
Length=1019

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/741 (48%), Positives = 464/741 (63%), Gaps = 31/741 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  +   PNGD Y G   G +P G GKY  SDG+ Y+G+W  G   G G++ W +GA YD
Sbjct  53    RIRDLFLPNGDSYSGSLLGKIPEGSGKYVWSDGSRYEGEWRHGMRHGHGKLEWPTGAVYD  112

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG G   + D   Y+G W+ N++HG+G + Y N D ++G W  G  +G G+Y
Sbjct  113   GEFSGGYMHGEGMHIAPDKVTYRGRWRFNLKHGLGYQVYPNGDFFEGSWIRGTPEGPGKY  172

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
              W+NGN+Y G  K G +SG+G + W NGD ++G W++G+ HG G Y + DG  Y GTW++
Sbjct  173   KWANGNVYVGNMKGGTLSGKGTLTWINGDSYEGSWLNGMMHGPGAYTWRDGGCYIGTWTH  232

Query  1138  GLKDGRGTLYPVGC-----------ALDKCKI--DGHKEIRRMLSHDSSISKKDAVKPKV  1278
             GLKDG+GT YP G            AL K  +  D  K+ R      SS      VK   
Sbjct  233   GLKDGKGTFYPSGSRLTAGQEFYLNALRKQGLLPDLRKQKRVSHISHSSSVDTGNVKVSG  292

Query  1279  KRSISEKIVDRFARDSGRISRRAVSVAGDAALHCS-STEVLPEDASCMLSHTTCDGKAEQ  1455
              +  S    DR ++  G IS    S   +  L    S EV  E     +     DG    
Sbjct  293   NKGSSRYSYDRLSK--GDISNLEQSHPTNVTLERRWSLEVAIEK----VIGNDLDGVDTG  346

Query  1456  LGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVR--KGSCMDLFKGRKSY  1629
                 T   EREYMQGVLI E + + D  S   T  ++   K VR  K     + KG + Y
Sbjct  347   NDMNTPILEREYMQGVLISEVVLN-DRFSPARTAAKRRQRKLVRESKRPGEAIIKGHRRY  405

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
              +ML+LQLGIRYSVGK+TP   REV  SDFG  A  +MYFP+KGS+LTP H+S DF WKD
Sbjct  406   NVMLSLQLGIRYSVGKVTPGQRREVGASDFGACACSRMYFPKKGSQLTPSHQSEDFKWKD  465

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR LFK++ ADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE
Sbjct  466   YCPVVFRNLRELFKIDTADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRKSE  525

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             +KVLL+MLP+Y++HVK +ENTLITKFFG++ I   R + +RFVVMGNMF TEL +H R+D
Sbjct  526   VKVLLRMLPNYHRHVKAYENTLITKFFGLHMIKPSRGQMLRFVVMGNMFCTELRIHRRFD  585

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGSSLGR  +K +I+E T LKDLDL Y   ++    E L+KQ+ +DS+FLE QHI+DYS
Sbjct  586   LKGSSLGRSANKVEIDENTILKDLDLNYCFYLEPSWREALLKQIEIDSKFLEQQHIMDYS  645

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SILPRSLTLVTHEPSIVSTAP  2523
             LLLG+H+RAP+HL + +            +V+ D  +   ILP+ L LV           
Sbjct  646   LLLGVHYRAPQHLRSPISCSGCTTTEGLGIVADDESLEDEILPQGLVLVPRGADDNCVVV  705

Query  2524  GPHIRGKTLRANSV--GDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF  2697
             G H+RG+ LR +S   GD+EVDLLLPGT RL++QLGVNMPA+A+    + +T        
Sbjct  706   GSHVRGRRLRTSSATGGDKEVDLLLPGTARLQIQLGVNMPARADHIPGKGDTR----MFL  761

Query  2698  EVYDVVLYLGIIDILQAYNMR  2760
             EVYDVVLY+GIIDILQ YN+R
Sbjct  762   EVYDVVLYVGIIDILQVYNLR  782



>ref|XP_002986315.1| hypothetical protein SELMODRAFT_124004 [Selaginella moellendorffii]
 gb|EFJ12524.1| hypothetical protein SELMODRAFT_124004 [Selaginella moellendorffii]
Length=729

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/769 (45%), Positives = 473/769 (62%), Gaps = 85/769 (11%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             E+   NGD Y G ++G LP G GKY  SDG  Y+G+W  G  TG+G+I W SGATY+G+ 
Sbjct  22    ERTLSNGDFYAGSWQGNLPEGTGKYLWSDGCMYEGEWGNGIKTGRGRISWPSGATYEGEL  81

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               G LHG G ++  D + YKG W+MN++HG G K Y N DVY+G WK G++ G GRY W 
Sbjct  82    LCGNLHGRGVYTGVDDTTYKGSWRMNLKHGEGVKSYANGDVYEGFWKAGLQHGDGRYIWQ  141

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G W+KG M+G+GV++W NGD ++G W+DGL HG G Y + DG+ Y GTW  G+K
Sbjct  142   NGNQYVGEWRKGVMNGKGVLRWSNGDTYNGQWLDGLEHGHGVYTWTDGACYMGTWRKGVK  201

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARDS  1326
             DG G  YP G                               P+ +RS         +   
Sbjct  202   DGTGIFYPTG----------------------------YFPPRSRRSFEAPAASELSGSD  233

Query  1327  GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGVL  1506
                S      + +  L  + ++   +  S +                T   EREY+QGVL
Sbjct  234   CPASPMERRWSLEGGLDLTHSKESSQKKSAI---------------DTPVLEREYVQGVL  278

Query  1507  IRERIKSVDGLSHQSTQRR-KFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKIT  1683
             I E +K  D  S + ++RR + PAK  R G    + KG  SY LMLNLQLGIR +VGK+T
Sbjct  279   INEIVKQGDAASLKVSKRRQRRPAK--RPGET--VIKGHGSYDLMLNLQLGIRTNVGKMT  334

Query  1684  PIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAA  1863
                  +V   DFG ++   + FPR GS LTPPH+S+DF W+DYCP VFR+LR++F++++A
Sbjct  335   LDTAPDVCPQDFGPRSVFVLKFPRLGSHLTPPHQSLDFKWRDYCPNVFRSLRKMFRIDSA  394

Query  1864  DYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDH  2043
             DYMMS+C +D LRE+ SPGKSGS+FYLS DD+F+IKT++K+E+KVLL+MLPSYY+HV+  
Sbjct  395   DYMMSLCGNDALREISSPGKSGSVFYLSQDDKFMIKTMRKAEVKVLLEMLPSYYEHVQSS  454

Query  2044  ENTLITKFFGVYRISLRRRKKVRF---VVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKI  2214
              NTLITKFFG++++  +  +K  F   ++MGN+F T+LH+H R+DLKGSS GR TDK +I
Sbjct  455   SNTLITKFFGLHQVEPQGGRKASFSKSILMGNVFCTDLHIHRRFDLKGSSQGRSTDKVEI  514

Query  2215  EEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTA  2394
             +E TTLKDLDL +   ++    + L+KQ+  D +FLESQ I+DYSLLLG+HFRAP+   A
Sbjct  515   DENTTLKDLDLNFVFHLEASWRQCLLKQIEQDCKFLESQRIMDYSLLLGVHFRAPQ-CPA  573

Query  2395  LLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDR  2574
             +  P  SL  P +   +++ G+    RS TL T E   + + P      KT R      R
Sbjct  574   VFSPVPSL-PPDA---AAEYGLDSSKRSGTLATTED--LCSLP------KTTRY-----R  616

Query  2575  EVDLLLPGTG----------RLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYL  2724
              +D+L PG            RL+++LGVNMPA+A+R    D T        +VYDVVLYL
Sbjct  617   HIDILYPGISSLRVLCFLSRRLQIRLGVNMPARADRSHCDDGTSS------DVYDVVLYL  670

Query  2725  GIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             GIIDILQ Y++ K++EH YKSL+FD  SIS ++P+LYS RF   + R+F
Sbjct  671   GIIDILQQYDITKRVEHAYKSLQFDSQSISAVDPRLYSNRFQELVRRIF  719



>gb|KCW57070.1| hypothetical protein EUGRSUZ_I02724 [Eucalyptus grandis]
Length=520

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/517 (60%), Positives = 389/517 (75%), Gaps = 8/517 (2%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYT-SSDGTTYDGDWEEGKMTGKGQIIWS  759
             MENNE  +EKV  NGD+Y G FKG+LPHGKG+YT +++   Y+G+WE GKMTGKG+I W 
Sbjct  1     MENNEMLEEKVLSNGDLYYGDFKGMLPHGKGRYTWANNKVVYEGEWELGKMTGKGKIFWE  60

Query  760   SGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVR  939
             SGA Y+GD   GYLHG GTF+  DGSVY G W+MNIQHGVGRKEY NSDVY+G WKEGVR
Sbjct  61    SGARYEGDISGGYLHGCGTFTKPDGSVYTGDWRMNIQHGVGRKEYGNSDVYEGMWKEGVR  120

Query  940   DGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYY  1119
             +G GRYTW++G+ Y G WK G M GRG+MKW NGDL+DG W++GLRH SG YRFADG+YY
Sbjct  121   EGSGRYTWNSGHTYVGNWKGGKMWGRGIMKWVNGDLYDGSWLNGLRHESGIYRFADGAYY  180

Query  1120  FGTWSNGLKDGRGTLYPVGC---ALDKCKIDGHKEIRRMLSHDS---SISKKDAVKPKVK  1281
             FGTW++ LK+G+GT YP G    +L K +  G+ +  + LS  S   +  K    K  + 
Sbjct  181   FGTWNSDLKEGKGTYYPAGSKHPSLKKLRSMGYNDKGKNLSSRSLSLAFDKSRPPKTSIN  240

Query  1282  RSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQL  1458
             RS SEK+ +    R+ GRIS RA+S+  + ++  S  E+  +++S  +     + + +  
Sbjct  241   RSYSEKVSMGGVLRNLGRISSRAMSLDENWSVFYSEGELGSQESSFEVPEVPEERQDKMQ  300

Query  1459  GNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLM  1638
              + ++ YEREYMQGVLI+ERI++   L+ ++ Q+ KF  KE +K  CMD+    +S+YL 
Sbjct  301   DDSSLIYEREYMQGVLIKERIRNYQELTRKTEQKNKFHGKESKKRPCMDMPLRDRSFYLK  360

Query  1639  LNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCP  1818
             LNLQLGIRY+VGKITP+PMREVR SDFGE+ARI+MYFPRKGS+ TPPH SIDFYWKDYCP
Sbjct  361   LNLQLGIRYTVGKITPVPMREVRSSDFGERARIRMYFPRKGSQFTPPHYSIDFYWKDYCP  420

Query  1819  IVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV  1998
             +VFRNLR +FKL+AA+YMMSIC DDGL E+ SPGKSGSIFY S D RFVIKTLKKSELKV
Sbjct  421   MVFRNLREMFKLDAAEYMMSICGDDGLTEISSPGKSGSIFYNSHDCRFVIKTLKKSELKV  480

Query  1999  LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKV  2109
             LLKMLP YY HV  HENTLITKFFG++RI L+  +KV
Sbjct  481   LLKMLPHYYNHVGRHENTLITKFFGLHRIKLKGGRKV  517



>ref|XP_007041491.1| Phosphatidylinositol-4-phosphate 5-kinase family protein isoform 
2 [Theobroma cacao]
 gb|EOX97322.1| Phosphatidylinositol-4-phosphate 5-kinase family protein isoform 
2 [Theobroma cacao]
Length=569

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/541 (58%), Positives = 398/541 (74%), Gaps = 22/541 (4%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             +EN ER +EK F N D Y+G FK +LPHGKGKYT SDGT Y+GDW  GKMTGKG ++W S
Sbjct  27    VENVERLNEKAFSNRDFYVGDFKEILPHGKGKYTWSDGTVYEGDWGAGKMTGKGLLLWPS  86

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y GD   GYLHG G F++ DGS+Y+G W+MNI+HG GRK+Y NSDVY+G WKEGV +
Sbjct  87    GAMYKGDISGGYLHGTGAFTAPDGSIYEGQWRMNIRHGFGRKKYSNSDVYEGEWKEGVHE  146

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G+GRY W+NGN YTG WK+G M GRG M+W NGD ++G W++G R GSG Y++ADG YYF
Sbjct  147   GNGRYFWNNGNKYTGNWKRGKMHGRGAMEWVNGDQYNGCWLNGFRQGSGIYQYADGGYYF  206

Query  1123  GTWSNGLKDGRGTLYPVGC---ALDKCKI-----DGHKEIRRMLSHDSSISKKDAV--KP  1272
             GTW+ GLKDG+G  YP G    +L K  +     +GHK     LS   S++ ++ +  KP
Sbjct  207   GTWTRGLKDGKGLFYPAGSKRPSLKKFCVSLGYDNGHKSA---LSQCPSLNLEECMVKKP  263

Query  1273  KVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
              VKRS+SE+I V    R SGRIS +    A ++ L  S  E +  ++S   S  +  G++
Sbjct  264   SVKRSLSERISVSSVLRSSGRISHK---TAENSRLSDSGREFIRHNSSGTFSLDSDAGQS  320

Query  1450  EQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
             E   N  V YEREYMQGV+I+ERI++   LS ++ +R K  AKE +K  C+ +FKG+ SY
Sbjct  321   EVQENTAVVYEREYMQGVMIKERIRNYGELSQKAEKRTKSHAKETKKSLCVGVFKGKNSY  380

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
             +LMLNLQLGIRY+VGKITP+P REVR +DFG++ARI M+FP KGS+ TPPH+SIDFYWKD
Sbjct  381   HLMLNLQLGIRYTVGKITPVPKREVRTADFGDRARITMFFPSKGSQFTPPHKSIDFYWKD  440

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR +FKL+AA+YMMSIC DDGL +  SPGKSGSIFYLS DD+FVIKTLK+SE
Sbjct  441   YCPMVFRNLREMFKLDAAEYMMSICGDDGLTDFSSPGKSGSIFYLSHDDKFVIKTLKRSE  500

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKK---VRFVVMGNMF--YTELHM  2154
             LKVL KMLP YY HVK++ENTLITKFFG++RI+L  R+K   + F+++   F  Y E  +
Sbjct  501   LKVLHKMLPKYYNHVKEYENTLITKFFGLHRITLPGRRKWGCLLFILLLGAFCGYGEYVL  560

Query  2155  H  2157
             H
Sbjct  561   H  561



>ref|XP_004516597.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X1 [Cicer arietinum]
Length=800

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/704 (48%), Positives = 446/704 (63%), Gaps = 47/704 (7%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E   PNG+ Y G   G +P G+GKY  SDG  YDG+W  G   G G+I W SG  Y+
Sbjct  49    RVGELSLPNGESYSGSLLGNVPEGQGKYVWSDGCVYDGEWRRGMRNGFGKIQWPSGVMYE  108

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+   +   YKG W+ N++HG+G + Y N DV++G W +G  +G G+Y
Sbjct  109   GEFSGGYIHGTGTYIGPENLTYKGRWRFNLKHGLGYQVYPNGDVFEGSWIQGTPEGPGKY  168

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW NGN+Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG  Y GTW+ 
Sbjct  169   TWDNGNVYLGNMKGGRMSGKGTLTWVNGDSFEGSWLNGMMHGLGAYTWSDGGCYVGTWTR  228

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSISKKDAVKPKV  1278
             GLKDG+GT YP+G  L   +              D  K+ +  + H +S    D VK   
Sbjct  229   GLKDGKGTFYPIGSCLPSAQEIYLNALRKRGLLPDLRKQNQVHIHHTASADMGD-VKVGE  287

Query  1279  KRSISEKIVDRFAR------DSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCD  1440
              R +S     + A       D  R   + +S+    +L  S  +V+  D+    + +   
Sbjct  288   NRRLSSVSSSKLATGNLLNLDQSR--SKNISLERRWSLEVSIEKVIGHDSKLASTDSIFG  345

Query  1441  GKAEQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFK  1614
                ++        EREYMQGVLI E +   S   L+ ++ Q +K  AKE+++     + K
Sbjct  346   SGNKEANEKIPILEREYMQGVLISEVVLNNSFSSLNRRAKQLKKKLAKEIKR-PGEQIIK  404

Query  1615  GRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSID  1794
             G +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A   M FP++GS+LTPPH+S D
Sbjct  405   GHRSYDLMLSLQLGIRYTVGKITPIQRREVRASDFGARASFWMNFPKEGSQLTPPHQSDD  464

Query  1795  FYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKT  1974
             F WKDYCP+VFRNLR LFK++AADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKT
Sbjct  465   FKWKDYCPMVFRNLRELFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKT  524

Query  1975  LKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHM  2154
             L++SE+KVLL+MLP Y+ HVK +ENTLITKFFG++RI     +K RFVVMGNMF TEL +
Sbjct  525   LRRSEVKVLLRMLPDYHHHVKSYENTLITKFFGLHRIIPSSGQKFRFVVMGNMFCTELRI  584

Query  2155  HHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQH  2334
             H R+DLKGSSLGR +DK +I+E TTLKDLDL Y   ++    E+L++Q+ +DS+FLE QH
Sbjct  585   HRRFDLKGSSLGRSSDKIEIDENTTLKDLDLNYCFYLEPSWRESLLEQIEIDSKFLEEQH  644

Query  2335  IIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISIL-------------PR  2475
             I+DYSLLLG+H+RAP+     L PP S     +  +++D G++IL             P+
Sbjct  645   IMDYSLLLGVHYRAPQQ----LRPPVSY----NHSINAD-GLAILAEEDPLEDEVYNYPQ  695

Query  2476  SLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGR  2607
              L LV       S   G HIRG  LRA++ GD EVDLLLPGT R
Sbjct  696   GLVLVPRGSDDGSVVVGSHIRGSRLRASAAGDEEVDLLLPGTAR  739



>gb|EMS63245.1| Phosphatidylinositol-4-phosphate 5-kinase 9 [Triticum urartu]
Length=921

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/810 (44%), Positives = 478/810 (59%), Gaps = 73/810 (9%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYT-SSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGD  783
             E   PNGD+Y G   G +P G G+Y  S  G  Y+G W  G   G G+  W SGA Y+G+
Sbjct  123   ELTLPNGDLYSGTLSGGVPEGTGRYVWSGSGCVYEGGWRRGMRHGIGRTEWPSGAVYEGE  182

Query  784   CFEGYLHGFGTFSSSDGSV---YKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGR  954
                G++ G G   ++  S    YKG WK++ +HG+G + + N DVY G W +G  +G GR
Sbjct  183   YSGGFMDGEGPHVAAGSSSSSSYKGQWKLDRKHGLGLQAHANGDVYQGAWVQGQMEGQGR  242

Query  955   YTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWS  1134
             YTW+NGN Y G  + G MSG+GV+ W  GD F G WV G+ HG G Y +  G  Y GTWS
Sbjct  243   YTWANGNSYVGTMRNGLMSGKGVLTWSTGDSFQGNWVAGVAHGYGLYTWEGGGCYLGTWS  302

Query  1135  NGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRF  1314
              GLKDG+GT YP    +   ++D  ++ R +L   S  +  D        S++  +    
Sbjct  303   RGLKDGKGTFYPERRRVPAARLDDLRK-RGVLPDVSFGAGADPEPAAADASLNSGLGRPP  361

Query  1315  ARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYM  1494
              +    + RR  S+     +        P      L    C+  A   G+++   EREY 
Sbjct  362   MKKRPSLQRRR-SIGAAIGVAVGVVTGGPAGPGKTLK---CEDTA---GSLSQILEREYA  414

Query  1495  QGVLIRERI--KSVDGLSHQSTQRRKFPAKEVR--KGSCMDLFKGRKSYYLMLNLQLGIR  1662
             QGVLI E +  KS+   S  S + R   +++V+  K     + KG +SY LML LQLGIR
Sbjct  415   QGVLISEVVLDKSLPD-SPSSKKPRLGRSRKVKDAKRPGETIIKGHRSYDLMLCLQLGIR  473

Query  1663  ----------------YSVGKITPIPMR-----------------EVRQSDFGEQARIKM  1743
                             Y   +I   P+R                 EVR SDFG +A   M
Sbjct  474   LKFIKKSFGNCPVFLAYRGNQIPWCPIRYSSASRIKNLGPTTQEREVRASDFGPKANFWM  533

Query  1744  YFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGK  1923
              FP+ GS LTP HR++DF WKDYCP+VFRNLR +FK++ ADYM+SI   D LREL SPGK
Sbjct  534   NFPKNGSPLTPSHRALDFKWKDYCPMVFRNLREMFKIDTADYMISISGSDALRELSSPGK  593

Query  1924  SGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRK  2103
             SGSIF+ S DD+F+IKTL+KSE++VLL+MLP YY+HV  +ENTL+TKFFG++R+     +
Sbjct  594   SGSIFFSSQDDQFMIKTLRKSEVQVLLRMLPYYYRHVHTYENTLVTKFFGLHRVRPSSGQ  653

Query  2104  KVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHE  2283
             K RFVVMGNMF TEL +H R+DLKGSSLGR T+K KI+E TTLKDLDL Y   ++    +
Sbjct  654   KFRFVVMGNMFCTELRIHRRFDLKGSSLGRSTEKIKIDENTTLKDLDLNYSFYLEPSWRD  713

Query  2284  TLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSD----  2451
              L+KQ+ +DS+FL +  I+DYSLLLG H+RA  +L      P+S+   K T++S      
Sbjct  714   ALLKQIEIDSEFLRNHSIMDYSLLLGFHYRARRNLQIGSSCPESILPDKLTILSEADAAE  773

Query  2452  --------GGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGR  2607
                     GG+ ++ R            S A GPH+RG  LRA S    EVDLL+PGTGR
Sbjct  774   EDSAYNYRGGLILVQRG------SDKNGSDAVGPHVRGSRLRAPSGCFEEVDLLIPGTGR  827

Query  2608  LRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKS  2787
             L +QLGVNMPA+A ++ KQ+E   S   L  +YDVVLY+GIIDILQ YNM KK+EH YKS
Sbjct  828   LPIQLGVNMPARAEKEEKQEEGSKS---LHHMYDVVLYIGIIDILQKYNMTKKIEHAYKS  884

Query  2788  L--RFDPMSISVIEPKLYSKRFISFLERVF  2871
             +  +++P+SIS +EP+ YS+RF+ F+   F
Sbjct  885   IKYKYNPLSISAVEPQFYSERFLKFVGTAF  914



>ref|XP_010312349.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform 
X2 [Solanum lycopersicum]
Length=992

