BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22705_g1_i2 len=2285 path=[3158:0-281 471:282-638 24:639-743
224:744-959 1266:960-1127 1344:1128-1128 1345:1129-2284]

Length=2285
                                                                      Score     E

ref|XP_009781949.1|  PREDICTED: zinc finger BED domain-containing...    270   4e-108   
ref|XP_009796184.1|  PREDICTED: zinc finger BED domain-containing...    281   1e-107   
ref|XP_010693749.1|  PREDICTED: zinc finger BED domain-containing...    265   2e-105   
ref|XP_010675028.1|  PREDICTED: zinc finger BED domain-containing...    263   2e-102   
ref|XP_009780212.1|  PREDICTED: zinc finger BED domain-containing...    247   2e-100   
ref|XP_009775590.1|  PREDICTED: zinc finger BED domain-containing...    248   3e-100   
ref|XP_009773687.1|  PREDICTED: zinc finger BED domain-containing...    271   4e-100   
ref|XP_009765425.1|  PREDICTED: zinc finger BED domain-containing...    271   8e-100   
ref|XP_009767846.1|  PREDICTED: zinc finger BED domain-containing...    251   2e-99    
ref|XP_009775656.1|  PREDICTED: zinc finger BED domain-containing...    231   1e-94    
ref|XP_009784104.1|  PREDICTED: zinc finger BED domain-containing...    230   3e-94    
ref|XP_009774751.1|  PREDICTED: zinc finger BED domain-containing...    276   8e-93    
ref|XP_009629645.1|  PREDICTED: zinc finger BED domain-containing...    266   1e-89    
ref|XP_006384292.1|  hypothetical protein POPTR_0004s11480g             221   7e-86    
gb|ACX85638.1|  putative transposase                                    209   3e-85    Cucumis melo [Oriental melon]
ref|XP_006384497.1|  hypothetical protein POPTR_0004s15890g             218   1e-84    
ref|XP_003591965.1|  Elongation factor 1-alpha                          219   2e-84    
ref|XP_009771238.1|  PREDICTED: zinc finger BED domain-containing...    257   2e-84    
ref|XP_009769521.1|  PREDICTED: zinc finger BED domain-containing...    251   2e-84    
ref|XP_006380778.1|  hypothetical protein POPTR_0007s13470g             215   3e-84    
ref|XP_006376750.1|  hypothetical protein POPTR_0012s05700g             211   8e-84    
ref|XP_007214254.1|  hypothetical protein PRUPE_ppa024136mg             211   2e-83    
ref|NP_001176010.1|  Os10g0118700                                       218   1e-82    
gb|EEE52457.1|  hypothetical protein OsJ_34617                          220   2e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007225531.1|  hypothetical protein PRUPE_ppa025795mg             208   2e-82    
ref|NP_001068267.2|  Os11g0613900                                       220   2e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006374644.1|  hypothetical protein POPTR_0015s13960g             208   6e-82    
gb|AAV32822.1|  transposase                                             213   9e-82    Zea mays [maize]
ref|XP_006370060.1|  hypothetical protein POPTR_0001s39120g             206   1e-81    
ref|XP_006377812.1|  hypothetical protein POPTR_0011s13140g             204   7e-81    
gb|AHC08670.1|  putative transposase                                    206   9e-81    
ref|XP_007200197.1|  hypothetical protein PRUPE_ppa016010mg             203   1e-80    
ref|XP_006370155.1|  hypothetical protein POPTR_0001s40220g             203   2e-80    
ref|XP_006371212.1|  hypothetical protein POPTR_0019s06065g             198   2e-80    
ref|XP_006375745.1|  hypothetical protein POPTR_0013s01720g             205   3e-80    
dbj|BAJ23914.1|  transposase                                            197   3e-80    
ref|XP_006369977.1|  hypothetical protein POPTR_0001s36760g             192   5e-80    
ref|XP_007214488.1|  hypothetical protein PRUPE_ppa020338mg             190   3e-79    
ref|XP_007203829.1|  hypothetical protein PRUPE_ppa016227m2g            192   7e-78    
gb|ABA94758.1|  hAT family dimerisation domain containing protein       201   7e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003617143.1|  Oligoribonuclease                                  187   8e-78    
gb|EEE50486.1|  hypothetical protein OsJ_30552                          201   1e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009590167.1|  PREDICTED: zinc finger BED domain-containing...    266   4e-77    
ref|XP_010530487.1|  PREDICTED: zinc finger BED domain-containing...    190   2e-76    
ref|NP_001042140.2|  Os01g0170400                                       221   8e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009768907.1|  PREDICTED: zinc finger BED domain-containing...    220   2e-75    
ref|XP_009774458.1|  PREDICTED: zinc finger BED domain-containing...    220   2e-75    
ref|XP_009604433.1|  PREDICTED: zinc finger BED domain-containing...    263   3e-75    
ref|XP_007203401.1|  hypothetical protein PRUPE_ppa021175mg             199   3e-75    
ref|XP_007213517.1|  hypothetical protein PRUPE_ppa020692mg             182   1e-74    
ref|XP_006369762.1|  hypothetical protein POPTR_0001s31105g             179   2e-74    
ref|XP_010548831.1|  PREDICTED: zinc finger BED domain-containing...    193   3e-74    
ref|XP_009339459.1|  PREDICTED: zinc finger BED domain-containing...    176   1e-73    
ref|XP_006369187.1|  hypothetical protein POPTR_0001s18450g             209   1e-73    
ref|XP_006386826.1|  hypothetical protein POPTR_0002s22610g             199   7e-73    
emb|CAB82966.1|  putative protein                                       201   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007208187.1|  hypothetical protein PRUPE_ppa020871mg             197   2e-72    
ref|XP_007212946.1|  hypothetical protein PRUPE_ppa022011mg             196   2e-72    
ref|XP_009762657.1|  PREDICTED: zinc finger BED domain-containing...    253   2e-71    
ref|XP_007219583.1|  hypothetical protein PRUPE_ppa023353mg             209   1e-70    
ref|XP_006279844.1|  hypothetical protein CARUB_v10028251mg             196   1e-70    
ref|XP_011078707.1|  PREDICTED: zinc finger BED domain-containing...    142   3e-70    
ref|XP_006377251.1|  hypothetical protein POPTR_0011s02940g             216   3e-70    
ref|XP_007227215.1|  hypothetical protein PRUPE_ppa018881mg             184   2e-69    
ref|XP_006384349.1|  hypothetical protein POPTR_0004s13680g             200   5e-69    
ref|XP_010266972.1|  PREDICTED: zinc finger BED domain-containing...    175   1e-68    
ref|XP_007224939.1|  hypothetical protein PRUPE_ppa021590mg             177   2e-68    
ref|XP_007202913.1|  hypothetical protein PRUPE_ppa016147mg             160   2e-68    
ref|XP_009775322.1|  PREDICTED: zinc finger BED domain-containing...    236   3e-68    
emb|CDY53459.1|  BnaCnng25180D                                          180   8e-68    
ref|XP_008779743.1|  PREDICTED: zinc finger BED domain-containing...    193   1e-67    
ref|XP_009374959.1|  PREDICTED: zinc finger BED domain-containing...    180   1e-66    
ref|XP_010686979.1|  PREDICTED: zinc finger BED domain-containing...    179   1e-64    
ref|XP_009618720.1|  PREDICTED: zinc finger BED domain-containing...    186   1e-64    
ref|XP_009767890.1|  PREDICTED: uncharacterized protein LOC104218960    236   1e-64    
ref|XP_002455637.1|  hypothetical protein SORBIDRAFT_03g015311          191   1e-64    Sorghum bicolor [broomcorn]
ref|XP_007226758.1|  hypothetical protein PRUPE_ppa018763mg             163   2e-64    
gb|KFK22491.1|  hypothetical protein AALP_AAs58843U000100               177   3e-64    
ref|XP_009604434.1|  PREDICTED: zinc finger BED domain-containing...    230   4e-64    
ref|XP_009793089.1|  PREDICTED: uncharacterized protein LOC104240006    235   7e-64    
ref|XP_009114427.1|  PREDICTED: zinc finger BED domain-containing...    174   4e-63    
ref|XP_007207805.1|  hypothetical protein PRUPE_ppa024297mg             172   5e-63    
ref|XP_006285547.1|  hypothetical protein CARUB_v10006988mg             172   1e-62    
ref|XP_007213385.1|  hypothetical protein PRUPE_ppa026473mg             182   1e-61    
ref|XP_007216820.1|  hypothetical protein PRUPE_ppa022981mg             155   1e-61    
ref|XP_009151481.1|  PREDICTED: zinc finger BED domain-containing...    166   2e-61    
ref|XP_007198910.1|  hypothetical protein PRUPE_ppa025415mg             144   2e-61    
ref|NP_001042787.2|  Os01g0290300                                       165   3e-61    Oryza sativa Japonica Group [Japonica rice]
gb|AAV25287.1|  hypothetical protein                                    176   3e-61    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054942.2|  Os05g0219300                                       175   7e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010473769.1|  PREDICTED: zinc finger BED domain-containing...    157   2e-60    
ref|XP_006376015.1|  hypothetical protein POPTR_0013s07990g             158   2e-60    
ref|XP_009145548.1|  PREDICTED: zinc finger BED domain-containing...    170   3e-60    
ref|XP_009138234.1|  PREDICTED: zinc finger BED domain-containing...    170   4e-60    
ref|XP_010324119.1|  PREDICTED: zinc finger BED domain-containing...    162   4e-60    
ref|XP_006373948.1|  hypothetical protein POPTR_0016s11380g             163   5e-60    
emb|CAN80126.1|  hypothetical protein VITISV_013417                     172   1e-59    Vitis vinifera
ref|XP_009763023.1|  PREDICTED: zinc finger BED domain-containing...    173   2e-59    
ref|XP_010677727.1|  PREDICTED: zinc finger BED domain-containing...    116   5e-59    
ref|XP_010513423.1|  PREDICTED: zinc finger BED domain-containing...    154   5e-59    
ref|XP_007221311.1|  hypothetical protein PRUPE_ppa025777mg             178   5e-59    
gb|AAG51228.1|AC035249_3  Tam3-like transposon protein; 93317-95488     165   7e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623579.1|  PREDICTED: zinc finger BED domain-containing...    219   7e-59    
ref|XP_009338975.1|  PREDICTED: uncharacterized protein LOC103931266    181   8e-59    
ref|XP_010417754.1|  PREDICTED: zinc finger BED domain-containing...    214   1e-58    
ref|XP_007198867.1|  hypothetical protein PRUPE_ppa018871mg             152   1e-58    
gb|AAM18172.1|AC092172_32  Putative activator-like transposable e...    189   2e-58    Oryza sativa Japonica Group [Japonica rice]
gb|EPS65408.1|  hypothetical protein M569_09369                         212   3e-58    
ref|XP_007225084.1|  hypothetical protein PRUPE_ppa017579mg             120   4e-58    
emb|CDX79550.1|  BnaC03g18860D                                          174   5e-58    
ref|XP_010686703.1|  PREDICTED: zinc finger BED domain-containing...    176   5e-58    
ref|XP_008655155.1|  PREDICTED: uncharacterized protein LOC100381...    189   5e-58    
ref|XP_007199162.1|  hypothetical protein PRUPE_ppa019737mg             166   6e-58    
gb|EAZ01015.1|  hypothetical protein OsI_23049                          210   2e-57    Oryza sativa Indica Group [Indian rice]
ref|XP_006857388.1|  hypothetical protein AMTR_s00067p00136180          182   2e-57    
ref|XP_006283232.1|  hypothetical protein CARUB_v10004265mg             157   4e-57    
ref|XP_007221437.1|  hypothetical protein PRUPE_ppa026657mg             156   5e-57    
ref|XP_007213553.1|  hypothetical protein PRUPE_ppa018046mg             139   1e-56    
gb|ADN33674.1|  transposase                                             207   3e-56    
ref|XP_010272686.1|  PREDICTED: zinc finger BED domain-containing...    178   4e-56    
ref|XP_007199292.1|  hypothetical protein PRUPE_ppa023051mg             177   4e-56    
ref|XP_003592705.1|  HAT family dimerization domain containing pr...    130   4e-56    
ref|XP_008798027.1|  PREDICTED: zinc finger BED domain-containing...    178   5e-56    
gb|AAP54387.2|  hAT family dimerisation domain containing protein       162   6e-56    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064234.2|  Os10g0170600                                       162   9e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010527738.1|  PREDICTED: zinc finger BED domain-containing...    163   2e-55    
gb|AAG13541.1|AC023240_14  putative Tam3-transposase                    161   2e-55    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009113627.1|  PREDICTED: zinc finger BED domain-containing...    156   3e-55    
emb|CDP00328.1|  unnamed protein product                                161   3e-55    
ref|NP_001050494.2|  Os03g0563400                                       161   3e-55    Oryza sativa Japonica Group [Japonica rice]
gb|AAX95609.1|  hAT family dimerisation domain, putative                161   4e-55    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044546.2|  Os01g0802400                                       157   4e-55    Oryza sativa Japonica Group [Japonica rice]
gb|KHN12551.1|  Putative AC transposase                                 162   5e-55    
ref|XP_007022882.1|  BED zinc finger,hAT family dimerization doma...    176   5e-55    
ref|XP_010273438.1|  PREDICTED: zinc finger BED domain-containing...    177   7e-55    
ref|XP_010527739.1|  PREDICTED: zinc finger BED domain-containing...    163   8e-55    
ref|XP_010229759.1|  PREDICTED: zinc finger BED domain-containing...    173   1e-54    
emb|CAN68697.1|  hypothetical protein VITISV_042570                     172   1e-54    Vitis vinifera
emb|CDY59949.1|  BnaA03g58810D                                          155   1e-54    
ref|XP_010468785.1|  PREDICTED: zinc finger BED domain-containing...    169   2e-54    
ref|XP_007213552.1|  hypothetical protein PRUPE_ppa018143mg             115   3e-54    
ref|XP_008675089.1|  PREDICTED: transposon protein isoform X1           179   5e-54    
ref|XP_010513175.1|  PREDICTED: zinc finger BED domain-containing...    137   6e-54    
ref|NP_001147988.1|  transposon protein                                 179   8e-54    Zea mays [maize]
ref|XP_009781000.1|  PREDICTED: zinc finger BED domain-containing...    198   9e-54    
gb|ACN26356.1|  unknown                                                 178   1e-53    Zea mays [maize]
ref|XP_007213601.1|  hypothetical protein PRUPE_ppa002416mg             185   1e-53    
emb|CAE01302.2|  OSJNBa0020P07.19                                       169   2e-53    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057110.1|  Os06g0209900                                       175   2e-53    Oryza sativa Japonica Group [Japonica rice]
gb|KDP34464.1|  hypothetical protein JCGZ_11935                         182   3e-53    
ref|WP_001246769.1|  hypothetical protein                               195   4e-53    
ref|XP_009145546.1|  PREDICTED: zinc finger BED domain-containing...    173   5e-53    
ref|XP_009376729.1|  PREDICTED: zinc finger BED domain-containing...    184   5e-53    
gb|ABF94985.1|  hAT family dimerisation domain containing protein       173   8e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006289367.1|  hypothetical protein CARUB_v10002853mg             143   1e-52    
ref|XP_009793080.1|  PREDICTED: zinc finger BED domain-containing...    150   1e-52    
ref|XP_009598305.1|  PREDICTED: zinc finger BED domain-containing...    149   2e-52    
sp|P08770.2|TRA1_MAIZE  RecName: Full=Putative AC transposase; Al...    168   2e-52    Zea mays [maize]
ref|XP_009103069.1|  PREDICTED: zinc finger BED domain-containing...    146   2e-52    
prf||2021344A  activator-like transposable element                      167   2e-52 
ref|XP_010253168.1|  PREDICTED: zinc finger BED domain-containing...    163   2e-52    
ref|NP_001051173.1|  Os03g0733400                                       176   3e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010253170.1|  PREDICTED: zinc finger BED domain-containing...    163   3e-52    
gb|EEE64835.1|  hypothetical protein OsJ_19692                          176   3e-52    Oryza sativa Japonica Group [Japonica rice]
emb|CDY08266.1|  BnaA05g13530D                                          154   3e-52    
ref|XP_010480984.1|  PREDICTED: zinc finger BED domain-containing...    193   4e-52    
gb|EEC79762.1|  hypothetical protein OsI_21153                          176   4e-52    Oryza sativa Indica Group [Indian rice]
emb|CAN60218.1|  hypothetical protein VITISV_006612                     171   5e-52    Vitis vinifera
gb|AEF33496.1|  putative transposase                                    160   5e-52    
ref|XP_006383274.1|  hypothetical protein POPTR_0005s13270g             195   6e-52    
ref|XP_007020914.1|  BED zinc finger,hAT family dimerization doma...    201   6e-52    
ref|XP_010644074.1|  PREDICTED: zinc finger BED domain-containing...    170   6e-52    
gb|AAC61291.1|  Ac-like transposase                                     139   1e-51    Arabidopsis thaliana [mouse-ear cress]
gb|KHN37124.1|  Putative AC transposase                                 157   1e-51    
ref|XP_010527601.1|  PREDICTED: zinc finger BED domain-containing...    153   2e-51    
ref|XP_008643805.1|  PREDICTED: transposon protein isoform X1           168   4e-51    
ref|NP_001151544.1|  transposon protein                                 168   4e-51    Zea mays [maize]
ref|XP_006290045.1|  hypothetical protein CARUB_v10003680mg             133   4e-51    
emb|CDX88018.1|  BnaA06g26090D                                          151   4e-51    
ref|XP_009596976.1|  PREDICTED: zinc finger BED domain-containing...    193   6e-51    
ref|XP_002463929.1|  hypothetical protein SORBIDRAFT_01g009090          166   6e-51    Sorghum bicolor [broomcorn]
ref|NP_001174288.1|  Os05g0239150                                       174   9e-51    
gb|AAD24567.1|AF120335_1  putative transposase                          154   1e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484797.1|  PREDICTED: zinc finger BED domain-containing...    150   1e-50    
emb|CAN79118.1|  hypothetical protein VITISV_005773                     134   2e-50    Vitis vinifera
ref|XP_009610145.1|  PREDICTED: zinc finger BED domain-containing...    138   2e-50    
ref|XP_010489640.1|  PREDICTED: zinc finger BED domain-containing...    149   2e-50    
ref|XP_008643588.1|  PREDICTED: LOC100281046 isoform X1                 177   2e-50    
ref|NP_001136571.1|  uncharacterized protein LOC100216693               174   2e-50    Zea mays [maize]
ref|XP_010656943.1|  PREDICTED: zinc finger BED domain-containing...    175   2e-50    
ref|NP_001147437.1|  LOC100281046                                       177   2e-50    Zea mays [maize]
ref|XP_010656941.1|  PREDICTED: zinc finger BED domain-containing...    175   2e-50    
ref|XP_010656944.1|  PREDICTED: zinc finger BED domain-containing...    174   2e-50    
gb|AAF79835.1|AC026875_15  T6D22.19                                     153   3e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006377715.1|  hypothetical protein POPTR_0011s10500g             175   4e-50    
emb|CAH66110.1|  OSIGBa0115D20.3                                        172   6e-50    Oryza sativa [red rice]
ref|XP_011044575.1|  PREDICTED: zinc finger BED domain-containing...    173   6e-50    
ref|XP_010268748.1|  PREDICTED: zinc finger BED domain-containing...    189   1e-49    
ref|XP_007210480.1|  hypothetical protein PRUPE_ppb018633mg             177   1e-49    
ref|XP_010314161.1|  PREDICTED: zinc finger BED domain-containing...    187   2e-49    
ref|XP_006370067.1|  hypothetical protein POPTR_0001s39240g             172   2e-49    
ref|XP_009613012.1|  PREDICTED: zinc finger BED domain-containing...    139   2e-49    
ref|XP_007214577.1|  hypothetical protein PRUPE_ppa019953mg             150   2e-49    
ref|XP_009622105.1|  PREDICTED: zinc finger BED domain-containing...    188   3e-49    
ref|XP_011098171.1|  PREDICTED: zinc finger BED domain-containing...    173   3e-49    
ref|XP_010534728.1|  PREDICTED: zinc finger BED domain-containing...    125   5e-49    
ref|XP_011045538.1|  PREDICTED: zinc finger BED domain-containing...    169   6e-49    
ref|XP_009777794.1|  PREDICTED: zinc finger BED domain-containing...    184   9e-49    
emb|CAB72476.1|  putative protein                                       146   9e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007021998.1|  BED zinc finger,hAT family dimerization doma...    160   1e-48    
ref|NP_001056444.1|  Os05g0583100                                       176   1e-48    Oryza sativa Japonica Group [Japonica rice]
sp|P03010.1|TRAC9_MAIZE  RecName: Full=Putative AC9 transposase         156   1e-48    Zea mays [maize]
ref|XP_007022001.1|  BED zinc finger,hAT family dimerization doma...    160   2e-48    
ref|XP_004511203.1|  PREDICTED: uncharacterized protein LOC101508098    191   2e-48    
ref|XP_009762687.1|  PREDICTED: zinc finger BED domain-containing...    129   2e-48    
ref|XP_010906914.1|  PREDICTED: zinc finger BED domain-containing...    163   2e-48    
gb|AAX95747.1|  hAT family dimerisation domain, putative                157   3e-48    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001176059.1|  Os10g0197200                                       157   4e-48    
ref|XP_011082213.1|  PREDICTED: zinc finger BED domain-containing...    180   5e-48    
ref|XP_006292237.1|  hypothetical protein CARUB_v10018444mg             146   5e-48    
ref|XP_002444199.1|  hypothetical protein SORBIDRAFT_07g014880          157   7e-48    Sorghum bicolor [broomcorn]
ref|XP_008790202.1|  PREDICTED: zinc finger BED domain-containing...    163   7e-48    
ref|XP_007219124.1|  hypothetical protein PRUPE_ppa015847mg             156   7e-48    
ref|XP_009626477.1|  PREDICTED: zinc finger BED domain-containing...    135   9e-48    
ref|XP_010684088.1|  PREDICTED: zinc finger BED domain-containing...    155   1e-47    
ref|XP_009379897.1|  PREDICTED: zinc finger BED domain-containing...    163   1e-47    
ref|XP_009379895.1|  PREDICTED: zinc finger BED domain-containing...    163   1e-47    
ref|XP_010917997.1|  PREDICTED: zinc finger BED domain-containing...    144   2e-47    
ref|XP_009379900.1|  PREDICTED: zinc finger BED domain-containing...    163   2e-47    
ref|XP_009621852.1|  PREDICTED: zinc finger BED domain-containing...    181   2e-47    
gb|AGH20188.1|  transposase                                             141   2e-47    
ref|XP_010485286.1|  PREDICTED: zinc finger BED domain-containing...    142   4e-47    
ref|XP_006386801.1|  hypothetical protein POPTR_0002s22070g             137   4e-47    
ref|XP_010430867.1|  PREDICTED: zinc finger BED domain-containing...    142   4e-47    
ref|XP_010431303.1|  PREDICTED: zinc finger BED domain-containing...    142   5e-47    
ref|XP_010424150.1|  PREDICTED: zinc finger BED domain-containing...    142   1e-46    
ref|XP_010490052.1|  PREDICTED: zinc finger BED domain-containing...    186   1e-46    
ref|XP_008776870.1|  PREDICTED: zinc finger BED domain-containing...    162   2e-46    
ref|XP_010906913.1|  PREDICTED: zinc finger BED domain-containing...    159   2e-46    
ref|XP_009390780.1|  PREDICTED: zinc finger BED domain-containing...    164   2e-46    
ref|XP_007048823.1|  BED zinc finger,hAT family dimerization domain     168   2e-46    
emb|CDP06055.1|  unnamed protein product                                168   2e-46    
ref|XP_010690214.1|  PREDICTED: zinc finger BED domain-containing...    106   2e-46    
ref|XP_006851229.1|  hypothetical protein AMTR_s00180p00017340          170   3e-46    
emb|CCI55351.1|  PH01B019A14.20                                         130   3e-46    
gb|KHG07030.1|  Putative AC transposase                                 154   4e-46    
ref|XP_009129514.1|  PREDICTED: zinc finger BED domain-containing...    116   5e-46    
ref|XP_009145274.1|  PREDICTED: zinc finger BED domain-containing...    159   6e-46    
ref|XP_010315628.1|  PREDICTED: zinc finger BED domain-containing...    176   6e-46    
ref|XP_010675272.1|  PREDICTED: zinc finger BED domain-containing...    183   9e-46    
ref|NP_001056445.1|  Os05g0583200                                       163   9e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009137078.1|  PREDICTED: zinc finger BED domain-containing...    136   9e-46    
gb|EEE64837.1|  hypothetical protein OsJ_19694                          164   1e-45    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009764968.1|  PREDICTED: zinc finger BED domain-containing...    176   1e-45    
ref|XP_010532457.1|  PREDICTED: zinc finger BED domain-containing...    179   1e-45    
gb|KHN26291.1|  Putative AC transposase                                 164   1e-45    
ref|XP_009392578.1|  PREDICTED: zinc finger BED domain-containing...    159   2e-45    
ref|XP_010463124.1|  PREDICTED: zinc finger BED domain-containing...    178   2e-45    
ref|XP_011070561.1|  PREDICTED: uncharacterized protein LOC105156187    182   2e-45    
ref|XP_010412443.1|  PREDICTED: zinc finger BED domain-containing...    109   2e-45    
emb|CAN61798.1|  hypothetical protein VITISV_044291                     181   2e-45    Vitis vinifera
ref|XP_006304852.1|  hypothetical protein CARUB_v10012565mg             140   2e-45    
ref|XP_009415017.1|  PREDICTED: zinc finger BED domain-containing...    158   3e-45    
ref|XP_009367359.1|  PREDICTED: zinc finger BED domain-containing...    177   3e-45    
gb|KDP42662.1|  hypothetical protein JCGZ_00166                         160   5e-45    
ref|XP_010481147.1|  PREDICTED: zinc finger BED domain-containing...    104   6e-45    
ref|NP_001130635.1|  uncharacterized protein LOC100191735               143   6e-45    Zea mays [maize]
emb|CAN63250.1|  hypothetical protein VITISV_017354                     125   6e-45    Vitis vinifera
ref|XP_011082939.1|  PREDICTED: zinc finger BED domain-containing...    172   7e-45    
gb|KGN55034.1|  hypothetical protein Csa_4G624400                       163   7e-45    
ref|XP_009782796.1|  PREDICTED: zinc finger BED domain-containing...    169   9e-45    
ref|XP_008680982.1|  PREDICTED: uncharacterized protein LOC100191...    142   1e-44    
ref|XP_009605438.1|  PREDICTED: zinc finger BED domain-containing...    170   1e-44    
ref|XP_007133312.1|  hypothetical protein PHAVU_011G169000g             160   1e-44    
gb|AAP59878.1|  Ac-like transposase THELMA13                            135   2e-44    Silene latifolia
ref|XP_006386803.1|  hypothetical protein POPTR_0002s22170g             109   2e-44    
ref|XP_011085903.1|  PREDICTED: zinc finger BED domain-containing...    170   2e-44    
ref|XP_010468189.1|  PREDICTED: zinc finger BED domain-containing...    175   3e-44    
ref|XP_008776470.1|  PREDICTED: zinc finger BED domain-containing...    176   3e-44    
ref|XP_011076819.1|  PREDICTED: zinc finger BED domain-containing...    169   4e-44    
ref|XP_010060762.1|  PREDICTED: zinc finger BED domain-containing...    157   5e-44    
ref|XP_009108655.1|  PREDICTED: zinc finger BED domain-containing...    178   5e-44    
ref|XP_009107624.1|  PREDICTED: zinc finger BED domain-containing...    168   5e-44    
ref|XP_007216990.1|  hypothetical protein PRUPE_ppa002590mg             150   5e-44    
ref|XP_010327097.1|  PREDICTED: zinc finger BED domain-containing...    155   7e-44    
gb|KHN10510.1|  Putative AC transposase                                 171   8e-44    
ref|XP_010679702.1|  PREDICTED: zinc finger BED domain-containing...    139   1e-43    
ref|XP_007202937.1|  hypothetical protein PRUPE_ppa016808mg           96.7    1e-43    
ref|XP_010678441.1|  PREDICTED: zinc finger BED domain-containing...    136   1e-43    
ref|XP_009597359.1|  PREDICTED: zinc finger BED domain-containing...    118   1e-43    
ref|XP_009757222.1|  PREDICTED: zinc finger BED domain-containing...    167   1e-43    
ref|XP_007221326.1|  hypothetical protein PRUPE_ppa016809mg             108   2e-43    
ref|XP_002442948.1|  hypothetical protein SORBIDRAFT_08g005330          159   2e-43    
ref|XP_007227103.1|  hypothetical protein PRUPE_ppa025706mg             176   2e-43    
ref|XP_007219605.1|  hypothetical protein PRUPE_ppa023156mg             176   2e-43    
gb|AAG50652.1|AC073433_4  transposase, putative                         128   2e-43    
ref|XP_010535019.1|  PREDICTED: zinc finger BED domain-containing...    144   2e-43    
ref|XP_007200126.1|  hypothetical protein PRUPE_ppa018034mg             176   2e-43    
ref|XP_006407043.1|  hypothetical protein EUTSA_v10020233mg             151   2e-43    
ref|XP_010468709.1|  PREDICTED: zinc finger BED domain-containing...    163   2e-43    
ref|XP_009800989.1|  PREDICTED: zinc finger BED domain-containing...    153   3e-43    
ref|XP_006369379.1|  hypothetical protein POPTR_0001s22360g             169   3e-43    
emb|CAB41922.1|  putative protein (possibly fragment)                   120   3e-43    
ref|XP_010256080.1|  PREDICTED: zinc finger BED domain-containing...    144   4e-43    
ref|XP_010256082.1|  PREDICTED: zinc finger BED domain-containing...    144   4e-43    
gb|EAY89356.1|  hypothetical protein OsI_10860                          172   4e-43    
ref|XP_009597360.1|  PREDICTED: zinc finger BED domain-containing...    116   4e-43    
ref|XP_009770558.1|  PREDICTED: zinc finger BED domain-containing...    166   4e-43    
ref|XP_009764185.1|  PREDICTED: zinc finger BED domain-containing...    166   4e-43    
ref|XP_007200665.1|  hypothetical protein PRUPE_ppa015215mg             136   4e-43    
ref|XP_010654811.1|  PREDICTED: zinc finger BED domain-containing...    147   5e-43    
ref|XP_009757221.1|  PREDICTED: zinc finger BED domain-containing...    167   5e-43    
ref|XP_007199330.1|  hypothetical protein PRUPE_ppa023755mg             174   5e-43    
ref|XP_007227649.1|  hypothetical protein PRUPE_ppa016870mg             174   6e-43    
ref|XP_010682149.1|  PREDICTED: zinc finger BED domain-containing...    109   1e-42    
gb|KFK28799.1|  hypothetical protein AALP_AA7G049700                    169   1e-42    
ref|XP_009374223.1|  PREDICTED: zinc finger BED domain-containing...    166   1e-42    
ref|XP_010670292.1|  PREDICTED: zinc finger BED domain-containing...    165   1e-42    
ref|XP_010501571.1|  PREDICTED: zinc finger BED domain-containing...    160   1e-42    
ref|XP_009624222.1|  PREDICTED: zinc finger BED domain-containing...    151   1e-42    
ref|XP_010241568.1|  PREDICTED: zinc finger BED domain-containing...    154   1e-42    
ref|XP_009374222.1|  PREDICTED: zinc finger BED domain-containing...    166   1e-42    
ref|XP_007022002.1|  BED zinc finger,hAT family dimerization doma...    139   2e-42    
ref|XP_007224101.1|  hypothetical protein PRUPE_ppa015615mg             172   2e-42    
ref|XP_007033378.1|  BED zinc finger,hAT family dimerization doma...    142   3e-42    
ref|XP_007033376.1|  BED zinc finger,hAT family dimerization doma...    142   3e-42    
ref|XP_007033377.1|  BED zinc finger,hAT family dimerization doma...    142   3e-42    
ref|XP_009609960.1|  PREDICTED: zinc finger BED domain-containing...    163   3e-42    
ref|XP_009127055.1|  PREDICTED: zinc finger BED domain-containing...    172   4e-42    
ref|XP_010696384.1|  PREDICTED: zinc finger BED domain-containing...    165   5e-42    
ref|XP_009763136.1|  PREDICTED: zinc finger BED domain-containing...    162   5e-42    
emb|CAN81954.1|  hypothetical protein VITISV_014020                     145   5e-42    
ref|XP_002451486.1|  hypothetical protein SORBIDRAFT_04g002725          171   6e-42    
ref|XP_009801003.1|  PREDICTED: zinc finger BED domain-containing...    147   7e-42    
emb|CDY20085.1|  BnaA01g29170D                                          146   7e-42    
gb|EPS60750.1|  hypothetical protein M569_14050                         162   8e-42    
ref|XP_010035892.1|  PREDICTED: zinc finger BED domain-containing...    142   9e-42    
ref|XP_009116606.1|  PREDICTED: zinc finger BED domain-containing...    147   9e-42    
ref|XP_008775801.1|  PREDICTED: zinc finger BED domain-containing...    165   1e-41    
ref|XP_007220434.1|  hypothetical protein PRUPE_ppa003125mg             170   1e-41    
ref|XP_010430907.1|  PREDICTED: zinc finger BED domain-containing...    125   1e-41    
ref|XP_010247653.1|  PREDICTED: zinc finger BED domain-containing...    162   1e-41    
ref|XP_007028994.1|  Ac-like transposase THELMA13                       156   1e-41    
ref|XP_009631480.1|  PREDICTED: zinc finger BED domain-containing...    107   1e-41    
gb|KGN47993.1|  hypothetical protein Csa_6G423350                       153   1e-41    
ref|XP_010424695.1|  PREDICTED: zinc finger BED domain-containing...    165   1e-41    
ref|XP_010551474.1|  PREDICTED: zinc finger BED domain-containing...    149   1e-41    
ref|XP_010424448.1|  PREDICTED: zinc finger BED domain-containing...  99.0    2e-41    
ref|XP_009121228.1|  PREDICTED: zinc finger BED domain-containing...    165   3e-41    
ref|XP_010412406.1|  PREDICTED: zinc finger BED domain-containing...    163   4e-41    
gb|AAF19546.1|AC007190_14  F23N19.13                                    122   6e-41    
ref|XP_008812480.1|  PREDICTED: zinc finger BED domain-containing...    102   6e-41    
emb|CDY12828.1|  BnaC07g16050D                                        99.8    7e-41    
dbj|BAD93710.1|  unnamed protein product                                133   7e-41    
dbj|BAI39457.1|  transposase                                            133   8e-41    
gb|KHN03605.1|  Putative AC transposase                                 144   9e-41    
ref|XP_007202856.1|  hypothetical protein PRUPE_ppa015420mg             169   1e-40    
ref|XP_010236819.1|  PREDICTED: zinc finger BED domain-containing...    163   1e-40    
ref|XP_010485160.1|  PREDICTED: zinc finger BED domain-containing...    164   1e-40    
gb|KHN15060.1|  Putative AC transposase                                 143   1e-40    
ref|XP_010230399.1|  PREDICTED: zinc finger BED domain-containing...    169   2e-40    
gb|KHG11798.1|  Putative AC transposase                                 167   2e-40    
gb|EYU28909.1|  hypothetical protein MIMGU_mgv1a002591mg                156   2e-40    
ref|XP_009631898.1|  PREDICTED: zinc finger BED domain-containing...    165   3e-40    
ref|XP_003599936.1|  hypothetical protein MTR_3g049280                  101   3e-40    
ref|XP_011081954.1|  PREDICTED: zinc finger BED domain-containing...    147   4e-40    
ref|XP_011081945.1|  PREDICTED: zinc finger BED domain-containing...    146   4e-40    
ref|XP_009364679.1|  PREDICTED: zinc finger BED domain-containing...    163   4e-40    
ref|XP_008792782.1|  PREDICTED: zinc finger BED domain-containing...    135   5e-40    
ref|XP_008792783.1|  PREDICTED: zinc finger BED domain-containing...    135   5e-40    
ref|XP_010924127.1|  PREDICTED: zinc finger BED domain-containing...    134   5e-40    
ref|XP_010229678.1|  PREDICTED: zinc finger BED domain-containing...    123   7e-40    
ref|NP_001174030.1|  Os04g0542100                                       134   7e-40    
ref|XP_008809199.1|  PREDICTED: zinc finger BED domain-containing...    100   1e-39    
ref|XP_003599931.1|  hypothetical protein MTR_3g049190                  101   1e-39    
ref|XP_010230409.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    159   2e-39    
ref|XP_009335444.1|  PREDICTED: zinc finger BED domain-containing...    160   2e-39    
emb|CAN66417.1|  hypothetical protein VITISV_044134                   99.8    2e-39    
ref|XP_010506923.1|  PREDICTED: zinc finger BED domain-containing...    160   2e-39    
dbj|BAJ88673.1|  predicted protein                                      165   2e-39    
dbj|BAB02646.1|  Ac transposase-like protein                            140   3e-39    
dbj|BAJ96825.1|  predicted protein                                      165   3e-39    
ref|XP_006379130.1|  hypothetical protein POPTR_0009s08260g             158   4e-39    
gb|KHN15596.1|  Putative AC transposase                               94.7    4e-39    
ref|XP_010327109.1|  PREDICTED: zinc finger BED domain-containing...    163   5e-39    
ref|XP_010473014.1|  PREDICTED: zinc finger BED domain-containing...    159   5e-39    
gb|KGN60709.1|  hypothetical protein Csa_2G008020                       145   6e-39    
ref|XP_008457064.1|  PREDICTED: putative AC transposase                 144   6e-39    
ref|XP_010431219.1|  PREDICTED: zinc finger BED domain-containing...    100   7e-39    
ref|XP_009775720.1|  PREDICTED: zinc finger BED domain-containing...    157   7e-39    
ref|XP_010326126.1|  PREDICTED: zinc finger BED domain-containing...    154   7e-39    
ref|XP_010923373.1|  PREDICTED: zinc finger BED domain-containing...    137   8e-39    
ref|XP_007146367.1|  hypothetical protein PHAVU_006G034500g             162   9e-39    
emb|CDP22169.1|  unnamed protein product                                156   9e-39    
ref|XP_009103832.1|  PREDICTED: zinc finger BED domain-containing...  95.1    9e-39    
ref|XP_009596761.1|  PREDICTED: zinc finger BED domain-containing...    156   9e-39    
dbj|BAK01733.1|  predicted protein                                      163   1e-38    
ref|XP_010047980.1|  PREDICTED: zinc finger BED domain-containing...    144   1e-38    
ref|XP_010923384.1|  PREDICTED: zinc finger BED domain-containing...    137   1e-38    
ref|NP_001043202.2|  Os01g0518400                                       145   1e-38    
sp|Q0JMB2.3|RSLE4_ORYSJ  RecName: Full=Zinc finger BED domain-con...    145   1e-38    
ref|XP_009595730.1|  PREDICTED: zinc finger BED domain-containing...    155   1e-38    
ref|XP_010415243.1|  PREDICTED: zinc finger BED domain-containing...    156   1e-38    
ref|XP_006297141.1|  hypothetical protein CARUB_v10013145mg             136   1e-38    
gb|KHN18108.1|  Putative AC transposase                                 160   1e-38    
ref|XP_009761067.1|  PREDICTED: zinc finger BED domain-containing...    157   2e-38    
ref|XP_010277695.1|  PREDICTED: zinc finger BED domain-containing...    103   2e-38    
ref|XP_010268111.1|  PREDICTED: zinc finger BED domain-containing...    156   2e-38    
ref|XP_010507036.1|  PREDICTED: zinc finger BED domain-containing...    100   3e-38    
ref|XP_009797845.1|  PREDICTED: zinc finger BED domain-containing...    156   3e-38    
ref|XP_009619413.1|  PREDICTED: zinc finger BED domain-containing...  97.4    4e-38    
ref|XP_003638290.1|  hypothetical protein MTR_126s0001                  133   4e-38    
ref|XP_007207820.1|  hypothetical protein PRUPE_ppa023823mg             156   5e-38    
gb|KHN23048.1|  Putative AC transposase                                 160   6e-38    
ref|XP_010431052.1|  PREDICTED: zinc finger BED domain-containing...    157   6e-38    
gb|KDO48633.1|  hypothetical protein CISIN_1g005485mg                   137   6e-38    
emb|CDY45808.1|  BnaC03g16310D                                        90.9    6e-38    
gb|AEF33497.1|  putative transposase                                    155   6e-38    
ref|NP_001060325.2|  Os07g0624100                                       161   6e-38    
ref|XP_010502162.1|  PREDICTED: zinc finger BED domain-containing...    135   7e-38    
ref|XP_008242814.1|  PREDICTED: putative AC transposase isoform X1      142   8e-38    
ref|XP_011069601.1|  PREDICTED: zinc finger BED domain-containing...    157   8e-38    
ref|XP_008242815.1|  PREDICTED: putative AC transposase isoform X2      142   8e-38    
ref|XP_010415664.1|  PREDICTED: zinc finger BED domain-containing...    144   9e-38    
ref|XP_010502154.1|  PREDICTED: zinc finger BED domain-containing...    135   9e-38    
ref|XP_007210781.1|  hypothetical protein PRUPE_ppa019206mg           96.3    9e-38    
ref|XP_010415663.1|  PREDICTED: zinc finger BED domain-containing...    143   9e-38    
ref|XP_006427320.1|  hypothetical protein CICLE_v10025036mg             136   9e-38    
ref|XP_010502139.1|  PREDICTED: zinc finger BED domain-containing...    135   9e-38    
ref|XP_010502134.1|  PREDICTED: zinc finger BED domain-containing...    135   9e-38    
gb|KHM99619.1|  Putative AC transposase                                 159   1e-37    
ref|XP_009623209.1|  PREDICTED: zinc finger BED domain-containing...    135   1e-37    
ref|XP_007155048.1|  hypothetical protein PHAVU_003G168600g             140   1e-37    
ref|XP_007013534.1|  BED zinc finger,hAT family dimerization doma...    143   1e-37    
ref|XP_010465389.1|  PREDICTED: zinc finger BED domain-containing...    134   2e-37    
ref|XP_010487284.1|  PREDICTED: zinc finger BED domain-containing...    136   2e-37    
dbj|BAK03580.1|  predicted protein                                      152   2e-37    
gb|KCW80278.1|  hypothetical protein EUGRSUZ_C01635                     158   3e-37    
ref|XP_007013535.1|  BED zinc finger,hAT family dimerization doma...    143   3e-37    
ref|XP_010501749.1|  PREDICTED: zinc finger BED domain-containing...    160   3e-37    
ref|XP_009589710.1|  PREDICTED: zinc finger BED domain-containing...    152   3e-37    
ref|XP_010495857.1|  PREDICTED: zinc finger BED domain-containing...    156   3e-37    
ref|XP_006380153.1|  hypothetical protein POPTR_0008s22405g             152   3e-37    
ref|XP_009770684.1|  PREDICTED: zinc finger BED domain-containing...    150   4e-37    
ref|XP_010512061.1|  PREDICTED: zinc finger BED domain-containing...    142   5e-37    
ref|XP_010250193.1|  PREDICTED: zinc finger BED domain-containing...    157   5e-37    
ref|XP_010512060.1|  PREDICTED: zinc finger BED domain-containing...    142   5e-37    
ref|XP_009588134.1|  PREDICTED: zinc finger BED domain-containing...    141   7e-37    
ref|XP_010312124.1|  PREDICTED: zinc finger BED domain-containing...    144   8e-37    
ref|NP_001241846.1|  uncharacterized protein LOC100857052               151   8e-37    
ref|XP_010468592.1|  PREDICTED: zinc finger BED domain-containing...    104   1e-36    
ref|XP_010412790.1|  PREDICTED: zinc finger BED domain-containing...  84.0    1e-36    
ref|XP_010237819.1|  PREDICTED: zinc finger BED domain-containing...    155   1e-36    
ref|NP_001050398.2|  Os03g0424600                                       105   2e-36    
gb|AAS16893.2|  putative hAT family dimerisation domain containin...    149   3e-36    
ref|XP_010327632.1|  PREDICTED: zinc finger BED domain-containing...    153   4e-36    
emb|CDP03495.1|  unnamed protein product                              99.4    4e-36    
gb|ABF96699.1|  AC transposase, putative, expressed                     103   4e-36    
gb|EPS67926.1|  hypothetical protein M569_06846                         137   5e-36    
ref|XP_006285350.1|  hypothetical protein CARUB_v10006740mg           83.6    5e-36    
emb|CDX68487.1|  BnaC01g25650D                                        91.7    5e-36    
ref|XP_010534669.1|  PREDICTED: zinc finger BED domain-containing...  97.4    5e-36    
ref|XP_009610280.1|  PREDICTED: zinc finger BED domain-containing...    154   6e-36    
ref|XP_009783770.1|  PREDICTED: zinc finger BED domain-containing...    154   7e-36    
ref|XP_010232197.1|  PREDICTED: zinc finger BED domain-containing...    120   7e-36    
ref|XP_010687924.1|  PREDICTED: zinc finger BED domain-containing...    130   7e-36    
ref|XP_010687925.1|  PREDICTED: zinc finger BED domain-containing...    130   8e-36    
ref|XP_010097200.1|  Putative AC transposase                            134   8e-36    
ref|XP_009757583.1|  PREDICTED: zinc finger BED domain-containing...    145   8e-36    
ref|XP_009336302.1|  PREDICTED: zinc finger BED domain-containing...    118   1e-35    
gb|AAP03362.1|  putative transposase                                    110   1e-35    
ref|XP_009140280.1|  PREDICTED: zinc finger BED domain-containing...    148   1e-35    
ref|XP_007199108.1|  hypothetical protein PRUPE_ppa020685mg           81.3    1e-35    
ref|XP_010474243.1|  PREDICTED: zinc finger BED domain-containing...    137   1e-35    
gb|KGN65126.1|  hypothetical protein Csa_1G229510                       139   1e-35    
ref|XP_004974613.1|  PREDICTED: uncharacterized protein LOC101754525    103   2e-35    
ref|XP_010541714.1|  PREDICTED: zinc finger BED domain-containing...    133   2e-35    
ref|XP_010541713.1|  PREDICTED: zinc finger BED domain-containing...    133   2e-35    
ref|XP_009767703.1|  PREDICTED: zinc finger BED domain-containing...  94.4    2e-35    
gb|ACN33643.1|  unknown                                                 132   2e-35    
ref|XP_010692516.1|  PREDICTED: zinc finger BED domain-containing...    145   2e-35    
ref|XP_007138404.1|  hypothetical protein PHAVU_009G205900g             132   2e-35    
ref|XP_010424173.1|  PREDICTED: zinc finger BED domain-containing...    104   2e-35    
ref|XP_007036331.1|  BED zinc finger,hAT family dimerization domain     114   3e-35    
ref|XP_010666012.1|  PREDICTED: zinc finger BED domain-containing...    152   3e-35    
ref|XP_009356659.1|  PREDICTED: zinc finger BED domain-containing...    152   4e-35    
ref|XP_009780704.1|  PREDICTED: zinc finger BED domain-containing...    105   4e-35    
emb|CDP18725.1|  unnamed protein product                                152   4e-35    
gb|KCW80149.1|  hypothetical protein EUGRSUZ_C01493                     150   4e-35    
ref|NP_001151767.1|  LOC100285402                                       130   4e-35    
ref|XP_007206270.1|  hypothetical protein PRUPE_ppa016213mg           86.3    5e-35    
ref|XP_010535860.1|  PREDICTED: zinc finger BED domain-containing...    151   6e-35    
ref|XP_009791008.1|  PREDICTED: zinc finger BED domain-containing...    139   6e-35    
gb|EPS71279.1|  hypothetical protein M569_03484                         139   7e-35    
ref|XP_009804558.1|  PREDICTED: zinc finger BED domain-containing...    143   7e-35    
ref|XP_010322292.1|  PREDICTED: uncharacterized protein LOC104647992    103   9e-35    
ref|XP_009791353.1|  PREDICTED: zinc finger BED domain-containing...    101   9e-35    
ref|XP_008385081.1|  PREDICTED: uncharacterized protein LOC103447669    149   1e-34    
ref|XP_007213398.1|  hypothetical protein PRUPE_ppa026428mg             140   1e-34    
ref|XP_010424269.1|  PREDICTED: zinc finger BED domain-containing...    146   1e-34    