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/704 (48%), Positives = 441/704 (63%), Gaps = 27/704 (4%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  +   PNGD Y G   G +P G GKY  SDG+ Y+G+W  G   G G++ W +GA YD
Sbjct  53    RIRDLFLPNGDSYSGSLLGKIPEGSGKYVWSDGSRYEGEWRHGMRHGHGKLEWPTGAVYD  112

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG G   + D   Y+G W+ N++HG+G + Y N D ++G W  G  +G G+Y
Sbjct  113   GEFSGGYMHGEGMHIAPDKVTYRGRWRFNLKHGLGYQVYPNGDFFEGSWIRGTPEGPGKY  172

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
              W+NGN+Y G  K G +SG+G + W NGD ++G W++G+ HG G Y + DG  Y GTW++
Sbjct  173   KWANGNVYVGNMKGGTLSGKGTLTWINGDSYEGSWLNGMMHGPGAYTWRDGGCYIGTWTH  232

Query  1138  GLKDGRGTLYPVGC-----------ALDKCKI--DGHKEIRRMLSHDSSISKKDAVKPKV  1278
             GLKDG+GT YP G            AL K  +  D  K+ R      SS      VK   
Sbjct  233   GLKDGKGTFYPSGSRLTAGQEFYLNALRKQGLLPDLRKQKRVSHISHSSSVDTGNVKVSG  292

Query  1279  KRSISEKIVDRFARDSGRISRRAVSVAGDAALHCS-STEVLPEDASCMLSHTTCDGKAEQ  1455
              +  S    DR ++  G IS    S   +  L    S EV  E     +     DG    
Sbjct  293   NKGSSRYSYDRLSK--GDISNLEQSHPTNVTLERRWSLEVAIEK----VIGNDLDGVDTG  346

Query  1456  LGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVR--KGSCMDLFKGRKSY  1629
                 T   EREYMQGVLI E + + D  S   T  ++   K VR  K     + KG + Y
Sbjct  347   NDMNTPILEREYMQGVLISEVVLN-DRFSPARTAAKRRQRKLVRESKRPGEAIIKGHRRY  405

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
              +ML+LQLGIRYSVGK+TP   REV  SDFG  A  +MYFP+KGS+LTP H+S DF WKD
Sbjct  406   NVMLSLQLGIRYSVGKVTPGQRREVGASDFGACACSRMYFPKKGSQLTPSHQSEDFKWKD  465

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFRNLR LFK++ ADYMMSIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE
Sbjct  466   YCPVVFRNLRELFKIDTADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRKSE  525

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYD  2169
             +KVLL+MLP+Y++HVK +ENTLITKFFG++ I   R + +RFVVMGNMF TEL +H R+D
Sbjct  526   VKVLLRMLPNYHRHVKAYENTLITKFFGLHMIKPSRGQMLRFVVMGNMFCTELRIHRRFD  585

Query  2170  LKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             LKGSSLGR  +K +I+E T LKDLDL Y   ++    E L+KQ+ +DS+FLE QHI+DYS
Sbjct  586   LKGSSLGRSANKVEIDENTILKDLDLNYCFYLEPSWREALLKQIEIDSKFLEQQHIMDYS  645

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGI--SILPRSLTLVTHEPSIVSTAP  2523
             LLLG+H+RAP+HL + +            +V+ D  +   ILP+ L LV           
Sbjct  646   LLLGVHYRAPQHLRSPISCSGCTTTEGLGIVADDESLEDEILPQGLVLVPRGADDNCVVV  705

Query  2524  GPHIRGKTLRANSV--GDREVDLLLPGTGRLRVQLGVNMPAQAN  2649
             G H+RG+ LR +S   GD+EVDLLLPGT RL++QLGVNMPA+A+
Sbjct  706   GSHVRGRRLRTSSATGGDKEVDLLLPGTARLQIQLGVNMPARAD  749



>gb|KCW57069.1| hypothetical protein EUGRSUZ_I02724 [Eucalyptus grandis]
Length=509

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/487 (61%), Positives = 368/487 (76%), Gaps = 7/487 (1%)
 Frame = +1

Query  859   MNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFN  1038
             MNIQHGVGRKEY NSDVY+G WKEGVR+G GRYTW++G+ Y G WK G M GRG+MKW N
Sbjct  1     MNIQHGVGRKEYGNSDVYEGMWKEGVREGSGRYTWNSGHTYVGNWKGGKMWGRGIMKWVN  60

Query  1039  GDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVGC---ALDKCKIDGH  1209
             GDL+DG W++GLRH SG YRFADG+YYFGTW++ LK+G+GT YP G    +L K +  G+
Sbjct  61    GDLYDGSWLNGLRHESGIYRFADGAYYFGTWNSDLKEGKGTYYPAGSKHPSLKKLRSMGY  120

Query  1210  KEIRRMLSHDS---SISKKDAVKPKVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALH  1377
              +  + LS  S   +  K    K  + RS SEK+ +    R+ GRIS RA+S+  + ++ 
Sbjct  121   NDKGKNLSSRSLSLAFDKSRPPKTSINRSYSEKVSMGGVLRNLGRISSRAMSLDENWSVF  180

Query  1378  CSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQ  1557
              S  E+  +++S  +     + + +   + ++ YEREYMQGVLI+ERI++   L+ ++ Q
Sbjct  181   YSEGELGSQESSFEVPEVPEERQDKMQDDSSLIYEREYMQGVLIKERIRNYQELTRKTEQ  240

Query  1558  RRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARI  1737
             + KF  KE +K  CMD+    +S+YL LNLQLGIRY+VGKITP+PMREVR SDFGE+ARI
Sbjct  241   KNKFHGKESKKRPCMDMPLRDRSFYLKLNLQLGIRYTVGKITPVPMREVRSSDFGERARI  300

Query  1738  KMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSP  1917
             +MYFPRKGS+ TPPH SIDFYWKDYCP+VFRNLR +FKL+AA+YMMSIC DDGL E+ SP
Sbjct  301   RMYFPRKGSQFTPPHYSIDFYWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLTEISSP  360

Query  1918  GKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRR  2097
             GKSGSIFY S D RFVIKTLKKSELKVLLKMLP YY HV  HENTLITKFFG++RI L+ 
Sbjct  361   GKSGSIFYNSHDCRFVIKTLKKSELKVLLKMLPHYYNHVGRHENTLITKFFGLHRIKLKG  420

Query  2098  RKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLL  2277
              +KVRFVVMGNMF TEL +H RYDLKGSSLGRFTDK+KI + TTLKDLDL YE  MDK L
Sbjct  421   GRKVRFVVMGNMFCTELQIHRRYDLKGSSLGRFTDKEKIHQNTTLKDLDLAYEFHMDKFL  480

Query  2278  HETLIKQ  2298
              E   K+
Sbjct  481   REAFFKK  487


 Score = 76.3 bits (186),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            K + N DVY GM+K  +  G G+YT + G TY G+W+ GKM G+G + W +G  YDG   
Sbjct  10   KEYGNSDVYEGMWKEGVREGSGRYTWNSGHTYVGNWKGGKMWGRGIMKWVNGDLYDGSWL  69

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             G  H  G +  +DG+ Y G W  +++ G G
Sbjct  70   NGLRHESGIYRFADGAYYFGTWNSDLKEGKG  100



>ref|XP_007027478.1| Phosphatidyl inositol monophosphate 5 kinase isoform 4 [Theobroma 
cacao]
 gb|EOY07980.1| Phosphatidyl inositol monophosphate 5 kinase isoform 4 [Theobroma 
cacao]
Length=683

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/619 (49%), Positives = 412/619 (67%), Gaps = 20/619 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PNGD Y G   G +P G+GKY    G  Y+G+W  G   G G+I W +G  YD
Sbjct  51    RVGELLLPNGDSYSGSLLGNVPEGRGKYVWQGGCVYEGEWSCGMRHGTGKIQWPTGTVYD  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  S+   YKG WK+N++HG+G + Y N DV++  W +G  +G G+Y
Sbjct  111   GEFSGGYMHGTGTYIGSNKLTYKGRWKLNLKHGLGYQVYPNGDVFEASWIQGTTEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG +Y GTW+ 
Sbjct  171   TWANGNVYLGNMKGGKMSGKGTLTWTNGDTFEGSWLNGMMHGFGVYTWSDGGFYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSISKKDAVK---  1269
             GLKDG+G+ YP    L   +              D  K++   + H SSI    ++K   
Sbjct  231   GLKDGKGSFYPKSSRLPALQEVYLNALRKRGLLPDLRKQVHAHIHHASSIDM-GSIKVGG  289

Query  1270  PKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
              +V    S K+ +    +  +   R VS+    +L  S  +V+  D+S  LS +  +G  
Sbjct  290   NRVSHRNSNKLSEGNLLNLEQSRNRNVSLERRWSLEVSIEKVIGHDSSFELSDSFTEGGE  349

Query  1450  EQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
             +         EREYMQGVLI E +   S    S ++ +R+K  AK++++     + KG +
Sbjct  350   KGSETNAPILEREYMQGVLISELVLNNSFSPSSRRAKRRQKKLAKDIKR-PGETIIKGHR  408

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITP+  REVR SDFG +A   M FP++GS+LTPPH+S DF W
Sbjct  409   SYDLMLSLQLGIRYTVGKITPVQRREVRASDFGPRASFWMNFPKEGSQLTPPHQSEDFKW  468

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGSIF+LS DDRF+IKTL+K
Sbjct  469   KDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSIFFLSQDDRFMIKTLRK  528

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE+KVLL+MLP+Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H R
Sbjct  529   SEVKVLLRMLPNYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRR  588

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             +DLKGSSLGR  D  +I+E TTLKDLDL Y   ++    E L++Q+ +DS+FLE+Q I+D
Sbjct  589   FDLKGSSLGRSADNVEIDENTTLKDLDLNYCFYLEPSWQEALLRQIEIDSKFLEAQRIMD  648

Query  2344  YSLLLGLHFRAPEHLTALL  2400
             YSLLLG+H+RAP+HL +L+
Sbjct  649   YSLLLGVHYRAPQHLRSLM  667



>ref|XP_007027477.1| Phosphatidyl inositol monophosphate 5 kinase isoform 3 [Theobroma 
cacao]
 ref|XP_007027479.1| Phosphatidyl inositol monophosphate 5 kinase isoform 3 [Theobroma 
cacao]
 gb|EOY07979.1| Phosphatidyl inositol monophosphate 5 kinase isoform 3 [Theobroma 
cacao]
 gb|EOY07981.1| Phosphatidyl inositol monophosphate 5 kinase isoform 3 [Theobroma 
cacao]
Length=696

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/619 (49%), Positives = 412/619 (67%), Gaps = 20/619 (3%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             R  E + PNGD Y G   G +P G+GKY    G  Y+G+W  G   G G+I W +G  YD
Sbjct  51    RVGELLLPNGDSYSGSLLGNVPEGRGKYVWQGGCVYEGEWSCGMRHGTGKIQWPTGTVYD  110

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GY+HG GT+  S+   YKG WK+N++HG+G + Y N DV++  W +G  +G G+Y
Sbjct  111   GEFSGGYMHGTGTYIGSNKLTYKGRWKLNLKHGLGYQVYPNGDVFEASWIQGTTEGPGKY  170

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW+NGN+Y G  K G MSG+G + W NGD F+G W++G+ HG G Y ++DG +Y GTW+ 
Sbjct  171   TWANGNVYLGNMKGGKMSGKGTLTWTNGDTFEGSWLNGMMHGFGVYTWSDGGFYVGTWTR  230

Query  1138  GLKDGRGTLYPVGCALDKCK-------------IDGHKEIRRMLSHDSSISKKDAVK---  1269
             GLKDG+G+ YP    L   +              D  K++   + H SSI    ++K   
Sbjct  231   GLKDGKGSFYPKSSRLPALQEVYLNALRKRGLLPDLRKQVHAHIHHASSIDM-GSIKVGG  289

Query  1270  PKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
              +V    S K+ +    +  +   R VS+    +L  S  +V+  D+S  LS +  +G  
Sbjct  290   NRVSHRNSNKLSEGNLLNLEQSRNRNVSLERRWSLEVSIEKVIGHDSSFELSDSFTEGGE  349

Query  1450  EQLGNITVAYEREYMQGVLIRERI--KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRK  1623
             +         EREYMQGVLI E +   S    S ++ +R+K  AK++++     + KG +
Sbjct  350   KGSETNAPILEREYMQGVLISELVLNNSFSPSSRRAKRRQKKLAKDIKR-PGETIIKGHR  408

Query  1624  SYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYW  1803
             SY LML+LQLGIRY+VGKITP+  REVR SDFG +A   M FP++GS+LTPPH+S DF W
Sbjct  409   SYDLMLSLQLGIRYTVGKITPVQRREVRASDFGPRASFWMNFPKEGSQLTPPHQSEDFKW  468

Query  1804  KDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKK  1983
             KDYCP+VFRNLR +FK++AADYMMSIC +D LREL SPGKSGSIF+LS DDRF+IKTL+K
Sbjct  469   KDYCPMVFRNLREMFKIDAADYMMSICGNDALRELSSPGKSGSIFFLSQDDRFMIKTLRK  528

Query  1984  SELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHR  2163
             SE+KVLL+MLP+Y+ HV+ +ENTLITKFFG++RI     +K RFVVMGNMF TEL +H R
Sbjct  529   SEVKVLLRMLPNYHHHVRSYENTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRR  588

Query  2164  YDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIID  2343
             +DLKGSSLGR  D  +I+E TTLKDLDL Y   ++    E L++Q+ +DS+FLE+Q I+D
Sbjct  589   FDLKGSSLGRSADNVEIDENTTLKDLDLNYCFYLEPSWQEALLRQIEIDSKFLEAQRIMD  648

Query  2344  YSLLLGLHFRAPEHLTALL  2400
             YSLLLG+H+RAP+HL +L+
Sbjct  649   YSLLLGVHYRAPQHLRSLM  667



>gb|EMS64982.1| Phosphatidylinositol-4-phosphate 5-kinase 9 [Triticum urartu]
Length=940

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/811 (44%), Positives = 473/811 (58%), Gaps = 94/811 (12%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGV-----LPHGKGKYTSSDGT--TYDGDWEEGKMTGKGQIIW  756
             R  E   PNGDVY G          +P G G+Y  + G+   Y+G W+ G   G G+ +W
Sbjct  164   RVTEITLPNGDVYSGTLSSSSHSQQVPEGTGRYVWAAGSCCVYEGGWKRGARHGHGRTLW  223

Query  757   SSGATYDGDCFEGYLHGFGTFSSSDGSV-----------YKGHWKMNIQHGVGRKEYQNS  903
              SGA Y+GD   G++ G GT+  +               YKG WK++ +HG G + Y N 
Sbjct  224   PSGAVYEGDYSAGFMDGQGTYVVAGPCTTSSSSSSSSYNYKGQWKLDRKHGHGLQTYPNG  283

Query  904   DVYDGCWKEGVRDGHG-RYTWSNGNMYTGIWKKGNMSGRGVMKW-FNGDLFDGFWVDGLR  1077
             D ++G W +G  +GHG RYTW+NGN Y G  + G M G+GV+ W   GD F G W+DG  
Sbjct  284   DTFEGSWVQGHMEGHGCRYTWANGNTYVGTMRNGTMFGKGVLTWSATGDSFQGNWLDGAM  343

Query  1078  HGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVGC---ALDKCKIDGHKEIRRMLSHDSSI  1248
             HG G Y + DG  Y GTW+ GLKDG+GT YP  C   A  +  ID  +  R +L  D S 
Sbjct  344   HGYGLYTWEDGGCYLGTWTRGLKDGKGTFYPKNCRVPANHQLYIDDLRN-RGVLPDDMST  402

Query  1249  S---------------KKDAVKPK-VKRSISEKIVDRFARDSGRISRR-AVSVAGDAALH  1377
             +               ++ A  P  + +S      +R       + RR ++ VA D  + 
Sbjct  403   NVLEPQHTSSSSFDTNQEPAAAPAHLNKSWRNLSFERPPVKKPSLQRRWSIGVAIDKII-  461

Query  1378  CSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQS--  1551
               + E +    S   +    D       ++ +  EREY QGVLI E + +   L   S  
Sbjct  462   -GAHEPISGAGSETQTQQGSDQNMAACSSLPI-LEREYAQGVLISEVVLNKSCLEDSSKK  519

Query  1552  -TQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQ  1728
              ++R+   AK+V++   M + KG +SY LML LQLGIRY+VGKITPI  R+V+ SDFG +
Sbjct  520   LSRRQSRAAKDVKRPGEM-IIKGHRSYDLMLCLQLGIRYTVGKITPIQRRQVQASDFGPK  578

Query  1729  ARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLREL  1908
             A   M FP KG+RLTP HR++DF WKDYCP+VFRNLR +FKL+ ADYM+SI   D LREL
Sbjct  579   ASFWMNFPTKGTRLTPAHRAVDFKWKDYCPVVFRNLREMFKLDTADYMISISGSDALREL  638

Query  1909  LSPG---KSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVY  2079
              SPG   KSGS+F+LS DDRF+IKTL+KSE++VLL+ML  YY+HV  ++NTL+TKFFG++
Sbjct  639   SSPGKREKSGSMFFLSQDDRFMIKTLRKSEVQVLLRMLRDYYRHVHTYDNTLVTKFFGLH  698

Query  2080  RISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYEL  2259
             R+     +K RFVVMGNMF T+L +H R+DLKGSSLGR TDK                  
Sbjct  699   RVKPSSGQKFRFVVMGNMFCTQLRIHRRFDLKGSSLGRSTDK------------------  740

Query  2260  RMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTL  2439
                          + +DS+FL++Q I+DYSLLLG H+RA + L      P+S+ +     
Sbjct  741   -------------IEIDSEFLKNQGIMDYSLLLGFHYRARQSLVRGGSLPESILQDNKLA  787

Query  2440  VSS------DGGISILPRSLTLVTHEPSI-VSTAPGPHIRGKTLRANSVGDREVDLLLPG  2598
             V S      D         L LV    +     A GPHIRG  LR++S    EVDLLLPG
Sbjct  788   VLSEQDAMEDDSAYNYREGLVLVQRGSNQDGKVAVGPHIRGSRLRSSSACYEEVDLLLPG  847

Query  2599  TGRLRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHK  2778
             T RL++QLGVNMPA+A ++ K          L +VYDVVLY+GIIDILQ Y+MRKK+EH 
Sbjct  848   TARLQIQLGVNMPARAEKQEKDGGKS-----LRQVYDVVLYIGIIDILQEYSMRKKVEHA  902

Query  2779  YKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             YKS++++P SISV+EP+ YS+RF++F+  VF
Sbjct  903   YKSIKYNPQSISVVEPRFYSERFLNFIRTVF  933



>ref|XP_006471084.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform 
X2 [Citrus sinensis]
Length=493

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/491 (59%), Positives = 361/491 (74%), Gaps = 25/491 (5%)
 Frame = +1

Query  574   VIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQII  753
             ++IME+  R  +K F NGD+Y+G F+G LPHGKGKY   DGT Y+GDWEEGKMTGKG I+
Sbjct  4     LLIMEDTGRL-KKSFTNGDIYVGNFEGELPHGKGKYIWLDGTVYEGDWEEGKMTGKGYIV  62

Query  754   WSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEG  933
             W SGA Y+GD   GYL GFGTF+  DGSVY+G+W+MNI+HG+GRKEY NSD+YDG WKEG
Sbjct  63    WPSGAKYEGDFSGGYLDGFGTFTGHDGSVYRGNWRMNIRHGLGRKEYPNSDIYDGSWKEG  122

Query  934   VRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGS  1113
             V +G GRY+W++GN+Y G WK G MSGRGVMKW NGD++DG W++G RHGSG Y FADG 
Sbjct  123   VHEGSGRYSWNSGNIYIGSWKDGKMSGRGVMKWMNGDIYDGSWLNGYRHGSGVYMFADGG  182

Query  1114  YYFGTWSNGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSH-------------DSSISK  1254
             +Y GTWS GLKDG+G  YP G          H  +RRM S+              SSI+ 
Sbjct  183   HYSGTWSKGLKDGKGKFYPAGSK--------HPSLRRMCSNLGYDDNTKGLPSQGSSINS  234

Query  1255  K--DAVKPKVKRSISEKI-VDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLS  1425
             +  +  KP+VKRS+SE+I V    R SGRIS R  S+ G+ +    S + +  D S  L 
Sbjct  235   EGSETSKPRVKRSLSERISVGGLLRSSGRISHRTSSLDGNWSQRHPSVKSISNDFSSKLL  294

Query  1426  HTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMD  1605
             H + + +++      V YEREYMQGVL++E +++    + +   R K   KEV+K SC+D
Sbjct  295   HDSDESQSDVPDGSPVVYEREYMQGVLMKETVRNYTEQTRKGKPRNKHSVKEVKKKSCVD  354

Query  1606  LFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHR  1785
             +F+G +SYYLMLNLQLGIRY+VGKITP+PMREVR SDFG++ARI+MYFPRKGS+ TPPH 
Sbjct  355   IFEGHRSYYLMLNLQLGIRYTVGKITPVPMREVRSSDFGDRARIRMYFPRKGSQFTPPHN  414

Query  1786  SIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFV  1965
             SIDF WKDYCP+VFRNLR +FKL+AA+YMMSIC DDGLRE  SPGKSGSIFYLS DDRF 
Sbjct  415   SIDFSWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLRERSSPGKSGSIFYLSHDDRFF  474

Query  1966  IKTLKKSELKV  1998
             IKTLKK+ELK+
Sbjct  475   IKTLKKTELKI  485



>ref|XP_010926458.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 2-like [Elaeis 
guineensis]
Length=801

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/772 (44%), Positives = 460/772 (60%), Gaps = 78/772 (10%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EKV PNGD+Y G F G LPHGKGKY  +DG  Y+G+W  GK  GKG+  W SGAT++G+ 
Sbjct  87    EKVLPNGDLYKGGFAGNLPHGKGKYLWADGCMYEGEWRRGKAAGKGKFSWPSGATFEGEF  146

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               G + GFGTF+ S+G  Y+G W  + +HG G K Y N D Y+G W+  +++GHGRY W 
Sbjct  147   RSGRMEGFGTFTGSEGDTYRGSWIADRKHGYGSKWYGNGDYYEGTWRRNLQEGHGRYVWR  206

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNG-L  1143
             NGN Y G W+ G +SGRG++ W NG+ +DG W +G+  GSG Y + DGS Y G+WS G  
Sbjct  207   NGNQYVGEWRNGVISGRGLLIWANGNRYDGQWENGIPKGSGVYYWPDGSCYVGSWSKGEP  266

Query  1144  KDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARD  1323
             K   GT YP      K    G +     L+        DA+ P  ++  S   VD     
Sbjct  267   KTLNGTYYPAAAGGRKEIAGGRRSPFSPLA--------DALLPASRKRSS---VDG---A  312

Query  1324  SGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGV  1503
              GR+S  A                  E     +     DG+A   G+IT          +
Sbjct  313   PGRVSAAAA-----------------EKNFPRICIWESDGEA---GDITCDIIDTLEASM  352

Query  1504  LIRERIKSVDGLSH-QSTQRRKFP----AKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYS  1668
             L R+      G     + QRR+ P    A +V+K     + KG K+Y LMLNLQLGIRYS
Sbjct  353   LYRDGTSFEPGSEDLGAGQRRRSPCCLTAADVKK-PGQTISKGHKNYDLMLNLQLGIRYS  411

Query  1669  VGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLF  1848
             VGK     MRE+RQ+DF  + +    FP +GS++TPPH+S++F WKDYCP+VFR+LR+LF
Sbjct  412   VGKPASTRMRELRQADFDPREKFWTRFPPEGSKITPPHQSVEFRWKDYCPMVFRHLRKLF  471

Query  1849  KLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYK  2028
              ++ ADYM++IC DD LREL SPGKSGS FYL+ DDRF+IKT+KKSE+KVL++MLPSYY+
Sbjct  472   SVDPADYMLAICGDDALRELSSPGKSGSFFYLTQDDRFMIKTVKKSEVKVLIRMLPSYYE  531

Query  2029  HVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDK-  2205
             HV+ ++N+L+TKF+GV+ +     +KVRF+VMGN+F +E  +H R+DLKGSS GR TDK 
Sbjct  532   HVRRYQNSLVTKFYGVHCVKPIGGQKVRFIVMGNLFCSEYRIHRRFDLKGSSHGRTTDKA  591

Query  2206  -DKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPE  2382
               +I+E TTLKDLDL +  R+ +   +  I+Q+  D +FLE++ I+DYSLL+GLHFR   
Sbjct  592   EAEIDETTTLKDLDLNFVFRLQRHWFKEFIQQIKRDCEFLEAERIMDYSLLVGLHFR---  648

Query  2383  HLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANS  2562
                               + +S  G+S    S        S          R    R + 
Sbjct  649   ----------------DDVSASKMGLSPYVASPKFFGERESFQGGG-----RLSEFRFSV  687

Query  2563  VGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDP---------SEVELFEVYDVV  2715
              G ++V  +L G   L ++LG NMPA+A   V + E++P         +  +  E+YDV+
Sbjct  688   SGCQDVGQILDGRKPL-IRLGANMPARAEH-VLRSESEPCPLIGGGLLTPTQSGEIYDVI  745

Query  2716  LYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             LY GIIDILQ Y++ KKLEH YKSL+ DP SIS ++PKLYS+RF  F+ ++F
Sbjct  746   LYFGIIDILQDYDITKKLEHAYKSLQADPNSISAVDPKLYSRRFQDFISKIF  797



>emb|CAN81224.1| hypothetical protein VITISV_027824 [Vitis vinifera]
Length=672

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/497 (63%), Positives = 356/497 (72%), Gaps = 72/497 (14%)
 Frame = +1

Query  1606  LFKGRKSYYLMLNL--------QLGIR-YSVGKITPIPMREVRQSDFGEQARIKMYFPRK  1758
             LF GR  +   L+L         LGI  Y+VGKITP+PMREVR SDFG++ARI+MYFPRK
Sbjct  177   LFDGRGVFCCSLHLVAILTPLYTLGILWYTVGKITPVPMREVRSSDFGDRARIRMYFPRK  236

Query  1759  GSRLTPPHRSIDFYWKDYCPIVFR---------------------------------NLR  1839
             GS+ TPPH SIDFYWKDYCP+VF                                  NLR
Sbjct  237   GSQFTPPHYSIDFYWKDYCPMVFSAYKYDPAITPFLKLSHKTRANSFGIALAQAAVWNLR  296

Query  1840  RLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKV-------  1998
              +FKL+AADYMMSIC DDGLREL SPGKSGS+FYLS DDRF+IKTLKKSELKV       
Sbjct  297   EMFKLDAADYMMSICGDDGLRELPSPGKSGSLFYLSHDDRFLIKTLKKSELKVVSVVWYL  356

Query  1999  ---------------LLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNM  2133
                            LLKMLP+YY HV  HENTLITKFFG++RI+LR  KKVRF+VMGNM
Sbjct  357   LGVLGPKRDFADVMVLLKMLPNYYNHVAAHENTLITKFFGLHRITLRGGKKVRFMVMGNM  416

Query  2134  FYTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDS  2313
             F TEL +H RYDLKGSS GR+TDKDKI+  TTLKDLDL YE  MDK L ++L +Q+SLD 
Sbjct  417   FCTELRIHRRYDLKGSSQGRYTDKDKIDSNTTLKDLDLSYEFHMDKSLRKSLFQQISLDC  476

Query  2314  QFLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLF-------KPKSTLVSSDGGISILP  2472
              FLESQ IIDYSLLLGLHF APEHL  LLE P++            S   +S G + I P
Sbjct  477   MFLESQQIIDYSLLLGLHFSAPEHLKTLLELPETNHSHGNNPGSDGSYGATSIGDLWIPP  536

Query  2473  RSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANR  2652
               L LVTHEP+  STAPGPH+RG  LRA SVGD+EVDLLLPGTGRLRVQLGVNMPAQANR
Sbjct  537   SGLILVTHEPN-GSTAPGPHMRGNPLRAYSVGDKEVDLLLPGTGRLRVQLGVNMPAQANR  595

Query  2653  KVKQDETDPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKL  2832
             KV QDE +  EVELFEVYDVVLYLGIIDILQ YN+RKK EH YKSL+FDP++ISV+EPKL
Sbjct  596   KVLQDEANSKEVELFEVYDVVLYLGIIDILQVYNVRKKAEHAYKSLQFDPLTISVVEPKL  655

Query  2833  YSKRFISFLERVFRA*P  2883
             YS+RFI+FLE+VF   P
Sbjct  656   YSRRFINFLEKVFPEQP  672


 Score = 93.6 bits (231),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 100/211 (47%), Gaps = 36/211 (17%)
 Frame = +1

Query  1348  VSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGVLIRERIKS  1527
             +S+  D +   S+ E +  D S MLSH + + + E     T+ YEREYMQGVLI+E+I+S
Sbjct  1     MSLDEDCSFCDSAREFIAHDTSGMLSHASDEDQHEMRDCCTLVYEREYMQGVLIKEKIRS  60

Query  1528  VDGLSHQSTQRRKFPAKEVRKGSCMDLFKG---RKSYYLMLNLQLGIR---------YSV  1671
                 S ++ QR KF AKE ++ SC  +F+    R+SYYLMLNLQLGIR         +  
Sbjct  61    SAVPSEKNKQRSKFHAKEAKQRSCXGIFEDHQRRRSYYLMLNLQLGIRIRGEEDKMVWKA  120

Query  1672  GKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFK  1851
              K     MR  R +    + + +M FP K              W  + P   R       
Sbjct  121   SKNGVFSMRSFRDA---LEVKGEMTFPSK------------IEWGSWTPTKARKSLDEAS  165

Query  1852  LNAADYMMS---------ICCDDGLRELLSP  1917
             ++  D+++           CC   L  +L+P
Sbjct  166   MSFLDFLIGWALFDGRGVFCCSLHLVAILTP  196



>gb|EMT21401.1| Phosphatidylinositol-4-phosphate 5-kinase 9 [Aegilops tauschii]
Length=807

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/772 (44%), Positives = 457/772 (59%), Gaps = 91/772 (12%)
 Frame = +1

Query  709   GDWEEGKMTGKGQIIWSSGATYDGDCFEGYLHGFGTFSSSD---------GSVYKGHWKM  861
             G W+ G   G G+ +W SGA Y+GD   G++ G GT+ +            S YKG WK+
Sbjct  69    GGWKRGARHGHGRTLWPSGAVYEGDYSAGFMDGEGTYVAGPCTSTTSSSSSSSYKGQWKL  128

Query  862   NIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKW-FN  1038
             + +HG GR+ Y N D ++G W +G  +GHGRYTW++GN Y G  + G M G+GV+ W   
Sbjct  129   DRKHGHGRQTYPNGDTFEGSWVQGQMEGHGRYTWADGNSYVGTMRNGTMFGKGVLTWSAT  188

Query  1039  GDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRGTLYPVGC---ALDKCKIDGH  1209
             GD F G W+DG  HG G Y + DG  Y GTW+ G KDG+GT YP  C   A  +  ID  
Sbjct  189   GDSFQGNWLDGAMHGYGLYTWEDGGCYLGTWTRGFKDGKGTFYPKSCRVPAAHQLYIDDL  248

Query  1210  K--------------EIRRMLSHDSSISKKDAVKPK-VKRSISEKIVDRFARDSGRISRR  1344
             +              + +R  S     +++ A  P  +K+S      +R       + RR
Sbjct  249   RNRGVLPDDISTNVLQQQRTSSSSFDTNQEPAAAPADLKKSWRNLSFERPPVKKPSLQRR  308

Query  1345  -AVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV--AYEREYMQGVLIRE  1515
              ++ VA D  +         E +       T  G  + +   +     EREY QGVLI E
Sbjct  309   WSIGVAIDKIIGAH------EPSGAGSEPQTQQGSDQNMAGCSSLPILEREYAQGVLISE  362

Query  1516  RIKSVDGLSHQS---TQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITP  1686
              + +   L   S   ++R+   AK+V++   M + KG +SY LML LQLGIRY+VGKITP
Sbjct  363   VVLNKSCLEDSSKKLSRRQSRAAKDVKRPGEM-IIKGHRSYDLMLCLQLGIRYTVGKITP  421

Query  1687  IPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVF--RNLRRLFKLNA  1860
             I  REV+ SDFG +A   M FP KG+RLTP HR++DF WKDYCP+VF  RNLR +FKL+ 
Sbjct  422   IQRREVQASDFGPKASFWMNFPTKGTRLTPAHRAVDFKWKDYCPVVFSFRNLREMFKLDT  481

Query  1861  ADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKD  2040
             ADYM+SI   D  REL SPGKSGS+F+LS DDRF+IKTL+KSE++VLL+ML  YY+HV  
Sbjct  482   ADYMISISGSDEFRELSSPGKSGSMFFLSQDDRFMIKTLRKSEVQVLLRMLRDYYRHVHT  541

Query  2041  HENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKDKIEE  2220
             ++NTL+TKFFG++R+     +K RFVVMGNMF TEL +H R+DLKGSSLGR TDK     
Sbjct  542   YDNTLVTKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHQRFDLKGSSLGRSTDK-----  596

Query  2221  GTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTALL  2400
                                       + +DS+FL++Q I+DYSLLLG H+RA + L    
Sbjct  597   --------------------------IEIDSEFLKNQGIMDYSLLLGFHYRARQSLVRGG  630

Query  2401  EPPDSLFKPKSTLVSS-------DGGISILPRSLTLVTHEPSIVS-TAPGPHIRGKTLRA  2556
               P+++ +     V S       D   +     L LV    +     A GPHIRG  LR+
Sbjct  631   SLPETILQDNKLAVLSEQDAMEDDSAYNDYREGLVLVQRGSNQEGKVAVGPHIRGSRLRS  690

Query  2557  NSVGDREVDLLLPGTGR-------LRVQLGVNMPAQANRKVKQDETDPSEVELFEVYDVV  2715
             +S    EVDLLLPGT R       L++QLGVNMPA+A ++ KQ E D  +  L +VYDVV
Sbjct  691   SSACYEEVDLLLPGTARLIFCYCWLQIQLGVNMPARAEKQEKQ-EKDGGK-SLRQVYDVV  748

Query  2716  LYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             LY+GIIDILQ Y+MRKK+EH YKS++++P+SISV+EP+ YS+RF++F+  VF
Sbjct  749   LYIGIIDILQEYSMRKKVEHAYKSVKYNPLSISVVEPRFYSERFLNFIRTVF  800


 Score = 73.6 bits (179),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 1/109 (1%)
 Frame = +1

Query  634  YIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEGYLHGFG  813
            Y G +K    HG G+ T  +G T++G W +G+M G G+  W+ G +Y G    G + G G
Sbjct  122  YKGQWKLDRKHGHGRQTYPNGDTFEGSWVQGQMEGHGRYTWADGNSYVGTMRNGTMFGKG  181

Query  814  TFS-SSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
              + S+ G  ++G+W     HG G   +++   Y G W  G +DG G +
Sbjct  182  VLTWSATGDSFQGNWLDGAMHGYGLYTWEDGGCYLGTWTRGFKDGKGTF  230


 Score = 70.5 bits (171),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS-GATYDGDC  786
            + +PNGD + G +      G G+YT +DG +Y G    G M GKG + WS+ G ++ G+ 
Sbjct  137  QTYPNGDTFEGSWVQGQMEGHGRYTWADGNSYVGTMRNGTMFGKGVLTWSATGDSFQGNW  196

Query  787  FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             +G +HG+G ++  DG  Y G W    + G G
Sbjct  197  LDGAMHGYGLYTWEDGGCYLGTWTRGFKDGKG  228



>ref|XP_008782272.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 2-like [Phoenix 
dactylifera]
Length=801

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/775 (43%), Positives = 460/775 (59%), Gaps = 76/775 (10%)
 Frame = +1

Query  595   ERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATY  774
             E   EKV PNGD+Y G F G  PHGKGKY  +DG  Y+G+W  GK  GKG+  W SGAT+
Sbjct  83    EAVVEKVLPNGDLYKGRFAGNQPHGKGKYLWADGCMYEGEWRRGKAAGKGKFSWPSGATF  142

Query  775   DGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGR  954
             +G+   G + GFGTF+ S+G  Y+G W  + +HG G K Y N D Y+G W+  +++GHGR
Sbjct  143   EGEFRSGRMEGFGTFTGSEGDTYRGSWIADRKHGYGSKWYANGDYYEGTWRRNLQEGHGR  202

Query  955   YTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWS  1134
             Y W NGN Y G W+ G +SGRGV+ W NG+ +DG W +G+  GSG Y + DGS Y G+WS
Sbjct  203   YLWRNGNQYVGEWRNGVISGRGVLIWANGNRYDGQWENGVPKGSGVYSWPDGSCYVGSWS  262

Query  1135  NGLKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRF  1314
              G        Y  G    + +I G +      S  S ++  DA+ P              
Sbjct  263   KGEPKTLNGTYCPGAGGGRKEIAGGRR-----SPFSPLA--DALLP--------------  301

Query  1315  ARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYM  1494
                    SR+  SV G      ++T        C+      DG+A   G+IT        
Sbjct  302   ------ASRKRSSVDGAPGRVSAATAEKNFPRICIWE---SDGEA---GDITCDIIDTLE  349

Query  1495  QGVLIRERIK-SVDGLSHQSTQRRKFP----AKEVRKGSCMDLFKGRKSYYLMLNLQLGI  1659
               +L R+       G    + QRR+ P    A +V+K     + KG K+Y LMLNLQLGI
Sbjct  350   ASMLYRDGTSFEPGGEDLGAGQRRRSPGSLTAGDVKK-PGQTISKGHKNYDLMLNLQLGI  408

Query  1660  RYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLR  1839
             RYSVGK   + MR++R +DF  + +    FP +GS++TPPH+S++F WKDYCP+VFR+LR
Sbjct  409   RYSVGKPASMQMRDLRPADFDPREKFWTRFPPEGSKITPPHQSVEFRWKDYCPMVFRHLR  468

Query  1840  RLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPS  2019
             +LF ++ ADYM++IC DD LREL SPGKSGS FYL+ DDRF+IKT+KKSE+KVL++MLPS
Sbjct  469   KLFSVDPADYMVAICGDDALRELSSPGKSGSFFYLTQDDRFMIKTVKKSEVKVLIRMLPS  528

Query  2020  YYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFT  2199
             YY+HV+ +EN+L+TKF+GV+ +     +KVRF+VMGN+F +E  +H R+DLKGSS GR T
Sbjct  529   YYEHVRRYENSLVTKFYGVHCVKPIGGQKVRFIVMGNLFCSEYRIHRRFDLKGSSHGRTT  588

Query  2200  DK--DKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR  2373
             DK   +I+E TTLKDLDL +  R+ +   +  I Q+  D +FLE++ I+DYSLL+GLHFR
Sbjct  589   DKAEAEIDETTTLKDLDLNFVFRLQRHWFKEFILQIKRDCEFLEAERIMDYSLLVGLHFR  648

Query  2374  APEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLR  2553
                                  + +S  G+S    S        S          R    R
Sbjct  649   -------------------DDVSASKMGLSPYIASPNFFGERESFRGGG-----RLSEFR  684

Query  2554  ANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDP---------SEVELFEVY  2706
              +  G +++D +L G   L ++LG NMPA+A   V + E++P         +  +  E+Y
Sbjct  685   FSVSGCQDMDWILDGWKPL-IRLGANMPARAEH-VLRSESEPCPLIGGGLLTSTQSGEIY  742

Query  2707  DVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             DV+LY GIIDILQ Y++ KKLEH YKSL+ DP SIS ++PKLYS+RF  F+ ++F
Sbjct  743   DVILYFGIIDILQDYDIAKKLEHAYKSLQADPNSISAVDPKLYSRRFQDFISKIF  797



>ref|XP_009408132.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like, 
partial [Musa acuminata subsp. malaccensis]
Length=710

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/662 (47%), Positives = 418/662 (63%), Gaps = 44/662 (7%)
 Frame = +1

Query  598   RTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYD  777
             +  E + PNGD Y G   G +P G GKY  SDG  Y+G+W  G   G+G I W  GA YD
Sbjct  54    KVAEVILPNGDKYYGTLLGNVPEGSGKYIWSDGCIYEGEWRRGMRHGRGNITWPLGAVYD  113

Query  778   GDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRY  957
             G+   GYLHG GT++  D   YKG WK+N++HG+G + + + D+++G W +GV +GHG+Y
Sbjct  114   GEFSGGYLHGNGTYTGPDNLSYKGRWKLNLRHGLGYQTHPSGDIFEGSWIQGVIEGHGKY  173

Query  958   TWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSN  1137
             TW NGNMY G  K G MSG G++ W NGD ++G W+DG+ HG G Y + DG  Y GTW+ 
Sbjct  174   TWPNGNMYVGDMKGGKMSGTGILTWKNGDTYEGNWLDGMMHGFGVYTWIDGGCYVGTWTR  233

Query  1138  GLKDGRGTLYPVGCALDKCKIDGHKEIRRM--------------LSHDSSISKKDAVKPK  1275
             GLKDG+G  YP G  +   +      +R+               + H SS+        +
Sbjct  234   GLKDGKGFFYPKGSKIPTGQELYLNALRKRGLLPDFKRQHHGARILHASSVDMGKMKVIE  293

Query  1276  VKRSISEKIVD-------RFARDSGR--ISRR-AVSVAGDAAL-HCSSTEVLPEDASCML  1422
              + S S   +         F R   +  + RR ++ VA +  + H ++ E + E+   ++
Sbjct  294   TQESDSSLTISIPKGRSINFDRSRAKHVLERRWSLEVAIEKVIGHVTTLESVAENDEKVI  353

Query  1423  SHTTCDGKAEQLGNITVAYEREYMQGVLIRERIKSVDGL--SHQSTQRRKFPAKEVRKGS  1596
                          NI +  EREYMQGVLI E + +   L    +  +R+K   KE++K  
Sbjct  354   DM-----------NIPIL-EREYMQGVLISEIVINNSFLMSPRKGKRRQKRLMKEIKK-P  400

Query  1597  CMDLFKGRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTP  1776
                + KG +SY LML+LQLGIRY+VGKITPI  REVR SDFG +A  +M FPR+GS+LTP
Sbjct  401   GETIIKGHRSYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFRMNFPREGSQLTP  460

Query  1777  PHRSIDFYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDD  1956
             PH + DF WKDYCP+VFRNLR +FK++ ADYMMSIC    LREL SPGKSGSIF+LS DD
Sbjct  461   PHCAEDFKWKDYCPMVFRNLREMFKIDTADYMMSICGCAALRELSSPGKSGSIFFLSQDD  520

Query  1957  RFVIKTLKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMF  2136
             RF+IKTL+KSE+KVLL+MLP YY HV+ +ENTLITKFFG++R+     +K RFVVMGNMF
Sbjct  521   RFMIKTLRKSEVKVLLRMLPDYYHHVRTYENTLITKFFGLHRVKPSGGQKFRFVVMGNMF  580

Query  2137  YTELHMHHRYDLKGSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQ  2316
              TEL +H R+DLKGSSLGR TD  +I+E TTLKDLDL Y   ++    + L+KQ+  DS+
Sbjct  581   CTELRIHRRFDLKGSSLGRSTDNVEIDENTTLKDLDLDYSFYLEPSWRDALLKQIETDSR  640

Query  2317  FLESQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGG----ISILPRSLT  2484
             FLE+QHI+DYSLLLG+H+RAP HL + +    S+   + T+ S +      IS  P+ L 
Sbjct  641   FLETQHIMDYSLLLGVHYRAPRHLQSYVSYHRSMTSDRLTVQSEEDAQEDEISKYPQGLV  700

Query  2485  LV  2490
             LV
Sbjct  701   LV  702



>gb|KCW89328.1| hypothetical protein EUGRSUZ_A01618 [Eucalyptus grandis]
Length=690

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/611 (49%), Positives = 396/611 (65%), Gaps = 23/611 (4%)
 Frame = +1

Query  616   FPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCFEG  795
              PNG+ Y G   G  P G G Y  SDG  Y+GDW  G   G G+I W SG  Y+G+   G
Sbjct  55    LPNGESYSGSLLGNAPEGFGTYVWSDGCIYEGDWRRGMRHGNGKISWPSGTVYEGEFSGG  114

Query  796   YLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGN  975
             Y+HG GT+   +   YKG W++N++HG+G + + N DV++G W +G+ +G G+Y+W+NGN
Sbjct  115   YIHGEGTYIGIEKLTYKGRWRLNLKHGLGYQIFPNGDVFEGSWIQGMAEGPGKYSWANGN  174

Query  976   MYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGR  1155
             +Y G  K G MSG+G + W NG+LF+G W++G+ HG G Y + DG  Y GTW+ GLKDG+
Sbjct  175   VYFGNMKGGKMSGKGTLTWVNGNLFEGSWLNGMMHGFGVYTWNDGGCYVGTWTRGLKDGK  234

Query  1156  GTLYPVGC-----------------ALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKR  1284
             G+ YP G                   L   K   H  I    S D    K        + 
Sbjct  235   GSFYPKGSRFPPVQELYLNAMRKRGLLPDMKKPNHSHIHHASSVDMGHMKVGGDWGVHRH  294