>ref|XP_009781949.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=1040

 Score =   270 bits (689),  Expect(3) = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/335 (46%), Positives = 214/335 (64%), Gaps = 17/335 (5%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD-------NSFKSDLGDSIP--TSL  1667
             K SLCLDV TRWNSTY+ML +A  ++  FD Y + D        ++  + G S    TS+
Sbjct  685   KRSLCLDVSTRWNSTYMMLDTAQQFELAFDKYSFFDIGLLHHLRTYVCEDGTSAGDLTSV  744

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGA  1490
             DW++V  +VK L+ FY +T+R+SGS+YVT+N  F EI +L  IL E +E  D ++K M  
Sbjct  745   DWDNVRTMVKFLEAFYLLTLRVSGSIYVTSNVHFVEICELDLILKEWMEHEDTSLKEMAK  804

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
              MK KF KY G+ +KMN MIF A+ILDPR+KLEY+P  +V M+G+ KGK  + ++   ++
Sbjct  805   KMKEKFVKYWGEPEKMNKMIFIASILDPRNKLEYVPFAIVRMFGENKGKKLILEVKNYMD  864

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG--  1136
              L+D Y    S     A+   +  +V+    F+     R     K + +K + E+ GG  
Sbjct  865   SLFDYYVKKNSIGTSSASSGNTTTTVSGYGSFL----KRGTMRTKLEFEKHK-EVTGGLG  919

Query  1135  KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSIS  956
              K ELE YL+E +  +   F IL+WWK+N  RFPIL+++ARD+LAIPIS+VASE AFS  
Sbjct  920   TKSELERYLAEDLEPETDDFKILKWWKINEPRFPILAEMARDVLAIPISSVASECAFSTG  979

Query  955   GRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             GR+LD FRSSLTPK+V++L+C QDWLR    PI +
Sbjct  980   GRILDSFRSSLTPKLVQSLICLQDWLRSEPIPIKV  1014


 Score =   121 bits (303),  Expect(3) = 4e-108, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHKG+ +A+ + +CL++WGL NVFT+TVDNASSNDV +  + +++ +WG++ + 
Sbjct  566   NFCPISSHKGDDMASVITNCLLDWGLENVFTITVDNASSNDVTVREVSKQLTTWGTNIMN  625

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
              K+LH+RC+AHILNL+VQD LK+  +++KRVR+ VRY+R SP++++KF++  E     SK
Sbjct  626   GKHLHVRCMAHILNLIVQDGLKEIGVSIKRVRQAVRYIRQSPARIRKFKECCESQKLTSK  685

Query  1818  KHPCV  1804
             +  C+
Sbjct  686   RSLCL  690


 Score = 52.8 bits (125),  Expect(3) = 4e-108, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             ++ +TTD+WTSIQRINYM +TAHFID +W
Sbjct  530   KICLTTDTWTSIQRINYMCLTAHFIDRDW  558



>ref|XP_009796184.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=980

 Score =   281 bits (719),  Expect(3) = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/337 (45%), Positives = 212/337 (63%), Gaps = 11/337 (3%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKS--------DLGDSIP-  1676
             +E   +LCLDVPTRWNSTYLML +A  ++K FD     D+ F +        D G++ P 
Sbjct  620   VECTKTLCLDVPTRWNSTYLMLDTAQHFEKAFDKLHLFDDGFSAYQCSHLCEDGGNAGPL  679

Query  1675  TSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKL  1499
              S DW +V N+++ L  F+E+T ++SGS YVT N+ F ++S+LYC L   +   D  ++ 
Sbjct  680   ESDDWVNVRNVIEFLARFHELTKKVSGSRYVTCNSHFEDVSELYCHLKMCLASEDEHLRK  739

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLA  1319
             M   M+ KF+KY G+ +KMN MIF A++LDPR+K EY+   L  ++G++KGK    ++ A
Sbjct  740   MAQQMQEKFKKYWGEPEKMNKMIFIASVLDPRNKFEYVEGALEELFGEEKGKKINAEVYA  799

Query  1318  ALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMEL-L  1142
              +N L+ +Y   YS    P + S S +S N       + +   +   K  +KKQ+ +   
Sbjct  800   YMNSLFGEYLKKYSTESCPQSPSSSTSSNNTSNTPSGSVISASKIRTKLSLKKQKEDNGS  859