Query  1285  SISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGN  1464
             S S+K+      +  +     VS+    +L  S  +V+  D+S   S +  DG  E   +
Sbjct  295   SSSDKMSKGNLLNLEQSRGSNVSLQRRWSLEVSIEKVIGHDSSLGSSESFLDGGEEAEAD  354

Query  1465  ITVAYEREYMQGVLIRERI---KSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYL  1635
             I +  EREYMQGVLI E +   K          +++KF  + +  G    +FKG +SY L
Sbjct  355   IPI-LEREYMQGVLISEVVLDNKFSPSSRRARRRQKKFAKEAIMLGEA--IFKGHRSYDL  411

Query  1636  MLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYC  1815
             ML+LQLGIRY+VGKITPI  REVR SDFG +A   M FPR+GS+LTPPH+S DF WKDYC
Sbjct  412   MLSLQLGIRYTVGKITPIQKREVRASDFGPRASFWMNFPREGSQLTPPHQSEDFKWKDYC  471

Query  1816  PIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELK  1995
             P+VFRNLR +FK++AADYM+SIC +D LREL SPGKSGS+F+LS DDRF+IKTL+KSE+K
Sbjct  472   PMVFRNLREMFKIDAADYMISICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVK  531

Query  1996  VLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLK  2175
             VLL+MLP+YY HV+ ++NTLITKFFG++RI     +K RFVVMGNMF TEL +H R+DLK
Sbjct  532   VLLRMLPNYYHHVQTYDNTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRRFDLK  591

Query  2176  GSSLGRFTDKDKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLL  2355
             GSSLGR  DK +I+E T LKDLDL Y   +     E L++Q+ +D++FLE+QHI+DYSLL
Sbjct  592   GSSLGRSADKVEIDENTILKDLDLNYCFYLQPSWQEALMQQIEIDAKFLEAQHIMDYSLL  651

Query  2356  LGLHFRAPEHL  2388
             LG+H+RAP+HL
Sbjct  652   LGVHYRAPQHL  662


 Score = 80.9 bits (198),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  610  KVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDCF  789
            ++FPNGDV+ G +   +  G GKY+ ++G  Y G+ + GKM+GKG + W +G  ++G   
Sbjct  145  QIFPNGDVFEGSWIQGMAEGPGKYSWANGNVYFGNMKGGKMSGKGTLTWVNGNLFEGSWL  204

Query  790  EGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
             G +HGFG ++ +DG  Y G W   ++ G G
Sbjct  205  NGMMHGFGVYTWNDGGCYVGTWTRGLKDGKG  235



>ref|XP_004142482.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Cucumis 
sativus]
 gb|KGN52322.1| hypothetical protein Csa_5G623850 [Cucumis sativus]
Length=756

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/766 (42%), Positives = 445/766 (58%), Gaps = 76/766 (10%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK  PNGD Y G +   +PHG GKY  +DG  Y G+W +GK  GKG+  W SGATY+GD 
Sbjct  52    EKAIPNGDFYTGQWMDNMPHGHGKYLWTDGCMYVGEWYKGKTLGKGKFSWPSGATYEGDF  111

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++ S G  Y+G W MN++HG G + Y N D Y+G W+ G +DG GRY W 
Sbjct  112   KSGYMDGKGTYTGSSGDTYRGCWVMNLKHGQGTQNYANGDYYEGEWRRGFQDGQGRYQWK  171

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             N N Y G WK G ++G G M W NG+ +DG W DGL  G+G +R+ADGS Y G WS    
Sbjct  172   NENHYIGQWKNGKINGNGTMIWNNGNRYDGCWEDGLPKGNGTFRWADGSCYVGVWSKDPT  231

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSI---SEKIVDRFA  1317
             +  GT YP   +  +   D  +     L+        D V    +R +   S+K++    
Sbjct  232   EQTGTFYPSDSSETEMSSDPQEIFAEYLN--------DFVLCSGERILIYPSQKMISWSG  283

Query  1318  RDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQ--LGNITVAYEREY  1491
              D     ++ +S  G+             D +  L  T+ DGK       ++        
Sbjct  284   LDLDSPQKQTISKKGN-------------DGNRRLRRTSVDGKVSNSSFESLNDGSNEAS  330

Query  1492  MQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSV  1671
              +  +   +++ +D    + +  R  PAK  R+G  + + KG K+Y LMLNLQLGIR+SV
Sbjct  331   SRNGIGTHQLQDLDSKGKRQSNLRFQPAK--RQG--ITISKGHKNYELMLNLQLGIRHSV  386

Query  1672  GKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFK  1851
             G+  P    +++ S F  + ++   FP +GS+ TPPH+S DF WKDYCP+VFR LR+LFK
Sbjct  387   GRPAPATSLDLKSSAFDPKEKVWTKFPPEGSKYTPPHQSSDFRWKDYCPVVFRTLRKLFK  446

Query  1852  LNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKH  2031
             ++ ADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT++K+E+KVLL+MLP+YYKH
Sbjct  447   VDPADYMLSICGNDALRELSSPGKSGSFFYLTHDDRYMIKTMRKAEVKVLLRMLPAYYKH  506

Query  2032  VKDHENTLITKFFGVY--RISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDK  2205
             V+  ENTL+TKF+G++  R++   +KKVRFV+MGN+F +E  +H R+DLKGSS GR TDK
Sbjct  507   VRSFENTLVTKFYGLHCVRLTGTSQKKVRFVIMGNLFCSEYTIHRRFDLKGSSHGRITDK  566

Query  2206  D--KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAP  2379
                +I+  TTLKDLDL Y  R+ K+  +   +Q+  D  FLE + I+DYSLL+GLHF+  
Sbjct  567   PEAEIDGTTTLKDLDLNYIFRLQKIWFQEFCRQVDKDCDFLEQERIMDYSLLVGLHFQ--  624

Query  2380  EHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRAN  2559
                       ++ ++  ST                            PG H  G      
Sbjct  625   ----------ETSYREVST----------------------------PGSHHSGSNPDYE  646

Query  2560  SVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEV--ELFEVYDVVLYLGII  2733
             + G    D          + LG+N+PA+A R V+Q E +   V     E+YDV+++ GII
Sbjct  647   ADGQLRADKEQDSARWASISLGINLPARAERTVRQGEPEAQLVGEPTGELYDVIIFFGII  706

Query  2734  DILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             DILQ Y++ KKLEH YKS ++DP SIS ++PK YSKRF  F+ R+F
Sbjct  707   DILQDYDISKKLEHAYKSFQYDPSSISAVDPKQYSKRFRDFIFRIF  752



>ref|XP_006494071.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like isoform 
X1 [Citrus sinensis]
Length=777

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/773 (43%), Positives = 462/773 (60%), Gaps = 72/773 (9%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             E+V  NGD Y G +   LPHG+GKY  +DG  Y G+W  GK  GKG+  W SGATY+GD 
Sbjct  55    ERVLANGDFYTGQWADNLPHGQGKYLWTDGCMYVGEWYRGKTMGKGKFSWPSGATYEGDF  114

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++ S G+ YKG W MN++HG G K + N D Y+G W+ G++DGHGRY W 
Sbjct  115   KGGYMDGIGTYTGSVGNTYKGSWIMNLKHGKGTKSFSNGDYYEGEWRRGLQDGHGRYQWK  174

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G ++G G M W  G+ +DGFW DGL  G+G +R+ADGS+Y G WS   K
Sbjct  175   NGNHYIGQWKNGMINGNGTMIWSCGNRYDGFWEDGLPKGNGTFRWADGSFYVGVWSKDPK  234

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVK----------PKVKRSISE  1296
             +  GT YP G        D        L+ DS I + + +           P +   +++
Sbjct  235   EQNGTYYPSGSPAGDLDWDPQHVYLVDLT-DSKICQGEKISILPSQKMTNWPGIAGEVNQ  293

Query  1297  K-IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
             K +V R   D GR  R +V    D  L   S   L  D S  +            G++ +
Sbjct  294   KQLVYRRWNDGGRPKRMSV----DERL---SNYSLDTDGSLNVYTN---------GDVDL  337

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
                 E M      E ++  D  S       K P    ++G    + +G K+Y LMLNLQL
Sbjct  338   RNSEEGM------ENLQLDDLDSGGGRVVLKLPPTPKKQGET--IARGHKNYELMLNLQL  389

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIR+SVG+  P    +++ S F  + ++   FP +GS+ TPPH+S +F WKDYCP+VFR 
Sbjct  390   GIRHSVGRPAPATSLDLKASAFDPKEKVWTKFPPEGSKHTPPHQSCEFKWKDYCPVVFRT  449

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR+LF ++AADYM+SIC +D LREL SPGKSGS FYL+ DD+++IKT+KK+E+KVL++ML
Sbjct  450   LRKLFNVDAADYMISICGNDALRELSSPGKSGSFFYLTNDDKYMIKTMKKAEVKVLIRML  509

Query  2014  PSYYKHVKDHENTLITKFFGVYRISL--RRRKKVRFVVMGNMFYTELHMHHRYDLKGSSL  2187
             P+YY HV+  ENTL+TKFFG++ + L    +KKVRFV+MGN+F +E  +H R+DLKGSS 
Sbjct  510   PAYYNHVRAFENTLVTKFFGLHCVKLTGTAQKKVRFVIMGNLFCSEYVIHRRFDLKGSSH  569

Query  2188  GRFTDKDK--IEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             GR T K +  ++  TTLKDLDL +  R+ K+  +   +Q+  D  FLE + I+DYSLL+G
Sbjct  570   GRTTAKPQTAVDPTTTLKDLDLNFIFRLQKVWFQEFCRQVDRDCDFLEQERIMDYSLLIG  629

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRG  2541
             +HFR        +   DS   P+++ V +       PR    + +EP+    AP      
Sbjct  630   VHFR------EAVSYRDSHTPPRTSGVRT-------PRGNAELDNEPA----AP------  666

Query  2542  KTLRANSVGDREVD-LLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEV--ELFEVYDV  2712
                R + V   ++D LLL  T    ++LGVNMPA+  + V++++ +   +     E+YDV
Sbjct  667   ---RLSRV---DMDQLLLDPTRWASIKLGVNMPARVEQTVRRNDCETQLIGEPTGELYDV  720

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             +LY GIIDILQ Y++ KKLEH YKS+++DP SIS ++P+ YS+RF  F+ R F
Sbjct  721   ILYFGIIDILQDYDISKKLEHAYKSMQYDPTSISAVDPRQYSRRFRDFIYRAF  773



>gb|KDO58858.1| hypothetical protein CISIN_1g004035mg [Citrus sinensis]
Length=777

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/773 (42%), Positives = 461/773 (60%), Gaps = 72/773 (9%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             E+V  NGD Y G +   LPHG+GKY  +DG  Y G+W  GK  GKG+  W SGATY+GD 
Sbjct  55    ERVLANGDFYTGQWADNLPHGQGKYLWTDGCMYVGEWYRGKTMGKGKFSWPSGATYEGDF  114

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++ S G+ YKG W MN++HG G K + N D Y+G W+ G++DGHGRY W 
Sbjct  115   KGGYMDGIGTYTGSVGNTYKGSWIMNLKHGKGTKSFSNGDYYEGEWRRGLQDGHGRYQWK  174

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G ++G G M W  G+ +DGFW DGL  G+G +R+ADGS+Y G WS   K
Sbjct  175   NGNHYIGQWKNGMINGNGTMIWSCGNRYDGFWEDGLPKGNGTFRWADGSFYVGVWSKDPK  234

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVK----------PKVKRSISE  1296
             +  GT YP G        D        L+ DS I + + +           P +   +++
Sbjct  235   EQNGTYYPSGSPAGDLDWDPQHVYLVDLT-DSKICQGEKISILPSQKMTNWPGIAGEVNQ  293

Query  1297  K-IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
             K +V R   D GR  R +V    D  L   S   L  D S  +            G++ +
Sbjct  294   KQLVYRRWNDGGRPKRMSV----DERL---SNYSLDTDGSLNVYTN---------GDVDL  337

Query  1474  AYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQL  1653
                 E M      E ++  D  S       K P    ++G    + +G K+Y LMLNLQL
Sbjct  338   RNSEEGM------ENLQLDDLDSGGGRVVLKLPPTPKKQGET--IARGHKNYELMLNLQL  389

Query  1654  GIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRN  1833
             GIR+SVG+  P    +++ S F  + ++   FP +GS+ TPPH+S +F WKDYCP+VFR 
Sbjct  390   GIRHSVGRPAPATSLDLKASAFDPKEKVWTKFPPEGSKHTPPHQSCEFKWKDYCPVVFRT  449

Query  1834  LRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKML  2013
             LR+LF ++AADYM+SIC +D LREL SPGKSGS FYL+ DD+++IKT+KK+E+KVL++ML
Sbjct  450   LRKLFNVDAADYMISICGNDALRELSSPGKSGSFFYLTNDDKYMIKTMKKAEVKVLIRML  509

Query  2014  PSYYKHVKDHENTLITKFFGVYRISLR--RRKKVRFVVMGNMFYTELHMHHRYDLKGSSL  2187
             P+YY HV+  ENTL+TKFFG++ + L    +KKVRFV+MGN+F +E  +H R+DLKGSS 
Sbjct  510   PAYYNHVRAFENTLVTKFFGLHCVKLTGTAQKKVRFVIMGNLFCSEYVIHRRFDLKGSSH  569

Query  2188  GRFTDKDK--IEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
             GR T K +  ++  TTLKDLDL +  R+ K+  +   +Q+  D  FLE + I+DYSLL+G
Sbjct  570   GRTTAKPQTAVDPTTTLKDLDLNFIFRLQKVWFQEFCRQVDRDCDFLEQERIMDYSLLIG  629

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRG  2541
             +HFR        +   DS   P+++   +       PR    + +EP+    AP      
Sbjct  630   VHFRE------AVSYRDSHTPPRTSGART-------PRGNAELDNEPA----AP------  666

Query  2542  KTLRANSVGDREVD-LLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEV--ELFEVYDV  2712
                R + V   ++D LLL  T    ++LGVNMPA+  + V++++ +   +     E+YDV
Sbjct  667   ---RLSRV---DMDQLLLDPTRWASIKLGVNMPARVEQTVRRNDCETQLIGEPTGELYDV  720

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             +LY GIIDILQ Y++ KKLEH YKS+++DP SIS ++P+ YS+RF  F+ R F
Sbjct  721   ILYFGIIDILQDYDISKKLEHAYKSMQYDPTSISAVDPRQYSRRFRDFIYRAF  773



>ref|XP_008375376.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Malus 
domestica]
Length=766

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/786 (42%), Positives = 455/786 (58%), Gaps = 102/786 (13%)
 Frame = +1

Query  604   DEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGD  783
             DEKV  NGD Y G +     HG+GKY  +DG  Y G+W++GK  GKG+  W  GATY+G+
Sbjct  49    DEKVLANGDFYTGQWVDDYAHGQGKYLWTDGCMYVGEWQKGKTAGKGKFSWPCGATYEGE  108

Query  784   CFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTW  963
                GY+ G GT+  S G  Y+G W MN+++G G K + N D Y+G W+ G++DG GRY W
Sbjct  109   FKNGYMDGKGTYIGSCGDTYRGSWVMNLKYGQGTKSFVNGDYYEGEWRRGLQDGQGRYQW  168

Query  964   SNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGL  1143
              NGN Y G W+ G + G G M W NG+ +DG W +GL  G+G +R+ADGS+Y G WS   
Sbjct  169   KNGNHYIGQWRHGKIHGNGTMIWSNGNRYDGSWEEGLPKGNGTFRWADGSFYVGVWSKES  228

Query  1144  KDGRGTLYPVGCA---------------LDKCKIDGHKEIRRMLSHDS----SISKKDAV  1266
             K+  GT YP G +               L+ CK+   + I    S  +     I  +   
Sbjct  229   KEQNGTYYPAGSSGGHVDWDPQEMFAVDLNDCKVCPQETISMYPSQKTLSWPGIEGEFLN  288

Query  1267  KPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
             K  + ++ +E  V       GR S  + S  GD+                       DG 
Sbjct  289   KQHIYKNGNEGNVRPRRSSDGRASNYSRSSNGDSMF---------------------DGA  327

Query  1447  AEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKS  1626
                  +    +E   ++G + +       G+ HQ  + +  P K  R+G  + + KG K+
Sbjct  328   DRSSRDGNAGFE---LEGSVAK-------GIRHQHLKVQ--PMK--RQG--VTIAKGHKN  371

Query  1627  YYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWK  1806
             Y LMLNLQLGIR+SVG+  P    +++ S F  + ++   FP +GS+ TPPH+S DF WK
Sbjct  372   YELMLNLQLGIRHSVGRPAPTTSLDLKTSAFDPKEKVWTKFPPEGSKYTPPHQSCDFRWK  431

Query  1807  DYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKS  1986
             DYCP+VFR LR+LFK++ ADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+KK+
Sbjct  432   DYCPVVFRTLRKLFKVDPADYMISICGNDALRELSSPGKSGSFFYLTNDDRYMIKTMKKA  491

Query  1987  ELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISL--RRRKKVRFVVMGNMFYTELHMHH  2160
             E+KVLL+MLP+YY HV+  ENTL+TKF+G++ + L    +KKVRFV+MGN+F +E  +H 
Sbjct  492   EVKVLLRMLPAYYNHVRSFENTLVTKFYGLHCVKLTGTAQKKVRFVIMGNLFCSEFAIHR  551

Query  2161  RYDLKGSSLGRFTDK--DKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQH  2334
             R+DLKGSSLGR TDK   +I+  TTLKDLDL Y  R+ K+  +   +Q+  D  FLE + 
Sbjct  552   RFDLKGSSLGRTTDKPESEIDATTTLKDLDLNYIFRLQKVWFQEFCRQVDRDCDFLEHER  611

Query  2335  IIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVS  2514
             I+DYSLL+GLHFR      +  E P +                            P   S
Sbjct  612   IMDYSLLVGLHFRE----ASCTENPKT----------------------------PDRTS  639

Query  2515  TAPGPHIRGK----TLRANSVGDREVDLLLPGTGRL-RVQLGVNMPAQANRKVKQDETDP  2679
              A  P   G     T R + V   ++D LL    R   + LG+NMPA A R V++++ +P
Sbjct  640   GARTPTGNGDPDNGTPRLSKV---DMDRLLSDPNRRSSISLGINMPAWAERTVRRNDCEP  696

Query  2680  SEV--ELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFIS  2853
               V     E+YDV+L+ GIIDILQ Y++ KKLEH YKS ++DP SIS ++PKLYSKRF +
Sbjct  697   QLVGDPTGELYDVILFFGIIDILQDYDISKKLEHAYKSFQYDPTSISAVDPKLYSKRFRA  756

Query  2854  FLERVF  2871
             F+ RVF
Sbjct  757   FVFRVF  762



>ref|XP_010547360.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Tarenaya 
hassleriana]
Length=713

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/768 (42%), Positives = 444/768 (58%), Gaps = 94/768 (12%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK  P+GD Y G ++  LPHG GKY  +DG  Y G+W  GK  GKG+  W SGATY+GD 
Sbjct  23    EKALPSGDFYTGQWRDNLPHGHGKYLWTDGCMYVGEWCRGKTMGKGRFSWPSGATYEGDF  82

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT+    G  Y+G W MN++HG G K Y N D Y+G W+ G++DGHGRY W 
Sbjct  83    KNGYMDGKGTYIGPCGDTYRGSWVMNLRHGQGTKNYDNGDGYEGEWRRGLQDGHGRYQWK  142

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G M+G G M W NG+ +DGFW DG   G+G +R+A+GS+Y G WS   K
Sbjct  143   NGNHYIGQWKNGIMNGNGTMIWSNGNRYDGFWEDGAPKGNGTFRWAEGSFYVGVWSKDPK  202

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKD--AVKPKVKRSI---SEKIVDR  1311
             +  GT YP   +      D  +     LS +  +S+ D   V P  K  +    E+  +R
Sbjct  203   EQNGTYYPSSSSSGNLDWDPQQVFYVDLS-ECLVSQCDRIPVLPSQKMPVWYGVEQTGNR  261

Query  1312  FARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREY  1491
                ++ R  RR+V                             DG+   + N+    +  +
Sbjct  262   AKNENNRPRRRSV-----------------------------DGR---ISNVEADMKNGF  289

Query  1492  MQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSV  1671
               G L  +     +  +  S  R + P K+ +  S     KG K+Y LMLNLQLGIR+SV
Sbjct  290   --GYLQLDDSVCAEENTRLSPLRIQLPKKQGQTIS-----KGHKNYELMLNLQLGIRHSV  342

Query  1672  GKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFK  1851
             G+  P    +++ S F  + ++   FP +GS+ TPPH+S +F WKDYCP+VFR LR+LF 
Sbjct  343   GRPAPATSLDLKASAFDPKEKVWTKFPPEGSKHTPPHQSCEFKWKDYCPVVFRTLRKLFN  402

Query  1852  LNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKH  2031
             ++AADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+KK+E KVL++MLP+YY H
Sbjct  403   VDAADYMISICGNDALRELSSPGKSGSFFYLTNDDRYMIKTMKKAETKVLIRMLPAYYNH  462

Query  2032  VKDHENTLITKFFGVYRISL--RRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDK  2205
             V+  ENTL+TKFFG++ + L    +KKVRFV+MGN+F TE  +H R+DLKGSS GR T K
Sbjct  463   VRACENTLVTKFFGLHCVKLTGTAQKKVRFVIMGNLFCTEYSIHRRFDLKGSSHGRLTTK  522

Query  2206  --DKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR-A  2376
                +I+  TTLKDLDL +  R+ K  ++   +Q+  D +FLE + I+DYSLL+G+HFR A
Sbjct  523   PESEIDPNTTLKDLDLNFIFRLQKNWYQEFCRQVDRDCEFLEQERIMDYSLLVGMHFREA  582

Query  2377  PEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRA  2556
                 TA          P S   +  G +  L R+                          
Sbjct  583   STRGTAT---------PPSGARTPTGNVPRLSRA--------------------------  607

Query  2557  NSVGDREVDLLLPGTGRL-RVQLGVNMPAQANRKVKQDETDPSEV--ELFEVYDVVLYLG  2727
                   E+D  L    RL  ++LG+NMP +  R V++++ +   V     E YDV+LY G
Sbjct  608   ------EIDRFLLDASRLASIKLGINMPVRVERTVRRNDCEAQLVGDPAGEFYDVILYFG  661

Query  2728  IIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             IIDILQ Y++ KKLEH YKS+++DP SIS ++PK YS+RF  F+ RVF
Sbjct  662   IIDILQDYDISKKLEHAYKSMQYDPTSISAVDPKQYSRRFRDFIFRVF  709



>ref|XP_011020411.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Populus 
euphratica]
Length=790

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/793 (43%), Positives = 466/793 (59%), Gaps = 102/793 (13%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK+  NGD Y G +   LPHG GKY  +DG  Y G+W +GK  GKG+  W SGATY+G+ 
Sbjct  58    EKILSNGDFYTGQWLDNLPHGHGKYLWTDGCMYLGEWYKGKTMGKGKFSWPSGATYEGEF  117

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++ S G  ++G+W MN++HG G + Y N D YDG W+ G +DGHGRY W 
Sbjct  118   KGGYMDGRGTYTGSSGDTFRGYWVMNLKHGNGTQSYANGDYYDGDWRRGSQDGHGRYQWK  177

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             + N Y G WK G M+G G M W NG+ +DGFW DGL  G+G +R+ DGS+Y G WS   K
Sbjct  178   SSNHYIGQWKTGLMNGSGTMIWSNGNRYDGFWQDGLPRGNGSFRWPDGSFYVGFWSKDPK  237

Query  1147  DGRGTLYPVGCA--------------LDKCKIDGHKEI-----RRMLSHDSSISKKDAVK  1269
             +  GT YP G                L+ CKI   +++     ++MLS    + + +A K
Sbjct  238   EQNGTYYPSGSVSENLDWDPQELFLDLNDCKIATCEKMSILPSQKMLSWPGVLDQGNA-K  296

Query  1270  PKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK-  1446
             P VKR+ +E  + R + D GR+S  +V     A+L            SC +S    DG+ 
Sbjct  297   P-VKRNANEGRLRRISVD-GRLSNYSV-----ASLD-----------SCDVSSGCGDGEL  338

Query  1447  ---AEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
                 E  GN+                    V+ L  +  + R  P K  ++G  +   KG
Sbjct  339   RDVKEGFGNL-------------------QVEELDPKIYKLRTQPVK--KQGETIS--KG  375

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              K+Y LMLNLQLGIR+SVG+  P    +++ S F  + ++   FP +GS+ TPPH+S +F
Sbjct  376   HKNYELMLNLQLGIRHSVGRPAPAISLDLKSSAFDPKEKVWTKFPPEGSKHTPPHQSSEF  435

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
              WKDYCP+VFR LR+LF ++AADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+
Sbjct  436   KWKDYCPVVFRTLRKLFNVDAADYMLSICGNDALRELSSPGKSGSFFYLTNDDRYMIKTI  495

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLR--RRKKVRFVVMGNMFYTELH  2151
             KK+E+KVLL+MLP+YY HV+  +NTL+TKF+G++ + L    +KKVRFV+MGN+F +E  
Sbjct  496   KKAEVKVLLRMLPAYYNHVRAFKNTLVTKFYGLHCVKLTGPNQKKVRFVIMGNLFCSEFS  555

Query  2152  MHHRYDLKGSSLGRFTDK--DKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLE  2325
             +H R+DLKGSS GR T K   +I+  TTLKDLDL Y  R+ K   +   +Q+  D  FLE
Sbjct  556   IHRRFDLKGSSHGRITSKPESEIDPTTTLKDLDLNYIFRLQKSWFQEFCRQVDRDCDFLE  615

Query  2326  SQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPS  2505
              + I+DYSLL+GLHF+      AL               S   GI   P   T     P+
Sbjct  616   QERIMDYSLLVGLHFQEASGREALTP-------------SRASGIRTPPGIRT-----PT  657

Query  2506  IVSTAPGPHI-RGKTLRANSVGDR----EVDLLLPGTGR-LRVQLGVNMPAQANRKVKQD  2667
              V T  G H   G    + S   R    ++D L     R   ++LG+NMPA+  +  K+D
Sbjct  658   GVRTPTGLHTPTGIGDESESGAPRLSRVDLDKLFMDPSRWASIKLGINMPARVEKTRKRD  717

Query  2668  ETDPSEVELFE-----VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKL  2832
                 SE +L       +++VVL+ GIIDILQ Y++ KKLEH YKS+++DP SIS ++PK 
Sbjct  718   ----SEAQLIGEPTGVLHEVVLFFGIIDILQDYDISKKLEHAYKSMQYDPTSISAVDPKQ  773

Query  2833  YSKRFISFLERVF  2871
             YSKRF  F+ RVF
Sbjct  774   YSKRFRDFIFRVF  786



>ref|XP_010645598.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Vitis 
vinifera]
Length=787

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/776 (43%), Positives = 453/776 (58%), Gaps = 70/776 (9%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EKV  NGD Y G +   LPHG GKY  +DG  Y G+W  GK  GKG+  W SGATY+G+ 
Sbjct  57    EKVLSNGDFYTGQWSDNLPHGHGKYLWTDGCMYVGEWVRGKTNGKGRFSWPSGATYEGEF  116

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++ + G  YKG W MN++HG G K Y N D Y+G W+ G ++G GRY W 
Sbjct  117   KAGYMDGKGTYTGASGDTYKGSWVMNLKHGEGTKSYANGDYYEGDWRRGFQEGQGRYQWK  176

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G W+ G +SG G M W NG+ +DG W DGL  G+G +R+ADGS+Y G WS   K
Sbjct  177   NGNHYIGQWRNGMISGNGTMIWANGNRYDGVWEDGLPKGNGTFRWADGSFYVGMWSKDPK  236

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVK----------PKVKRSISE  1296
             +  GT YP G      + D  +E+  +  +D  I+  + V           P +     +
Sbjct  237   EQTGTYYPSGSPTGHMEWD-PQELFSVELNDCKINPGENVSILPLQKMLNWPGLDGEFLQ  295

Query  1297  K--IVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNIT  1470
             K  I      + G +  R +SV G    H         +    +S    DG      N  
Sbjct  296   KQPIWKPSKGNDGSVRPRRMSVDGRVNYHSW-------EGDGDVSFDIVDG------NSL  342

Query  1471  VAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQ  1650
             +  + +   G L   +++  D    +  Q R  P K  R+G  +   KG K+Y LMLNLQ
Sbjct  343   MGRDVDEGLGSL---QLEDPDLTETRQQQIRLQPMK--RQGETIS--KGHKNYELMLNLQ  395

Query  1651  LGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFR  1830
             LGIR+SVG+  P    +++ S F  + ++   FP +GS+ TPPH+S DF WKDYCP+VFR
Sbjct  396   LGIRHSVGRPAPSTSLDLKSSAFDPKEKVWTKFPPEGSKHTPPHQSSDFRWKDYCPLVFR  455

Query  1831  NLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKM  2010
              LR+LFK++ ADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+KKSE+KVLL+M
Sbjct  456   TLRKLFKVDPADYMISICGNDALRELSSPGKSGSFFYLTNDDRYMIKTMKKSEVKVLLRM  515

Query  2011  LPSYYKHVKDHENTLITKFFGVYRISLR--RRKKVRFVVMGNMFYTELHMHHRYDLKGSS  2184
             LP+YY HV+  ENTL+TKF+G++ + L    +KKVRFV+MGN+F +E  +H R+DLKGSS
Sbjct  516   LPAYYNHVRAFENTLVTKFYGLHCVKLTGAAQKKVRFVIMGNLFCSEYAIHRRFDLKGSS  575

Query  2185  LGRFTDKD--KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
              GR TDK   +I+  TTLKDLDL +  R+ K   +   +Q+  D   LE + I+DYSLL+
Sbjct  576   HGRTTDKPEAEIDATTTLKDLDLNFIFRLQKAWFQEFCRQVDRDCDLLEQERIMDYSLLV  635

Query  2359  GLHFR-APEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPG---  2526
             GLHFR AP   T     P  +  P         GI             P+ + T  G   
Sbjct  636   GLHFREAPGTRT-----PSGIRTPS--------GIRT-----------PTGIRTPTGNGD  671

Query  2527  PHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQ-DETDPSEVELFEV  2703
             P I G   R + V   ++D LL    R  ++LG+NMPA+  + V++ DET        E 
Sbjct  672   PDIDGAAPRLSGV---DMDKLLLDR-RSSIRLGINMPARVEKTVRRGDETQLIGEPTGEF  727

Query  2704  YDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             Y+VVL+ GIIDILQ Y++ KKLEH YKS +FDP SIS ++PK YSKRF  F+ R F
Sbjct  728   YEVVLFFGIIDILQDYDISKKLEHAYKSFQFDPTSISAVDPKQYSKRFRDFIFRAF  783



>ref|XP_010926980.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Elaeis 
guineensis]
Length=793

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/766 (42%), Positives = 450/766 (59%), Gaps = 60/766 (8%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             E++ PNGD Y G +   LPHG GKY  +DG  Y+G+W  GK TG+G+  W SGATY+G+ 
Sbjct  73    ERLLPNGDFYTGQWAAGLPHGTGKYLWTDGCMYEGEWRHGKTTGRGKFSWPSGATYEGEF  132

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               G++ G GT++   G  Y+G W MN++HG GRK Y N D YDG W+ G +DG GRY W 
Sbjct  133   KAGFMDGIGTYTGPSGDTYRGGWSMNLKHGPGRKSYANGDHYDGDWRSGAQDGQGRYIWR  192

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NG  YTG W+ G + G+G + + NG+ +DG W DG+  G+G +R+ADGS Y G WS    
Sbjct  193   NGTEYTGQWRAGLLHGKGSLVFANGNRYDGGWEDGVPSGNGSFRWADGSLYVGIWSKDDA  252

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARDS  1326
             + +G  YP   A      D  +     L        +       ++++S   +++     
Sbjct  253   EHKGVYYPSPAATSPTARDPQEAFAAELPECRICPGEIVSILPSQKTVSCSGLEQAGSKP  312

Query  1327  GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGVL  1506
                 RR  SV   A      T       +      TCD       ++     RE +  V+
Sbjct  313   PLRPRRRASVDTAAGAAGGPTR----RPNGRTKTITCD--IVDGSSVVGGGGREEVDDVV  366

Query  1507  IRERIKSVDG----LSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVG  1674
             +  R +SVD     L   + Q+ ++P K  RK     + KG K+Y LMLNLQLGIR++VG
Sbjct  367   MAGR-RSVDVDPRVLRTLAPQQVRWPPKTPRKQGDT-ISKGHKNYELMLNLQLGIRHAVG  424

Query  1675  KITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKL  1854
             K + +   E++ S F  + ++   FP +GS+ TPPH+S +F WKDYCP+VFR LR+LFK+
Sbjct  425   KQS-LASSELKASAFDPKEKVWTKFPPEGSKHTPPHQSCEFRWKDYCPLVFRTLRKLFKV  483

Query  1855  NAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHV  2034
             +AADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+KKSE+KVLL+MLP+YY HV
Sbjct  484   DAADYMISICGNDALRELSSPGKSGSFFYLTNDDRYMIKTMKKSEVKVLLRMLPAYYNHV  543

Query  2035  KDHENTLITKFFGVYRISL--RRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDK-  2205
             +++ENTL+TKFFG++ + L    +KKVRFV+MGN+F +E  +H R+DLKGSS GR T K 
Sbjct  544   RNYENTLVTKFFGLHCVKLTGATQKKVRFVIMGNLFCSEFAVHRRFDLKGSSHGRTTTKP  603

Query  2206  -DKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPE  2382
               +I+E TTLKDLDL +  R+     +   +Q+  D +FLE++ I+DYSLL+G+HFR P 
Sbjct  604   ESEIDEYTTLKDLDLNFIFRLQGSFFQDFQRQVEKDCEFLEAERIMDYSLLVGVHFRGPS  663

Query  2383  HLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANS  2562
              +                L   +G I                   AP PH+         
Sbjct  664   EM---------------PLAEGNGEI--------------GSKKEAP-PHLSRAI-----  688

Query  2563  VGDREVDLLLPGTGRLRV-QLGVNMPAQANRKVKQDETDPSEV--ELFEVYDVVLYLGII  2733
                  VD  L    RL + +LGVNMPA+A   V++++++P  +     E YDVVL  GII
Sbjct  689   -----VDQFLYDPARLAMSRLGVNMPARAELTVRRNDSEPQLIGEPTGEFYDVVLIFGII  743

Query  2734  DILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             DILQ Y++ KKLEH YKS+++DP SIS ++PK Y+KRF  F+ + F
Sbjct  744   DILQDYDISKKLEHAYKSIQYDPTSISAVDPKQYAKRFRDFIFKAF  789



>ref|XP_004250336.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 2 [Solanum 
lycopersicum]
Length=818

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/777 (44%), Positives = 455/777 (59%), Gaps = 72/777 (9%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK  PNGD+YIG F G  PHG GKY   DG  Y+G+W+ GK +GKG+  W SGAT++G+ 
Sbjct  88    EKHLPNGDLYIGSFSGSSPHGSGKYLWKDGCMYEGEWKRGKASGKGKFSWPSGATFEGEF  147

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               G + G GTF  SDG +YKG W  + +HG G+K Y N D Y+G WK  ++DG GRY W 
Sbjct  148   KSGRMEGSGTFIGSDGDMYKGSWSGDRKHGYGQKHYSNGDYYEGLWKRNLQDGQGRYVWK  207

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G++ GRGV+ W NG+ +DG W  G   G G + + DGS Y G WS   K
Sbjct  208   NGNEYVGEWKTGDIHGRGVLIWANGNRYDGNWEAGGPKGHGVFTWPDGSCYIGCWSKDAK  267

Query  1147  DGR-------GTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIV  1305
             + +       GT YP        + + H  +++  S D S +K+D +       ++  ++
Sbjct  268   NQQHQNQILNGTFYPA-----NSRTNSHGSVKKE-SVDFS-AKEDVLGGFFGHKLAAPLM  320

Query  1306  DRFARDSG----RISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
                  D G     + ++  SV G       S   + E     +     DG+A   G+IT 
Sbjct  321   A--DEDCGLLVMNMGKKRSSVDG-------SRGSMTERNFPRICIWESDGEA---GDITC  368

Query  1474  AYEREYMQGVLIRERIK-SVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQ  1650
                      ++ R+      DGL         F  +E + G  +   KG K+Y LMLNLQ
Sbjct  369   DIIDNVEASMIYRDGFGFGRDGLKQFRRNPCCFSKEEKKPGHTIS--KGHKNYDLMLNLQ  426

Query  1651  LGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFR  1830
             LGIRYSVGK   I +R+++ SDF    +    FP +GS+LTPPH+S DF WKDYCP+VFR
Sbjct  427   LGIRYSVGKHASI-LRDLKTSDFDPNEKFWTRFPPEGSKLTPPHQSTDFRWKDYCPVVFR  485

Query  1831  NLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKM  2010
             +LR LF+++ ADYM++IC +D LREL SPGKSGS FYL+ DDRF+IKT+KKSE+KVL+KM
Sbjct  486   HLRELFQVDPADYMLAICGNDALRELSSPGKSGSFFYLTQDDRFMIKTVKKSEVKVLIKM  545

Query  2011  LPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLG  2190
             LPSYY+HV  +ENTL+TKF+GV+ +      K RF+VMGNMF +E  +H R+DLKGSS G
Sbjct  546   LPSYYQHVCRYENTLVTKFYGVHCVKPVGGVKTRFIVMGNMFCSEYRIHRRFDLKGSSHG  605

Query  2191  RFTDKD--KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGL  2364
             R TDK   +I+E TTLKDLDL +  R+ +  +E LIKQ+  D +FLE++ I+DYSLL+GL
Sbjct  606   RTTDKPEGEIDETTTLKDLDLNFVFRLQRNWYEELIKQIDRDCEFLEAERIMDYSLLVGL  665

Query  2365  HFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGK  2544
             HFR       +   P  L   KS    ++                           +RG 
Sbjct  666   HFREDNTGEKMGLSPFLLRNGKSDSFQNE-------------------------KFMRGC  700

Query  2545  TLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF--------E  2700
                   + D  +D +L G   L +QLG NMPA+A R  ++ + D      F        E
Sbjct  701   RFLEAELQD--MDRILAGRKPL-IQLGANMPARAERVARRSDFDQYTPGGFCNVPPSRGE  757

Query  2701  VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VY+VVLY GIIDILQ Y++ KKLEH YKSL+ DP SIS ++PKLYSKRF +F+ R+F
Sbjct  758   VYEVVLYFGIIDILQDYDISKKLEHAYKSLQVDPASISAVDPKLYSKRFRNFIGRIF  814


 Score = 71.6 bits (174),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 50/95 (53%), Gaps = 0/95 (0%)
 Frame = +1

Query  874   GVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFD  1053
             GV  K   N D+Y G +      G G+Y W +G MY G WK+G  SG+G   W +G  F+
Sbjct  85    GVVEKHLPNGDLYIGSFSGSSPHGSGKYLWKDGCMYEGEWKRGKASGKGKFSWPSGATFE  144

Query  1054  GFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
             G +  G   GSG +  +DG  Y G+WS   K G G
Sbjct  145   GEFKSGRMEGSGTFIGSDGDMYKGSWSGDRKHGYG  179



>ref|XP_010269395.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like isoform 
X2 [Nelumbo nucifera]
Length=771

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/781 (42%), Positives = 453/781 (58%), Gaps = 92/781 (12%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK+  NGD Y G +   LPHG GKY  +DG  Y G+W  GK  GKG+  W SGATY+GD 
Sbjct  53    EKMLANGDFYTGQWVDNLPHGNGKYLWTDGCMYVGEWCRGKTNGKGKFSWPSGATYEGDF  112

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++ S G  Y+G W MN++HG G K Y N D YDG W+ G +DG+GRY W 
Sbjct  113   KSGYMDGKGTYTGSSGDTYRGSWVMNLKHGQGVKHYANGDSYDGEWRRGAQDGNGRYQWK  172

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G + G G + W NG+ +DG W DGL  G+G +R++DGS+Y GTWS   K
Sbjct  173   NGNHYIGQWKNGIICGSGTLIWTNGNRYDGSWEDGLPKGNGTFRWSDGSFYVGTWSKDPK  232

Query  1147  DGRGTLYPVGCA----------------LDKCKIDGHKEIRRMLSHDS----SISKKDAV  1266
             +  GT YP G +                L++CKI   +++  + S  S        + + 
Sbjct  233   EQSGTYYPSGASASGNXDWDPREVFSVDLNECKICPGEKVSVLPSQKSVNWPGAEGRSSK  292

Query  1267  KPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
              P   R  S  +  R + D G + R  +S + D  + C        DA+ M S    DG 
Sbjct  293   APDKPRGSS--VDGRGSTDKG-LDRIYISES-DGDITCDIV-----DANSMPSRDGDDG-  342

Query  1447  AEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKS  1626
                +G   V      +Q                   Q +  P +  R+G  +   KG K+
Sbjct  343   ---IGGPQVEDAGARLQ-------------------QLKMQPRETKRQGETIS--KGHKN  378

Query  1627  YYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWK  1806
             Y LMLNLQLGIR+SVG+  PI   +++ S F  + ++   FP +GS+ TPPH+S +F WK
Sbjct  379   YELMLNLQLGIRHSVGRPGPIATLDLKASAFDPKEKVWTKFPPEGSKHTPPHQSCEFRWK  438

Query  1807  DYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKS  1986
             DYCP+VFR LR+LFK++ ADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+KKS
Sbjct  439   DYCPLVFRTLRKLFKVDPADYMISICGNDALRELSSPGKSGSFFYLTNDDRYMIKTMKKS  498

Query  1987  ELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLR--RRKKVRFVVMGNMFYTELHMHH  2160
             E+KVL++MLP+YY HV+  ENTL+T+FFG++ + L    +KKVRFV+MGN+F TE  +  
Sbjct  499   EVKVLIRMLPAYYNHVRAFENTLVTRFFGLHCVKLTGAAQKKVRFVIMGNLFCTEYPIQR  558

Query  2161  RYDLKGSSLGRFTDKD--KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQH  2334
             R+DLKGSS GR TDK   +I+E TTLKDLDL +  R+ +   + L +Q+  D +FLE + 
Sbjct  559   RFDLKGSSHGRTTDKPEAEIDENTTLKDLDLNFIFRLQRTWFQELHRQVDRDCEFLEQER  618

Query  2335  IIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVS  2514
             I+DYSLL+GLHFR                   S+    +G  S +   +    HE    S
Sbjct  619   IMDYSLLVGLHFR------------------DSSYTRDEGRHSSVRTPMGNGDHE----S  656

Query  2515  TAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEV--  2688
                 PH+             ++D L   +    ++LG+NMPA+  + V++ + D   V  
Sbjct  657   EGTAPHLP----------RVDMDHLFDXSRWASIRLGINMPARVEQTVRRSDCDSQLVGE  706

Query  2689  ELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERV  2868
                E  DV+L+ GIIDILQ Y++ KKLEH YKS+++DP SIS ++PK YS+RF  F+ +V
Sbjct  707   PTGEFRDVILFFGIIDILQDYDISKKLEHAYKSIQYDPTSISAVDPKQYSRRFRDFIFKV  766

Query  2869  F  2871
             F
Sbjct  767   F  767



>gb|KDP32752.1| hypothetical protein JCGZ_12044 [Jatropha curcas]
Length=790

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/770 (43%), Positives = 454/770 (59%), Gaps = 91/770 (12%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK+ PNGD+YIG F G  PHG GKY  +DG  Y+G+W  GK +GKG+  W SGAT++G+ 
Sbjct  93    EKLLPNGDLYIGSFSGNAPHGSGKYLWTDGCMYEGEWRRGKASGKGKFSWPSGATFEGEF  152

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               G + GFGTF  SDG  Y+G W  + +HG G+K Y N D Y+G WK+ ++DG GRY W 
Sbjct  153   KSGRMEGFGTFIGSDGDTYRGSWNADRKHGYGQKRYANGDFYEGTWKKNLQDGKGRYVWK  212

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNG--  1140
             NGN+Y G WK G +SGRGV+ W NG+ +DG W +G+  G+G + + DGS Y GTW++   
Sbjct  213   NGNVYDGEWKNGVISGRGVLMWANGNRYDGQWENGVPKGNGIFTWPDGSCYVGTWNSNKD  272

Query  1141  --LKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRF  1314
                ++  GT YP G   ++C + G              S+ D V P    +         
Sbjct  273   IMAQELNGTFYP-GNGKEQC-MKG--------------SEADLVLPAAAGT---------  307

Query  1315  ARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYM  1494
                     R+  SV G    + +   +   ++       TCD     + N+  +      
Sbjct  308   --------RKRSSVDGARGSNMNFPRICIWESDGEAGDITCD----IIDNVEAS------  349