Query  1141  GGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
             GG K EL+ Y+SE        FDIL WWK ++ RFPILS++ARD+LAIPIS+VASE AFS
Sbjct  860   GGAKSELDKYISEEQEPFSEEFDILSWWKTHAPRFPILSELARDVLAIPISSVASECAFS  919

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
               GR+LD FRSSLTPK V+AL+C QDWLR    PIS+
Sbjct  920   TGGRILDSFRSSLTPKCVQALICVQDWLREEKNPISV  956


 Score =   109 bits (272),  Expect(3) = 1e-107, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHKGE +  A+  CL+EW L  VFT+TVDNASSNDV +  L +++  W ++ + 
Sbjct  504   NFCPITSHKGEEMTKAIRDCLLEWKLDKVFTITVDNASSNDVTVKELSKQLDMWKTNMMS  563

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
              K+LH+RC+AHILNL+VQD LK+ D +V RVR +VRYVRSSP++  KF+
Sbjct  564   GKHLHVRCMAHILNLIVQDGLKELDASVTRVRNIVRYVRSSPARTLKFK  612


 Score = 51.2 bits (121),  Expect(3) = 1e-107, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             ++ +TTD+WTS+QRINYM +TAHFID +W
Sbjct  468   KICLTTDTWTSLQRINYMCLTAHFIDRDW  496



>ref|XP_010693749.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Beta vulgaris subsp. vulgaris]
Length=754

 Score =   265 bits (678),  Expect(3) = 2e-105, Method: Compositional matrix adjust.
 Identities = 147/330 (45%), Positives = 200/330 (61%), Gaps = 16/330 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGD--------SIPT  1673
             I  ++ LCLDVPTRWNSTYLML +A+ +   F+ ++  DN +  DL D          P 
Sbjct  396   ISTQSMLCLDVPTRWNSTYLMLNTAVKFINAFERFDGEDNHYHDDLWDVNGYGNGLGKPV  455

Query  1672  SLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA-VKLM  1496
               DW+ V NL+ LL+ FY +T+R+SGS YVT++T+F E++D+ C+L +  ++     K M
Sbjct  456   FEDWDHVKNLIILLEAFYSLTLRVSGSSYVTSDTYFHEVTDVDCLLKQWCDSSNEDFKSM  515

Query  1495  GANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAA  1316
                MK K +KY GD  K N M+F + +LDPR K E +   +  MY          ++  A
Sbjct  516   ALKMKEKCDKYWGDPTKFNVMLFLSAVLDPRYKWECVEYGICQMYESDVALAVCTRVKKA  575

Query  1315  LNELYDDYAV--SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKK-QRMEL  1145
               +++D+Y+   S   +    T SG   S  + +E      G    +++A+ KK +  + 
Sbjct  576   FRDIFDEYSHKGSLGANRPACTQSGVPYSTGVDIETSKENKG----IIRARYKKLKATKE  631

Query  1144  LGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAF  965
              G  K E+E YL E   ED   FDIL+WWK N++RFP LS IARD+LAIP+STVASESAF
Sbjct  632   DGDSKSEIEKYLDEETVEDVDDFDILKWWKTNTSRFPTLSLIARDVLAIPVSTVASESAF  691

Query  964   SISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             S  GRVLD FRSSLTPKIVEALVC QDWLR
Sbjct  692   STGGRVLDPFRSSLTPKIVEALVCGQDWLR  721


 Score =   117 bits (294),  Expect(3) = 2e-105, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHKGE I  A+E CL+ WG+ NV TVTVDNASSND A+ +LK+++ +WG+S VK
Sbjct  280   NFCPISSHKGEAIGKAIEKCLLAWGIENVMTVTVDNASSNDTAIVYLKKRLNNWGTSVVK  339

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              ++LH+RCIAHI+NLVV D LK    +V RVR  VR+VRSS ++++KF+  A
Sbjct  340   GEFLHVRCIAHIMNLVVTDGLKLVSDSVHRVRNAVRFVRSSSNRVEKFKRCA  391


 Score = 51.2 bits (121),  Expect(3) = 2e-105, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             ++V +TTD+WTSIQ+INYM +TAHFID +W
Sbjct  243   RKVCLTTDTWTSIQKINYMCLTAHFIDNDW  272



>ref|XP_010675028.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Beta vulgaris subsp. vulgaris]
Length=712

 Score =   263 bits (671),  Expect(3) = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/330 (45%), Positives = 199/330 (60%), Gaps = 16/330 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGD--------SIPT  1673
             I  ++ LCLDVPTRWNSTYLML +A+ +   F+  +  DN +  DL D          P 
Sbjct  354   ISTQSMLCLDVPTRWNSTYLMLNTAVKFINAFERCDGEDNHYHDDLWDVNGYGNGLGKPV  413

Query  1672  SLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA-VKLM  1496
               DW+ V NL+ LL+ FY +T+R+SGS YVT++T+F E+SD+ C+L +  ++     K M
Sbjct  414   FEDWDHVKNLIILLEAFYSLTLRVSGSSYVTSDTYFHEVSDVDCLLKQWCDSSNEDFKSM  473

Query  1495  GANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAA  1316
                MK K +KY GD  K N M+F + +LDPR K E +   +  +Y          ++  A
Sbjct  474   ALKMKEKCDKYWGDPTKFNVMLFLSAVLDPRYKWECVEYGICQIYETDVALAVCTRVKKA  533

Query  1315  LNELYDDYAV--SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKK-QRMEL  1145
               +++D+Y+   S   +    T SG   S  + +E      G    +++A+ KK +  + 
Sbjct  534   FRDIFDEYSHKGSLGANRPACTQSGVPYSTGVDIETSKENKG----IIRARYKKLKATKE  589

Query  1144  LGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAF  965
              G  K E+E YL E   ED   FDIL+WWK N++RFP LS IARD+LAIP+STVASESAF
Sbjct  590   DGDSKSEIEKYLDEETVEDVDDFDILKWWKTNTSRFPTLSLIARDVLAIPVSTVASESAF  649

Query  964   SISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             S  GRVLD FRSSLTPKIVEALVC QDWLR
Sbjct  650   STGGRVLDPFRSSLTPKIVEALVCGQDWLR  679


 Score =   110 bits (275),  Expect(3) = 2e-102, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHKGE I  A+E CL+ WG+ NV +VTVDNASSND A+ +LK++  +WG+S VK
Sbjct  241   NFCPISSHKGEAIGKAIEKCLLAWGIENVMSVTVDNASSNDTAVVYLKKRFNNWGTSVVK  300

Query  1998  SKYLHMRCIAHILNLVVQDSL  1936
              ++LH+RCIAHI+NLVV D  
Sbjct  301   GEFLHVRCIAHIMNLVVTDGF  321


 Score = 51.2 bits (121),  Expect(3) = 2e-102, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             ++V +TTD+WTSIQ+INYM +TAHFID +W
Sbjct  204   RKVCLTTDTWTSIQKINYMCLTAHFIDNDW  233



>ref|XP_009780212.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=811

 Score =   247 bits (630),  Expect(3) = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/344 (42%), Positives = 199/344 (58%), Gaps = 18/344 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPT--------  1673
             I  K SLCLDVPTRWNSTYLML+ A +Y++ F  Y   D    S + + I          
Sbjct  442   ITSKKSLCLDVPTRWNSTYLMLKVATVYEEAFTKYCDIDYGLMSCIANCICEDGQPACPL  501

Query  1672  -SLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKL  1499
              S DW+SV  +VK L+ FYE+T+++SG+LY+T+N  F EI  +   L E++++ D  +K 
Sbjct  502   LSTDWDSVRRIVKFLEIFYELTLKVSGTLYITSNVHFLEICVVGSSLKELMQSEDATLKE  561

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLA  1319
             M  NMK KF+KY GD  KMN MIF + + DP  K + +   L  M+G+  G     ++  
Sbjct  562   MANNMKEKFDKYWGDPQKMNKMIFISCVFDPHHKFQSLSFALAAMFGETIGVKIQIEVKT  621

Query  1318  ALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG  1139
              +  L++ YA     S        S +  +        P         + + K  ++L  
Sbjct  622   YMESLFNVYAKKNGGSGSFPYSPSSGSCPSSPSSPGSCPSSPTSSTSSSSLSKFMLDLKK  681

Query  1138  GKK-------IELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVA  980
              KK        EL+ YL E + ED  +F IL WWK+NS RFP L+++ARD+LAIPIS+VA
Sbjct  682   HKKGEGIDSKTELDKYLGEDVEEDFENFKILGWWKLNSPRFPALAEMARDVLAIPISSVA  741

Query  979   SESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPN-TPISI  851
             SESAFS  GR+LD FRSSLTP++V+ALVC QDWLR  + TP+ I
Sbjct  742   SESAFSTGGRILDPFRSSLTPRLVQALVCVQDWLRNESTTPVKI  785


 Score =   113 bits (283),  Expect(3) = 2e-100, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHKG+ +A+ +  CL+EWG+  VFTVTVDNASSNDV +  L ++   W ++ ++
Sbjct  326   NFCPITSHKGQDLASGVAKCLLEWGVDKVFTVTVDNASSNDVMVKELSKQFTRWNTNLME  385

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
             SK++H+RC+AHI+NLVVQD L++  ++V+R+R+ VRY+R SP++ KKF++  +     SK
Sbjct  386   SKHVHVRCMAHIINLVVQDGLREGSVSVERIRQAVRYIRQSPARWKKFKECCDLDRITSK  445

Query  1818  KHPCV  1804
             K  C+
Sbjct  446   KSLCL  450


 Score = 57.4 bits (137),  Expect(3) = 2e-100, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ ITTD+WTSIQRINYM VTAH+ID+ W
Sbjct  289   QRICITTDTWTSIQRINYMCVTAHYIDKNW  318



>ref|XP_009775590.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like, partial [Nicotiana sylvestris]
Length=838

 Score =   248 bits (633),  Expect(3) = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 199/351 (57%), Gaps = 32/351 (9%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPT--------  1673
             I  K SLCLDVPTRWNSTYLML+ A +Y++ F  Y   D    S + + I          
Sbjct  422   ITSKKSLCLDVPTRWNSTYLMLKVATVYEEAFTKYCDIDYGLMSCISNCICEDGQPAGPL  481

Query  1672  -SLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKL  1499
              S DW+SV  +VK L+ FYE+T+++SG+LY+T+N  F EI  +   L E++++ D  +K 
Sbjct  482   LSTDWDSVRRIVKFLEIFYELTLKVSGTLYITSNVHFLEICVVGSSLKELMQSEDATLKE  541

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLA  1319
             M  NMK KF+KY GD  KMN MIF + + DPR K + +   L  M+G+  G     ++  
Sbjct  542   MANNMKEKFDKYWGDPQKMNKMIFISCVFDPRHKFQSLSFALAAMFGETIGVKIQIEVKT  601

Query  1318  ALNELYDDYAVSYSPSVVPATGSGSV--------------ASVNLVVEFVFTPVGRPQHL  1181
              +  L++ YA           GSGS               +  +       +        
Sbjct  602   YMESLFNVYAKKNG-------GSGSFPYSPSSGSCPSSPSSPSSCPSSPTSSTSSSSLSK  654

Query  1180  LKAQIKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILA  1001
                 +KK +       K EL+ YL E + ED  +F IL WWK+NS RFP L+++ARD+LA
Sbjct  655   FMLDLKKHKKGEGIDSKTELDKYLGEDVEEDFENFKILGWWKLNSPRFPALAEMARDVLA  714

Query  1000  IPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPN-TPISI  851
             IPIS+VASESAFS  GR+LD FRSSLTP++V+ALVC QDWLR  + TP+ I
Sbjct  715   IPISSVASESAFSTGGRILDPFRSSLTPRLVQALVCVQDWLRNESTTPVKI  765


 Score =   112 bits (280),  Expect(3) = 3e-100, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHKG+ +A+ +  CL+EWG+  VFTVTVDNASSNDV +  L ++   W ++ ++
Sbjct  306   NFCPITSHKGQDLASGVAKCLLEWGVDKVFTVTVDNASSNDVMVKELSKQFTRWNTNLME  365

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
              K++H+RC+AHI+NLVVQD L++  ++V+R+R+ VRY+R SP++ KKF++  +     SK
Sbjct  366   GKHVHVRCMAHIINLVVQDGLREGSVSVERIRQAVRYIRQSPARWKKFKECCDLDRITSK  425

Query  1818  KHPCV  1804
             K  C+
Sbjct  426   KSLCL  430


 Score = 57.0 bits (136),  Expect(3) = 3e-100, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ ITTD+WTSIQRINYM VTAH+ID+ W
Sbjct  269   QRICITTDTWTSIQRINYMCVTAHYIDKNW  298



>ref|XP_009773687.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=494

 Score =   271 bits (693),  Expect(3) = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/335 (46%), Positives = 215/335 (64%), Gaps = 17/335 (5%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD-------NSFKSDLGDSIP--TSL  1667
             K SLCLDV TRWNSTY+ML +A  ++  FD Y + D        ++  + G S    TS+
Sbjct  139   KRSLCLDVSTRWNSTYMMLDTAQQFELAFDKYSFFDIGLLHHLRTYVCEDGTSAGDLTSV  198

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGA  1490
             DW++V  +VK L+ FY +T+R+SGS+YVT+N  F EI +L  IL E +E  D ++K M  
Sbjct  199   DWDNVRTMVKFLEAFYLLTLRVSGSIYVTSNVHFVEICELDLILKEWMEHEDTSLKEMAK  258

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
              MK KF KY G+ +KMN MIF A+ILDPR+KLEY+P  +V M+G+ KGK+ + ++   ++
Sbjct  259   KMKEKFVKYWGEPEKMNKMIFIASILDPRNKLEYVPFAIVRMFGENKGKELILEVKNYMD  318

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG--  1136
              L+D Y    S     A+   +  +V+    F+     R     K + +K + E+ GG  
Sbjct  319   SLFDYYVKKNSIGTSSASSGNTTTTVSGYGSFL----KRGTMRTKLEFEKHK-EVTGGLG  373

Query  1135  KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSIS  956
              K ELE YL+E +  +   F IL+WWK+N  RFPIL+++ARD+LAIPIS+VASE AFS  
Sbjct  374   TKSELERYLAEDLEPETDDFKILKWWKINEPRFPILAEMARDVLAIPISSVASECAFSTG  433

Query  955   GRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             GR+LD FRSSLTPK+V++L+C QDWLR    PI +
Sbjct  434   GRILDSFRSSLTPKLVQSLICLQDWLRSEPIPIKV  468


 Score =   121 bits (303),  Expect(3) = 4e-100, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHKG  +A+ + +CL++WGL+NVFT+TVDNASSNDV +  + +++ +WG++ + 
Sbjct  20    NFCPISSHKGNDMASTITNCLLDWGLKNVFTITVDNASSNDVTVREVSKQLTTWGTNIMN  79

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
              K+LH+RC+AHILNL+VQD LK+  +++KRVR+ VRY+R SP++++KF++  E     SK
Sbjct  80    GKHLHVRCMAHILNLIVQDGLKEIGVSIKRVRQAVRYIRQSPARIRKFKECCESQKLTSK  139

Query  1818  KHPCV  1804
             +  C+
Sbjct  140   RSLCL  144


 Score = 24.3 bits (51),  Expect(3) = 4e-100, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -1

Query  2231  MVVTAHFIDEEW  2196
             M +TAHFID +W
Sbjct  1     MCLTAHFIDRDW  12



>ref|XP_009765425.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=494

 Score =   271 bits (693),  Expect(3) = 8e-100, Method: Compositional matrix adjust.
 Identities = 153/335 (46%), Positives = 215/335 (64%), Gaps = 17/335 (5%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD-------NSFKSDLGDSIP--TSL  1667
             K SLCLDV TRWNSTY+ML +A  ++  FD Y + D        ++  + G S    TS+
Sbjct  139   KRSLCLDVSTRWNSTYMMLDTAQQFELAFDKYSFFDIGLLHHLRTYVCEDGTSAGDLTSV  198

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGA  1490
             DW++V  +VK L+ FY +T+R+SGS+YVT+N  F EI +L  IL E +E  D ++K M  
Sbjct  199   DWDNVRTMVKFLEAFYLLTLRVSGSIYVTSNVHFVEICELDLILKEWMEHEDTSLKEMAK  258

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
              MK KF KY G+ +KMN MIF A+ILDPR+KLEY+P  +V M+G+ KGK+ + ++   ++
Sbjct  259   KMKEKFVKYWGEPEKMNKMIFIASILDPRNKLEYVPFAIVRMFGENKGKELILEVKNYMD  318

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG--  1136
              L+D Y    S     A+   +  +V+    F+     R     K + +K + E+ GG  
Sbjct  319   SLFDYYVKKNSIGTSSASSGNTTTTVSGYGSFL----KRGTMRTKLEFEKHK-EVTGGLG  373

Query  1135  KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSIS  956
              K ELE YL+E +  +   F IL+WWK+N  RFPIL+++ARD+LAIPIS+VASE AFS  
Sbjct  374   TKSELERYLAEDLEPETDDFKILKWWKINEPRFPILAEMARDVLAIPISSVASECAFSTG  433

Query  955   GRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             GR+LD FRSSLTPK+V++L+C QDWLR    PI +
Sbjct  434   GRILDSFRSSLTPKLVQSLICLQDWLRSEPIPIKV  468


 Score =   121 bits (303),  Expect(3) = 8e-100, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHKG+ +A+ + +CL++WGL NVFT+TVDNASSNDV +  + +++ +WG++ + 
Sbjct  20    NFCPISSHKGDDMASVITNCLLDWGLENVFTITVDNASSNDVTVREVSKQLTTWGTNIMN  79

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
              K+LH+RC+AHILNL+VQD LK+  +++KRVR+ VRY+R SP++++KF++  E     SK
Sbjct  80    GKHLHVRCMAHILNLIVQDGLKEIGVSIKRVRQAVRYIRQSPARIRKFKECCESQKLTSK  139

Query  1818  KHPCV  1804
             +  C+
Sbjct  140   RSLCL  144


 Score = 23.1 bits (48),  Expect(3) = 8e-100, Method: Compositional matrix adjust.
 Identities = 7/12 (58%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -1

Query  2231  MVVTAHFIDEEW  2196
             M +TAHF+D +W
Sbjct  1     MCLTAHFMDRDW  12



>ref|XP_009767846.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=823

 Score =   251 bits (640),  Expect(3) = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/326 (45%), Positives = 190/326 (58%), Gaps = 15/326 (5%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL-----GDSIP----TSL  1667
             K SLCLDVPTRWNSTYLML  A+ Y++   +Y   D S    L      D  P    T  
Sbjct  339   KKSLCLDVPTRWNSTYLMLSRAIEYERAIKEYSDRDTSLSRYLMFDAISDGKPVGILTRT  398

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGA  1490
             DW+ V  + + L+ FY +T+++SGSLYVT+N  F EI  +   LN ++   D  +  M  
Sbjct  399   DWDEVKRIAQFLEIFYNLTLKVSGSLYVTSNAHFIEIGQVVVYLNRLITTEDKLLSEMTL  458

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
             +M  KFEKY G+  KMN MIF A +LDPR K   +   L  M+GD +G    +++   ++
Sbjct  459   SMWKKFEKYWGEPKKMNKMIFIACVLDPRYKFTTVSFVLKKMFGDDEGTIIEKEVHTYMS  518

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG-GK  1133
              L+++Y    S SV   TG G V++      F           L  +I+K +    G   
Sbjct  519   SLFNEYV---SKSVSKDTG-GKVSTSLPSSSFSTMETSTGLGALLDEIRKHKAASGGVDS  574

Query  1132  KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
             K ELE YL E    +   FDIL WWKVNS RFPIL  +ARD+LAIPIS+VASESAFS  G
Sbjct  575   KTELEKYLGEDPENERPEFDILAWWKVNSPRFPILGMMARDVLAIPISSVASESAFSTGG  634

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLR  875
             R+LD FRSSLTPK+VE LVC QDWLR
Sbjct  635   RILDQFRSSLTPKLVETLVCLQDWLR  660


 Score =   109 bits (272),  Expect(3) = 2e-99, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHKGE +A  +   L EWGL+ +FTV VDNASSNDV +  L  K+  WG++S+ 
Sbjct  221   NFSPITSHKGEDMARCIIDYLREWGLQKIFTVIVDNASSNDVTVEKLSDKLDDWGTNSMN  280

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
               +LHMRC+AHI+NL+V+D LK+  I++ RVR VVRY+R SP++L+KF++  E S  + K
Sbjct  281   GHHLHMRCMAHIVNLIVKDGLKESSISIARVRCVVRYIRQSPARLRKFQECCE-SENIVK  339

Query  1818  KHPCV  1804
             K  C+
Sbjct  340   KSLCL  344


 Score = 54.7 bits (130),  Expect(3) = 2e-99, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QRVS+TTD+WTSIQ++NYM +T H+ID EW
Sbjct  184   QRVSLTTDTWTSIQKVNYMCITTHWIDSEW  213


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 46/68 (68%), Gaps = 4/68 (6%)
 Frame = -2

Query  1180  LKAQIKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILA  1001
             L ++ KK++ E    KK+ + Y L E    +   FDIL WWKVNS RFPIL  +ARD+LA
Sbjct  707   LSSKGKKRKRE---SKKVYVTY-LGEDPENERPEFDILAWWKVNSPRFPILGMMARDVLA  762

Query  1000  IPISTVAS  977
             IPIS+VAS
Sbjct  763   IPISSVAS  770



>ref|XP_009775656.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=765

 Score =   231 bits (589),  Expect(3) = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/337 (41%), Positives = 192/337 (57%), Gaps = 14/337 (4%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPT--------  1673
             I  K SLCLDVPTRWNSTYLML+ A +Y++ F  Y   D    S + + I          
Sbjct  307   ITSKKSLCLDVPTRWNSTYLMLKVATVYEEAFTKYCDIDYGLMSCISNCICEDGQPAGPL  366

Query  1672  -SLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKL  1499
              S DW++V  ++K L+ FYE+T+++S +LY+T N  F EI  +   L E++++ D  +K 
Sbjct  367   LSTDWDNVRRIMKFLEIFYELTLKVSCTLYITYNVHFLEICVVGSSLKELMQSEDITLKE  426

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLA  1319
             M  NMK KF+KY GD  KMN MIF + + DPR K + +   L  M+G+  G     ++  
Sbjct  427   MANNMKEKFDKYWGDPQKMNKMIFISCVFDPRHKFQSLSFALAAMFGETIGVKIQIEVKT  486

Query  1318  ALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG  1139
              +  L++ YA     S    +   S +  +       +       L    +KK +     
Sbjct  487   YMESLFNVYAKKNGGSGSFPSSPSSGSCPSSPTSSTSSSSLSKFML---DLKKHKKGEGI  543

Query  1138  GKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSI  959
               K EL+ YL E + ED   F IL WWK+NS RFP L+++A D+LAIPIS+VASES FS 
Sbjct  544   DSKTELDKYLGEDVEEDFEKFKILGWWKLNSPRFPALAEMACDVLAIPISSVASESTFST  603

Query  958   SGRVLDHFRSSLTPKIVEALVCTQDWLRRPN-TPISI  851
              G +LD  RSSLTPK+V+ALVC QDWLR  + TP+ I
Sbjct  604   GGHILDPIRSSLTPKLVQALVCVQDWLRNESTTPVKI  640


 Score =   112 bits (279),  Expect(3) = 1e-94, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHKG+ +A+ +  CL+EWG+  VFTVTVDNASSNDV +  L ++   W ++ ++
Sbjct  191   NFCPITSHKGQDLASGVAKCLLEWGVDKVFTVTVDNASSNDVMVKELSKQFTRWNTNLME  250

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
              K++H+RC+AHI+NLVVQD L++  ++V+R+R+ VRY+R SP++ KKF++  +     SK
Sbjct  251   GKHVHVRCMAHIINLVVQDGLREGSVSVERIRQAVRYIRQSPARWKKFKECCDLDRITSK  310

Query  1818  KHPCV  1804
             K  C+
Sbjct  311   KSLCL  315


 Score = 55.1 bits (131),  Expect(3) = 1e-94, Method: Composition-based stats.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ ITT++WTSIQRINYM VTAH+ID+ W
Sbjct  154   QRICITTNTWTSIQRINYMCVTAHYIDKNW  183



>ref|XP_009784104.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like, partial [Nicotiana sylvestris]
Length=817

 Score =   230 bits (586),  Expect(3) = 3e-94, Method: Compositional matrix adjust.
 Identities = 134/322 (42%), Positives = 189/322 (59%), Gaps = 17/322 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPT--------  1673
             I  K SLCLDVPTRWNSTYLML+ A +Y++ F  Y   D    S + + I          
Sbjct  501   ITSKKSLCLDVPTRWNSTYLMLKVATVYEEAFTKYCDIDYGLMSCISNCICEDGQPAGPL  560

Query  1672  -SLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKL  1499
              S DW+SV  +VK L+ FYE+T+++SG+LY+T+N  F EI  +   L E+++  D  ++ 
Sbjct  561   LSSDWDSVRRIVKFLEIFYELTLKVSGTLYITSNVHFLEICVVDSSLKELMQNEDAFLRE  620

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLA  1319
             M  NMK KF+KY GD  KMN MIF + +LDPR K   +   L  M+G+  G    E +  
Sbjct  621   MAKNMKEKFDKYWGDPHKMNKMIFISCVLDPRHKFNTLSFALGSMFGETVGLKIQEDVKT  680

Query  1318  ALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG  1139
              ++ L++ Y +    S    + S   +  +       + +     L K  +  ++ +  G
Sbjct  681   YMDTLFNVYPMKNGGSGSCPSTSSPSSPSSGPSSPSSSSL-----LSKFMLDLKQHKKCG  735

Query  1138  G--KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAF  965
             G   K EL+ YL E + ED   F+IL WWK+NS RFP L+++ARD+LAIPIS+VASESAF
Sbjct  736   GVDSKTELDKYLGEDVEEDHEKFNILGWWKLNSPRFPTLAEMARDVLAIPISSVASESAF  795

Query  964   SISGRVLDHFRSSLTPKIVEAL  899
             S  GR+ D FRSSLTP+ V+AL
Sbjct  796   STGGRIHDPFRSSLTPRFVQAL  817


 Score =   111 bits (278),  Expect(3) = 3e-94, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHKG+ +A+ +  CL+EWG+  VFTVTVDNASSNDV +  L ++   W ++ ++
Sbjct  385   NFCPITSHKGQDLASGIAKCLLEWGVDKVFTVTVDNASSNDVMVRELSKQFTRWNTNLME  444

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
              K++H+RC+AHI+NLVVQD L+   ++V+R+R+ VRY+R SP++ KKF++  +     SK
Sbjct  445   GKHVHVRCMAHIINLVVQDGLRDGSVSVERIRQAVRYIRQSPARWKKFKECCDLDRITSK  504

Query  1818  KHPCV  1804
             K  C+
Sbjct  505   KSLCL  509


 Score = 55.8 bits (133),  Expect(3) = 3e-94, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ ITTD+WTSIQRINYM VTAH+ID  W
Sbjct  348   QRICITTDTWTSIQRINYMCVTAHYIDNNW  377



>ref|XP_009774751.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like, partial [Nicotiana sylvestris]
Length=453

 Score =   276 bits (707),  Expect(2) = 8e-93, Method: Compositional matrix adjust.
 Identities = 150/337 (45%), Positives = 209/337 (62%), Gaps = 11/337 (3%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKS--------DLGDSIP-  1676
             +E   +LCLDVPTRWNSTYLML +A  ++K FD     D+ F +        D   + P 
Sbjct  105   VECTKTLCLDVPTRWNSTYLMLDTAQHFEKAFDKLHLFDDGFSAYQCSHLCEDGSSAGPL  164

Query  1675  TSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKL  1499
              S DW +V N+++ L  F+E+T ++SGS YVT N+ F ++S+LYC L   +   D  ++ 
Sbjct  165   ESDDWVNVRNVIEFLARFHELTKKVSGSRYVTCNSHFEDVSELYCHLKMCLASEDEHLRK  224

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLA  1319
             M   M+ KF+KY G+ +KMN MIF A++LDPR+K EY+   L  ++G++KGK    K+ A
Sbjct  225   MAQQMQEKFKKYWGEPEKMNKMIFIASVLDPRNKFEYVEGALEELFGEEKGKKINAKVYA  284

Query  1318  ALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMEL-L  1142
              +N L+ +Y   YS    P + S S +S N       + +   +   K  +KKQ+ +   
Sbjct  285   YMNSLFGEYLKKYSTESCPQSPSSSTSSNNTSNTPSGSVISASKIRTKLSLKKQKEDNGS  344

Query  1141  GGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
             GG K EL+ Y+SE        FDIL WWK ++ RFPILS++ARD+LAIPIS+VASE AFS
Sbjct  345   GGAKSELDKYISEEQEPFSEEFDILSWWKTHALRFPILSELARDVLAIPISSVASECAFS  404

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
               G +LD FRSSLTPK V+AL+C QDWLR    PIS+
Sbjct  405   TGGSILDSFRSSLTPKCVQALICVQDWLREEKNPISV  441


 Score = 94.4 bits (233),  Expect(2) = 8e-93, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  2142  IANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHI  1963
             +A A+  CL+EW L  VFT+TVDNASSNDV +  L +++  W ++ +  K+LH+RC+AHI
Sbjct  1     MAKAIRDCLLEWKLDKVFTITVDNASSNDVTVKELSKQLDMWKTNMMSGKHLHVRCMAHI  60

Query  1962  LNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
             LNL+VQD LK+ D +V RVR +VRYVRSSP++  KF+
Sbjct  61    LNLIVQDGLKELDASVTRVRNIVRYVRSSPARTLKFK  97



>ref|XP_009629645.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=456

 Score =   266 bits (681),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/337 (43%), Positives = 205/337 (61%), Gaps = 11/337 (3%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPT--------  1673
             +E   +LCL+VPTRWNSTY ML  A  ++K FD +   D+ F + L   +          
Sbjct  105   VECTKTLCLNVPTRWNSTYFMLDMAQNFEKAFDKFHLFDDGFSAYLCSHLCEDGSSAGPL  164

Query  1672  -SLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKL  1499
              S DW +V N++  L  F+E+T ++SGS YVT N+ F ++S LYC L   ++  D  ++ 
Sbjct  165   ESDDWVNVRNVIAFLARFHELTKKVSGSRYVTCNSHFEDVSKLYCHLKMCLISEDEHLRK  224

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLA  1319
             M   M+ KF+KY G+ +KMN +IF A +LDPR+K EY+   L  ++G++KGK    ++ A
Sbjct  225   MAEWMQEKFKKYWGEPEKMNKIIFIAFVLDPRNKFEYVSLALEELFGEEKGKKINVEVYA  284

Query  1318  ALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMEL-L  1142
              +N L+++Y   YS    P + S S +S N       + +       K  +KKQ+ +   
Sbjct  285   YMNSLFEEYLKKYSTGSCPQSPSSSTSSNNTSNTSSGSVLTASLIRTKLHLKKQKEDNGS  344

Query  1141  GGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
             GG K EL+ Y+SE        FDIL WWK ++ RFPILS++ARD+L IPIS+VASE AFS
Sbjct  345   GGAKSELDKYISEEQEPFSEEFDILSWWKTHAPRFPILSELARDVLTIPISSVASECAFS  404

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
               GR+LD FRSSLTPK V+ALVC QDWLR    PIS+
Sbjct  405   TGGRILDSFRSSLTPKCVQALVCVQDWLREEKNPISV  441


 Score = 94.0 bits (232),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  2142  IANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHI  1963
             +A A+ +CL+EW L  VFT+TVDNASSNDV +  L +K+  W ++ +  K+LH+RC+AHI
Sbjct  1     MAKAISNCLLEWKLDKVFTITVDNASSNDVTVKELSKKLDMWKTNMMSGKHLHVRCMAHI  60

Query  1962  LNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
             LNL+VQD LK+ D ++ R+R +VRYVRSSP +  KF+
Sbjct  61    LNLIVQDGLKEIDASITRLRNIVRYVRSSPVRTLKFK  97



>ref|XP_006384292.1| hypothetical protein POPTR_0004s11480g [Populus trichocarpa]
 gb|ERP62089.1| hypothetical protein POPTR_0004s11480g [Populus trichocarpa]
Length=620

 Score =   221 bits (562),  Expect(3) = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/339 (40%), Positives = 196/339 (58%), Gaps = 33/339 (10%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSF------------KSDLGD  1685
             IE K SLCLDV TRWNSTYLML++A  ++KVF     S+  +            K ++G 
Sbjct  279   IECKKSLCLDVATRWNSTYLMLEAAEKFEKVFVRLGQSEPRYVSYFLEVDSKGNKKNIG-  337

Query  1684  SIPTSL-DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DG  1511
               P SL DWE+   L+K LK FY +T++ SGSL+VT+N+FF+E+  ++  L ++ ++ D 
Sbjct  338   --PPSLEDWENARTLLKFLKIFYLVTLKFSGSLHVTSNSFFNELIYMHTNLLQLCKSRDN  395

Query  1510  AVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLE  1331
              +  M  NM +KFEKY G     N++++ AN+LDPR KL+Y+      +Y   K +   +
Sbjct  396   LLSGMAMNMMSKFEKYWGYGANQNFLLYVANVLDPRLKLKYVKFCFGELYDHDKAQLLTK  455

Query  1330  KLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRM  1151
             K+   L  LY+ Y  +     V          VN +  F        +HLL+    + R 
Sbjct  456   KVRDNLVSLYEFYLKADEVVDVNDAIDDMEIDVNTLARF-------KRHLLEEDSVENRN  508

Query  1150  ELLGGKKIELEYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASE  974
             E+        E YL +   + ++   DIL WWK+N++++ ILSK+A+ +LAIPISTVASE
Sbjct  509   EV--------ERYLVDGCEDPNDDKLDILGWWKINASKYKILSKVAQHVLAIPISTVASE  560

Query  973   SAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPI  857
             SAFS  GR+LD FRSSL+P  V+AL+C Q+WL     P+
Sbjct  561   SAFSTGGRILDQFRSSLSPATVQALICCQNWLHHDPIPV  599


 Score =   100 bits (248),  Expect(3) = 7e-86, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H GE I   +E+CL++WG+  + TVTVDNASSN V L +LK  +  W ++ + 
Sbjct  163   NFCQVSNHMGETIGQVIENCLLDWGIDKLLTVTVDNASSNSVTLSYLKNVMKDWPTNILS  222

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +++LH+RC AHI+NL+V D LK+ +++V ++R  +R+VRSSPS+L  F+  AE
Sbjct  223   NEHLHIRCCAHIVNLIVCDGLKEMNVSVVKIRNAIRFVRSSPSRLLAFKKCAE  275


 Score = 48.1 bits (113),  Expect(3) = 7e-86, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ +T D+WTSIQ INYM +TAH+ID EW
Sbjct  126   QRLCLTIDTWTSIQNINYMSLTAHWIDNEW  155



>gb|ACX85638.1| putative transposase [Cucumis melo]
Length=680

 Score =   209 bits (533),  Expect(3) = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/327 (39%), Positives = 181/327 (55%), Gaps = 15/327 (5%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLV  1640
             K  L +DVPTRWNST+ ML  A+  QK F+  E  D S+     D IPT+ DW++    V
Sbjct  329   KNCLTMDVPTRWNSTFTMLDGAIKCQKTFERLEEHDPSYLP--KDDIPTTEDWDNAKVFV  386

Query  1639  KLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAV-KLMGANMKAKFEKY  1463
             K LK F E+T++ S S+ VT+N FF E+  +  I+ E    + A+   M  +M+ KF KY
Sbjct  387   KFLKTFSEVTMKFSASMSVTSNIFFHELCLIQEIIREYSSYENALLSQMTLSMQTKFNKY  446

Query  1462  *G--DIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYA  1289
              G    +K N +++ + +LDPR KL Y+         +   K +  K+  A   L DDY 
Sbjct  447   WGITTSEKTNLLLYVSVVLDPRYKLAYVNYCFNEFLEEDCAKIWTNKVEEAFRRLCDDYY  506

Query  1288  V-------SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK  1130
             +       S + S  P  G G   S + +     +   + +  +  + K+     L   K
Sbjct  507   MRMSKEKYSQTQSCTPIEGFG-FQSQSEIPSISSSGSYKARATVHDRFKQSNKTCLDDAK  565

Query  1129  IELEYYLSEAITEDEGS--FDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSIS  956
              E+  YL EA  +  G    D+L WWKVN++RF I+S++ARDI +IPISTV SESAFS  
Sbjct  566   TEVTRYLDEARIDCMGDEYLDLLTWWKVNASRFKIISQVARDIYSIPISTVPSESAFSTG  625

Query  955   GRVLDHFRSSLTPKIVEALVCTQDWLR  875
             GRVLD FRSSLTP+  EAL+C Q+W++
Sbjct  626   GRVLDSFRSSLTPQTAEALICAQNWIQ  652


 Score =   101 bits (252),  Expect(3) = 3e-85, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +HKG+ I  A+E CL  WG+  +FTVTVDNASSNDVA+ +L +K        + 
Sbjct  210   NFCQVANHKGDTIGRAIEKCLEGWGIDRLFTVTVDNASSNDVAIAYLVKKFKGRNGLVLD  269

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
              +++H+RC AHILNL+V D+LK   +++ R+R  V+YVRSSP++L+ F+D A+
Sbjct  270   GEFIHIRCCAHILNLIVSDALKDLHVSIIRIRNAVKYVRSSPARLQIFKDFAK  322


 Score = 55.8 bits (133),  Expect(3) = 3e-85, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QRV +TTD+WTS+Q INYMV+TAHFID++W
Sbjct  173   QRVCLTTDTWTSVQNINYMVITAHFIDDDW  202



>ref|XP_006384497.1| hypothetical protein POPTR_0004s15890g [Populus trichocarpa]
 gb|ERP62294.1| hypothetical protein POPTR_0004s15890g [Populus trichocarpa]
Length=520

 Score =   218 bits (554),  Expect(3) = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/349 (39%), Positives = 201/349 (58%), Gaps = 44/349 (13%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSF------------KSDLGD  1685
             IE K SLCLDV TRWNSTYLML++A  ++KVF     S+  +            K ++G 
Sbjct  172   IECKKSLCLDVATRWNSTYLMLEAAEKFEKVFVRLGQSEPRYVSYFLEVDSKGNKKNIG-  230

Query  1684  SIPTSL-DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DG  1511
               P SL DWE+   L+K LK FY +T++ SGSL+VT+N+FF+E+  ++  L ++ ++ D 
Sbjct  231   --PPSLEDWENARTLLKFLKIFYMVTLKFSGSLHVTSNSFFNELIYMHTNLMQLCKSRDN  288

Query  1510  AVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLE  1331
              +  M  NM +KFEKY G     NY+++ AN+LDPR KL+Y+      +Y   K +   +
Sbjct  289   LLSGMTMNMMSKFEKYWGYGANQNYLLYVANVLDPRLKLKYVKFCFGELYDHDKAQLLTK  348

Query  1330  KLLAALNELYDDYAVS--------YSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLK  1175
             K+   L  LY+ Y  +        +   V  A     +  VN +  F        +HLL+
Sbjct  349   KVRDNLVSLYEFYLKTDEMVDDNRHKQDVNDAIDDMEI-DVNTLARF-------KRHLLE  400

Query  1174  AQIKKQRMELLGGKKIELEYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAI  998
                 + R E+        E YL +   + ++   DIL WWK+N++++ ILSK+A+ +LAI
Sbjct  401   EDSVENRNEV--------ERYLVDGCEDPNDDKLDILGWWKINASKYKILSKVAQHVLAI  452

Query  997   PISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             PISTVASESAFS  GR+LD FRSSL+P  V+AL+C Q+WL     PI++
Sbjct  453   PISTVASESAFSTGGRILDQFRSSLSPATVQALICCQNWLHHG--PITV  499


 Score = 99.8 bits (247),  Expect(3) = 1e-84, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H GE I   +E+CL++WG+  + TVTVDNASSN V L +LK  +  W ++ + 
Sbjct  56    NFCQVSNHMGETIGQVIENCLLDWGIDKLLTVTVDNASSNSVTLSYLKNVMKDWPTNILS  115

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +++LH+RC AHI+NL+V D LK+ +++V ++R  +R+VRSSPS+L  F+  AE
Sbjct  116   NEHLHVRCCAHIVNLIVCDGLKEMNVSVVKIRNAIRFVRSSPSRLLAFKKCAE  168


 Score = 47.8 bits (112),  Expect(3) = 1e-84, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ +TTD+WTSIQ INYM +TA++ID EW
Sbjct  19    QRLCLTTDTWTSIQNINYMSLTAYWIDNEW  48



>ref|XP_003591965.1| Elongation factor 1-alpha [Medicago truncatula]
Length=1001

 Score =   219 bits (558),  Expect(3) = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/319 (39%), Positives = 184/319 (58%), Gaps = 20/319 (6%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL---GDSIPTSLDWESVN  1649
             K+S+CLDV TRWN+TYLM  +AL ++K F++  + D  + ++L   G  +PT  DW+ V 
Sbjct  346   KSSVCLDVETRWNTTYLMAAAALKHEKTFEELCFLDQKYVNELTTKGKGVPTQDDWKRVR  405

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAKF  1472
              ++  LK FY+ T+RISGS Y+T+N +  EI  +   + EM  + D  ++ M   MK K+
Sbjct  406   EILPFLKMFYDATVRISGSSYLTSNIYMFEILGIGKRIVEMCSSEDVHLRSMAQRMKLKY  465

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY G+   +N M+  A + DPR K+      +   Y +      +  L + L  LY++Y
Sbjct  466   DKYWGNYKSLNMMLLVALVFDPRRKVRLADWMIRRFYNEDDSDALIAMLESCLKSLYEEY  525

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYY  1112
                Y   + P   S +  + N   +      G  +  L         +  G    EL  Y
Sbjct  526   ---YDRVMHPRGNSEAPQAFNGDSDLY----GTSEFYLS--------DGCGTSDNELNTY  570

Query  1111  LSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFR  932
             L+E++ E     ++L WWKVNS R+PIL+KIARD+LAIPI+TVASES FS S RVLD +R
Sbjct  571   LNESL-ERNMEINVLEWWKVNSGRYPILAKIARDVLAIPITTVASESTFSTSERVLDPYR  629

Query  931   SSLTPKIVEALVCTQDWLR  875
             SSLTP  +EAL+CTQDWL+
Sbjct  630   SSLTPTTIEALICTQDWLK  648


 Score =   100 bits (248),  Expect(3) = 2e-84, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V SH GE I   ++ CL  WGL  V ++TVDNASSNDV +  LK+++LS GS  + 
Sbjct  227   NFCQVSSHTGETICATMDKCLNNWGLHRVLSLTVDNASSNDVGVRRLKKRLLSRGSLVMN  286

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
               Y HMRC AH+LNL+V+D L+  D ++ R+R+ V YVRSSP +L KF+ L +
Sbjct  287   GNYFHMRCCAHVLNLIVKDGLEDMDESILRIRQAVWYVRSSPLRLSKFKGLID  339


 Score = 45.1 bits (105),  Expect(3) = 2e-84, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
             QRV +TTD WTS  Q+++YM VTAHFID  W
Sbjct  189   QRVCLTTDMWTSSCQKMSYMCVTAHFIDNNW  219



>ref|XP_009771238.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=522

 Score =   257 bits (657),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/338 (43%), Positives = 204/338 (60%), Gaps = 11/338 (3%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKS--------DLGDSIP  1676
              +E    LCLDVPTR NSTYLML +A  ++K FD     D+ F +        D   + P
Sbjct  104   NVECTKMLCLDVPTRCNSTYLMLDTAQHFEKAFDKLHLFDDGFFAYQCSHLCEDGSSAGP  163

Query  1675  -TSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVK  1502
               S DW +V N+++ L  F+E+T ++SGS YVT N+ F ++S+LYC L   +V  D  ++
Sbjct  164   LESDDWVNVRNVIEFLARFHELTKKVSGSRYVTCNSHFKDVSELYCHLKMCLVSEDEQLR  223

Query  1501  LMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLL  1322
              M   M+ KF+KY G  +KMN MIF A++L+P +K EY+   L  ++G++KGK    ++ 
Sbjct  224   KMAERMQEKFKKYWGKPEKMNKMIFIASVLNPCNKFEYVEGALEELFGEEKGKKINVEVY  283

Query  1321  AALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMEL-  1145
             A +N L+ +Y   YS    P + S S +S N       + +       K  +KKQ+ +  
Sbjct  284   AYMNSLFGEYLKKYSTKSCPQSPSSSTSSNNTSNTSSGSVISASLIRTKLHLKKQKEDNG  343

Query  1144  LGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAF  965
              GG K EL+ Y+SE        FDIL WWK ++ RFP LS++ARD+LAIPIS++AS  AF
Sbjct  344   SGGAKSELDKYISEEQEPFSEEFDILSWWKTHAPRFPNLSELARDVLAIPISSMASACAF  403

Query  964   SISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             S  GR+LD FRSSLTPK V+AL+C QDWLR    PIS+
Sbjct  404   STGGRILDSFRSSLTPKCVQALICVQDWLREEKNPISV  441


 Score = 85.5 bits (210),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  2142  IANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHI  1963
             +A A+  CL+EW L   FT+TVDNASS DV +  L +++  W ++ +  K+LH+RC+AHI
Sbjct  1     MAKAIRDCLLEWKLDKDFTITVDNASSTDVTVKELSKQLDMWKTNMMSGKHLHVRCMAHI  60

Query  1962  LNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
             LNL+VQ  LK+ D +V RVR +VRYVRSSP++  KF+
Sbjct  61    LNLIVQYGLKELDASVTRVRNIVRYVRSSPARTLKFK  97



>ref|XP_009769521.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=487

 Score =   251 bits (640),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/352 (43%), Positives = 206/352 (59%), Gaps = 35/352 (10%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDS-----IPT---  1673
             +  K +LCLDVPTRWNSTYLML+ A+ ++  F  Y  S+   +  L  S     IPT   
Sbjct  105   LNSKKTLCLDVPTRWNSTYLMLRRAIEFESAFSHYASSEIGLRHYLEHSYIDVGIPTGEL  164

Query  1672  -SLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EADGAVKL  1499
              S DW++V  + K L+ FY +T++ISGS YVT+N  F EI  +   L +++   D  +  
Sbjct  165   LSSDWDNVKRITKFLEIFYLLTLKISGSRYVTSNIHFLEICAVAVYLKQLIANEDIVLSE  224

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLA  1319
             M  NMK KF+KY GD  KMN +IF + ILDPR K+E +   LV M+G   G     ++  
Sbjct  225   MAKNMKEKFDKYWGDPGKMNKIIFISCILDPRYKIESVGFALVKMFGVDPGATIQAEVTK  284

Query  1318  ALNELYDDYAVSYSPSVVPATGS-------------GSVASVNLVVEFVFTPVGRPQHLL  1178
              +  L+ +Y  S S SVV A+ S             GS AS           +G  + L+
Sbjct  285   YMTSLFSEYVKSSSKSVVLASSSDCSSLDTSSSGLSGSQASTQ--------NIGLLESLM  336

Query  1177  KAQIKKQRMELLG-GKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILA  1001
             +  IKK +    G   + EL+ YL E   +D   FD+L WWK+NS RFPIL+++ARD+LA
Sbjct  337   Q-DIKKYKSGSGGVDTRTELDKYLGEETEDDTKEFDVLLWWKLNSPRFPILAEMARDVLA  395

Query  1000  IPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR--RPNTPISI  851
             + +S+VASE AFS  GR+LD FRSSLTPK+V+ALVC QDWLR  +   PIS+
Sbjct  396   VLVSSVASECAFSTGGRLLDSFRSSLTPKLVQALVCLQDWLRNEKLKQPISV  447


 Score = 92.0 bits (227),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = -3

Query  2142  IANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHI  1963
             +AN +  CL EWG+   FTVTVDNASSNDV +  L +++   G++ +   +LH+RC+AHI
Sbjct  1     MANGIGRCLREWGINKSFTVTVDNASSNDVTVKELSKQLTKMGTNLMNGTHLHVRCMAHI  60

Query  1962  LNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKKHPCV  1804
             +N VVQ+ LK+  ++++RVR  VRYVR SP++LK+F++  +     SKK  C+
Sbjct  61    MNFVVQNGLKESSVSIERVRHAVRYVRQSPARLKRFQECFDAEQLNSKKTLCL  113



>ref|XP_006380778.1| hypothetical protein POPTR_0007s13470g [Populus trichocarpa]
 gb|ERP58575.1| hypothetical protein POPTR_0007s13470g [Populus trichocarpa]
Length=531

 Score =   215 bits (548),  Expect(3) = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 192/330 (58%), Gaps = 33/330 (10%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSL-DWESV  1652
             IE K SLCLDV TRWNSTYLML++A  ++KVF     S+  +        P SL DWE+ 
Sbjct  211   IECKKSLCLDVATRWNSTYLMLEAAEKFEKVFVRLGQSEPRYVR------PPSLEDWENA  264

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
               L+K LK FY +T++ SGSL+VT+N+FF+E+  ++  L ++ ++ D  +  M  NM +K
Sbjct  265   RTLLKFLKIFYMVTLKFSGSLHVTSNSFFNELIYMHTNLLQLCKSRDNLLSGMAMNMMSK  324

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             FEKY G     N++++ AN+LDPR KL+Y+      +Y   K +   +K+   L  LY+ 
Sbjct  325   FEKYWGYGANQNFLLYVANVLDPRLKLKYVKFCFGELYDHDKAQLLTKKVRDNLVSLYEF  384

Query  1294  YAVS--------YSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG  1139
             Y  +        +   V  A     +  VN +  F        +HLL+    + R E+  
Sbjct  385   YLKADEVVDDNRHKQDVNDAIDDMEI-DVNTLARF-------ERHLLEEDSVENRNEV--  434

Query  1138  GKKIELEYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
                   E YL +   + +    DIL WWK+N++++ ILSK+A+ +LAIPISTVASESAFS
Sbjct  435   ------ERYLVDGCEDPNNDKLDILGWWKINASKYKILSKVAQHVLAIPISTVASESAFS  488

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLRR  872
               GR+LD FRSSL+P  V+AL+C Q+WL  
Sbjct  489   TGGRILDQFRSSLSPATVQALICCQNWLHH  518


 Score =   100 bits (250),  Expect(3) = 3e-84, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H GE I   +E+CL++WG+  + TVTVDNASSN V L +LK  +  W ++ + 
Sbjct  95    NFYQVSNHMGETIGQVIENCLLDWGIDKLLTVTVDNASSNSVTLSYLKNVMKDWPTNILS  154

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +++LH+RC AHI+NL+V D LK+ +I+V ++R  +R+VRSSPS+L  F+  AE
Sbjct  155   NEHLHIRCCAHIVNLIVCDGLKEMNISVVKIRNAIRFVRSSPSRLLAFKKCAE  207


 Score = 47.8 bits (112),  Expect(3) = 3e-84, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ +TTD+WTSIQ INYM +TA++ID EW
Sbjct  58    QRLCLTTDTWTSIQNINYMSLTAYWIDNEW  87



>ref|XP_006376750.1| hypothetical protein POPTR_0012s05700g [Populus trichocarpa]
 gb|ERP54547.1| hypothetical protein POPTR_0012s05700g [Populus trichocarpa]
Length=732

 Score =   211 bits (536),  Expect(3) = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/341 (38%), Positives = 196/341 (57%), Gaps = 33/341 (10%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSF-----------KSDLGDS  1682
             I  K  +CLDV TRWNSTY+ML +A+ +  VF   E +D+ +           + +LG  
Sbjct  360   IGSKKFVCLDVATRWNSTYMMLDAAVKFDVVFMRLEETDHRYLSYFEVDSQGKQKNLGP-  418

Query  1681  IPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAV  1505
              P   DWE   + VK LK FY +T++ SGSLYVT+N+FF E+  ++  ++++  + D  V
Sbjct  419   -PALEDWEKARSFVKFLKLFYTVTLKFSGSLYVTSNSFFHELISMHTSISQLCRSEDVYV  477

Query  1504  KLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKL  1325
               M  NM AK++KY GD D  N++++ A +LDPR KL+Y+      +Y  ++ +++  K+
Sbjct  478   SNMAKNMMAKYKKYWGDQDTQNFLLYVAVVLDPRFKLKYVRFCFGRLYDVEEAENFTIKV  537