Query  1495  QGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVG  1674
               ++ RE +   DG          F   EV+K     + KG K+Y LMLNLQLGIRYSVG
Sbjct  350   --LIYREGLDR-DGFRQFRRGPCCFNGGEVKK-PGETISKGHKNYDLMLNLQLGIRYSVG  405

Query  1675  KITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKL  1854
             K   I +R+++ +DF  + +    FP +GS++TPPH+S++F WKDYCP+VFR+LR LF++
Sbjct  406   KHAQI-VRDLKPTDFDPKEKFWTRFPPEGSKITPPHQSVEFRWKDYCPMVFRHLRELFQV  464

Query  1855  NAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHV  2034
             + ADYM++IC +D LREL SPGKSGS FYL+ DDRF+IKT+KKSE+KVL++MLPSYY+HV
Sbjct  465   DTADYMLAICGNDALRELSSPGKSGSFFYLTQDDRFMIKTVKKSEVKVLIRMLPSYYQHV  524

Query  2035  KDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKD--  2208
               +EN+L+TKFFGV+ +     +K RF+VMGN+F +E  +H R+DLKGSS GR TDK   
Sbjct  525   CRYENSLVTKFFGVHCVKPIGGQKTRFIVMGNLFCSEYRIHRRFDLKGSSHGRTTDKPEG  584

Query  2209  KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHL  2388
             +I+E TTLKDLDL +  R+ +  ++ LIKQ++ D +FLE++ I+DYSLL+GLHFR     
Sbjct  585   EIDETTTLKDLDLNFVFRLQRNWYQELIKQINRDCEFLEAERIMDYSLLVGLHFRDDNTY  644

Query  2389  TALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVG  2568
               +   P                          V    S  S      +RG       + 
Sbjct  645   DKMGLSP-------------------------FVLRSGSKDSYQNEKFMRGCRFLEAELQ  679

Query  2569  DREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETD---PSEVELF------EVYDVVLY  2721
             DR  D +L G   L ++LG NMPA+A R  ++ + D   P  +         E+Y+VVLY
Sbjct  680   DR--DRILSGRKPL-IRLGANMPARAERMARRSDFDQYTPGGISHLTPSRNGEIYEVVLY  736

Query  2722  LGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
              GIIDILQ Y++ KKLEH YKSL+ DP SIS ++PK YSKRF  F+ R+F
Sbjct  737   FGIIDILQDYDISKKLEHAYKSLQADPTSISAVDPKHYSKRFRDFIGRIF  786



>ref|XP_002304802.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
 gb|EEE79781.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
Length=790

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/793 (42%), Positives = 465/793 (59%), Gaps = 102/793 (13%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK+  NGD Y G +   LPHG GKY  +DG  Y G+W +GK  GKG+  W SGATY+G+ 
Sbjct  58    EKILSNGDFYTGQWLDNLPHGHGKYLWTDGCMYLGEWYKGKTMGKGKFSWPSGATYEGEF  117

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++ S G  ++G+W MN++HG G + Y N D YDG W+ G +DGHGRY W 
Sbjct  118   KGGYMDGRGTYTGSSGDTFRGYWVMNLKHGNGTQSYANGDYYDGDWRRGSQDGHGRYQWK  177

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             + N Y G WK G M+G G M W NG+ +DGFW DGL  G+G +R+ DGS+Y G WS   K
Sbjct  178   SSNHYIGQWKNGLMNGSGTMIWSNGNRYDGFWQDGLPRGNGSFRWPDGSFYVGFWSKDPK  237

Query  1147  DGRGTLYPVGCA--------------LDKCKIDGHKEI-----RRMLSHDSSISKKDAVK  1269
             +  GT YP G                L+ CKI   + +     ++MLS    + + +A K
Sbjct  238   EQNGTCYPSGSVSENLDWDPQELFLDLNDCKIATCETMSILPSQKMLSWPGFLDQGNA-K  296

Query  1270  PKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK-  1446
             P VKR+ +E  + R + D GR+S  +V     A+L            SC +S    DG+ 
Sbjct  297   P-VKRNGNEGRLRRISVD-GRLSNYSV-----ASLD-----------SCDVSSGCGDGEL  338

Query  1447  ---AEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
                 E  GN+                    V+ L  +  + R  P K  ++G  +   KG
Sbjct  339   RDVEEGFGNL-------------------QVEELDPKIYKLRTQPVK--KQGETIS--KG  375

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              K+Y LMLNLQLGIR+SVG+  P    +++ S F  + ++   FP +GS+ TPPH+S +F
Sbjct  376   HKNYELMLNLQLGIRHSVGRPAPAISLDLKSSAFDPKEKVWTKFPPEGSKHTPPHQSSEF  435

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
              WKDYCP+VFR LR+LF ++AADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+
Sbjct  436   KWKDYCPVVFRTLRKLFNVDAADYMLSICGNDALRELSSPGKSGSFFYLTNDDRYMIKTI  495

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLR--RRKKVRFVVMGNMFYTELH  2151
             KK+E+KVLL+MLP+YY HV+  +NTL+TKF+G++ + L    +KKVRFV+MGN+F +E  
Sbjct  496   KKAEVKVLLRMLPAYYNHVRAFKNTLVTKFYGLHCVKLTGPNQKKVRFVIMGNLFCSEFS  555

Query  2152  MHHRYDLKGSSLGRFTDK--DKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLE  2325
             +H R+DLKGSS GR T K   +I+  TTLKDLDL Y  R+ K   +   +Q+  D  FLE
Sbjct  556   IHRRFDLKGSSHGRITSKPESEIDPTTTLKDLDLNYIFRLQKSWFQEFCRQVDRDCDFLE  615

Query  2326  SQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPS  2505
              + I+DYSLL+GLHF+      AL               S   G+   P   T     P+
Sbjct  616   QERIMDYSLLVGLHFQEASCREALTP-------------SRTSGVRTPPGIRT-----PT  657

Query  2506  IVSTAPGPHIR---GKTLRANSVGDREVD---LLLPGTGRLRVQLGVNMPAQANRKVKQD  2667
              V T  G H     G    + +     VD   L +  + R  ++LG+NMPA+  +  K+D
Sbjct  658   GVRTPTGLHTPTGIGDESESGAPRLSRVDLDKLFMDPSRRASIKLGINMPARVAKTRKRD  717

Query  2668  ET-----DPSEVELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKL  2832
                    +P+ V    +++VVL+ GIIDILQ Y++ KKLEH YKS+++DP SIS ++PK 
Sbjct  718   FEAQLIGEPTGV----LHEVVLFFGIIDILQDYDISKKLEHAYKSMQYDPTSISAVDPKQ  773

Query  2833  YSKRFISFLERVF  2871
             YSKRF  F+ RVF
Sbjct  774   YSKRFRDFIFRVF  786



>ref|XP_006847787.1| hypothetical protein AMTR_s00162p00082010 [Amborella trichopoda]
 gb|ERN09368.1| hypothetical protein AMTR_s00162p00082010 [Amborella trichopoda]
Length=829

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/783 (43%), Positives = 456/783 (58%), Gaps = 69/783 (9%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EKV  NGD Y G++   LPHG GKY  +DG  Y+GDW  G+ TGKG+  W SGATY+G+ 
Sbjct  84    EKVLANGDFYTGLWSEGLPHGSGKYLWTDGCMYEGDWCRGRTTGKGKFSWPSGATYEGEF  143

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               G++ G GT++ + G  Y G W MN++HG G K Y N D ++G W+ GV++G GRY W 
Sbjct  144   KNGFMDGDGTYTGASGDTYHGRWSMNLKHGHGFKSYANGDYHEGSWRHGVQEGKGRYVWR  203

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G M GRG + W NG+ FDG W +G   G G + +ADGS Y GTWS   +
Sbjct  204   NGNEYVGEWKGGVMHGRGYLLWANGNRFDGEWEEGEPKGHGVFTWADGSCYVGTWSRDPR  263

Query  1147  DGRGTLYPV-GCALDKCKIDGHKEI-RRMLSHDSSISKKDAVKPKVK---------RSIS  1293
             +  GT YP  G A      D    I   M+    S  +  ++ P  K           + 
Sbjct  264   EQSGTYYPSRGSAGGGGGWDQQDTILTEMMDCKVSPGETVSILPSQKMMSWTGAEAEFMH  323

Query  1294  EKIV---DRFARDSGR-----ISRRAVSVAG---DAALHCSSTEVLPEDASCMLSHTTCD  1440
             ++ V    R A  SG+     + RR  SV G   +             D +C +   +  
Sbjct  324   KQAVWRSSRVADSSGKPPVTGMGRRRGSVDGIRREKGFDRFCIWETEGDITCEVVDRSSG  383

Query  1441  GKAEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVR--KGSCMDLFK  1614
                   GN  +A        +L      + + +SH S+++ +  A  V+  K     + K
Sbjct  384   SGGGGGGNDDLA--------MLNNGNYNNNNNVSHPSSRQSRMVAPLVKEAKRQGETIKK  435

Query  1615  GRKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSID  1794
             G K+Y LMLNLQLGI +SVGK  P   R++R SDF  + RI   FP +GS+ TPPH+SI+
Sbjct  436   GHKNYELMLNLQLGITHSVGKPAPAQSRDLRASDFDPKERIWTRFPPEGSKHTPPHQSIE  495

Query  1795  FYWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKT  1974
             F WKDYCP+VFR LRRLFK++AADYM+S+C +D LREL SPGKSGS FYL+ DDR++IKT
Sbjct  496   FRWKDYCPLVFRYLRRLFKIDAADYMLSLCGNDALRELSSPGKSGSFFYLTHDDRYMIKT  555

Query  1975  LKKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHM  2154
             +KKSE+KVLL+MLPSYY HV+ +ENTL+TKFFG++ +     +KVRF++MGN+F +E H+
Sbjct  556   MKKSEVKVLLRMLPSYYNHVRAYENTLVTKFFGLHCVKAAGGQKVRFIIMGNLFCSEYHI  615

Query  2155  HHRYDLKGSSLGRFTDKD--KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLES  2328
             H R+DLKGSS GR TDK   +I+E TTLKDLDL +  R+ K   + L +Q+  D +FLE+
Sbjct  616   HRRFDLKGSSHGRITDKPEAEIDETTTLKDLDLNFVFRLQKSWFQELRRQVDRDCEFLET  675

Query  2329  QHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSI  2508
             + I+DYSLL+GLHF             DS  +      SS G + +L  +       P  
Sbjct  676   ERIMDYSLLVGLHFL------------DSNGRLSGQRTSSLGDLDLLMEATVYRLSRPET  723

Query  2509  VSTAPGPHIRGKTLRANSVGDREVD-LLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSE  2685
                                  RE+D  LL    R   +LG+N+PA+    V++ + D   
Sbjct  724   ---------------------REMDQFLLDPNKRSSTRLGINLPARVEHTVRRSDCDQLI  762

Query  2686  VE-LFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLE  2862
              E   E+ DV+++ GIIDILQ Y++ KKLEH YKS+++DP SIS ++P+ YS+RF  F+ 
Sbjct  763   GEPTGELCDVIIFFGIIDILQDYDISKKLEHAYKSIQYDPTSISAVDPRQYSRRFRDFIY  822

Query  2863  RVF  2871
             RVF
Sbjct  823   RVF  825



>ref|XP_004169495.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-phosphate 
5-kinase 6-like [Cucumis sativus]
Length=769

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/766 (42%), Positives = 453/766 (59%), Gaps = 63/766 (8%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK  PNGD Y G +   +PHG GKY  +DG  Y G+W +GK  GKG+  W SGATY+GD 
Sbjct  52    EKAIPNGDFYTGQWMDNMPHGHGKYLWTDGCMYVGEWYKGKTLGKGKFSWPSGATYEGDF  111

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++ S G  Y+G W MN++HG G + Y N D Y+G W+ G +DG GRY W 
Sbjct  112   KSGYMDGKGTYTGSSGDTYRGCWVMNLKHGQGTQNYANGDYYEGEWRRGFQDGQGRYQWK  171

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             N N Y G WK G ++G G M W NG+ +DG W DGL  G+G +R+ADGS Y G WS    
Sbjct  172   NENHYIGQWKNGKINGNGTMIWNNGNRYDGCWEDGLPKGNGTFRWADGSCYVGVWSKDPT  231

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSI---SEKIVDRFA  1317
             +  GT YP   +  +   D  +     L+        D V    +R +   S+K++    
Sbjct  232   EQTGTFYPSDSSETEMSSDPQEIFAEYLN--------DFVLCSGERILIYPSQKMISWSG  283

Query  1318  RDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQ--LGNITVAYEREY  1491
              D     ++ +S  G+             D +  L  T+ DGK       ++        
Sbjct  284   LDLDSPQKQTISKKGN-------------DGNRRLRRTSVDGKVSNSSFESLNDGSNEAS  330

Query  1492  MQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSV  1671
              +  +   +++ +D    + +  R  PAK  R+G  + + KG K+Y LMLNLQLGIR+SV
Sbjct  331   SRNGIGTHQLQDLDSKGKRQSNLRFQPAK--RQG--ITISKGHKNYELMLNLQLGIRHSV  386

Query  1672  GKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFK  1851
             G+  P    +++ S F  + ++   FP +GS+ TPPH+S DF WKDYCP+VFR LR+LFK
Sbjct  387   GRPAPATSLDLKSSAFDPKEKVWTKFPPEGSKYTPPHQSSDFRWKDYCPVVFRTLRKLFK  446

Query  1852  LNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKH  2031
             ++ ADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT++K+E+KVLL+MLP+YYKH
Sbjct  447   VDPADYMLSICGNDALRELSSPGKSGSFFYLTHDDRYMIKTMRKAEVKVLLRMLPAYYKH  506

Query  2032  VKDHENTLITKFFGVY--RISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDK  2205
             V+  ENTL+TKF+G++  R++   +KKVRFV+MGN+F +E  +H R+DLKGSS GR TDK
Sbjct  507   VRSFENTLVTKFYGLHCVRLTGTSQKKVRFVIMGNLFCSEYTIHRRFDLKGSSHGRITDK  566

Query  2206  D--KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAP  2379
                +I+  TTLKDLDL Y  R+ K+  +   +Q+  D  FLE + I+DYSLL+GLHF+  
Sbjct  567   PEAEIDGTTTLKDLDLNYIFRLQKIWFQEFCRQVDKDCDFLEQERIMDYSLLVGLHFQET  626

Query  2380  EHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRAN  2559
              +                  +S +  I +L  ++   T+  S+   A    I  ++L  +
Sbjct  627   SY---------------REFISYN--IDVLKFNIITKTNLNSLXYLA--ADIPXQSLFXS  667

Query  2560  SVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEV--ELFEVYDVVLYLGII  2733
                     L +       + LG+N+PA+A R V+Q E +   V     E+YDV+++ GII
Sbjct  668   --------LTIYLFRWASISLGINLPARAERTVRQGEPEAQLVGEPTGELYDVIIFFGII  719

Query  2734  DILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             DILQ Y++ KKLEH YKS ++DP SIS ++PK YSKRF  F+ R+F
Sbjct  720   DILQDYDISKKLEHAYKSFQYDPSSISAVDPKQYSKRFRDFIFRIF  765



>ref|XP_010557867.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6 [Tarenaya 
hassleriana]
Length=720

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/773 (42%), Positives = 443/773 (57%), Gaps = 97/773 (13%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK  P+GD Y G ++  +PHG GKY  +DG  Y G+W  GK  GKG+  W SGATY+GD 
Sbjct  23    EKALPSGDFYTGQWRDNIPHGHGKYLWTDGCMYVGEWHRGKTMGKGRFSWPSGATYEGDF  82

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT+  S G  Y+G W MN++HG G K Y N D Y+G W+ G++DGHGRY W 
Sbjct  83    KNGYMDGKGTYIGSSGDTYRGSWVMNLRHGQGTKSYVNGDCYEGEWRRGLQDGHGRYQWK  142

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G M+G G M W NG+ +DGFW DG   G+G +R+ADGS+Y G WS   K
Sbjct  143   NGNHYIGQWKNGIMNGNGTMIWSNGNRYDGFWEDGAPKGNGTFRWADGSFYVGVWSKDPK  202

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIR-RMLSHDSSISKKDAVKPKVKRSI---SEKIVDRF  1314
             +  GT YP G +      D  +     ++    S   +  V P  K  +   +E+  +R 
Sbjct  203   EQNGTYYPSGSSSGNLDWDPQQVFYVDLIECIVSQCDRIPVLPSQKMPVWYGTEQSGNRA  262

Query  1315  ARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYM  1494
               ++ R  RR+V                             DG+    G + +     Y+
Sbjct  263   KNENNRPRRRSV-----------------------------DGRISN-GEVEMRNGFGYL  292

Query  1495  QGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVG  1674
             Q   + + + +V+  +  S  R + P K+ +      + KG K+Y LMLNLQLGIR+SVG
Sbjct  293   Q---LDDSVGAVEN-TRLSPLRIQPPKKQGQT-----ISKGHKNYDLMLNLQLGIRHSVG  343

Query  1675  KITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKL  1854
             +  P    +++ S F  + ++   FP +GS+ TPPH+S +F WKDYCP+VFR LR+LF +
Sbjct  344   RPAPTTSLDLKASAFDPKEKVWTKFPSEGSKHTPPHQSCEFKWKDYCPVVFRTLRKLFNV  403

Query  1855  NAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHV  2034
             +AADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+KK+E KVL++MLP+YY HV
Sbjct  404   DAADYMISICGNDALRELSSPGKSGSFFYLTNDDRYMIKTMKKAETKVLIRMLPAYYNHV  463

Query  2035  KDHENTLITKFFGVYRISL--RRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDK-  2205
             +  ENTL+TKFFG++ + L    +KKVRFV+MGN+F TE  +H R+DLKGSS GR T K 
Sbjct  464   RACENTLVTKFFGLHCVKLTGTAQKKVRFVIMGNLFCTEYSIHRRFDLKGSSHGRLTTKH  523

Query  2206  -DKIEEGT-------TLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLG  2361
               +I+  T       TLKDLDL +  R+ K  ++   +Q+  D +FLE + I+DYSLL+G
Sbjct  524   ESEIDPNTTYEAVVSTLKDLDLNFMFRLQKNWYQEFCRQVDRDCEFLEQERIMDYSLLVG  583

Query  2362  LHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRG  2541
             +HFR          PP     P        G +  L R+                     
Sbjct  584   MHFRE-SSFRGTATPPSGARTPT-------GNVPRLSRA---------------------  614

Query  2542  KTLRANSVGDREVDLLLPGTGRL-RVQLGVNMPAQANRKVKQDETDPSEV--ELFEVYDV  2712
                        E+D  L    RL  ++LG+NMPA+  R  ++++ +   V     E YDV
Sbjct  615   -----------EMDRFLLDASRLASIKLGINMPARVERTTRRNDGETQLVGEPAGEFYDV  663

Query  2713  VLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             +LY GIIDILQ Y++ KKLEH YKS+ FDP SIS ++P+ YS+RF  F+ RVF
Sbjct  664   ILYFGIIDILQDYDISKKLEHAYKSMHFDPTSISAVDPRQYSRRFRDFIFRVF  716



>ref|XP_011000574.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Populus 
euphratica]
Length=814

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/788 (42%), Positives = 457/788 (58%), Gaps = 67/788 (9%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK   NGD Y G++   LPHG GKY  +DG  Y G+W +GK  GKG+  W SGATY+GD 
Sbjct  57    EKALCNGDFYTGLWLDNLPHGHGKYLWTDGCMYLGEWYKGKTMGKGKFGWFSGATYEGDF  116

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GTF+ S G  Y+G+W MN++HG G + Y N D YDG W+ G +DGHGRY W+
Sbjct  117   KGGYMDGRGTFTGSSGDAYRGYWVMNLRHGQGTQSYANGDCYDGDWRRGSQDGHGRYQWN  176

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
               N Y G WK G M+G G M W NG+ +DGFW DGL  G+G +R++D S+Y G WS    
Sbjct  177   TSNRYIGQWKSGLMNGNGTMIWSNGNRYDGFWQDGLPKGNGSFRWSDESFYVGFWSKDPN  236

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDR-----  1311
             +  GT YP G A      D  +    +     S  +  ++ P +K      ++D+     
Sbjct  237   EQNGTYYPSGSASGNLDWDPQEVYLDLNDCKISTCETMSIFPSLKMLNWPGVLDQGNANP  296

Query  1312  FARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA----EQLGNITVAY  1479
                + G    R +SV G      S+  V   D  C +     DG      E  GN+    
Sbjct  297   MKGNGGEGRLRRISVDG----RLSNYSVASFDG-CDVYSGGVDGNLRDVDEGFGNL----  347

Query  1480  EREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGI  1659
                             V+ L  + ++ R  P K  ++G  +   KG K+Y LMLNLQLGI
Sbjct  348   ---------------QVEELDPKISKWRTQPVK--KQGETIS--KGHKNYELMLNLQLGI  388

Query  1660  RYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLR  1839
             R+SVG+  P    +++ S F  + ++   FP +GS+ TPPH+S +F WKDYCP+VFR LR
Sbjct  389   RHSVGRPAPAISLDLKSSAFDPKEKVWTKFPSEGSKHTPPHQSSEFKWKDYCPVVFRTLR  448

Query  1840  RLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPS  2019
             +LF ++AADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+KK+E+KVLL+MLP+
Sbjct  449   KLFNVDAADYMLSICGNDALRELSSPGKSGSFFYLTNDDRYMIKTIKKAEVKVLLRMLPA  508

Query  2020  YYKHVKDHENTLITKFFGVYRISLR--RRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             YY HV+  ENTL+TKF+G++ + L    +KKVRFV+MGN+F ++  +H R+DLKGSS GR
Sbjct  509   YYNHVRSFENTLVTKFYGLHCVKLTGPNQKKVRFVIMGNLFCSDFSIHRRFDLKGSSHGR  568

Query  2194  FTDK--DKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLH  2367
              T K   +I+  TTLKDLDL Y  R+ K   +   +Q+  D  FLE + I+DYSLL+GLH
Sbjct  569   MTSKPESEIDPTTTLKDLDLNYIFRLQKSWFQEFCRQVDRDCDFLEQERIMDYSLLVGLH  628

Query  2368  FRAPEHLTALLEPPDS-LFKPKSTLVSSDGGISILPRSLTLVT--HEPSIVSTAPGPHIR  2538
             FR   +  +L  P  S ++ P  T + +  G+   P  L   T    P+ V T  G    
Sbjct  629   FREASYRESLTPPRTSGVWTP--TGIRTPTGVQT-PNGLRTPTGIRTPTGVQTPNGLRTP  685