Query  1324  LAALNELYDDYA-VSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRME  1148
                L  L++ Y  V  +  VVP+ G+    +VN+ +  V                    +
Sbjct  538   KNTLLTLFEHYMNVDENVDVVPSVGTSINENVNVDLMVV---------------NDDMRK  582

Query  1147  LLGGKKIELEYYLSEAITEDEGSF--DILRWWKVNSARFPILSKIARDILAIPISTVASE  974
              +  KK ++E YL +   ED   F  DIL WW+ N+ ++ ILSK+A+ +LAIP+ST  SE
Sbjct  583   KVVSKKNKVERYLGDD-CEDPNDFKLDILGWWRCNATKYKILSKVAQHVLAIPVSTFVSE  641

Query  973   SAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             +AFS  GR+LD FRSSL+P  V+ALVC Q+WL     PI+I
Sbjct  642   AAFSTGGRILDPFRSSLSPSTVQALVCCQNWLSLAPIPINI  682


 Score =   103 bits (258),  Expect(3) = 8e-84, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +HKGE I  A+ESCL+EWG+  + TVTVDNASSN++ + +LKR  + W ++ + 
Sbjct  244   NFCQVSNHKGETIGQAIESCLLEWGIDKILTVTVDNASSNNLTIKYLKRVTIGWATNILS  303

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
             + ++H+RC AHI+NL+V   LK  D +V ++R  VR+VRSSPS+   F   AE     SK
Sbjct  304   NDFMHVRCCAHIVNLIVCAGLKDIDESVVKIRNAVRFVRSSPSRQLVFNQCAERLKIGSK  363

Query  1818  KHPCV  1804
             K  C+
Sbjct  364   KFVCL  368


 Score = 47.8 bits (112),  Expect(3) = 8e-84, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             Q + +TTD+WTSIQ INYM +TAH+IDE W
Sbjct  207   QCLCLTTDTWTSIQNINYMCLTAHWIDEGW  236



>ref|XP_007214254.1| hypothetical protein PRUPE_ppa024136mg, partial [Prunus persica]
 gb|EMJ15453.1| hypothetical protein PRUPE_ppa024136mg, partial [Prunus persica]
Length=741

 Score =   211 bits (537),  Expect(3) = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/355 (39%), Positives = 203/355 (57%), Gaps = 41/355 (12%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVF------DDYEYS-----DNSFKSDLGDS  1682
             IE K  + LDVPTRWNSTYLML +AL ++K F      DD  ++     D     D G  
Sbjct  363   IECKGLVVLDVPTRWNSTYLMLDAALKFEKAFVRMGEDDDAPFASWFGEDEPVGEDEGVV  422

Query  1681  I----------PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFF-------SEIS  1553
             +          PT  DW +    V  LK FY+MT+++S SL+  ++T F        EI 
Sbjct  423   VSHRPKKRVGPPTKEDWSNALTFVNFLKVFYDMTLKMSVSLHPASHTTFHNLIAIEGEIG  482

Query  1552  DLYC--ILNEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPT  1379
             DL+    L         +K M  +MK KFEKY GD+DK+N ++  A +LDPR KL  +  
Sbjct  483   DLFFGEQLPSETHTSTVLKDMACSMKVKFEKYWGDLDKVNQLLMVALVLDPRYKLGNLEF  542

Query  1378  QLVHMYGD----KKGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFV  1211
              L   + +     K K+ +++LL    +LY++YA+   P+    + +G+ +S + +    
Sbjct  543   VLKRRFENPQDATKKKNEVKELLM---KLYEEYAIPPPPTQC-TSANGNTSSTSSITLTS  598

Query  1210  FTPVGRPQHLLKAQ---IKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSAR  1040
                 G  +HL + +   IK+ +       + E++ YL++ I +   +FDIL+WWK+N  +
Sbjct  599   SNKKGGGKHLWEMEEGWIKESQASNTMILEHEVDRYLTDPIEKMVPNFDILKWWKLNGVK  658

Query  1039  FPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             +P LS IA+D+LAIP+STVASES FS SGRV++ FR+SLTPKIVEAL+C+Q+WLR
Sbjct  659   YPSLSLIAKDVLAIPVSTVASESCFSTSGRVINSFRASLTPKIVEALICSQNWLR  713


 Score = 95.1 bits (235),  Expect(3) = 2e-83, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSW--GSSS  2005
             +F  + +HKG  I   LE+CL+ W L+ + T+T DNASSN  A+ +LK K+  W  GS  
Sbjct  245   NFCVIANHKGNSIGKLLETCLLHWDLKKILTITADNASSNTKAIDYLKSKMGHWKNGSLV  304

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
             ++ KY+H+RC AHI+NL+V+D LK+ + ++  +R  VRYVRSSP +L++F+
Sbjct  305   LEGKYMHVRCCAHIVNLIVRDGLKKLEKSILAIRNAVRYVRSSPQRLEEFK  355


 Score = 54.7 bits (130),  Expect(3) = 2e-83, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
              RV +TTD+WTS+Q +NYMV+TAHFID EW
Sbjct  208   HRVCLTTDTWTSVQNVNYMVITAHFIDGEW  237



>ref|NP_001176010.1| Os10g0118700 [Oryza sativa Japonica Group]
 gb|AAL31650.1|AC079179_5 Putative Tam3-like transposon protein [Oryza sativa]
 gb|AAP51893.1| hAT family dimerisation domain containing protein [Oryza sativa 
Japonica Group]
 dbj|BAH94738.1| Os10g0118700 [Oryza sativa Japonica Group]
Length=737

 Score =   218 bits (554),  Expect(3) = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 186/350 (53%), Gaps = 40/350 (11%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL----GDSIPTSLDW  1661
             ++ K  L LD+ TRWNSTYLML +A  YQK F+ Y   D  +K +L    G  +PT  DW
Sbjct  366   VQSKAFLNLDICTRWNSTYLMLNAAEKYQKAFERYSDEDPYYKLELEGENGPGVPTRADW  425

Query  1660  ESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANM  1484
             E    +   L+ FY++T+R+S     T++T+F EI+D+  +L E   + D   K MG  M
Sbjct  426   EKARKMADFLEHFYDLTLRVSVQSRTTSHTYFHEIADVLLLLREWSHSEDKLSKEMGTRM  485

Query  1483  KAKFEKY*GDI--------------DK----MNYMIFFANILDPRDKLEYMPTQLVH-MY  1361
               K+ KY G+               DK    +N+ +FF   +DPR KL       +  M+
Sbjct  486   LMKYYKYWGEKYGERQGDREKRGEKDKGDQLLNFTVFFCVAIDPRYKLSNCIRMGIKVMF  545

Query  1360  GDKKGKDYLEKLLAALNELYDDYAVSYSPS--VVPATGSGSVASVNLVVEFVFTPVGRPQ  1187
             GD  G+   E +      L+++Y   Y+P       T S S A  +  V   +  V    
Sbjct  546   GDTVGEKVWETVNTYFRALFEEYKEMYTPKDKAPQPTESESTAETSKRVSCRWMSV----  601

Query  1186  HLLKAQIKKQRMELLGGK---KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIA  1016
                      Q++   GG    K E++ YLSE    D   FDIL+WWK NS RFPILS +A
Sbjct  602   -------ITQQLNSEGGSGTIKSEVDKYLSEDNEPDTPKFDILKWWKANSTRFPILSHLA  654

Query  1015  RDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPN  866
              D+LAIPI++VASESAFS  GR LD FR+SLTP++VE LVC  DWLR  N
Sbjct  655   CDLLAIPITSVASESAFSAGGRTLDDFRTSLTPRMVERLVCANDWLRGGN  704


 Score = 97.1 bits (240),  Expect(3) = 1e-82, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
              F  VK H+GE I  +LE+CL EWG+  VFT+TVDNAS+N+ A+ +++R +        +
Sbjct  250   GFFLVKGHRGEDIGKSLENCLAEWGIDKVFTITVDNASANNNAIKYMRRVLNESKGCVAE  309

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
              +Y+HMRC AHI+NL+V D LK+   +++RVR  V+++R   S+L KF+  AE +   SK
Sbjct  310   GEYIHMRCAAHIINLIVGDGLKEIGTSIQRVRAAVKFIRCGTSRLVKFKKCAELAKVQSK  369


 Score = 43.9 bits (102),  Expect(3) = 1e-82, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RV +TTD+WT+    N+M VTAHFID EW
Sbjct  214   RVCLTTDTWTAKNSQNFMCVTAHFIDNEW  242



>gb|EEE52457.1| hypothetical protein OsJ_34617 [Oryza sativa Japonica Group]
Length=697

 Score =   220 bits (560),  Expect(3) = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/339 (39%), Positives = 191/339 (56%), Gaps = 32/339 (9%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL----GDSIPTSLDW  1661
             ++ K  L LDV T WNSTY ML  A  Y+K F+ Y   D  +K DL    G  +P   DW
Sbjct  355   VQTKAFLTLDVCTMWNSTYHMLNIAQQYEKAFERYSDEDPYYKLDLEGHDGPGVPEKSDW  414

Query  1660  ESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANM  1484
             +    + + L+ FYE+T+R+S +   T++TFF EI+ +  +L +   + D     MG  M
Sbjct  415   DKARKMAEFLEHFYELTLRVSATSRPTSHTFFHEIAGVVVLLRQWCNSEDLLCAEMGKRM  474

Query  1483  KAKFEKY*GDI----DKMNYMIFFANILDPRDKLE-YMPTQLVHMYGDKKGKDYLEKLLA  1319
               K++KY G+I      +N ++FF   LDPR KL  Y+    + M+GD+ G+     ++ 
Sbjct  475   LLKYQKYWGEIGPGVQNLNLIVFFCVALDPRYKLNSYIKMATMVMFGDEIGEQLWTTVVN  534

Query  1318  ALNELYDDYAVSYSPS---VVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRME  1148
             + + L+ +Y   Y+P+     P    GS+++               + L+++ I  Q+M 
Sbjct  535   SFHSLFHEYKEIYTPNEPVAAPNDIQGSLST--------------SKRLMRS-IVAQQMS  579

Query  1147  LLGGK----KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVA  980
               G      K EL+ Y SE   ED   FDIL++WK NS R P+LS++ARD+LAIPIS+VA
Sbjct  580   NNGASRSIAKSELDKYFSEDNEEDTKGFDILKYWKDNSTRLPLLSRMARDLLAIPISSVA  639

Query  979   SESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNT  863
             SESAFS  GR LD FRSSLTP +VE L+C  DWLR  N+
Sbjct  640   SESAFSAGGRTLDDFRSSLTPTMVERLICANDWLRGCNS  678


 Score = 90.9 bits (224),  Expect(3) = 2e-82, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
              F  VK H+GE I  +L++CL EW +  V ++TVDNAS+N+ A+ ++KR +        +
Sbjct  239   GFFLVKGHRGEDIGKSLDNCLSEWRIDIVLSITVDNASANNNAIKYMKRVLNESKGCIAE  298

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
              ++LHMRC+AHI+NL+V D LK+ + ++ RVR  +++V++ P++L KF+  AE
Sbjct  299   GEFLHMRCVAHIINLIVADGLKEINKSICRVRAAIKFVKAGPARLAKFKKCAE  351


 Score = 47.0 bits (110),  Expect(3) = 2e-82, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             +RVS+TTD+WT+    NYM VTAHFID +W
Sbjct  202   ERVSLTTDTWTANTNQNYMCVTAHFIDNDW  231



>ref|XP_007225531.1| hypothetical protein PRUPE_ppa025795mg, partial [Prunus persica]
 gb|EMJ26730.1| hypothetical protein PRUPE_ppa025795mg, partial [Prunus persica]
Length=741

 Score =   208 bits (529),  Expect(3) = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/355 (38%), Positives = 202/355 (57%), Gaps = 41/355 (12%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVF------DDYEYS-----DNSFKSDLGDS  1682
             IE K  + L+VPTRWNSTYLML +AL ++K F      DD  ++     D     D G  
Sbjct  363   IECKGLVVLNVPTRWNSTYLMLDAALKFEKAFVRMGEDDDAPFASWFGEDEPVGEDEGVV  422

Query  1681  I----------PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFF-------SEIS  1553
             +          PT  DW +    V  LK FY+MT+++S SL+  ++T F        EI 
Sbjct  423   VSHRPKKRVGPPTKEDWSNALTFVNFLKVFYDMTLKMSVSLHPASHTTFHNLIAIEGEIG  482

Query  1552  DLYC--ILNEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPT  1379
             DL+    L         +K M  +MK KFEKY GD+DK+N ++  A +LDPR KL  +  
Sbjct  483   DLFFGEQLPSETHTSTVLKDMACSMKVKFEKYWGDLDKVNQLLMVALVLDPRYKLGNLEF  542

Query  1378  QLVHMYGD----KKGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFV  1211
              L   + +     K K+ +++LL    +LY++YA+   P+    + +G+ +S + +    
Sbjct  543   VLKRRFENPQDATKKKNEVKELLM---KLYEEYAIPPPPTQC-TSANGNTSSTSSITLTS  598

Query  1210  FTPVGRPQHLLKAQ---IKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSAR  1040
                 G  +HL + +   IK+ +       + E++ YL + I +   +FDIL+WWK+N  +
Sbjct  599   SNKKGGGKHLWEMEEGWIKESQASNTMILEHEVDRYLIDPIEKMVPNFDILKWWKLNGVK  658

Query  1039  FPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             +P LS IA+D+LAIP+STVASES FS SGRV++ FR+SLTPKIVEAL+C+Q+WLR
Sbjct  659   YPSLSLIAKDVLAIPVSTVASESCFSTSGRVINSFRASLTPKIVEALICSQNWLR  713


 Score = 95.1 bits (235),  Expect(3) = 2e-82, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSW--GSSS  2005
             +F  + +HKG  I   LE+CL+ W L+ + T+T DNASSN  A+ +LK K+  W  GS  
Sbjct  245   NFCVIANHKGNSIGKLLETCLLHWDLKKILTITADNASSNTKAIDYLKSKMGHWKNGSLV  304

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
             ++ KY+H+RC AHI+NL+V+D LK+ + ++  +R  VRYVRSSP +L++F+
Sbjct  305   LEGKYMHVRCCAHIVNLIVRDGLKKLEKSILAIRNAVRYVRSSPQRLEEFK  355


 Score = 54.7 bits (130),  Expect(3) = 2e-82, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
              RV +TTD+WTS+Q +NYMV+TAHFID EW
Sbjct  208   HRVCLTTDTWTSVQNVNYMVITAHFIDGEW  237



>ref|NP_001068267.2| Os11g0613900 [Oryza sativa Japonica Group]
 gb|ABA94812.1| hAT family dimerisation domain containing protein [Oryza sativa 
Japonica Group]
 dbj|BAF28630.2| Os11g0613900 [Oryza sativa Japonica Group]
Length=709

 Score =   220 bits (560),  Expect(3) = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/339 (39%), Positives = 191/339 (56%), Gaps = 32/339 (9%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL----GDSIPTSLDW  1661
             ++ K  L LDV T WNSTY ML  A  Y+K F+ Y   D  +K DL    G  +P   DW
Sbjct  355   VQTKAFLTLDVCTMWNSTYHMLNIAQQYEKAFERYSDEDPYYKLDLEGHDGPGVPEKSDW  414

Query  1660  ESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANM  1484
             +    + + L+ FYE+T+R+S +   T++TFF EI+ +  +L +   + D     MG  M
Sbjct  415   DKARKMAEFLEHFYELTLRVSATSRPTSHTFFHEIAGVVVLLRQWCNSEDLLCAEMGKRM  474

Query  1483  KAKFEKY*GDI----DKMNYMIFFANILDPRDKLE-YMPTQLVHMYGDKKGKDYLEKLLA  1319
               K++KY G+I      +N ++FF   LDPR KL  Y+    + M+GD+ G+     ++ 
Sbjct  475   LLKYQKYWGEIGPGVQNLNLIVFFCVALDPRYKLNSYIKMATMVMFGDEIGEQLWTTVVN  534

Query  1318  ALNELYDDYAVSYSPS---VVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRME  1148
             + + L+ +Y   Y+P+     P    GS+++               + L+++ I  Q+M 
Sbjct  535   SFHSLFHEYKEIYTPNEPVAAPNDIQGSLST--------------SKRLMRS-IVAQQMS  579

Query  1147  LLGGK----KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVA  980
               G      K EL+ Y SE   ED   FDIL++WK NS R P+LS++ARD+LAIPIS+VA
Sbjct  580   NNGASRSIAKSELDKYFSEDNEEDTKGFDILKYWKDNSTRLPLLSRMARDLLAIPISSVA  639

Query  979   SESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNT  863
             SESAFS  GR LD FRSSLTP +VE L+C  DWLR  N+
Sbjct  640   SESAFSAGGRTLDDFRSSLTPTMVERLICANDWLRGCNS  678


 Score = 90.5 bits (223),  Expect(3) = 2e-82, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
              F  VK H+GE I  +L++CL EW +  V ++TVDNAS+N+ A+ ++KR +        +
Sbjct  239   GFFLVKGHRGEDIGKSLDNCLSEWRIDIVLSITVDNASANNNAIKYMKRVLNESKGCIAE  298

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
              ++LHMRC+AHI+NL+V D LK+ + ++ RVR  +++V++ P++L KF+  AE
Sbjct  299   GEFLHMRCVAHIINLIVADGLKEINKSICRVRAAIKFVKAGPARLAKFKKCAE  351


 Score = 47.0 bits (110),  Expect(3) = 2e-82, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             +RVS+TTD+WT+    NYM VTAHFID +W
Sbjct  202   ERVSLTTDTWTANTNQNYMCVTAHFIDNDW  231



>ref|XP_006374644.1| hypothetical protein POPTR_0015s13960g [Populus trichocarpa]
 gb|ERP52441.1| hypothetical protein POPTR_0015s13960g [Populus trichocarpa]
Length=625

 Score =   208 bits (530),  Expect(3) = 6e-82, Method: Compositional matrix adjust.
 Identities = 131/331 (40%), Positives = 189/331 (57%), Gaps = 28/331 (8%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSL------  1667
             IE K SLCLDV TRWNSTYLML++A  ++KVF             LG+  P  +      
Sbjct  284   IECKKSLCLDVATRWNSTYLMLEAAEKFEKVF-----------VRLGEKEPRYIKPPGLE  332

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGA  1490
             DW++   LVK LK FY +T+R SGSL+VT+N+FF+E+  ++  L ++ +  D  +  M  
Sbjct  333   DWKNARTLVKFLKIFYMVTLRFSGSLHVTSNSFFNELIYIHTNLLQLCKNKDSILSGMAM  392

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
             NM  KFEKY G     N++++ AN+LDPR KL+Y+   +  +Y   K +    K+   L 
Sbjct  393   NMMLKFEKYLGCEVNQNFLLYVANVLDPRLKLKYVKFCIGDLYDYDKAQLLTNKVKDTLV  452

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK  1130
              LY+ Y +     V        V++++ V   V T     +HL       Q ++ +  K 
Sbjct  453   SLYEFY-LKIDEVVDNNRHKQDVSAIDDVEVDVNTLARFKRHL-------QEVDSVENKN  504

Query  1129  IELEYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
              E+E YL +   + ++   DIL WWK N+ ++  LSK+A+ +L IPISTVASESAFS  G
Sbjct  505   -EVERYLIDGCEDPNDDKLDILGWWKSNALKYKTLSKVAQHVLVIPISTVASESAFSTCG  563

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLRRPNTP  860
              VLD FRSSL+P  V+AL+C Q+WL   + P
Sbjct  564   HVLDQFRSSLSPATVQALICCQNWLHYGSIP  594


 Score = 97.1 bits (240),  Expect(3) = 6e-82, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H GE I   +E+CL+EWG+  + T+T+DNASSN+V + +LK  +  W ++ + 
Sbjct  168   NFYQVSNHMGETIGQVIENCLLEWGIDKLLTITLDNASSNNVTISYLKNVMKDWPTNILS  227

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +++LH+RC AHI+NL+V D LK+ +++V ++R  +R+VRSSPS+   F+  AE
Sbjct  228   NEHLHVRCCAHIVNLIVCDGLKEINVSVVKIRNAIRFVRSSPSRHLAFKKCAE  280


 Score = 50.4 bits (119),  Expect(3) = 6e-82, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ +TTD+WTSIQ INYM +TAH+ID++W
Sbjct  131   QRLCLTTDTWTSIQNINYMCLTAHWIDDDW  160



>gb|AAV32822.1| transposase [Zea mays]
Length=674

 Score =   213 bits (543),  Expect(3) = 9e-82, Method: Compositional matrix adjust.
 Identities = 133/352 (38%), Positives = 195/352 (55%), Gaps = 61/352 (17%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGD-----SIPTSLD  1664
             +  K  L +DVPTRWNST+LML++AL+Y+KVF      D S  +DL +       P   D
Sbjct  296   LTNKQFLKIDVPTRWNSTFLMLKAALVYEKVFTRLADEDMSCVNDLSEEKDRYGHPEEHD  355

Query  1663  WESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAVKL-MGAN  1487
             W++  N+   L+ F+++T+R+S + ++T++T F EI +++ ++   + ++   +  M   
Sbjct  356   WQNAKNMADFLEHFHDLTVRVSATNHITSHTLFHEIGEVHLLVQSWLNSEDVFQASMVKR  415

Query  1486  MKAKFEKY*G------DID-----------------KMNYMIFFANILDPRDKLE-YMPT  1379
             MK KF+KY G      +ID                  MN +IF A  LDPR KL  Y   
Sbjct  416   MKEKFDKYWGLWHTSKNIDGNANDKEKGRGKGKEKENMNLLIFVAGCLDPRYKLSMYTKI  475

Query  1378  QLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPV  1199
              +  ++G+++G++    +L           V   P V     S S+AS            
Sbjct  476   TVEEIFGEERGQNTGNYILQ----------VKRQPDV-----SDSIASKG----------  510

Query  1198  GRPQHLLKAQIKKQRMELLGG----KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPI  1031
             GR   L   ++  +RM+L  G     K EL+ YL+E   + E   D+L WWK +  RFPI
Sbjct  511   GRGGKL--KEVIAKRMKLGTGSNSNNKSELDKYLAEETEDTEMKLDLLVWWKASEQRFPI  568

Query  1030  LSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             LS++ARD+LAIPIS+VASESAFS  GR+LD FRSSLTP ++E+LVCTQDWLR
Sbjct  569   LSRLARDVLAIPISSVASESAFSTGGRILDDFRSSLTPFMLESLVCTQDWLR  620


 Score = 96.7 bits (239),  Expect(3) = 9e-82, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 78/113 (69%), Gaps = 2/113 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
              F  VK HKG+ I   +  C+ +WGL+ V  VTVDNAS+ND  +G+LKR +    ++   
Sbjct  182   GFFMVKGHKGDDIGRNVLRCMTDWGLQRVMPVTVDNASANDNCIGYLKRHLTK--TNVAG  239

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
              KYLHMRC AHI+NL+V D LK+ D++VKR+R  VRY+R+  S++ KF++L E
Sbjct  240   GKYLHMRCAAHIVNLIVHDGLKEVDLSVKRIRAAVRYIRNGGSRIVKFKELIE  292


 Score = 45.4 bits (106),  Expect(3) = 9e-82, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QRV +TTD WTS Q+ +YM VTA FIDE W
Sbjct  145   QRVCLTTDGWTSQQQDSYMTVTASFIDENW  174



>ref|XP_006370060.1| hypothetical protein POPTR_0001s39120g [Populus trichocarpa]
 gb|ERP66629.1| hypothetical protein POPTR_0001s39120g [Populus trichocarpa]
Length=660

 Score =   206 bits (525),  Expect(3) = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/342 (39%), Positives = 190/342 (56%), Gaps = 59/342 (17%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSF-----------KSDLGDS  1682
             I  K S+CLDV TRWNSTY+ML +A+ +  VF   E +D  +           + +LG  
Sbjct  319   IGSKKSVCLDVATRWNSTYMMLDAAVKFDVVFMRLEETDPRYLSYFEVDSQGKQKNLGP-  377

Query  1681  IPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAV  1505
              P   DWE   + VK LK FY +T++ SGSLYVT+N+FF+E+  ++  ++++  + D  V
Sbjct  378   -PALEDWEKARSFVKFLKLFYTVTLKFSGSLYVTSNSFFNELISMHTSISQLCRSEDVYV  436

Query  1504  KLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKL  1325
               M  NM AK++KY GD D  N++++ A +LDPR KL+Y+      +             
Sbjct  437   SNMAKNMMAKYKKYWGDQDTQNFLLYVAVVLDPRFKLKYVRFCFGRL-------------  483

Query  1324  LAALNELYDDYAVSYSPSVVPATGSGSVASVN--LVVEFVFTPVGRPQHLLKAQIKKQRM  1151
                L E Y +  V  +  VVP+ G+    +VN  L VE             +  ++KQ  
Sbjct  484   ---LFEYYMN--VDENVDVVPSVGTSKNENVNVDLTVE-------------EGCVQKQN-  524

Query  1150  ELLGGKKIELEYYLSEAITEDEGSF--DILRWWKVNSARFPILSKIARDILAIPISTVAS  977
                     E+E YL +   ED   F  DIL WW+ N+ ++ ILSK+A+ +LAIP+STV S
Sbjct  525   --------EVERYLGDD-CEDPNDFKLDILGWWRCNATKYKILSKVAQHVLAIPVSTVVS  575

Query  976   ESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             E+AFS  GR+LD FRSSL+P  V+ALVC Q+WL     PI+I
Sbjct  576   EAAFSTGGRILDPFRSSLSPSTVQALVCCQNWLSLAPIPINI  617


 Score =   100 bits (249),  Expect(3) = 1e-81, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 83/125 (66%), Gaps = 0/125 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +HKGE I  A+ESCL+EWG+  + TVTVDNASSN++ + +LKR  + W ++ + 
Sbjct  203   NFCQVSNHKGETIGQAIESCLLEWGIDKILTVTVDNASSNNLTIKYLKRVTIGWATNILS  262

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
             + ++H+RC AHI+NL+V   LK  D +V ++R  VR+VRSS S+   F   AE     SK
Sbjct  263   NDFMHVRCCAHIVNLIVCAGLKDIDDSVVKIRNAVRFVRSSSSRQLVFNQCAERLKIGSK  322