Query  2539  GKTLRANSVGDR---------EVD---LLLPGTGRLRVQLGVNMPAQANRKVKQDETDPS  2682
                     +GD           VD   L +  T    ++LG+NMPA+  +  ++ +    
Sbjct  686   TGLHSPTGMGDETESGAPRLSRVDLDKLFIDPTRWASIKLGINMPARVEKTARRRD---G  742

Query  2683  EVELFE-----VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRF  2847
             E +L       +Y+VVL+ GIIDILQ Y++ KKLEH YKS+++DP SIS ++PK YSKRF
Sbjct  743   EAQLIGEPTGVLYEVVLFFGIIDILQDYDISKKLEHAYKSMQYDPTSISAVDPKQYSKRF  802

Query  2848  ISFLERVF  2871
               F+ RVF
Sbjct  803   RDFIFRVF  810



>ref|XP_011014126.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Populus 
euphratica]
Length=790

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/793 (43%), Positives = 465/793 (59%), Gaps = 102/793 (13%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK+  NGD Y G +   LPHG GKY  +DG  Y G+W +GK  GKG+  W SGATY+G+ 
Sbjct  58    EKILSNGDFYTGQWLDNLPHGHGKYLWTDGCMYLGEWYKGKTMGKGKFSWPSGATYEGEF  117

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++ S G  ++G+W MN++HG G + Y N D YDG W+ G +DGHGRY W 
Sbjct  118   KGGYMDGRGTYTGSSGDTFRGYWVMNLKHGNGTQSYANGDYYDGDWRRGSQDGHGRYQWK  177

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             + N Y G WK G M+G G M W NG+ +DGFW DGL  G+G +R+ DGS+Y G WS   K
Sbjct  178   SSNHYIGQWKTGLMNGSGTMIWSNGNRYDGFWQDGLPRGNGSFRWPDGSFYVGFWSKDPK  237

Query  1147  DGRGTLYPVGCA--------------LDKCKIDGHKEI-----RRMLSHDSSISKKDAVK  1269
             +  GT YP G                L+ CKI   +++     ++MLS    + + +A K
Sbjct  238   EQNGTYYPSGSVSENLDWDPQELFLDLNDCKIATCEKMSILPSQKMLSWPGVLDQGNA-K  296

Query  1270  PKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK-  1446
             P VKR+ +E  + R + D GR+S  +V     A+L            SC +S    DG+ 
Sbjct  297   P-VKRNANEGRLRRISVD-GRLSNYSV-----ASLD-----------SCDVSSGCGDGEL  338

Query  1447  ---AEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKG  1617
                 +  GN+                    V+ L  +  + R  P K  ++G  +   KG
Sbjct  339   RDVEDGFGNL-------------------QVEELDPKIYKLRTQPVK--KQGETIS--KG  375

Query  1618  RKSYYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDF  1797
              K+Y LMLNLQLGIR+SVG+  P    +++ S F  + ++   FP +GS+ TPPH+S +F
Sbjct  376   HKNYELMLNLQLGIRHSVGRPAPAISLDLKSSAFDPKEKVWTKFPPEGSKHTPPHQSSEF  435

Query  1798  YWKDYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTL  1977
              WKDYCP+VFR LR+LF ++AADYM+SIC +D LREL SPGK GS FYL+ DDR++IKT+
Sbjct  436   KWKDYCPVVFRTLRKLFNVDAADYMLSICGNDALRELSSPGKRGSFFYLTNDDRYMIKTI  495

Query  1978  KKSELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLR--RRKKVRFVVMGNMFYTELH  2151
             KK+E+KVLL+MLP+YY HV+  +NTL+TKF+G++ + L    +KKVRFV+MGN+F +E  
Sbjct  496   KKAEVKVLLRMLPAYYNHVRAFKNTLVTKFYGLHCVKLTGPNQKKVRFVIMGNLFCSEFS  555

Query  2152  MHHRYDLKGSSLGRFTDK--DKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLE  2325
             +H R+DLKGSS GR T K   +I+  TTLKDLDL Y  R+ K   +   +Q+  D  FLE
Sbjct  556   IHRRFDLKGSSHGRITSKPESEIDPTTTLKDLDLNYIFRLQKSWFQEFCRQVDRDCDFLE  615

Query  2326  SQHIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPS  2505
              + I+DYSLL+GLHF+      AL               S   GI   P   T     P+
Sbjct  616   QERIMDYSLLVGLHFQEASGREALTP-------------SRASGIRTPPGIRT-----PT  657

Query  2506  IVSTAPGPHI-RGKTLRANSVGDR----EVDLLLPGTGR-LRVQLGVNMPAQANRKVKQD  2667
              V T  G H   G    + S   R    ++D L     R   ++LG+NMPA+  +  K+D
Sbjct  658   GVRTPTGLHTPTGIGDESESGAPRLSRVDLDKLFMDPSRWASIKLGINMPARVEKTRKRD  717

Query  2668  ETDPSEVELFE-----VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKL  2832
                 SE +L       +++VVL+ GIIDILQ Y++ KKLEH YKS+++DP SIS ++PK 
Sbjct  718   ----SEAQLIGEPTGVLHEVVLFFGIIDILQDYDISKKLEHAYKSMQYDPTSISAVDPKQ  773

Query  2833  YSKRFISFLERVF  2871
             YSKRF  F+ RVF
Sbjct  774   YSKRFRDFIFRVF  786



>ref|XP_010922254.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Elaeis 
guineensis]
Length=797

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/770 (42%), Positives = 451/770 (59%), Gaps = 63/770 (8%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             E++ PNGD Y G +   LPHG GKY  +DG  Y+G+W  GK  GKG+  W SGATY+G+ 
Sbjct  72    ERLLPNGDFYTGQWHNNLPHGSGKYLWTDGCMYEGEWRNGKTMGKGKFSWPSGATYEGEF  131

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               G++ GFGT++ S G  Y+G W MN++HG G+K Y N D YDG W+ G++DGHGRY W 
Sbjct  132   KTGFMDGFGTYTGSLGDTYRGSWSMNLKHGQGKKSYANGDYYDGEWRAGLQDGHGRYIWK  191

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWS--NG  1140
             NGN Y G W+ G + GRG + W NG+ +DG W DG   G+G +R+ADGS Y G WS  NG
Sbjct  192   NGNEYVGEWRAGVIHGRGTLVWLNGNRYDGGWEDGFPKGNGSFRWADGSLYVGHWSKENG  251

Query  1141  LKDGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSI--SEKIVDRF  1314
                 +G  YP   A      D +      L +         V P    SI  S+K ++  
Sbjct  252   AIQQKGVYYPSPAATSPTARDPNAAFTADLGNCK-------VCPGETVSILPSQKTLNWL  304

Query  1315  ARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTT--CDGKAEQLGNITVAYERE  1488
               +   + ++AV     +  +       P D +     T    +G    +   +     E
Sbjct  305   GMEENFLQKQAVWRQSKS--NDGQPRRRPSDDTVGTGETPKRLNGHNNSIAKASGDGVNE  362

Query  1489  YMQGVLIRERIKSVDGLSHQSTQRR---KFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGI  1659
              M G+L+ E          + T R    K+P  EV+K     + KG K+Y LMLNLQLGI
Sbjct  363   LMGGLLLEE-------TESRGTGRWVPIKWPPPEVKK-QGETISKGHKNYDLMLNLQLGI  414

Query  1660  RYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLR  1839
             R++VG+       +++ S F  + ++   FP +G++ TPPH+S DF WKDYCP+VFR LR
Sbjct  415   RHAVGRPAQPTSLDLKASAFDPKEKVWTRFPPEGTKQTPPHQSCDFRWKDYCPLVFRTLR  474

Query  1840  RLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPS  2019
             +LFK++  DYM+SIC +D LREL SPGKSGS FYL+ DD+++IKT+KKSE+KVLL+MLP+
Sbjct  475   KLFKVDPGDYMISICGNDALRELSSPGKSGSFFYLTNDDKYMIKTMKKSEVKVLLRMLPA  534

Query  2020  YYKHVKDHENTLITKFFGVYRISLRR--RKKVRFVVMGNMFYTELHMHHRYDLKGSSLGR  2193
             YY HV+  ENTL+TKFFG++ + L    ++KVRFV+MGN+F T   +H R+DLKGSS GR
Sbjct  535   YYNHVRAFENTLVTKFFGLHCVKLTGAIQRKVRFVIMGNLFCTNYAIHRRFDLKGSSHGR  594

Query  2194  FTDK--DKIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLH  2367
              TDK  ++I+  TTLKDLDL +  R+ K   +   +Q+  D + LE + I+DYSLL+G+H
Sbjct  595   TTDKPEEEIDANTTLKDLDLNFIFRLQKSWFQDFYRQVDRDLELLEQERIMDYSLLVGVH  654

Query  2368  FRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKT  2547
             FR    ++  + P +              G+  +  S+T + H        P      + 
Sbjct  655   FR---EVSQDMLPTE--------------GVPFI--SVTGIGHNEKTSEATP------RL  689

Query  2548  LRANSVGDREVDLLLPGTGRL-RVQLGVNMPAQANRKVKQD-ETDPSEVELFEVYDVVLY  2721
              RA      +VD  L    R   ++LG+NMPA+  R V+ D E+        E YDV+L+
Sbjct  690   SRA------DVDQFLCDPTRWATIRLGINMPARVERIVRSDVESLLIGEPTGEFYDVILF  743

Query  2722  LGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
              GIIDILQ Y++ KKLEH YKS+++DP SIS ++PK Y+KRF  F+ RVF
Sbjct  744   FGIIDILQDYDISKKLEHAYKSIQYDPTSISAVDPKQYAKRFRDFIFRVF  793



>ref|XP_010242826.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 [Nelumbo 
nucifera]
Length=596

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/480 (60%), Positives = 348/480 (73%), Gaps = 16/480 (3%)
 Frame = +1

Query  583   MENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSS  762
             ME +ER  EKVF NGD+Y+G FKG+LPHG GKYT SDG+ Y+G+WEEGKMTGKG   W+S
Sbjct  1     MEASERHMEKVFLNGDIYVGDFKGMLPHGTGKYTWSDGSIYEGEWEEGKMTGKGHFQWAS  60

Query  763   GATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRD  942
             GA Y+GD   G+LHGFGTF+  DGSVY G W+MN+Q+GVG K+Y NSD+Y+G WKEGVR+
Sbjct  61    GAAYEGDFSGGFLHGFGTFTGLDGSVYTGAWRMNVQNGVGNKKYCNSDIYEGSWKEGVRN  120

Query  943   GHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYF  1122
             G GRYTW+  N Y G WK G M GRGVM W NGDLFDGFW+DGLRHGSG YRFADG YYF
Sbjct  121   GCGRYTWNAQNTYVGNWKDGKMCGRGVMNWENGDLFDGFWLDGLRHGSGFYRFADGGYYF  180

Query  1123  GTWSNGLKDGRGTLYPVGCALD-----KCKIDGHKEIRRMLSHDSSISKKDAVKPKV--K  1281
             GTW+ G KDG GT YP G  L      +     + +I+ ML H S ++  +    K+  K
Sbjct  181   GTWTRGQKDGPGTFYPAGSKLPSLTRWRSTAGYYDKIQTMLPHTSPVNLGELRDHKLGMK  240

Query  1282  RSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLG  1461
              S+SEK+     R SGRIS R +S+ G  +      EV   D     S +T + +  + G
Sbjct  241   HSLSEKLSFGLVRGSGRISHRTISLDGAPSADDPLAEVPARD-----SFSTDEDQTVEQG  295

Query  1462  NITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
             +  + YEREYMQGVLI ER+++ +    + TQ+ K   K  +K S   +FKG +SYYLML
Sbjct  296   SCNLVYEREYMQGVLISERVRNNEA---EMTQKNKCELKGTKK-SGETIFKGHRSYYLML  351

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIRY+VGKITP+P REVR SDFG +ARI+MYFPRKGS+LTPPH SI FYWKDYCP+
Sbjct  352   NLQLGIRYTVGKITPVPRREVRSSDFGPRARIRMYFPRKGSQLTPPHYSIGFYWKDYCPM  411

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFRNLR +FK++AADYMMSIC  D LREL SPGKSGSIFYLS D+RF IKTLK+SELK L
Sbjct  412   VFRNLREMFKIDAADYMMSICGCDSLRELSSPGKSGSIFYLSQDERFFIKTLKESELKGL  471



>ref|XP_004307106.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Fragaria 
vesca subsp. vesca]
Length=748

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/780 (42%), Positives = 448/780 (57%), Gaps = 110/780 (14%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EKV  NGD Y G +     HG+GKY  +DG  Y G+W++GK  GKG+  W SGATY+GD 
Sbjct  50    EKVLANGDFYTGQWLDNYAHGQGKYLWTDGCMYVGEWQKGKTAGKGKFSWPSGATYEGDF  109

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               G++ G GT++ S G  Y+G W MN+++G G K + N D Y+G W+ G++DG GRY W 
Sbjct  110   KNGFMDGKGTYTGSFGETYRGSWVMNLRYGQGSKSFVNGDHYEGEWRRGLQDGQGRYQWK  169

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G W+ G + G G M W NG+ +DG W +GL  G+G +R+ADGS+Y G WS   K
Sbjct  170   NGNHYIGQWRNGMIHGSGTMIWNNGNRYDGSWEEGLPKGNGTFRWADGSFYVGVWSKETK  229

Query  1147  DGRGTLYPVGCA---------------LDKCKIDGHKEIR----RMLSHDSSISKKDAVK  1269
             D  GT YP G +               L+ CK+   + I     +M+ +   +  +   K
Sbjct  230   DQCGTYYPAGSSGGHVDWDPQEVFAVDLNDCKVCPVETISIFPSQMMLNWPGMEGEFMNK  289

Query  1270  PKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKA  1449
             P + ++ SE  V           RR+  V G                S +   + CD   
Sbjct  290   PPIYKNGSEGNVR---------PRRSSDVRG----------------SNVSRGSNCDNNF  324

Query  1450  EQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSY  1629
             ++LG  +VA                            R+F  +  +K   + + KG K+Y
Sbjct  325   DELGG-SVA----------------------------RRFRVQPTKK-QGITIAKGHKNY  354

Query  1630  YLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKD  1809
              LMLNLQLGIR+SVG+  P    +++ S F  + ++   FP +GS+ TPPH+S DF WKD
Sbjct  355   ELMLNLQLGIRHSVGRPAPTTSLDLKTSAFDPREKVWTKFPPEGSKYTPPHQSSDFKWKD  414

Query  1810  YCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSE  1989
             YCP+VFR LR+LFK++ ADYM+S+C +D LREL SPGKSGS FYL+ DDR++IKT+KK+E
Sbjct  415   YCPVVFRTLRKLFKVDPADYMISLCGNDALRELSSPGKSGSFFYLTNDDRYMIKTMKKAE  474

Query  1990  LKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLR--RRKKVRFVVMGNMFYTELHMHHR  2163
             +KVLL+MLP+YY HV+  ENTL+TKFFG++ + L    +KKVRFV+MGN+F +E  +H R
Sbjct  475   VKVLLRMLPAYYNHVRAFENTLVTKFFGLHCVKLTGPTQKKVRFVIMGNLFCSEYSIHRR  534

Query  2164  YDLKGSSLGRFTDKD--KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHI  2337
             +DLKGSSLGR TDK   +I+  TTLKDLDL Y  R+ K+  +   +Q+  D  FLE + I
Sbjct  535   FDLKGSSLGRSTDKPAAEIDATTTLKDLDLNYIFRLQKVWFQEFCRQVDRDCDFLEQERI  594

Query  2338  IDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVST  2517
             +DYSLL+GLHFR   +   L  P  S             G+                  T
Sbjct  595   MDYSLLVGLHFREASYNDPLATPDRS------------SGVG---------------TPT  627

Query  2518  APGPHIRGKTLRANSVGDREVDLLLPGTGRL-RVQLGVNMPAQANRKV-KQDETDPSEVE  2691
               G     KT R   V   E+D LL    R   ++LG+NMPA A + V K DE       
Sbjct  628   GYGDPDNDKTPR---VSKGEMDRLLSDPNRWASIRLGINMPAWAEKTVRKTDEAQLVGEP  684

Query  2692  LFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
               ++YDV+L+ GIIDILQ Y++ KKLEH YKS ++DP SIS ++PK YS+RF +F+ RVF
Sbjct  685   TGDLYDVILFFGIIDILQDYDISKKLEHAYKSFQYDPTSISAVDPKQYSRRFRAFIFRVF  744


 Score = 94.7 bits (234),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 78/149 (52%), Gaps = 0/149 (0%)
 Frame = +1

Query  718   EEGKMTGKGQIIWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQ  897
             +E   T   + + ++G  Y G   + Y HG G +  +DG +Y G W+     G G+  + 
Sbjct  41    DEPGETYHAEKVLANGDFYTGQWLDNYAHGQGKYLWTDGCMYVGEWQKGKTAGKGKFSWP  100

Query  898   NSDVYDGCWKEGVRDGHGRYTWSNGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLR  1077
             +   Y+G +K G  DG G YT S G  Y G W      G+G   + NGD ++G W  GL+
Sbjct  101   SGATYEGDFKNGFMDGKGTYTGSFGETYRGSWVMNLRYGQGSKSFVNGDHYEGEWRRGLQ  160

Query  1078  HGSGCYRFADGSYYFGTWSNGLKDGRGTL  1164
              G G Y++ +G++Y G W NG+  G GT+
Sbjct  161   DGQGRYQWKNGNHYIGQWRNGMIHGSGTM  189



>ref|XP_006351873.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 2-like [Solanum 
tuberosum]
Length=816

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/777 (44%), Positives = 455/777 (59%), Gaps = 72/777 (9%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK  PNGD+YIG F G  PHG GKY   DG  Y+G+W+ GK +GKG+  W SGAT++G+ 
Sbjct  86    EKHLPNGDLYIGSFSGSSPHGSGKYLWKDGCMYEGEWKRGKASGKGKFSWPSGATFEGEF  145

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               G + G GTF  SDG +YKG W  + +HG G+K Y N D Y+G WK  ++DG GRY W 
Sbjct  146   KSGRMEGSGTFIGSDGDMYKGSWSGDRKHGYGQKHYSNGDYYEGLWKRNLQDGQGRYVWK  205

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G++ GRGV+ W NG+ +DG W  G   G G + + DGS Y G WS   K
Sbjct  206   NGNEYVGEWKTGDIHGRGVLIWANGNRYDGNWEAGGPKGHGVFTWPDGSCYIGCWSKDAK  265

Query  1147  DGR-------GTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIV  1305
             + +       GT YP        + + H  +++  S D S +K+D +       ++  ++
Sbjct  266   NQQHQNQILNGTFYPA-----NSRTNSHGSVKKE-SVDFS-AKEDVLGGFFGHKLAAPLM  318

Query  1306  DRFARDSG----RISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITV  1473
                  D G     + ++  SV G       S   + E     +     DG+A   G+IT 
Sbjct  319   A--DEDCGLLVMNMGKKRSSVDG-------SRGSMTERNFPRICIWESDGEA---GDITC  366

Query  1474  AYEREYMQGVLIRERIK-SVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQ  1650
                      ++ R+      DGL         F  +E + G  +   KG K+Y LMLNLQ
Sbjct  367   DIIDNVEASMIYRDGFGFGRDGLKQFRRNPCCFSKEEKKPGQTIS--KGHKNYDLMLNLQ  424

Query  1651  LGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFR  1830
             LGIRYSVGK   I +++++ SDF    +    FP +GS+LTPPH+S DF WKDYCP+VFR
Sbjct  425   LGIRYSVGKHASI-LQDLKTSDFDPNEKFWSRFPPEGSKLTPPHQSTDFRWKDYCPVVFR  483

Query  1831  NLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKM  2010
             +LR LF+++ ADYM++IC +D LREL SPGKSGS FYL+ DDRF+IKT+KKSE+KVL+KM
Sbjct  484   HLRELFQVDPADYMLAICGNDALRELSSPGKSGSFFYLTQDDRFMIKTVKKSEVKVLIKM  543

Query  2011  LPSYYKHVKDHENTLITKFFGVYRISLRRRKKVRFVVMGNMFYTELHMHHRYDLKGSSLG  2190
             LPSYY+HV  +ENTL+TKF+GV+ +      K RF+VMGNMF +E  +H R+DLKGSS G
Sbjct  544   LPSYYQHVCRYENTLVTKFYGVHCVKPVGGVKTRFIVMGNMFCSEYRIHRRFDLKGSSHG  603

Query  2191  RFTDKD--KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGL  2364
             R TDK   +I+E TTLKDLDL +  R+ +  +E LIKQ+  D +FLE++ I+DYSLL+GL
Sbjct  604   RTTDKPEGEIDETTTLKDLDLNFVFRLQRNWYEELIKQIDRDCEFLEAERIMDYSLLVGL  663

Query  2365  HFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGK  2544
             HFR       +   P  L   KS    ++                           +RG 
Sbjct  664   HFREDSMGDKMGLSPFLLRNGKSDSYQNE-------------------------KFMRGC  698

Query  2545  TLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF--------E  2700
                   + D  +D +L G   L +QLG NMPA+A R  ++ + D      F        E
Sbjct  699   RFLEAELQD--MDRILAGRKPL-IQLGANMPARAERMARRSDFDQYTPGGFCNLPPSRGE  755

Query  2701  VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             VY+VVLY GIIDILQ Y++ KKLEH YKSL+ DP SIS ++PKLYSKRF +F+ R+F
Sbjct  756   VYEVVLYFGIIDILQDYDISKKLEHAYKSLQVDPASISAVDPKLYSKRFRNFIGRIF  812


 Score = 73.2 bits (178),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 57/116 (49%), Gaps = 5/116 (4%)
 Frame = +1

Query  811   GTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWSNGNMYTGI  990
             GT  ++ G+        N   GV  K   N D+Y G +      G G+Y W +G MY G 
Sbjct  67    GTICAASGTT-----GTNSNFGVVEKHLPNGDLYIGSFSGSSPHGSGKYLWKDGCMYEGE  121

Query  991   WKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLKDGRG  1158
             WK+G  SG+G   W +G  F+G +  G   GSG +  +DG  Y G+WS   K G G
Sbjct  122   WKRGKASGKGKFSWPSGATFEGEFKSGRMEGSGTFIGSDGDMYKGSWSGDRKHGYG  177



>ref|XP_010067728.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Eucalyptus 
grandis]
Length=777

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/779 (42%), Positives = 444/779 (57%), Gaps = 92/779 (12%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK+  NGD Y G +   LPHG GKY  +DG  Y G+W +G+  GKG+  W SGATY+G+ 
Sbjct  63    EKLLSNGDFYTGQWADNLPHGHGKYLWTDGCMYVGEWHKGRTNGKGKFCWPSGATYEGEF  122