Query  1818  KHPCV  1804
             K  C+
Sbjct  323   KSVCL  327


 Score = 47.8 bits (112),  Expect(3) = 1e-81, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             Q + +TTD+WTSIQ INYM +TAH+IDE W
Sbjct  166   QCLCLTTDTWTSIQNINYMCLTAHWIDEGW  195



>ref|XP_006377812.1| hypothetical protein POPTR_0011s13140g [Populus trichocarpa]
 gb|ERP55609.1| hypothetical protein POPTR_0011s13140g [Populus trichocarpa]
Length=532

 Score =   204 bits (519),  Expect(3) = 7e-81, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 185/330 (56%), Gaps = 40/330 (12%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSL-DWESV  1652
             IE K SLCLDV TRWNSTYLML++A  ++KVF      +  +        P SL DW++ 
Sbjct  211   IECKKSLCLDVATRWNSTYLMLEAAEKFEKVFVRLAEKEPRYMR------PPSLEDWKNA  264

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGANMKAK  1475
               LVK LK FY +T+R SGSL+VT+N+FF+E+  ++  L ++ +  D  +  M  NM  K
Sbjct  265   RTLVKFLKIFYMVTLRFSGSLHVTSNSFFNELIYMHTNLLQLCKNKDNILSGMAMNMMLK  324

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             FEKY G     N++++ AN+LDPR KL+Y+      +Y   K +    K+   L  LY+ 
Sbjct  325   FEKYWGFEGNQNFLLYVANVLDPRFKLKYVKFCFGDLYDYDKAQLLTNKVKDVLVSLYEF  384

Query  1294  YAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKK-QRMELLGGKKIELE  1118
             Y                     L ++ V   V   +H  K  + +  R+E     K E+E
Sbjct  385   Y---------------------LKIDEV---VDNNRH--KQDVNEMDRVE----NKNEVE  414

Query  1117  YYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLD  941
              YL ++  + +    DIL WWK NS R+  LSK+A+ +LAIPISTVASESAFS  GRVLD
Sbjct  415   RYLIDSCEDPNNDKLDILGWWKSNSLRYKTLSKVAQHVLAIPISTVASESAFSTGGRVLD  474

Query  940   HFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
              FRSSL    V+AL+C Q+WL   + P  I
Sbjct  475   QFRSSLPSATVQALICCQNWLHHGSIPTDI  504


 Score = 99.0 bits (245),  Expect(3) = 7e-81, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H GE I   +E+C++EWG+  V TVTVDNASSN+V + FLK  +  W ++ + 
Sbjct  95    NFCQVSNHMGETIDQVIENCMLEWGIDKVLTVTVDNASSNNVTISFLKNVMKDWPTNILS  154

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +++LH+RC AHI+NL+V D LK+ +++V ++R  +R+VRSSPS+   F+  AE
Sbjct  155   NEHLHVRCCAHIVNLIVCDVLKEINVSVVKIRNAIRFVRSSPSRQLAFKKCAE  207


 Score = 49.3 bits (116),  Expect(3) = 7e-81, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ +TTD+WTSIQ INY+ +TAH+ID EW
Sbjct  58    QRLCLTTDTWTSIQNINYICLTAHWIDNEW  87



>gb|AHC08670.1| putative transposase [Medicago truncatula]
Length=628

 Score =   206 bits (523),  Expect(3) = 9e-81, Method: Compositional matrix adjust.
 Identities = 119/326 (37%), Positives = 183/326 (56%), Gaps = 17/326 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDS-IPTSLDWESV  1652
             I  K  +CLDV TRWNS ++ML +A  +Q  F+   + D+S+     ++ +PT  DWE  
Sbjct  263   ITCKKHVCLDVSTRWNSLFMMLDTAEKFQPAFEKLVHEDSSYVEWFKEAGLPTPNDWEKA  322

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKLMGANMKAK  1475
                V  LK FY+ T   S S  V+ +T F  ++ + C L +  ++ +  V  MG  MKAK
Sbjct  323   RAFVSFLKIFYDATKVFSSSQQVSIHTAFHSLASILCELQKACMDLNTIVADMGVEMKAK  382

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNE----  1307
             ++KY G++ KMN  ++F  I DPR K  Y+      +YG   G D  ++   ++++    
Sbjct  383   YDKYWGNVVKMNQFLYFGVIFDPRYKFGYIEWSFNDLYG--AGSDIAKERAGSVSDNLFK  440

Query  1306  LYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG--K  1133
             LY+ Y   +   V P+  + S      V +        P    +A   K+ ++       
Sbjct  441   LYNLYKSEHESFVGPSGSNNSSVEQPAVPKI-------PSLNTRADAYKKHLKTKETIVP  493

Query  1132  KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
             + +LE YLS+    D+ SFDIL WWK N  R+P+L+ + RD+LA P+S+VASESAFS  G
Sbjct  494   QNDLERYLSDPPENDDPSFDILTWWKKNCVRYPVLATMVRDVLATPVSSVASESAFSTGG  553

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLR  875
             R+LD +RSSL+P++ EAL+CTQ+WL+
Sbjct  554   RILDTYRSSLSPEMAEALICTQNWLK  579


 Score =   108 bits (269),  Expect(3) = 9e-81, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 83/125 (66%), Gaps = 0/125 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             SF P+ +HKG  I   +E  L EWG+RNV T+TVDNASSNDVA+ +LK+++        +
Sbjct  147   SFAPIPNHKGLTIGKKVEEVLKEWGIRNVSTITVDNASSNDVAVSYLKQRLKIKNGLLGE  206

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
               + HMRC+AHILNLVV D LK  D+++  +R  VR+VRSSP +  KF++  + S    K
Sbjct  207   GDHFHMRCVAHILNLVVMDGLKDQDLSISSIRNAVRFVRSSPQRALKFKECIDMSRITCK  266

Query  1818  KHPCV  1804
             KH C+
Sbjct  267   KHVCL  271


 Score = 38.1 bits (87),  Expect(3) = 9e-81, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -1

Query  2279  VSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             V++TTD W+S Q ++++ +TAHFID  W
Sbjct  112   VALTTDCWSSQQNLSFITITAHFIDRCW  139



>ref|XP_007200197.1| hypothetical protein PRUPE_ppa016010mg [Prunus persica]
 gb|EMJ01396.1| hypothetical protein PRUPE_ppa016010mg [Prunus persica]
Length=747

 Score =   203 bits (517),  Expect(3) = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/355 (38%), Positives = 204/355 (57%), Gaps = 41/355 (12%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVF------DDYEYS-----DNSFKSDLGDS  1682
             IE K  + LDVPTRWNSTYLML +AL + K F      DD  ++     D     D G  
Sbjct  356   IECKGLVVLDVPTRWNSTYLMLDAALKFVKAFVRMGEDDDAPFASWFSEDEPVWEDEGVV  415

Query  1681  I----------PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFS-------EIS  1553
             +          PT  DW +    V  LK FY+MT+++S SL+  ++T F        EI 
Sbjct  416   VSHRPKKRVGPPTKEDWSNALTFVIFLKVFYDMTLKMSVSLHPASHTTFHNLIAIEGEIG  475

Query  1552  DLYC--ILNEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPT  1379
             DL+    L         +K M  +MK KFEKY GD+DK+N ++  A +LDPR KL  +  
Sbjct  476   DLFFGEQLPSETHTSMVLKDMACSMKVKFEKYWGDLDKVNQLLMVAVVLDPRYKLGNLEF  535

Query  1378  QLVHMYGD----KKGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFV  1211
              L   + +     K K+ +++LL    +LY++YA+   P+    + +G+ +S + +    
Sbjct  536   VLKRRFENPQDATKKKNEVKELLM---KLYEEYAIPPPPTQC-TSANGNTSSTSSITLTS  591

Query  1210  FTPVGRPQHLLKAQ---IKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSAR  1040
              +  G  ++L + +   IK+ ++      + E++ YL++ I +   +FDIL+WWK+N  +
Sbjct  592   SSKKGGGKNLWEMEEGWIKESQVSNTMILEHEVDRYLTDPIEKMVLNFDILKWWKLNGVK  651

Query  1039  FPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             +P LS IA+D+LAIP+STVASES FS SGRV++ FR+SLTPKI+EAL+C+Q+WLR
Sbjct  652   YPSLSLIAKDVLAIPVSTVASESCFSTSGRVINSFRASLTPKIMEALICSQNWLR  706


 Score = 96.7 bits (239),  Expect(3) = 1e-80, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 79/111 (71%), Gaps = 2/111 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSW--GSSS  2005
             +F  + +HKG  I   LE+CL+ W L+ + T+T DNASSN  A+ +LK K+  W  GS  
Sbjct  238   NFCVIANHKGNSIGKLLETCLLHWDLKKILTITADNASSNTKAIDYLKSKMSHWKNGSLV  297

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
             ++ KY+H+RC AHI+NL+V+DSLK+ + ++  +R  VRYVRSSP +L++F+
Sbjct  298   LEGKYMHVRCCAHIVNLIVRDSLKKLEKSILAIRNAVRYVRSSPQRLEEFK  348


 Score = 52.0 bits (123),  Expect(3) = 1e-80, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
              RV +TTD+WTS+Q +NYMV+T HFID EW
Sbjct  201   HRVCLTTDTWTSVQNVNYMVITTHFIDGEW  230



>ref|XP_006370155.1| hypothetical protein POPTR_0001s40220g [Populus trichocarpa]
 gb|ERP66724.1| hypothetical protein POPTR_0001s40220g [Populus trichocarpa]
Length=722

 Score =   203 bits (517),  Expect(3) = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/338 (39%), Positives = 189/338 (56%), Gaps = 27/338 (8%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDY------------EYSDNSFKSDLGD  1685
             IE K SLCLDV TRWNSTYLML++A  ++KVF               E      K ++G 
Sbjct  366   IECKKSLCLDVATRWNSTYLMLEAAEKFEKVFVRLGEKKPRYMSYFLEVDSKGNKKNIGP  425

Query  1684  SIPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGA  1508
               P   DWE+   LVK LK FY +T+R S SL+VT+N+FF+E+  ++  L ++ +  D  
Sbjct  426   --PGLEDWENARTLVKFLKIFYMVTLRFSVSLHVTSNSFFNELIYMHTNLLQLCKNKDSI  483

Query  1507  VKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEK  1328
             +  M  NM  KFEKY G     N++++ AN+LDPR KL+Y+      +Y   K +    K
Sbjct  484   LSGMAMNMMLKFEKYWGCEVNQNFLLYVANVLDPRLKLKYVKFCFGDLYDYDKAQLLTNK  543

Query  1327  LLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGR-PQHLLKAQIKKQRM  1151
             +   L  LY+ Y +     V        V++++ V E     + R  +HL       Q +
Sbjct  544   VKDTLMSLYEFY-LKIDEVVDNNRHKQDVSAIDYV-EVDINALARFKRHL-------QEV  594

Query  1150  ELLGGKKIELEYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASE  974
             + +  K  E+E YL +   + ++   DIL WWK N  ++  LSK+A+ +LAIPISTVASE
Sbjct  595   DSVENKN-EVERYLIDGCEDPNDDKLDILGWWKSNVLKYKTLSKVAQHVLAIPISTVASE  653

Query  973   SAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTP  860
             SAFS  GRVL  FRSSL+P  V+AL+C Q+WL   + P
Sbjct  654   SAFSTGGRVLYQFRSSLSPATVQALICCQNWLHHGSIP  691


 Score = 96.7 bits (239),  Expect(3) = 2e-80, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H GE I   +E+CL+EWG+  + T+T+DNASSN+V + +LK  +  W ++ + 
Sbjct  250   NFCQVSNHMGETIGQVIENCLLEWGIDKLLTITLDNASSNNVTISYLKNVMKDWPTNILS  309

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +++LH+RC AHI+NL+V D LK+ +++V ++R  +R+VRSSPS+   F+  AE
Sbjct  310   NEHLHVRCCAHIVNLIVCDGLKEINVSVVKIRNGIRFVRSSPSRHLAFKKCAE  362


 Score = 51.2 bits (121),  Expect(3) = 2e-80, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ +TTD+WTSIQ INYM +TAH+ID++W
Sbjct  213   QRLCLTTDTWTSIQNINYMCLTAHWIDDDW  242



>ref|XP_006371212.1| hypothetical protein POPTR_0019s06065g [Populus trichocarpa]
 gb|ERP49009.1| hypothetical protein POPTR_0019s06065g [Populus trichocarpa]
Length=577

 Score =   198 bits (504),  Expect(3) = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/342 (37%), Positives = 191/342 (56%), Gaps = 34/342 (10%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD-----------NSFKSDLGDS  1682
             I  K  +CLDV TRWNS Y+ML +A  +  VF   E +D           N  + +LG  
Sbjct  238   IGSKKYVCLDVVTRWNSIYMMLDAAAKFDVVFMRLEETDPRYLSYFEVDSNGKQKNLGP-  296

Query  1681  IPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAVK  1502
              PT  DWE   + VK LK FY +T++ SG LYVT+N F  E+  ++  ++++  ++    
Sbjct  297   -PTLEDWEKARSFVKFLKLFYTVTLKFSGLLYVTSNFFLHELISMHTSISQLCRSEDV--  353

Query  1501  LMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLL  1322
                      ++KY GD D  N++++ A +LDPR KL+Y+      +Y  ++  ++  K+ 
Sbjct  354   ---------YKKYWGDQDTQNFLLYVAVVLDPRFKLKYVRFCFGRLYDVEEAGNFTFKVK  404

Query  1321  AALNELYDDYA-VSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMEL  1145
               L  L++ Y  V  +  VV + G+    +VN+ +  V   +      L +Q KK  +E 
Sbjct  405   DTLIRLFEHYMNVDENVEVVHSVGTSINENVNVDLTMVNDDMLDD---LASQFKKH-LEE  460

Query  1144  LGG--KKIELEYYLSEAITEDEGSF--DILRWWKVNSARFPILSKIARDILAIPISTVAS  977
              GG  KK E+E YL +   ED   F  DIL WW+ N+ ++ ILSK+A+ +LAI +STV S
Sbjct  461   EGGVQKKNEVERYLGDD-CEDPNDFKLDILGWWRCNATKYKILSKVAQHVLAISVSTVVS  519

Query  976   ESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             E+AFS  GR+LD FRSSL+P  V+ALVC Q+WL     PI+I
Sbjct  520   EAAFSTGGRILDPFRSSLSPSTVQALVCCQNWLSLAPIPINI  561


 Score =   102 bits (253),  Expect(3) = 2e-80, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +HKGE I  A+E+CL+EWG+  +  VTVDNASSN++ + +LKR  + W ++ + 
Sbjct  122   NFCQVSNHKGETIGQAIENCLLEWGIDKILIVTVDNASSNNLTIKYLKRVTIGWATNILS  181

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
             + ++H+RC AHI+NL+V   LK  D +V ++R  VR+VRSSPS+   F   AE     SK
Sbjct  182   NDFMHVRCCAHIVNLIVCAGLKDIDDSVVKIRIAVRFVRSSPSRQLVFNQCAERLKIGSK  241

Query  1818  KHPCV  1804
             K+ C+
Sbjct  242   KYVCL  246


 Score = 50.4 bits (119),  Expect(3) = 2e-80, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ +TTD+WTSIQ INYM +TAH+IDE W
Sbjct  85    QRLCLTTDTWTSIQNINYMCLTAHWIDEGW  114



>ref|XP_006375745.1| hypothetical protein POPTR_0013s01720g [Populus trichocarpa]
 gb|ERP53542.1| hypothetical protein POPTR_0013s01720g [Populus trichocarpa]
Length=598

 Score =   205 bits (521),  Expect(3) = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/329 (40%), Positives = 188/329 (57%), Gaps = 27/329 (8%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDW---E  1658
             IE K SLCLDV TRWNSTY ML++A  ++KVF             LG+  P  + +   E
Sbjct  264   IECKKSLCLDVATRWNSTYHMLEAAKNFEKVF-----------VRLGEKEPRYMSYFLEE  312

Query  1657  SVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGANMK  1481
             +   LVK LK FY +T+R SGSL+VT+N+FF+E+  ++  L ++ +  D  +  M  NM 
Sbjct  313   NARTLVKFLKIFYMVTLRFSGSLHVTSNSFFNELIYMHTNLLQLCKNKDSILSGMAMNMM  372

Query  1480  AKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELY  1301
              KFEKY G     N++++ AN+LDPR KL+Y+      +Y   K +    K+   L  LY
Sbjct  373   LKFEKYWGCEVNQNFLLYVANVLDPRLKLKYVKFCFGDLYDYDKAQLLTNKVKDTLVSLY  432

Query  1300  DDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGK-KIE  1124
             + Y +     V        V++++ V   V T          A+IK+   E+   K K +
Sbjct  433   EFY-LKIDEVVDNNRHKQDVSAIDDVEVDVNTL---------ARIKRHLQEVDSVKNKNK  482

Query  1123  LEYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRV  947
             +E YL +   + ++   DIL WWK N+ ++  LSK+A+ +LAIPISTVASESAFS  GRV
Sbjct  483   VERYLIDGCEDPNDDKLDILGWWKSNALKYKTLSKVAQHVLAIPISTVASESAFSTGGRV  542

Query  946   LDHFRSSLTPKIVEALVCTQDWLRRPNTP  860
             LD FRSSL P  V+AL+C Q+WL   + P
Sbjct  543   LDQFRSSLPPATVQALICCQNWLHHGSIP  571


 Score = 97.1 bits (240),  Expect(3) = 3e-80, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H GE I   +E+CL+EWG+  + T+T+DNASSN+V + +LK  +  W ++ + 
Sbjct  148   NFCQVSNHMGETIGQVIENCLLEWGIDKLLTITLDNASSNNVTISYLKNVMKDWPTNILS  207

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +++LH+RC AHI+NL+V D LK+ +++V +++  +++VRSSPS+   F+  AE
Sbjct  208   NEHLHVRCCAHIVNLIVCDGLKEINVSVVKIQNAIKFVRSSPSRHLAFKKCAE  260


 Score = 48.5 bits (114),  Expect(3) = 3e-80, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             Q++ +TTD+WTSIQ INYM +TAH+ID++W
Sbjct  111   QQLCLTTDTWTSIQNINYMCLTAHWIDDDW  140



>dbj|BAJ23914.1| transposase [Saintpaulia hybrid cultivar]
Length=742

 Score =   197 bits (502),  Expect(3) = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/331 (38%), Positives = 185/331 (56%), Gaps = 17/331 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVF----------DDYEYSDNSFKSDLGDSI  1679
             +++ +++ +DVPTRWNSTY ML  A  ++KVF          + +E  D S K       
Sbjct  346   MDKMSTVPMDVPTRWNSTYTMLSVAYKFKKVFGRMTESIQFVEYFEEVDGSEKKKRVGP-  404

Query  1678  PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV--EADGAV  1505
             P   DWE     V  LK FY+ T+++S S   T+   + EI  L  I+N+ +    D ++
Sbjct  405   PMEKDWEKAQVFVNFLKRFYDTTLQLSASKKTTSPLIWEEIVSLGTIINDTIVNTLDPSL  464

Query  1504  KLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK-KGKDYLEK  1328
             + +   M+ KF+KY GD++ +N +IF  +ILDPR KL+ +   L  M  D  K   +++ 
Sbjct  465   QEVSKKMETKFKKYWGDLENVNKLIFLGHILDPRYKLQMIGIHLGDMKLDSTKIHFFVDG  524

Query  1327  LLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRME  1148
             L  +L ELY  Y  +     +     G V    L+  +    V    H+  AQ++K + +
Sbjct  525   LKKSLMELYHAYKGNSLLDSLEGVDDGDVDK-ELMEMYKNDHVKLNFHMKMAQVRKSQNQ  583

Query  1147  LLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESA  968
                    E++ Y S+   +   +FDIL WWK N+  +P++SKIARDI AIP STVASE+A
Sbjct  584   --AEITNEVDKYFSDPFVKWSSNFDILEWWKGNTTTYPVISKIARDIFAIPSSTVASENA  641

Query  967   FSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             FS+  RV+D FR+SL PK+VEALVCT DWLR
Sbjct  642   FSLGRRVVDPFRASLHPKMVEALVCTSDWLR  672


 Score = 95.5 bits (236),  Expect(3) = 3e-80, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  + SHKG+ I   LE+CL +WG+  VFT+TVDNAS+ND A+ ++++++   G+  + 
Sbjct  230   NFTKITSHKGDDIGKVLETCLSDWGIDKVFTITVDNASTNDKAVEYMRKRLKEMGTLLLD  289

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              KYLH+RC  HI+NL+V+  LK  +  V+ +R  V+Y+ SS ++L +FR+ A
Sbjct  290   GKYLHLRCCCHIINLIVKSGLKFLNEAVESIRNCVKYIHSSAARLDQFRECA  341


 Score = 57.0 bits (136),  Expect(3) = 3e-80, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+SITTD+WTSIQ INYMV+TAHF+D +W
Sbjct  193   QRISITTDTWTSIQNINYMVITAHFLDNDW  222



>ref|XP_006369977.1| hypothetical protein POPTR_0001s36760g [Populus trichocarpa]
 gb|ERP66546.1| hypothetical protein POPTR_0001s36760g [Populus trichocarpa]
Length=662

 Score =   192 bits (487),  Expect(3) = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/342 (37%), Positives = 193/342 (56%), Gaps = 43/342 (13%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKS-----------DLGDS  1682
             I  K  +CLDV TRWNSTY+ML +A  +  VF   + +D  + S           +LG  
Sbjct  320   IGSKKYVCLDVATRWNSTYMMLDAADKFDVVFMRLKETDPRYSSYFEVDSKGKQKNLG--  377

Query  1681  IPTSL-DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGA  1508
              P +L DWE     VK LK FY +T++ SGSLYVT+N+FF E+  ++  ++++  + D  
Sbjct  378   -PLALEDWEKARFFVKFLKLFYTITLKFSGSLYVTSNSFFHELISMHTSISQLCRSEDVY  436

Query  1507  VKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEK  1328
             V  M  NM AK++KY GD D  N++++ A +LD R KL+Y+      +Y  ++ +++  K
Sbjct  437   VSKMAKNMIAKYKKYWGDQDTQNFLLYVAVVLDQRFKLKYVRFCFGRLYDVEEAENFTIK  496

Query  1327  LLAALNELYDDYA-VSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRM  1151
             +  AL  L++ +  V  +  VV + G+    +VN+ +  V   +      L +Q KK  +
Sbjct  497   VKDALIRLFEHFMNVDENVEVVHSVGTSINENVNVDLMVVNDDMLGD---LASQFKKH-L  552

Query  1150  ELLGG--KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVAS  977
             E  GG  KK E+E                    + N+ ++ ILSK+A+ +LAIP+S V S
Sbjct  553   EEEGGVQKKNEVE--------------------RCNATKYKILSKVAQHVLAIPVSIVVS  592

Query  976   ESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             E+AFS  GR+LD FRSSL+P IV+ALVC Q+WL   + PI+I
Sbjct  593   EAAFSTGGRILDPFRSSLSPSIVQALVCCQNWLSLASIPINI  634


 Score =   106 bits (264),  Expect(3) = 5e-80, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 88/126 (70%), Gaps = 0/126 (0%)
 Frame = -3

Query  2181  KSFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             ++F  V +HKGE I+ A+ESCL+EWG+ N+ T+TVDNA SN++ + +LKR + +W ++ +
Sbjct  203   RNFCQVSNHKGETISQAIESCLLEWGIDNILTITVDNARSNNLTIKYLKRVISNWATNIL  262

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELS  1822
              + ++H+RC AHI+NL+V   LK  D +V ++R  VR+VRSSPS+   F   AE     S
Sbjct  263   SNDFMHVRCCAHIVNLIVCAGLKDIDDSVVKIRNAVRFVRSSPSRQLVFNQCAERLKIGS  322

Query  1821  KKHPCV  1804
             KK+ C+
Sbjct  323   KKYVCL  328


 Score = 51.6 bits (122),  Expect(3) = 5e-80, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QRV +TTD+WTSIQ INYM +TAH+IDE W
Sbjct  167   QRVCLTTDTWTSIQNINYMCLTAHWIDEGW  196



>ref|XP_007214488.1| hypothetical protein PRUPE_ppa020338mg [Prunus persica]
 gb|EMJ15687.1| hypothetical protein PRUPE_ppa020338mg [Prunus persica]
Length=707

 Score =   190 bits (483),  Expect(3) = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 181/328 (55%), Gaps = 25/328 (8%)
 Frame = -2

Query  1804  LDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKS------------DLGDSIPTSLDW  1661
             ++VPTRWN+TY ML+ A  Y+++F+   YS   F++                  P   DW
Sbjct  359   MNVPTRWNATYKMLECAFKYRQIFEKMAYSCEVFQAYFLEEEKVKKVMVKRVGPPKDDDW  418

Query  1660  ESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE--ADGAVKLMGAN  1487
             E     V  LK  Y+ T++ S +   T+   F E+  L   +   ++   +  ++ + + 
Sbjct  419   EKALAFVHFLKKIYDATLKFSATKTCTSPIIFLELVALQVQIETKMKDPRNPTMQRVASL  478

Query  1486  MKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEK-LLAALN  1310
             MK KF+KY G  D +N +IF  N+LDPR KL+ +     ++ GD + +D + K ++  LN
Sbjct  479   MKLKFDKYWGSFDIVNKLIFLGNVLDPRMKLQMLQISFGNLGGDARKQDEIVKEVVKCLN  538

Query  1309  ELYDDY-AVSYSPSVVPATG-SGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG  1136
             ELY++Y  V    S +        VA +   V+  F  +   Q L++ +  +Q +E+   
Sbjct  539   ELYNEYKGVGGGVSQIDEDEIDDEVAQIGDDVDVTFQLM---QQLVQKRKDEQSVEISN-  594

Query  1135  KKIELEYYLSEAITED-EGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSI  959
                E++ YL++         F++L WWK N  R+PILS++A+DI AIP STVASE+AFS+
Sbjct  595   ---EVDKYLTDPFESPLSKQFNLLNWWKGNQTRYPILSQVAKDIFAIPNSTVASENAFSL  651

Query  958   SGRVLDHFRSSLTPKIVEALVCTQDWLR  875
               R++D FRSSL PK+VEALVCT DWLR
Sbjct  652   GKRIVDPFRSSLHPKMVEALVCTSDWLR  679


 Score =   101 bits (251),  Expect(3) = 3e-79, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             SF  + SHKG  I   L++CL +WG+  VFT+TVDNAS+ND A+ ++ + + +  +  + 
Sbjct  235   SFTKITSHKGIDIGKTLDACLTDWGIHKVFTITVDNASANDGAVEYMAQSLKAMNTLMLD  294

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              KYLH+RC  HILNL+V+D LK+   +++ +R  V+++ SSP++L KFR+ A
Sbjct  295   GKYLHLRCACHILNLIVKDGLKELSASIEGIRNCVKFIHSSPARLDKFREFA  346


 Score = 55.5 bits (132),  Expect(3) = 3e-79, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             +RVSITTD+WTSIQ INYMVVT HF+D +W
Sbjct  198   KRVSITTDTWTSIQNINYMVVTIHFMDSDW  227



>ref|XP_007203829.1| hypothetical protein PRUPE_ppa016227m2g, partial [Prunus persica]
 gb|EMJ05028.1| hypothetical protein PRUPE_ppa016227m2g, partial [Prunus persica]
Length=573

 Score =   192 bits (489),  Expect(3) = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/357 (36%), Positives = 198/357 (55%), Gaps = 45/357 (13%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVF----DDYEYSDNSF----KSDLGDSI--  1679
             IE K  + LDVPTRWNSTY+ML+++L ++K F    +D E    S+    + D+ D +  
Sbjct  195   IECKGLVVLDVPTRWNSTYMMLEASLKFEKAFWRMGEDDEGPYISWFGEDEPDVEDGVVM  254

Query  1678  ----------PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFF-------SEISD  1550
                       PT+ DW +    V  LK FY+ T+++S +L+  ++T F        EI D
Sbjct  255   SHYPRKREGPPTNEDWNNARTFVNFLKVFYDATLKMSVTLHPASHTTFHDLIAMEEEIED  314

Query  1549  LYC----ILNEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMP  1382
             L      IL+E  +    +K M  NMK KF+KY GD+DK+N M+  A +LDPR KL  + 
Sbjct  315   LLMEEEEILSE-TQTSKVLKDMALNMKMKFKKYWGDLDKLNQMLMVALVLDPRYKLGNLE  373

Query  1381  TQLVHMYGDK----KGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEF  1214
               L   + +     K K+ ++++L    +LY++YA+   P       S   +    +   
Sbjct  374   FILKSRFENPEDAVKKKNEIKEILK---KLYEEYAMPPPPPPPSTQSSSYSSDTTTM--N  428

Query  1213  VFTPVGRPQHLLKAQIKKQRMELLGGKKIELEY----YLSEAITEDEGSFDILRWWKVNS  1046
               + + R     +   +  R E      + LE+    Y+++ I +    FD+L+WWK+N 
Sbjct  429   TSSSLNRGGKKRRQMTENWRKETQANDVVVLEHEIDRYITDPIEDVVDEFDVLKWWKLNG  488

Query  1045  ARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
              ++P L+ IA+D+LAIP+STVASES FS  GRV++ FR+SLTPKIVEAL+C+Q+WLR
Sbjct  489   VKYPGLALIAKDVLAIPVSTVASESCFSTGGRVINSFRASLTPKIVEALICSQNWLR  545


 Score = 97.4 bits (241),  Expect(3) = 7e-78, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 79/111 (71%), Gaps = 2/111 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--  2005
             +F  + +HKG  I   LESCL++W ++ + T+T DNASSN  A+ +LK K+  WG+ S  
Sbjct  77    NFCVISNHKGNSIGKLLESCLLDWDMKKILTITADNASSNTKAIDYLKSKMGHWGNGSLL  136

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
             ++ KY+H+RC AHI+NL+V+D LK+ + ++  +R  V+YVRSSP +L+ F+
Sbjct  137   LEGKYMHIRCCAHIVNLIVRDGLKKLEKSILCIRNAVKYVRSSPKRLEDFK  187


 Score = 52.8 bits (125),  Expect(3) = 7e-78, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
              RV +TTD+WTS+Q INYMV+TAHFID +W
Sbjct  40    HRVCLTTDTWTSVQNINYMVITAHFIDGDW  69



>gb|ABA94758.1| hAT family dimerisation domain containing protein [Oryza sativa 
Japonica Group]
Length=932

 Score =   201 bits (512),  Expect(3) = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/334 (39%), Positives = 176/334 (53%), Gaps = 40/334 (12%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL----GDSIPTSLDW  1661
             ++ K  L LD+ TRWNSTYLML +A  YQK F+ Y   D  +K +L    G  +PT  DW
Sbjct  608   VQSKAFLNLDICTRWNSTYLMLNAAEKYQKAFERYSDEDPYYKLELEGENGPGVPTRADW  667

Query  1660  ESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANM  1484
             E    +   L+ FY++T+R+S     T++T+F EI+D+  +L E   + D   K MG  M
Sbjct  668   EKARKMADFLEHFYDLTLRVSVQSRTTSHTYFHEIADVLLLLREWSHSEDKLSKEMGTRM  727

Query  1483  KAKFEKY*GDI--------------DK----MNYMIFFANILDPRDKLEYMPTQLVH-MY  1361
               K+ KY G+               DK    +N+ +FF   +DPR KL       +  M+
Sbjct  728   LMKYYKYWGEKYGERQGDREKRGEKDKGDQLLNFTVFFCVAIDPRYKLSNCIRMGIKVMF  787

Query  1360  GDKKGKDYLEKLLAALNELYDDYAVSYSPS--VVPATGSGSVASVNLVVEFVFTPVGRPQ  1187
             GD  G+   E +      L+++Y   Y+P       T S S A  +  V   +  V    
Sbjct  788   GDTVGEKVWETVNTYFRALFEEYKEMYTPKDKAPQPTESESTAETSKRVSCRWMSV----  843

Query  1186  HLLKAQIKKQRMELLGGK---KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIA  1016
                      Q++   GG    K E++ YLSE    D   FDIL+WWK NS RFPILS +A
Sbjct  844   -------ITQQLNSEGGSGTIKSEVDKYLSEDNEPDTPKFDILKWWKANSTRFPILSHLA  896

Query  1015  RDILAIPISTVASESAFSISGRVLDHFRSSLTPK  914
             RD+LAIPI++VASESAFS  GR LD FR+SLTPK
Sbjct  897   RDLLAIPITSVASESAFSAGGRTLDDFRTSLTPK  930


 Score = 97.1 bits (240),  Expect(3) = 7e-78, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
              F  VK H+GE I  +LE+CL EWG+  VFT+TVDNAS+N+ A+ +++R +        +
Sbjct  492   GFFFVKGHRGEDIGKSLENCLAEWGIDKVFTITVDNASANNNAIKYMRRVLNESKGCVAE  551

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
              +Y+HMRC AHI+NL+V D LK+   +++RVR  V+++R   S+L KF+  AE +   SK
Sbjct  552   GEYIHMRCAAHIINLIVGDGLKEIGTSIQRVRAAVKFIRCGTSRLVKFKKCAELAKVQSK  611


 Score = 43.9 bits (102),  Expect(3) = 7e-78, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RV +TTD+WT+    N+M VTAHFID EW
Sbjct  456   RVCLTTDTWTAKNSQNFMCVTAHFIDNEW  484



>ref|XP_003617143.1| Oligoribonuclease [Medicago truncatula]
Length=1551

 Score =   187 bits (474),  Expect(3) = 8e-78, Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 164/306 (54%), Gaps = 33/306 (11%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I+ K+++  D PTRWNSTYLML+SAL +QK F         + + L   +P ++DW++  
Sbjct  1264  IQDKSTVQYDCPTRWNSTYLMLESALKFQKAFKRLGEKCVEY-AMLEGGVPNNVDWDNAK  1322

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV---EADGAVKLMGANMKA  1478
               VK LK F+E+T ++SGS YVT++T+F E   +    N  +   + D  +  M   M A
Sbjct  1323  CFVKFLKLFFEITKKVSGSTYVTSSTYFMEHCKILGGFNAWMGCHKDDPILANMATKMTA  1382

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYD  1298
             K+ KY GD+ KMN ++F A I  PR K +++   L   Y  +      +K+  ALN++++
Sbjct  1383  KYSKYWGDVAKMNMLVFIAVIFYPRRKFQFINWGLNKYYEKEVADSLCDKVKEALNKMFE  1442

Query  1297  DYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELE  1118
              Y+   +   V                               Q +K   +     + E++
Sbjct  1443  SYSRFSNKEDV-----------------------------DDQFEKDMDQDPNLSQTEVD  1473

Query  1117  YYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDH  938
              YLSE   +    FDIL WWKVNS ++P L  IARDILA+PISTVASESAFS  GRVL  
Sbjct  1474  IYLSEPREKKNPDFDILNWWKVNSTKYPTLGLIARDILAMPISTVASESAFSTGGRVLSC  1533

Query  937   FRSSLT  920
             +RSSLT
Sbjct  1534  YRSSLT  1539


 Score =   102 bits (253),  Expect(3) = 8e-78, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHKGE I    E CL  W +  VFT+TVDNASSND+A+ +LK ++  W S  +K
Sbjct  1146  NFCPITSHKGEVIGKKFEKCLEGWMIDKVFTITVDNASSNDLAISYLKNRMEDWNSHPLK  1205

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDI  1921
              ++LH+RC AHILNLVV D LK  D+
Sbjct  1206  GEHLHVRCCAHILNLVVGDGLKSKDM  1231


 Score = 53.5 bits (127),  Expect(3) = 8e-78, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             Q V +TTD+WTS+Q INYMV+TAHFID++W
Sbjct  1109  QSVCLTTDTWTSVQNINYMVLTAHFIDQDW  1138



>gb|EEE50486.1| hypothetical protein OsJ_30552 [Oryza sativa Japonica Group]
Length=690

 Score =   201 bits (510),  Expect(3) = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/334 (39%), Positives = 176/334 (53%), Gaps = 40/334 (12%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL----GDSIPTSLDW  1661
             ++ K  L LD+ TRWNSTYLML +A  YQK F+ Y   D  +K +L    G  +PT  DW
Sbjct  366   VQSKAFLNLDICTRWNSTYLMLNAAEKYQKAFERYSDEDPYYKLELEGENGPGVPTRADW  425

Query  1660  ESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANM  1484
             E    +   L+ FY++T+R+S     T++T+F EI+D+  +L E   + D   K MG  M
Sbjct  426   EKARKMADFLEHFYDLTLRVSVQSRTTSHTYFHEIADVLLLLREWSHSEDKLSKEMGTRM  485

Query  1483  KAKFEKY*GDI--------------DK----MNYMIFFANILDPRDKLEYMPTQLVH-MY  1361
               K+ KY G+               DK    +N+ +FF   +DPR KL       +  M+
Sbjct  486   LMKYYKYWGEKYGERQGDREKRGEKDKGDQLLNFTVFFCVAIDPRYKLSNCIRMGIKVMF  545

Query  1360  GDKKGKDYLEKLLAALNELYDDYAVSYSPS--VVPATGSGSVASVNLVVEFVFTPVGRPQ  1187
             GD  G+   E +      L+++Y   Y+P       T S S A  +  V   +  V    
Sbjct  546   GDTVGEKVWETVNTYFRALFEEYKEMYTPKDKAPQPTESESTAETSKRVSCRWMSV----  601

Query  1186  HLLKAQIKKQRMELLGGK---KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIA  1016
                      Q++   GG    K E++ YLSE    D   FDIL+WWK NS RFPILS +A
Sbjct  602   -------ITQQLNSEGGSGTIKSEVDKYLSEDNEPDTPKFDILKWWKANSTRFPILSHLA  654

Query  1015  RDILAIPISTVASESAFSISGRVLDHFRSSLTPK  914
             RD+LAIPI++VASESAFS  GR LD FR+SLTPK
Sbjct  655   RDLLAIPITSVASESAFSAGGRTLDDFRTSLTPK  688


 Score = 96.7 bits (239),  Expect(3) = 1e-77, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
              F  VK H+GE I  +LE+CL EWG+  VFT+TVDNAS+N+ A+ +++R +        +
Sbjct  250   GFFFVKGHRGEDIGKSLENCLAEWGIDKVFTITVDNASANNNAIKYMRRVLNESKGCVAE  309

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
              +Y+HMRC AHI+NL+V D LK+   +++RVR  V+++R   S+L KF+  AE +   SK
Sbjct  310   GEYIHMRCAAHIINLIVGDGLKEIGTSIQRVRAAVKFIRCGTSRLVKFKKCAELAKVQSK  369


 Score = 44.7 bits (104),  Expect(3) = 1e-77, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RV +TTD+WT+    N+M VTAHFID EW
Sbjct  214   RVCLTTDTWTAKNSQNFMCVTAHFIDNEW  242



>ref|XP_009590167.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
 ref|XP_009590169.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=417

 Score =   266 bits (680),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 149/335 (44%), Positives = 211/335 (63%), Gaps = 17/335 (5%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIP---------TSL  1667
             K  LCLDV TRWNSTY+ML +A  ++  FD Y + D      L   +          TS 
Sbjct  62    KRILCLDVSTRWNSTYMMLDTAQQFELAFDKYSFFDTRLLHHLRTYVCEDGTSAGDLTSA  121

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGA  1490
             DW++V  ++K L+ FY +T+R+SGS+YVT+N +F EI +L  IL E +E  D ++K M  
Sbjct  122   DWDNVRIMIKFLEAFYLLTLRVSGSIYVTSNVYFVEICELDLILKEWMEHEDASLKEMAK  181

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
              MK KF KY G+ +KMN MIF A+ILDPR+KL+Y+P  +V M+G+K+GK  + ++   ++
Sbjct  182   KMKEKFVKYWGEPEKMNNMIFIASILDPRNKLDYVPFAIVRMFGEKEGKKLILEVKNYMD  241

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG--  1136
              L+D Y    S     A+   + A+V+    F+     R     K + +K + E+ GG  
Sbjct  242   SLFDYYVKKNSKGSTSASSGNTTATVSGYGSFLKRGTMRT----KLEFEKHK-EVTGGLG  296

Query  1135  KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSIS  956
              K EL+ YL+E I  +   F IL+WWK+N  RF IL+++ARD+LAIPIS+VASE AFS  
Sbjct  297   AKSELDRYLAEDIEPETDEFKILKWWKINEPRFSILAEMARDVLAIPISSVASECAFSTG  356

Query  955   GRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             GR+LD FRSSLTPK+V++L+C QDWLR    PI +
Sbjct  357   GRILDSFRSSLTPKLVQSLICLQDWLRSEPIPIKV  391



>ref|XP_010530487.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Tarenaya hassleriana]
Length=784

 Score =   190 bits (483),  Expect(3) = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/352 (35%), Positives = 192/352 (55%), Gaps = 28/352 (8%)
 Frame = -2

Query  1843  RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD----NSFKSDLGDSI-  1679
             RV  GI  + SL LD  TRWNST+LML SAL Y++ F   E  D    + F+ D    I 
Sbjct  400   RVRSGIFSRGSLVLDCTTRWNSTFLMLTSALKYKETFRRMELEDKLYDDYFREDDESRIG  459

Query  1678  ------PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA  1517
                   P+  DW++   LV++L+ FYE T+  S +  VT++  ++EI  +  +L  ++ +
Sbjct  460   KKRNGPPSENDWDNAQRLVRVLRVFYESTLAFSATKKVTSSGCYNEILRVESVLATLMNS  519

Query  1516  -DGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK--KG  1346
              D  +  M  +MK K++KY    +K+N ++  A+  DPR K+ ++      +YG    K 
Sbjct  520   SDHNLSTMAESMKCKYDKYWEGTEKINKLLIIASAFDPRSKMTFITHCFEKLYGKDSVKA  579

Query  1345  KDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLK---  1175
              +    ++  L  L+D Y      S V  +GS  +++ ++ +  + T +     L K   
Sbjct  580   AEVKRNIMDVLRRLFDLYYTWSKASDVVESGSKHLSNGDINLCVIPTDLDLDIDLEKYDN  639

Query  1174  -----AQIKKQRMELLGGKKIELEYYLSEAITEDEGS-----FDILRWWKVNSARFPILS  1025
                  +Q+     ++  G   EL+ YL E +     +     FDIL WWK+NS +FPIL+
Sbjct  640   PFASFSQMIAHGGDV-EGSLTELDLYLMEKLEVVRSNNLSLEFDILLWWKINSGKFPILA  698

Query  1024  KIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRP  869
             ++A+DILA P+STVASE+AFS   R+LD +RSSL   +VEAL+ TQ+WL+ P
Sbjct  699   QMAKDILAFPVSTVASEAAFSTGCRILDQYRSSLNHDMVEALILTQNWLQYP  750


 Score = 99.4 bits (246),  Expect(3) = 2e-76, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 77/110 (70%), Gaps = 2/110 (2%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--V  2002
             F P+ +HKGE IAN LE CL +WG+  VFT+TVD+AS+ND A+  L++++ +W   +  +
Sbjct  289   FAPISNHKGETIANQLERCLKDWGVDKVFTITVDSASANDSAIKILRKRLSTWNDDTLVL  348

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
                ++HMRC AHILNL+V++ L     +V  +R  ++YVRSS S+L+ FR
Sbjct  349   NGDFMHMRCGAHILNLIVKEGLSDMGDSVISIRNAIKYVRSSDSRLQSFR  398


 Score = 47.8 bits (112),  Expect(3) = 2e-76, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+S+TTD WTSI  ++YMV+TAHFID  W
Sbjct  251   QRISLTTDIWTSITTVSYMVITAHFIDSTW  280



>ref|NP_001042140.2| Os01g0170400 [Oryza sativa Japonica Group]
 dbj|BAF04054.2| Os01g0170400 [Oryza sativa Japonica Group]
Length=664

 Score =   221 bits (563),  Expect(2) = 8e-76, Method: Compositional matrix adjust.
 Identities = 138/350 (39%), Positives = 187/350 (53%), Gaps = 40/350 (11%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL----GDSIPTSLDW  1661
             ++ K  L LD+ TRWNSTYLML +A  YQK F+ Y   D  +K +L    G  +PT  DW
Sbjct  220   VQSKAFLNLDICTRWNSTYLMLNAAEKYQKAFERYSDEDPYYKLELEGENGPGVPTRADW  279

Query  1660  ESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANM  1484
             E    +   L+ FY++T+R+S     T++T+F EI+D+  +L E   + D   K MG  M
Sbjct  280   EKARKMADFLEHFYDLTLRVSVQSRTTSHTYFHEIADVLLLLREWSHSEDKLSKEMGTRM  339

Query  1483  KAKFEKY*GDI--------------DK----MNYMIFFANILDPRDKLEYMPTQLVH-MY  1361
               K+ KY G+               DK    +N+ +FF   +DPR KL       +  M+
Sbjct  340   LMKYYKYWGEKYGERQGDREKRGEKDKGDQLLNFTVFFCVAIDPRYKLSNCIRMGIKVMF  399

Query  1360  GDKKGKDYLEKLLAALNELYDDYAVSYSPS--VVPATGSGSVASVNLVVEFVFTPVGRPQ  1187
             GD  G+   E +      L+++Y   Y+P       T S S A  +  V   +  V    
Sbjct  400   GDTVGEKVWETVNTYFRALFEEYKEMYTPKDKAPQPTESESTAETSKRVSCRWMSV----  455

Query  1186  HLLKAQIKKQRMELLGGK---KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIA  1016
                      Q++   GG    K E++ YLSE    D   FDIL+WWK NS RFPILS +A
Sbjct  456   -------ITQQLNSEGGSGTIKSEVDKYLSEDNEPDTPKFDILKWWKANSTRFPILSHLA  508

Query  1015  RDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPN  866
             RD+LAIPI++VASESAFS  GR LD FR+SLTP++VE LVC  DWLR  N
Sbjct  509   RDLLAIPITSVASESAFSAGGRTLDDFRTSLTPRMVERLVCANDWLRGGN  558


 Score = 92.8 bits (229),  Expect(2) = 8e-76, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 77/114 (68%), Gaps = 0/114 (0%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHM  1981
              H+GE I  +LE+CL EWG+  VFT+TVDNAS+N+ A+ +++R +        + +Y+HM
Sbjct  110   GHRGEDIGKSLENCLAEWGIDKVFTITVDNASANNNAIKYMRRVLNESKGCVAEGEYIHM  169

Query  1980  RCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
             RC AHI+NL+V D LK+   +++RVR  V+++R   S+L KF+  AE +   SK
Sbjct  170   RCAAHIINLIVGDGLKEIGTSIQRVRAAVKFIRCGTSRLVKFKKCAELAKVQSK  223



>ref|XP_009768907.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=466

 Score =   220 bits (560),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/335 (41%), Positives = 191/335 (57%), Gaps = 17/335 (5%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL-----GDSIP----TSL  1667
             K SLCLDVPTR NSTYLML  A+ Y++   +Y   D      L      D  P    T  
Sbjct  107   KKSLCLDVPTRCNSTYLMLSRAIEYERAIKEYFDRDTDLSGYLMFDAISDRQPVGMLTRT  166

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGA  1490
             DW+ V  + + L+ FY +T+++S SLYVT+N  F EI  +   LN ++   D  +  M +
Sbjct  167   DWDDVKRISQFLEIFYNLTLKVSRSLYVTSNAHFLEIGQVAVYLNRLITTEDELLSEMTS  226

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
             +M   FEKY G+  KMN +IF A +LDP  K   +   L  ++GD+ G    +++   ++
Sbjct  227   SMWKFFEKYWGEPTKMNKVIFIACVLDPHYKFTTVSFVLKKIFGDE-GTIIEKEVHTYMS  285

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQ-HLLKAQIKKQRMELLG-G  1136
              L++ Y    S SV   TG G V++      F       P    L  +I+K +    G  
Sbjct  286   SLFNKYV---SKSVSKDTG-GKVSTSLPSSSFSTMETSTPGLGELLDEIRKHKAASGGVD  341

Query  1135  KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSIS  956
              K +LE YL+E    +   FDIL WWKVNS RFPIL+K+ARD+LAIPI +VA ES+FS  
Sbjct  342   SKTKLEKYLAEDPENERPDFDILAWWKVNSPRFPILAKMARDVLAIPILSVAYESSFSTG  401

Query  955   GRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             G +LD FRSSLTPK+VE LVC QDWL+  + P+++
Sbjct  402   GHILDQFRSSLTPKLVETLVCLQDWLQSESLPVNV  436


 Score = 93.2 bits (230),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 78/105 (74%), Gaps = 1/105 (1%)
 Frame = -3

Query  2118  LIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHILNLVVQDS  1939
             L EWGL+ +FTVTVDNASSNDV +  L  K+  WG++S+  ++L MRC++HI+NL+V+D 
Sbjct  9     LREWGLQKIFTVTVDNASSNDVTVEKLSDKLDDWGTNSMNGQHLQMRCMSHIVNLIVKDG  68

Query  1938  LKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKKHPCV  1804
             LK+  I++  VR  V+Y+R SP++L+KF++  E S+ + KK  C+
Sbjct  69    LKESGISIACVRYAVKYIRQSPARLRKFQECCE-SINIVKKSLCL  112



>ref|XP_009774458.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=436

 Score =   220 bits (560),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/333 (41%), Positives = 183/333 (55%), Gaps = 47/333 (14%)
 Frame = -2

Query  1813  SLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL-----GDSIP----TSLDW  1661
             SLCLDVPTRWNSTYLML  A+ Y++   +Y   D S    L      D  P    T  DW
Sbjct  109   SLCLDVPTRWNSTYLMLSRAIEYERAIKEYSDRDTSLSRYLMFDAISDGKPAGVLTRTDW  168

Query  1660  ESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANM  1484
             + V  + + L+ FY +T+++SGSLYVT+N  F EI  +   LN ++   D  +  M ++M
Sbjct  169   DDVKRIAQFLEIFYNLTLKVSGSLYVTSNANFLEIGQVVVYLNRLITTEDELLSEMASSM  228

Query  1483  KAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNEL  1304
               KFEKY G+  KMN +IF A +LDPR K     ++LV    D  GK       ++ + +
Sbjct  229   WKKFEKYWGEPIKMNKIIFIAYVLDPRYKFTTYVSKLVS--KDTGGKVSTSLPSSSFSTM  286

Query  1303  YDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG--KK  1130
                       +  P  G                        L  +I+K ++ + GG   K
Sbjct  287   ---------KTSTPGLGD-----------------------LLDEIRKHKV-VSGGVDSK  313

Query  1129  IELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGR  950
              +L+ YL E    +  +FDIL WWKVNS RFPIL+K+ARD+L IPIS+VASE AFS   R
Sbjct  314   TKLKKYLPEDPENERPNFDILVWWKVNSPRFPILAKMARDVLVIPISSVASERAFSTGWR  373

Query  949   VLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             +LD FR SLTPK+VE LVC QDWLR  + P++I
Sbjct  374   ILDQFRRSLTPKLVETLVCLQDWLRSESLPVNI  406


 Score = 92.4 bits (228),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  2118  LIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHILNLVVQDS  1939
             L EWGL+ +FTVTVDNASSNDV +  L  K+  WG++S+  ++LHMRC+AHI+NL+V+D 
Sbjct  9     LREWGLQKIFTVTVDNASSNDVTVEKLSDKLDDWGTNSINGQHLHMRCMAHIINLIVKDG  68

Query  1938  LKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             LK+  I++ RVR  VRY+R  P++L+KF++  E
Sbjct  69    LKESVISIARVRCAVRYIRQFPARLRKFQECCE  101



>ref|XP_009604433.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Nicotiana tomentosiformis]
Length=485

 Score =   263 bits (672),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 205/333 (62%), Gaps = 13/333 (4%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIP---------TSL  1667
             K +LCLDV T+WNSTY+ML +A  ++  FD Y + D      L   +          TS 
Sbjct  108   KRTLCLDVSTQWNSTYMMLDTAQQFELAFDKYSFFDTELLHHLRTYVCENGTSAGDLTSA  167

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGA  1490
             DW++V  +VK L+ FY +T+R+SGS+YVT+N +F +I +L  IL E +E  D ++K M  
Sbjct  168   DWDNVRTMVKFLETFYFLTLRVSGSIYVTSNVYFVQICELDLILKEWMEHEDASLKEMAK  227

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
              +K KF KY G+ +KMN MI  A+ILDP +KL+Y+P  +V M+G+K+G+  + ++   ++
Sbjct  228   KIKEKFVKYWGEPEKMNNMIIIASILDPSNKLDYVPFAIVRMFGEKEGEKLILEVKNYMD  287