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++   G  Y+G W MN +HG G K Y N D Y+G W  G++DGHGRY W+
Sbjct  123   KNGYMDGKGTYTGPSGDTYRGSWTMNSKHGQGTKSYANGDYYEGEWHRGLQDGHGRYQWT  182

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G ++G G M W NG+ +DG W DGL  G+G +R+ADGS+Y G WS   K
Sbjct  183   NGNHYVGQWKNGVINGNGTMIWSNGNRYDGLWEDGLPKGNGTFRWADGSFYVGVWSKDPK  242

Query  1147  DGRGTLYPVGCA---------------LDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVK  1281
             +  GT YP G                 L+ CK+   +++  +L     ++    V+   K
Sbjct  243   EQSGTYYPSGSMAGSIDFDPQNVFAVDLNDCKVSTGEKVP-VLPSQKMLNCPPVVEGGFK  301

Query  1282  RSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLG  1461
              S       R A   GR+        GD                     TT     E LG
Sbjct  302   PSKGNDGKSRRASVDGRVCNYGWDSDGDRN-----------------GDTTPRSMVEGLG  344

Query  1462  NITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLML  1641
             +I    E +     + R R              R  P K  R+G    + KG K+Y LML
Sbjct  345   SI----ELDDSDTRIARTR----------QLASRIQPVK--RQGET--ITKGHKNYELML  386

Query  1642  NLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPI  1821
             NLQLGIR+SVG+  P    +++ S F  + ++   FP +GS+ TPPH+S +F WKDYCP+
Sbjct  387   NLQLGIRHSVGRPAPATSLDLKASAFDPREKVWTRFPPEGSKHTPPHQSCEFKWKDYCPV  446

Query  1822  VFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVL  2001
             VFR LR+LFK++AADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+KK+E+KVL
Sbjct  447   VFRTLRKLFKVDAADYMISICGNDALRELSSPGKSGSFFYLTNDDRYMIKTVKKAEVKVL  506

Query  2002  LKMLPSYYKHVKDHENTLITKFFGVYRISLR--RRKKVRFVVMGNMFYTELHMHHRYDLK  2175
             L+MLP+YY H + +ENTL+TKFFG++ + L    +KKVRFV+MGN+F +E  +H R+DLK
Sbjct  507   LRMLPAYYNHFRAYENTLVTKFFGLHCVKLTGATQKKVRFVIMGNLFCSEYAIHRRFDLK  566

Query  2176  GSSLGRFTDKDK--IEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYS  2349
             GSS GR T+K +  I+  TTLKDLDL +  R+ K   +   +Q+  D  FLE + I+DYS
Sbjct  567   GSSHGRITEKPEADIDATTTLKDLDLNFIFRLQKFWFQEFCRQVDRDCDFLEQERIMDYS  626

Query  2350  LLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGP  2529
             LL+GLHFR   +   LL                                 PS   T  G 
Sbjct  627   LLIGLHFRDISYNKDLL----------------------------TAEARPSRAQTPRGF  658

Query  2530  HIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF----  2697
                  ++   S  + + +LL P T    ++LGVNMPA+A   V++ +   SE +L     
Sbjct  659   GDTDSSMGRFSNVEADRNLLDP-TRWASIKLGVNMPARAELTVRRTD---SESQLIGDPT  714

Query  2698  -EVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
              E+YDV++Y GIIDILQ Y++ KK+EH YK+ ++DP SIS ++PK YS+RF  F+ R+F
Sbjct  715   GEMYDVIIYFGIIDILQDYDISKKIEHAYKAFQYDPTSISAVDPKQYSRRFRDFIFRIF  773



>ref|XP_011000430.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 4 [Populus 
euphratica]
Length=766

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/761 (42%), Positives = 452/761 (59%), Gaps = 62/761 (8%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK+ PNGD Y G +    PHG+GKY  +DG  Y G+W +GK  G+G+  W SGATY+G+ 
Sbjct  58    EKILPNGDYYTGQWYDNFPHGQGKYLWTDGCMYVGEWYKGKTMGRGRFSWPSGATYEGEF  117

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++ S+G  Y+G W MN++HG G K + N D YDG W+ G ++G+G+Y W 
Sbjct  118   KSGYMDGIGTYTGSNGDTYRGQWVMNMKHGHGLKHFSNGDWYDGEWRRGFQEGNGKYEWK  177

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G M G+G   W NG+ FDG W DGL  G+G +++ DGS+Y G WS    
Sbjct  178   NGNHYVGEWKNGLMCGKGGFVWTNGNKFDGNWEDGLPKGNGTFKWIDGSFYVGNWSKDPS  237

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSISEKIVDRFARDS  1326
             +  GT YP   +++  + D  +E+ ++   DS +   + V   V  S  +  V   ++  
Sbjct  238   EQNGTYYPSESSVEGLEWD-PQEVYKVHLSDSQVCPGERVS--VLPSQKKLAVWNSSKGG  294

Query  1327  GRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQGVL  1506
             G   RR +SV G  ++          D   M         +   G  + A     + G+ 
Sbjct  295   GDKPRR-MSVDGRVSVGIERAF----DRMNMWEGEDNTSTSGDRGRFSDAD----LLGLN  345

Query  1507  IRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKITP  1686
             + E I  +  +        + P    R+G  +   KG K+Y LMLNLQLGIR+SVG+  P
Sbjct  346   VEEGIPKMMPI-------MRLPKTCKRQGETIS--KGHKNYELMLNLQLGIRHSVGRPAP  396

Query  1687  IPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNAAD  1866
                 +++ S F  + ++   FP +GS+ TPPH+S +F WKDYCP+VFR LR+LFK++ AD
Sbjct  397   SASLDLKASAFDPKEKVWTRFPPEGSKYTPPHQSTEFKWKDYCPLVFRTLRKLFKVDPAD  456

Query  1867  YMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKDHE  2046
             YM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+KKSE KVL++MLP+YY HV+ +E
Sbjct  457   YMLSICGNDALRELSSPGKSGSFFYLTNDDRYMIKTMKKSEAKVLIRMLPAYYNHVRSYE  516

Query  2047  NTLITKFFGVYRISLR--RRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDK--DKI  2214
             NTL+TKF+G++ + L    +KKVRF++MGN+F +E  +H R+DLKGSSLGR TDK   +I
Sbjct  517   NTLVTKFYGLHCVKLNGTAQKKVRFIIMGNLFCSEYTIHRRFDLKGSSLGRTTDKPESEI  576

Query  2215  EEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFRAPEHLTA  2394
             E  T LKDLDL +  R+ K   +   +Q+  D +FLE + I+DYSLL+GLHFR       
Sbjct  577   EATTILKDLDLNFIFRLQKAWFQEFCRQVDRDCEFLEQERIMDYSLLVGLHFRE------  630

Query  2395  LLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIRGKTLRANSVGDR  2574
                       P   L++S             +   P    +  GP +        S  D 
Sbjct  631   --------VSPNGDLITSG------------MRTPPGETESDDGPRL--------SRADM  662

Query  2575  EVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEV--ELFEVYDVVLYLGIIDILQA  2748
             +  LL P     R++LG+NMPA+A R V++ + +   V     E+Y+VV++ GIIDILQ 
Sbjct  663   DQLLLDPDMWS-RIKLGINMPARAERTVRRSDCEYLLVGEPTGELYEVVMFFGIIDILQD  721

Query  2749  YNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             Y++ KKLEH YKS+++DP SIS ++PK YS+RF  FL ++F
Sbjct  722   YDISKKLEHAYKSIQYDPTSISAVDPKQYSRRFRDFLLKIF  762



>emb|CAN81212.1| hypothetical protein VITISV_020918 [Vitis vinifera]
Length=724

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/766 (43%), Positives = 448/766 (58%), Gaps = 80/766 (10%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EKV  NGD Y G +   LPHG GKY  +DG  Y G+W  GK  GKG+  W SGATY+G+ 
Sbjct  24    EKVLSNGDFYTGQWSDNLPHGHGKYLWTDGCMYVGEWVRGKTNGKGRFSWPSGATYEGEF  83

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++ + G  YKG W MN++HG G K Y N D Y+G W+ G ++G GRY W 
Sbjct  84    KAGYMDGKGTYTGASGDTYKGSWVMNLKHGEGTKSYANGDYYEGDWRRGFQEGQGRYQWK  143

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G W+ G +SG G M W NG+ +DG W DGL  G+G +R+ADGS+Y G WS   K
Sbjct  144   NGNHYIGQWRNGMISGNGTMIWANGNRYDGVWEDGLPKGNGTFRWADGSFYVGMWSKDPK  203

Query  1147  DGRGTLYPVGCALDKCKIDGHKEIRRMLSHDSSISKKDAVKPKVKRSIS--EKIVDRFAR  1320
             +  GT YP G      + D  +E+  +  +D  I+  + V      SI   +K+++    
Sbjct  204   EQTGTYYPSGSPTGHMEWD-PQELFSVELNDCKINPGENV------SILPLQKMLNWPGL  256

Query  1321  DSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNITVAYEREYMQG  1500
             D   + ++ +                  D S        D   E LG++           
Sbjct  257   DGEFLQKQPIWKPNKG-----------NDGSVRPRRIDVD---EGLGSL-----------  291

Query  1501  VLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQLGIRYSVGKI  1680
                  +++  D    +  Q R  P K  R+G  +   KG K+Y LMLNLQLGIR+SVG+ 
Sbjct  292   -----QLEDPDLTETRLQQIRLQPMK--RQGETIS--KGHKNYELMLNLQLGIRHSVGRP  342

Query  1681  TPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFRNLRRLFKLNA  1860
              P    +++ S F  + ++   FP +GS+ TPPH+S DF WKDYCP+VFR LR+LFK++ 
Sbjct  343   APSTSLDLKSSAFDPKEKVWTKFPPEGSKHTPPHQSSDFRWKDYCPLVFRTLRKLFKVDP  402

Query  1861  ADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKMLPSYYKHVKD  2040
             ADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+KKSE+KVLL+MLP+YY HV+ 
Sbjct  403   ADYMISICGNDALRELSSPGKSGSFFYLTNDDRYMIKTMKKSEVKVLLRMLPAYYNHVRA  462

Query  2041  HENTLITKFFGVYRISLR--RRKKVRFVVMGNMFYTELHMHHRYDLKGSSLGRFTDKD--  2208
              ENTL+TKF+G++ + L    +KKVRFV+MGN+F +E  +H R+DLKGSS GR TDK   
Sbjct  463   FENTLVTKFYGLHCVKLTGAAQKKVRFVIMGNLFCSEYAIHRRFDLKGSSHGRTTDKPEA  522

Query  2209  KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLLGLHFR-APEH  2385
             +I+  TTLKDLDL +  R+ K   +   +Q+  D   LE + I+DYSLL+GLHFR AP  
Sbjct  523   EIDATTTLKDLDLNFIFRLQKAWFQEFCRQVDRDCDLLEQERIMDYSLLVGLHFREAPGT  582

Query  2386  LTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPG---PHIRGKTLRA  2556
              T     P  +  P         GI             P+ + T  G   P I G   R 
Sbjct  583   RT-----PSGIRTPS--------GIRT-----------PTGIRTPTGNGDPDIDGAAPRL  618

Query  2557  NSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQ-DETDPSEVELFEVYDVVLYLGII  2733
             + V   ++D LL    R  ++LG+NMPA+  + V++ DET        E Y+VVL+ GII
Sbjct  619   SGV---DMDKLLLDR-RSSIRLGINMPARVEKTVRRGDETQLIGEPTGEFYEVVLFFGII  674

Query  2734  DILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             DILQ Y++ KKLEH YKS +FDP SIS ++PK YSKRF  F+ R F
Sbjct  675   DILQDYDISKKLEHAYKSFQFDPTSISAVDPKQYSKRFRDFIFRAF  720



>ref|XP_010032297.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6 [Eucalyptus 
grandis]
 gb|KCW51712.1| hypothetical protein EUGRSUZ_J01180 [Eucalyptus grandis]
Length=775

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/777 (42%), Positives = 458/777 (59%), Gaps = 81/777 (10%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             E+V  NGD Y G +   LPHG GKY  +DG  Y G+W  GK  GKG+  W SGATY+G+ 
Sbjct  54    ERVLSNGDFYTGQWADNLPHGHGKYLWTDGCMYVGEWFRGKTMGKGKFCWPSGATYEGEF  113

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
                Y+ G GT++   G  Y+G W MN++HG G K Y N D Y+G W+ G++DGHGRY W 
Sbjct  114   KSSYMDGKGTYTGPSGDTYRGSWIMNLKHGQGTKSYVNGDYYEGEWRRGMQDGHGRYQWH  173

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             +GN Y G WK G ++G G M W NG+ +DGFW DGL  G+G +R+ADGS+Y G WS   K
Sbjct  174   SGNNYIGQWKNGTINGNGTMIWSNGNRYDGFWEDGLPKGNGTFRWADGSFYVGIWSRDPK  233

Query  1147  DGRGTLYPVGCALDKCKIDGH-KEIRRMLSHDSSISKKDAVK----------PKVKRSIS  1293
             +  GT YP G       ID + +E+  +   D  I   + V           P ++    
Sbjct  234   EQSGTYYPSGST--GGNIDWNPQEVFSVDLQDCKICPGEKVSILPSQKLLNWPGIEGEFL  291

Query  1294  EKIVD-RFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGKAEQLGNIT  1470
             EK    R  ++S    +R +SV G  + +   +E    D + +        + E+LGNI 
Sbjct  292   EKQQSWRPQKESEGGGKRRMSVDGRVSHYSWGSE--GSDGNHLRD------EHEELGNIQ  343

Query  1471  VAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKSYYLMLNLQ  1650
                           +     D L+ Q   R K P K+        + KG ++Y LMLNLQ
Sbjct  344   P-------------QDSSMGDTLTKQQMLRIKPPKKQGET-----ISKGHRNYELMLNLQ  385

Query  1651  LGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWKDYCPIVFR  1830
             LGIR+SVG+  P    +++ S F  + ++   FP +GS+ TPPH+S +F WKDYCP+VFR
Sbjct  386   LGIRHSVGRPAPATSLDLKASAFDPKEKVWTRFPPEGSKHTPPHQSCEFRWKDYCPVVFR  445

Query  1831  NLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKSELKVLLKM  2010
              LR+LF+++AADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+KK+E+KVLL+M
Sbjct  446   TLRKLFRIDAADYMISICGNDALRELSSPGKSGSFFYLTHDDRYMIKTMKKAEVKVLLRM  505

Query  2011  LPSYYKHVKDHENTLITKFFGVYRISL--RRRKKVRFVVMGNMFYTELHMHHRYDLKGSS  2184
             LPSYY HV+ +ENTL+TK+FG++ + L    +KKVRFV+MGN+F +E  +H R+DLKGSS
Sbjct  506   LPSYYNHVRTYENTLVTKYFGLHCVKLTGTAQKKVRFVIMGNLFCSEYAIHRRFDLKGSS  565

Query  2185  LGRFTDKD--KIEEGTTLKDLDLMYELRMDKLLHETLIKQLSLDSQFLESQHIIDYSLLL  2358
              GR TDK   +IE  TTLKDLDL +  R+  +  +   +Q+  D  FLE + I+DYSLL+
Sbjct  566   HGRITDKPEAEIEATTTLKDLDLNFIFRLQNVWFQEFCRQVDKDCDFLEQERIMDYSLLI  625

Query  2359  GLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIVSTAPGPHIR  2538
             GLHFR            D+ +   S +  +       PR +     +P      P     
Sbjct  626   GLHFR------------DTSYNKDSLVAEACPAGIRTPRGIGDNNVDP----VDP-----  664

Query  2539  GKTLRANSVGDREVD-LLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEVELF-----E  2700
                 R +SV   E+D L L  T     +LG+NMPA+A   ++++     E++L      E
Sbjct  665   ----RLSSV---EMDQLQLDPTRWASTRLGINMPARAELTMRRNGC---ELQLVGEPTGE  714

Query  2701  VYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLERVF  2871
             +Y+V+L+ GIIDILQ Y++ KKLEH YKS+ +DP SIS ++PK YS+RF  F+ R+F
Sbjct  715   LYEVILFFGIIDILQDYDISKKLEHAYKSIHYDPTSISAVDPKQYSRRFRDFIYRIF  771


 Score = 67.8 bits (164),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 55/116 (47%), Gaps = 8/116 (7%)
 Frame = +1

Query  535  EVYRNSYGMGI*CVIIMENNERTDEKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGD  714
            + YR S+        IM        K + NGD Y G ++  +  G G+Y    G  Y G 
Sbjct  130  DTYRGSW--------IMNLKHGQGTKSYVNGDYYEGEWRRGMQDGHGRYQWHSGNNYIGQ  181

Query  715  WEEGKMTGKGQIIWSSGATYDGDCFEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVG  882
            W+ G + G G +IWS+G  YDG   +G   G GTF  +DGS Y G W  + +   G
Sbjct  182  WKNGTINGNGTMIWSNGNRYDGFWEDGLPKGNGTFRWADGSFYVGIWSRDPKEQSG  237



>ref|XP_010269394.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like isoform 
X1 [Nelumbo nucifera]
Length=772

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/782 (42%), Positives = 453/782 (58%), Gaps = 93/782 (12%)
 Frame = +1

Query  607   EKVFPNGDVYIGMFKGVLPHGKGKYTSSDGTTYDGDWEEGKMTGKGQIIWSSGATYDGDC  786
             EK+  NGD Y G +   LPHG GKY  +DG  Y G+W  GK  GKG+  W SGATY+GD 
Sbjct  53    EKMLANGDFYTGQWVDNLPHGNGKYLWTDGCMYVGEWCRGKTNGKGKFSWPSGATYEGDF  112

Query  787   FEGYLHGFGTFSSSDGSVYKGHWKMNIQHGVGRKEYQNSDVYDGCWKEGVRDGHGRYTWS  966
               GY+ G GT++ S G  Y+G W MN++HG G K Y N D YDG W+ G +DG+GRY W 
Sbjct  113   KSGYMDGKGTYTGSSGDTYRGSWVMNLKHGQGVKHYANGDSYDGEWRRGAQDGNGRYQWK  172

Query  967   NGNMYTGIWKKGNMSGRGVMKWFNGDLFDGFWVDGLRHGSGCYRFADGSYYFGTWSNGLK  1146
             NGN Y G WK G + G G + W NG+ +DG W DGL  G+G +R++DGS+Y GTWS   K
Sbjct  173   NGNHYIGQWKNGIICGSGTLIWTNGNRYDGSWEDGLPKGNGTFRWSDGSFYVGTWSKDPK  232

Query  1147  DGRGTLYPVGCA----------------LDKCKIDGHKEIRRMLSHDS----SISKKDAV  1266
             +  GT YP G +                L++CKI   +++  + S  S        + + 
Sbjct  233   EQSGTYYPSGASASGNXDWDPREVFSVDLNECKICPGEKVSVLPSQKSVNWPGAEGRSSK  292

Query  1267  KPKVKRSISEKIVDRFARDSGRISRRAVSVAGDAALHCSSTEVLPEDASCMLSHTTCDGK  1446
              P   R  S  +  R + D G + R  +S + D  + C        DA+ M S    DG 
Sbjct  293   APDKPRGSS--VDGRGSTDKG-LDRIYISES-DGDITCDIV-----DANSMPSRDGDDG-  342

Query  1447  AEQLGNITVAYEREYMQGVLIRERIKSVDGLSHQSTQRRKFPAKEVRKGSCMDLFKGRKS  1626
                +G   V      +Q                   Q +  P +  R+G  +   KG K+
Sbjct  343   ---IGGPQVEDAGARLQ-------------------QLKMQPRETKRQGETIS--KGHKN  378

Query  1627  YYLMLNLQLGIRYSVGKITPIPMREVRQSDFGEQARIKMYFPRKGSRLTPPHRSIDFYWK  1806
             Y LMLNLQLGIR+SVG+  PI   +++ S F  + ++   FP +GS+ TPPH+S +F WK
Sbjct  379   YELMLNLQLGIRHSVGRPGPIATLDLKASAFDPKEKVWTKFPPEGSKHTPPHQSCEFRWK  438

Query  1807  DYCPIVFRNLRRLFKLNAADYMMSICCDDGLRELLSPGKSGSIFYLSCDDRFVIKTLKKS  1986
             DYCP+VFR LR+LFK++ ADYM+SIC +D LREL SPGKSGS FYL+ DDR++IKT+KKS
Sbjct  439   DYCPLVFRTLRKLFKVDPADYMISICGNDALRELSSPGKSGSFFYLTNDDRYMIKTMKKS  498

Query  1987  ELKVLLKMLPSYYKHVKDHENTLITKFFGVYRISLR--RRKKVRFVVMGNMFYTELHMHH  2160
             E+KVL++MLP+YY HV+  ENTL+T+FFG++ + L    +KKVRFV+MGN+F TE  +  
Sbjct  499   EVKVLIRMLPAYYNHVRAFENTLVTRFFGLHCVKLTGAAQKKVRFVIMGNLFCTEYPIQR  558

Query  2161  RYDLKGSSLGRFTDKD--KIEEGTTLKDLDLMYELRMDKLLHETL-IKQLSLDSQFLESQ  2331
             R+DLKGSS GR TDK   +I+E TTLKDLDL +  R+ +   + L  +Q+  D +FLE +
Sbjct  559   RFDLKGSSHGRTTDKPEAEIDENTTLKDLDLNFIFRLQRTWFQELHSRQVDRDCEFLEQE  618

Query  2332  HIIDYSLLLGLHFRAPEHLTALLEPPDSLFKPKSTLVSSDGGISILPRSLTLVTHEPSIV  2511
              I+DYSLL+GLHFR                   S+    +G  S +   +    HE    
Sbjct  619   RIMDYSLLVGLHFR------------------DSSYTRDEGRHSSVRTPMGNGDHE----  656

Query  2512  STAPGPHIRGKTLRANSVGDREVDLLLPGTGRLRVQLGVNMPAQANRKVKQDETDPSEV-  2688
             S    PH+             ++D L   +    ++LG+NMPA+  + V++ + D   V 
Sbjct  657   SEGTAPHLP----------RVDMDHLFDXSRWASIRLGINMPARVEQTVRRSDCDSQLVG  706

Query  2689  -ELFEVYDVVLYLGIIDILQAYNMRKKLEHKYKSLRFDPMSISVIEPKLYSKRFISFLER  2865
                 E  DV+L+ GIIDILQ Y++ KKLEH YKS+++DP SIS ++PK YS+RF  F+ +
Sbjct  707   EPTGEFRDVILFFGIIDILQDYDISKKLEHAYKSIQYDPTSISAVDPKQYSRRFRDFIFK  766

Query  2866  VF  2871
             VF
Sbjct  767   VF  768



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9623457487592