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK  1130
              L+D Y    S     A+   +  +V     F+     R +  LK +  K+    LG K 
Sbjct  288   SLFDYYVKKISKGSTSASSGNTTTTVTGYGSFLKRGTMRTK--LKFEKYKEVTGGLGAKS  345

Query  1129  IELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGR  950
              EL+ YL+E I  +   F IL+WWK+N  RF IL+++ARD+L IPIS+VASE AFS  G 
Sbjct  346   -ELDRYLAEDIEPETDEFKILKWWKINEPRFSILAEMARDVLVIPISSVASECAFSTGGH  404

Query  949   VLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             +LD FRSSLTPK+V++L+C QDWLR    PI +
Sbjct  405   ILDSFRSSLTPKLVQSLICLQDWLRSEPIPIKV  437


 Score =   103 bits (257),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = -3

Query  2142  IANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHI  1963
             +A  + +CL++WGL+NVFT+TVDNASSNDV++  + +++ +WG+  +  K++++RC+AHI
Sbjct  1     MAAVITNCLLDWGLKNVFTITVDNASSNDVSIREVPKQLTTWGTKIMNGKHMYVRCMAHI  60

Query  1962  LNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKKHPCVLMCQQ  1789
             LNL+VQD LK+  +++KRVR+ VRY+R SP++++KF++  E     SK+  C+ +  Q
Sbjct  61    LNLIVQDGLKEIGVSIKRVRQDVRYIRLSPARIRKFKEYCESQKLTSKRTLCLDVSTQ  118



>ref|XP_007203401.1| hypothetical protein PRUPE_ppa021175mg, partial [Prunus persica]
 gb|EMJ04600.1| hypothetical protein PRUPE_ppa021175mg, partial [Prunus persica]
Length=598

 Score =   199 bits (507),  Expect(3) = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/329 (39%), Positives = 185/329 (56%), Gaps = 42/329 (13%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLG--DSIPTSLD-WESVN  1649
             K  +CLDV TRWNSTYLM+ +A+ ++KVFD     D  ++S  G  +  P + D W  + 
Sbjct  277   KKVVCLDVKTRWNSTYLMINAAMEFEKVFDRLLEHDPFYRSGSGCHEGGPINEDNWRKLR  336

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLY-CILNEMVEADGAVKLMGANMKAKF  1472
             +L   L+ FY +T RISGS Y+T+NT+F E++     +L +M   D  +  M   M  KF
Sbjct  337   SLHMFLEDFYLLTKRISGSHYITSNTYFDEVTQTKDMLLQQMGSNDVFLSSMAKKMNEKF  396

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELY---  1301
             EKY  +ID +N ++  + +LDPR KL+Y+           + +D +E+  + ++ LY   
Sbjct  397   EKY-CNIDALNPILIASIVLDPRYKLDYVTFWY-------RIEDCVERFKSMMSRLYLHY  448

Query  1300  -------DDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELL  1142
                    DD + + S SVV   G           E   + + R +H              
Sbjct  449   KSEATSLDDQSAN-SESVVANQGGNRSKK-----EMFRSKLKRKEH--------------  488

Query  1141  GGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
                  +L+ YLS+ I ++  +FD+L WWK   A +  L+ +ARD+L+IP+++VASESAFS
Sbjct  489   ADANNDLDKYLSDGIEDESPNFDVLVWWKGKYATYHALAIMARDVLSIPVTSVASESAFS  548

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
              +GRVLD FRSSLTP IVEALVCTQDWLR
Sbjct  549   TTGRVLDPFRSSLTPNIVEALVCTQDWLR  577


 Score = 86.7 bits (213),  Expect(3) = 3e-75, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMR  1978
             HKGE IA A+E+CL+EWG+  V T+T+DNA +ND  +  LK++        +  ++ H+R
Sbjct  165   HKGEVIAKAIENCLLEWGIEKVMTITLDNAKNNDTCVMDLKKRFNKRNMMLLGGQFFHVR  224

Query  1977  CIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             C AH++NLVV+D +++   T+KR+R  V+YVRSS S+L+ F+  A
Sbjct  225   CFAHVINLVVRDGIEEVKTTIKRLRRSVKYVRSSSSRLQMFKKCA  269


 Score = 47.4 bits (111),  Expect(3) = 3e-75, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+ ITTD WTS+Q + YM +TAHF+D++W
Sbjct  121   RICITTDLWTSVQNLGYMALTAHFVDKDW  149



>ref|XP_007213517.1| hypothetical protein PRUPE_ppa020692mg [Prunus persica]
 gb|EMJ14716.1| hypothetical protein PRUPE_ppa020692mg [Prunus persica]
Length=629

 Score =   182 bits (462),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/335 (34%), Positives = 181/335 (54%), Gaps = 34/335 (10%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKS------------DLGD  1685
             +++  ++ +DVPTRWN+TY ML+ A  Y++VF+   YS   F++                
Sbjct  284   MDKMANVPMDVPTRWNATYKMLEGAFKYRQVFEKMAYSCEVFQAYFLEEEKVKKVMVKRV  343

Query  1684  SIPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE--ADG  1511
               P   DW+     V  LK  Y+ T+++S +   T+   F E+  L   +   ++   + 
Sbjct  344   GPPKDDDWDKALAFVHFLKKIYDATLKLSATKTCTSPIIFLELVALQVQIEAKMKDPRNP  403

Query  1510  AVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLE  1331
              ++ + + MK KF+KY G  D +N +IF  N+LDPR KL+ +     ++  D + +D + 
Sbjct  404   TMQRVASLMKLKFDKYWGSFDVVNKLIFLGNVLDPRTKLQMLQISFGNLGADARKQDEIV  463

Query  1330  K-LLAALNELYDDY-AVSYSPSVVPATG-SGSVASVNLVVEFVFTPVGRPQHLLKAQIKK  1160
             K ++  LNELY++Y  V    + +        VA +   V+  F  +   Q L+  ++ K
Sbjct  464   KEVVKYLNELYNEYKGVGGDVTQIDEDEIDDEVAQIGDDVDVTFQLM---QQLISNEVDK  520

Query  1159  QRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVA  980
               M+         E  LS+        F++L WWK N  R+PILS++A+DI AIP STVA
Sbjct  521   YLMD-------PFESPLSK-------QFNLLNWWKGNQTRYPILSQVAKDIFAIPSSTVA  566

Query  979   SESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             +E+AFS+  R++D FRSSL PK+VEALVCT DWLR
Sbjct  567   TENAFSLGKRIVDPFRSSLHPKMVEALVCTSDWLR  601


 Score = 97.4 bits (241),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             SF  + SHKG  I   L++CL  WG+  VFT+TVDNAS+ND  + ++ + + +  +  + 
Sbjct  168   SFTKITSHKGIDIGKTLDACLTNWGVHKVFTITVDNASANDGVVEYMAQSLKAMNTLMLD  227

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              KYLH+RC  HILNL+V+D LK    +++ +R  V+++ SSP++L KFR+ A
Sbjct  228   GKYLHLRCARHILNLIVKDGLKDLSASIEGIRNCVKFIHSSPARLDKFREFA  279


 Score = 52.0 bits (123),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QRV ITTD+WTSIQ +NYMVVT HF+D +W
Sbjct  131   QRVRITTDTWTSIQNMNYMVVTIHFMDSDW  160



>ref|XP_006369762.1| hypothetical protein POPTR_0001s31105g [Populus trichocarpa]
 gb|ERP66331.1| hypothetical protein POPTR_0001s31105g [Populus trichocarpa]
Length=697

 Score =   179 bits (455),  Expect(3) = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/331 (37%), Positives = 180/331 (54%), Gaps = 31/331 (9%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVF-----DDYEYSDNSFKSDLGDSIPTSL-  1667
             IE K SLCLDV TRWNSTYLML++A  ++KVF      +  Y     + +  +  P  L 
Sbjct  359   IECKKSLCLDVATRWNSTYLMLEAAEKFEKVFVRLGEKEPRYMSYFLEGNKKNIGPPGLK  418

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGA  1490
             DWE+   LVK LK FY +T+R SGSL+VT+N+FF+E+  ++  L ++ +  D  +  M  
Sbjct  419   DWENTRTLVKFLKIFYMVTLRFSGSLHVTSNSFFNELIYMHTNLLQLCKNKDSILSGMAM  478

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
             NM  KFEKY G     N++++ AN+LDPR KL+Y+      +Y   K +    K+   L 
Sbjct  479   NMMLKFEKYWGCEVNQNFLLYVANVLDPRLKLKYVKFCFGDLYDYDKAQLLTNKVKDTLV  538

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK  1130
              LY+ Y +     V        V++++ V   V       +HL       Q ++ +  K 
Sbjct  539   SLYEFY-LKIDEVVDNNRHKQDVSAIDDVEVDVNALARFKRHL-------QEVDSVENKN  590

Query  1129  IELEYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
              E+E YL +   + ++   DIL WWK N+ ++  LSK+A+ +LAIPISTVASESAFS + 
Sbjct  591   -EVERYLIDGCEDPNDDKLDILGWWKSNALKYKTLSKVAQHVLAIPISTVASESAFSTA-  648

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLRRPNTP  860
                           V+AL+C Q+WL   + P
Sbjct  649   -------------TVQALICCQNWLHHGSIP  666


 Score = 99.0 bits (245),  Expect(3) = 2e-74, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H GE I   +E+CL+EWG+  + T+T+DNASSN+V + +LK  +  W ++ + 
Sbjct  243   NFCQVSNHMGETIGQVIENCLLEWGIDKLLTITLDNASSNNVTISYLKNVMKDWPTNILS  302

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +++LH+RC AHI+NL+V D LK+ D+++ ++R  +R+VRSSPS+   F+  AE
Sbjct  303   NEHLHVRCCAHIVNLIVCDGLKEIDVSIVKIRNAIRFVRSSPSRHLAFKKCAE  355


 Score = 52.0 bits (123),  Expect(3) = 2e-74, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ +TTD+WTSIQ INYM +TAH+ID++W
Sbjct  206   QRLCLTTDTWTSIQNINYMCLTAHWIDDDW  235



>ref|XP_010548831.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Tarenaya hassleriana]
Length=900

 Score =   193 bits (491),  Expect(3) = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/362 (36%), Positives = 196/362 (54%), Gaps = 35/362 (10%)
 Frame = -2

Query  1876  SFKVEEI*GFGRV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKS  1697
             SFK  E  G G+   G     SL LD  TRWNST+LML SAL Y++ F+  E  D  +++
Sbjct  335   SFKSRE--GSGKFTRG-----SLVLDCTTRWNSTFLMLTSALKYRETFERMEVEDKLYEA  387

Query  1696  DLGD-----------SIPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISD  1550
                +             P+  DW++   LV +LK FY+ T+  S +  VT++  ++EI  
Sbjct  388   YFHEDDESRSSKKRIGPPSESDWDNARRLVHILKVFYDSTLVFSATKKVTSSGCYNEILR  447

Query  1549  LYCILNEMVE-ADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQL  1373
             +  +L  +++ +D  +  M  +MK K++KY    +K+N ++  A + DPR K+ ++    
Sbjct  448   VESVLASLIDNSDQNLSTMAKSMKWKYDKYWEGTEKINKLLIIAAVFDPRSKMSFVTHCF  507

Query  1372  VHMYGDKKGK-DYLEKLLA-ALNELYDDYAVSYSPSVVPATGS--GSVASVNLVV----E  1217
               +YG    K D ++K +   L  L+D Y   Y    V  +GS   SV +  L V    +
Sbjct  508   EKIYGKDNAKCDEMKKSVTDVLRRLFDSYHTWYKTPSVAESGSEYRSVGNTELYVVPTND  567

Query  1216  FVFTPVGRPQHLLKAQIKKQRMELLG---GKKIELEYYLSEAITEDEGS-----FDILRW  1061
              +   +G  ++        Q M  +G   G   EL+ YL E +     +     FDIL W
Sbjct  568   DIDLGIGYEKYDNLFASFSQMMADVGDIEGSLSELDLYLMEKVEVARSNNLNMEFDILTW  627

Query  1060  WKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDW  881
             WK++S +F IL+++ARDILA P+STVASES FS  GR+LD +RSSLTP +VEALV +Q+W
Sbjct  628   WKMHSGKFSILAQMARDILAFPVSTVASESVFSTGGRILDQYRSSLTPDMVEALVLSQNW  687

Query  880   LR  875
             LR
Sbjct  688   LR  689


 Score = 89.7 bits (221),  Expect(3) = 3e-74, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKV--LSWGSSS  2005
             SF P+ +HKGE IA   E CL +WG+  VFT+TVD+AS+ND A+  LK ++  ++  +  
Sbjct  227   SFRPISNHKGETIARQFEKCLNDWGIDKVFTITVDSASANDSAIRLLKHRLSFVNVNTLV  286

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
             +  +YLHMRC AHILNL+V++ L     +V  +R  ++YVRSS ++L+ F+
Sbjct  287   LNGEYLHMRCGAHILNLIVKEGLSDMGDSVIGIRNAIKYVRSSDARLQSFK  337


 Score = 47.0 bits (110),  Expect(3) = 3e-74, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QRVS TTD WTSI  ++YMVVTAHFID  W
Sbjct  190   QRVSFTTDIWTSITTVSYMVVTAHFIDISW  219


 Score = 73.9 bits (180),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 5/72 (7%)
 Frame = -2

Query  1138  GKKIELEYYLSEAITEDEGS-----FDILRWWKVNSARFPILSKIARDILAIPISTVASE  974
             G   EL+ YL E I     +     FDIL WWK++S +FPIL+++ARDILA P+S VAS+
Sbjct  826   GSLSELDLYLMEKIEVARSNHLNTEFDILMWWKMHSGKFPILAQMARDILAFPVSAVASK  885

Query  973   SAFSISGRVLDH  938
             SAFS  G +LD 
Sbjct  886   SAFSTEGHILDQ  897



>ref|XP_009339459.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Pyrus x bretschneideri]
Length=813

 Score =   176 bits (445),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/359 (32%), Positives = 189/359 (53%), Gaps = 55/359 (15%)
 Frame = -2

Query  1825  EQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSF----KSDLGDSI-------  1679
             ++ +S+  DV TRWN+TY ML SA  +++VF    +  +SF    K ++   +       
Sbjct  358   DRMSSIPFDVVTRWNATYEMLNSAFKFKEVFSKMAFECDSFIAYFKEEVSKEVDGVTTKT  417

Query  1678  -----PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV--E  1520
                  P   DWE   +    LK FY+ T+ +S +L  T++   S +  L   + E +   
Sbjct  418   KRVGPPEVDDWERSMSFAHFLKKFYDATLTLSATLTPTSHLILSMVIALQVEIQEQILNA  477

Query  1519  ADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHM-YGDKKGK  1343
             ++  ++ +  + K KF+KY G I+K+N ++F A +LDPR K + + T L  + YG  K +
Sbjct  478   SNATLQSVATSTKLKFDKYWGHIEKVNPILFVAQVLDPRYKFDMLETNLEELGYGWDKIR  537

Query  1342  DYLEKLLAALNELYDDYA--------------------VSYSPSVVPATGSGSVASVNLV  1223
             +   ++   + ELY+ Y                     V    SVV     G +  +++ 
Sbjct  538   EEKVRVKGYVTELYNAYKEGVVLSSSSTSSTSSSATSNVEQRSSVVLDDVGGVIVDIDVA  597

Query  1222  VEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYLS---EAITEDEGSFDILRWWKV  1052
                        + + + + + Q+ E+      E++ Y +   +++T +   F++L WWK 
Sbjct  598   SRMT-------KKIQRKRAEAQQNEIAN----EVDMYFNDPHQSLTYE--GFNLLDWWKG  644

Query  1051  NSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             N A++P LSK+A+D+LA+P STVASE+AFS+ GRV+D FR+SLTPK VEALVCT DWLR
Sbjct  645   NCAQYPTLSKVAKDVLALPSSTVASENAFSLGGRVVDPFRTSLTPKPVEALVCTSDWLR  703


 Score = 99.4 bits (246),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +FV V SHKG+ I   LE CL +WG+  VF++TVDNAS+ND  + ++KR++ S G+  + 
Sbjct  241   NFVQVTSHKGDDIGRCLEVCLNDWGIDKVFSITVDNASANDTVIAYMKRRLKSNGTLLLD  300

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRD  1849
               +LHMRC  HILNL+V+D + +    +  +R  V+++ SSP++L+ FR+
Sbjct  301   GAHLHMRCACHILNLIVKDGMTELSCEIDAIRNCVKFIHSSPARLESFRE  350


 Score = 53.5 bits (127),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RVSITTD+WTSIQ INYMV+TAHF+D  W
Sbjct  205   RVSITTDTWTSIQMINYMVITAHFLDTNW  233



>ref|XP_006369187.1| hypothetical protein POPTR_0001s18450g [Populus trichocarpa]
 gb|ERP65756.1| hypothetical protein POPTR_0001s18450g [Populus trichocarpa]
Length=620

 Score =   209 bits (533),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/324 (40%), Positives = 193/324 (60%), Gaps = 21/324 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSL-DWESV  1652
             I  K SLCLDV TR+NSTYLML++A  ++KVF     S+  +        P SL DWE+ 
Sbjct  296   IRCKKSLCLDVATRYNSTYLMLEAAEKFEKVFVRLGQSEPRYVR------PPSLEDWENA  349

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
               L+K LK FY +T++ SGSL+VT+N+FF+E+  ++  L ++ ++ D  +  M  NM +K
Sbjct  350   RTLLKFLKIFYMVTLKFSGSLHVTSNSFFNELIYMHTNLLQLCKSRDNLLSGMAMNMMSK  409

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             FEKY G     N++++ AN+LDPR KL+Y+      +Y   K +   +K+   L  +Y+ 
Sbjct  410   FEKYWGCGANQNFLLYVANVLDPRLKLKYVKFCFGELYDHDKAQLLTKKVRDNLVSMYEF  469

Query  1294  YAVSYSPSVVPATGSGSVASVNLV-VEFVFTPVGR-PQHLLKAQIKKQRMELLGGKKIEL  1121
             Y    +  VV         + ++  +E     + R  +HLL+    + R E+        
Sbjct  470   YL--KTDEVVDDNRHKQYVNDSIDDMEIDVNTLARFKRHLLEEDSVENRNEV--------  519

Query  1120  EYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVL  944
             E YL +   + ++   DIL WWK+N++++ ILSK+A+ +LAIPISTVASESAFS  GR+L
Sbjct  520   ERYLVDGCEDPNDDKLDILDWWKINASKYKILSKVAQHVLAIPISTVASESAFSTGGRIL  579

Query  943   DHFRSSLTPKIVEALVCTQDWLRR  872
             D FRSSL+P  V+AL+C Q+WL  
Sbjct  580   DQFRSSLSPATVQALICCQNWLHH  603


 Score = 70.5 bits (171),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H GE I   +E+CL++W +  + T TVDN SS+ V + +LK  V+  G   + 
Sbjct  195   NFCQVSNHIGETIGQVIENCLLDWEIDKLLTDTVDNTSSSSVTISYLK-NVMKIGQLILS  253

Query  1998  SKYLHMRCIAHILNLVVQDSLK  1933
             +++LH+RC AHI+NL+++++++
Sbjct  254   NEHLHVRCCAHIVNLIIRNAIR  275


 Score = 48.1 bits (113),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ +TTD+WTSIQ IN+M +TAH+ID EW
Sbjct  158   QRLCLTTDTWTSIQNINHMSLTAHWIDNEW  187



>ref|XP_006386826.1| hypothetical protein POPTR_0002s22610g [Populus trichocarpa]
 gb|ERP64623.1| hypothetical protein POPTR_0002s22610g [Populus trichocarpa]
Length=600

 Score =   199 bits (506),  Expect(3) = 7e-73, Method: Compositional matrix adjust.
 Identities = 131/340 (39%), Positives = 186/340 (55%), Gaps = 25/340 (7%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDY------------EYSDNSFKSDLGD  1685
             I+ K SLCLDV TRWNSTYLML++   ++KVF               E      K ++G 
Sbjct  242   IKCKKSLCLDVATRWNSTYLMLEAVEKFEKVFVRLGEKEPRYMSYFLEVDSKGNKKNIGP  301

Query  1684  SIPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAV  1505
               P   DWE+   LVK LK FY +T+R SGSL+VT+N FF+E+  ++  L ++ +  G++
Sbjct  302   --PGLEDWENARTLVKFLKIFYMVTLRFSGSLHVTSNAFFNELIYMHTNLLQLCKNKGSI  359

Query  1504  -KLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEK  1328
                M  NM  KFEKY G     N++++ A +LDP  KL+YM      +Y   K +    K
Sbjct  360   LSGMAMNMMLKFEKYWGCEVNQNFLLYVAKVLDPCLKLKYMKFCFGDLYDYDKAQLLTNK  419

Query  1327  LLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRME  1148
             +   L  LY+ Y +     V        V +++ V   V T     +HL       Q ++
Sbjct  420   VKDTLVSLYEFY-LKIDEVVDNNRHKQDVNAIDDVEVDVNTLARFKRHL-------QEVD  471

Query  1147  LLGGKKIELEYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASES  971
              +  KK E+E YL +   + ++   DIL WWK N+ ++  LSK+A+ +LAI ISTVA ES
Sbjct  472   NMENKK-EVERYLIDGCEDPNDDKLDILGWWKSNALKYKTLSKVAQHVLAILISTVAFES  530

Query  970   AFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             AFS  GRVLD FRSSL+P  V+AL+C Q+WL   +    I
Sbjct  531   AFSTGGRVLDQFRSSLSPATVQALICCQNWLHHGSISTDI  570


 Score = 79.0 bits (193),  Expect(3) = 7e-73, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 73/113 (65%), Gaps = 13/113 (12%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H GE I   +++CL+EW +  + T+T+DNASSN++ + +LK            
Sbjct  139   NFCQVSNHMGETIGQVIKNCLLEWRIDKLLTITLDNASSNNMTISYLK------------  186

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
               +LH+RC AHI+NL+V D LK+ +++V ++R  +R+VRSSPS+   F+  AE
Sbjct  187   -NHLHVRCCAHIVNLIVCDGLKEINVSVVKIRNAIRFVRSSPSRHLAFKKCAE  238


 Score = 47.4 bits (111),  Expect(3) = 7e-73, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ +TTD+WTSIQ INYM +TA++ID +W
Sbjct  102   QRLCLTTDTWTSIQNINYMCLTAYWIDNDW  131



>emb|CAB82966.1| putative protein [Arabidopsis thaliana]
Length=705

 Score =   201 bits (512),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/341 (37%), Positives = 196/341 (57%), Gaps = 36/341 (11%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFD---------DYEYSDNSFKSDLGDSIPTSL  1667
             + S+ LD  TRWNSTYLML+SAL Y+  FD         D  + +        D  P ++
Sbjct  333   RGSVVLDCVTRWNSTYLMLKSALKYKVAFDRMADMDKPYDAWFKEVDSNKKKRDGPPMAI  392

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EADGAVKLMGA  1490
             DW++  ++V+ LK FY+ T+  S S+ VT+N  ++EI  +   + +M    D  ++ M +
Sbjct  393   DWDNARHMVRFLKAFYDSTLAFSSSIKVTSNGCYNEICKIQSSVQKMAFSQDSDLREMAS  452

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEY--MPTQLVHMYGDKKGKDYLEKLLAA  1316
              M AKF+KY    +K+N ++  A +LDPR K+ +     +L++  G+ K  +  E ++  
Sbjct  453   AMTAKFDKYWEGTEKINKILIVAGVLDPRRKMVFTMFSFELIYGKGNPKCVEMKELVMDV  512

Query  1315  LNELYDDYAVSYSPSVVPATGSGSVASV--------NLVVEFVFTPVGRPQHLLKAQI-K  1163
             L +L+D Y+V Y+ S +  + S    +V        N+ V+ +  P       LK  + K
Sbjct  513   LEKLFDIYSVRYATSNLQPSVSCDAENVTQVHQDFENMEVDNIDDP------FLKFMVAK  566

Query  1162  KQRMELLGGKKIELEYYLSEAI---TEDEGS--FDILRWWKVNSARFPILSKIARDILAI  998
             K  + ++     EL  YL + +   TE+     FD+L WWK NS+++PI+S +AR++LAI
Sbjct  567   KTSVAVVN----ELVKYLKDELHVTTENSLGLPFDLLDWWKTNSSKYPIMSLMAREVLAI  622

Query  997   PISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             P+S+VASESAFS  GR+LD +RS LTP +VEALV TQDWLR
Sbjct  623   PVSSVASESAFSTGGRILDQYRSCLTPDMVEALVLTQDWLR  663


 Score = 78.6 bits (192),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--  2005
             SF P+  HKG+ IAN     L +WG+  VF++TVDNAS+ND A   LK ++ +  S +  
Sbjct  213   SFSPIPDHKGKTIANQFLRSLDDWGIEKVFSITVDNASANDKANTVLKERLSNRNSDALM  272

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +   ++H+RC AHILNL+  + L+    ++  VR  V+YVR+S S+L+ F+   E
Sbjct  273   MNGDFMHIRCGAHILNLIANEGLEDISNSIVSVRNAVKYVRTSNSRLESFKRWVE  327


 Score = 44.3 bits (103),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             Q +S TTD WTSI  ++YMVVTAHFID +W
Sbjct  176   QAMSFTTDIWTSITTLSYMVVTAHFIDMDW  205



>ref|XP_007208187.1| hypothetical protein PRUPE_ppa020871mg [Prunus persica]
 gb|EMJ09386.1| hypothetical protein PRUPE_ppa020871mg [Prunus persica]
Length=691

 Score =   197 bits (501),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/346 (37%), Positives = 185/346 (53%), Gaps = 52/346 (15%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSL---------  1667
             K  +CLDV TRWNSTYLM+ +A+ ++KVFD     D  +++   +    S          
Sbjct  333   KKVVCLDVKTRWNSTYLMINAAMEFEKVFDRLLEHDPFYRTGFEEKKGGSGCHEGGPINE  392

Query  1666  -DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLY-CILNEMVEADGAVKLMG  1493
              DW  + +L   L+ FY +T RISGS Y+T NT+F E++     +L +M   D  +  M 
Sbjct  393   DDWRKLRSLHTFLEDFYLLTKRISGSHYITFNTYFDEVTQTKDMLLQQMGSNDVFLSSMA  452

Query  1492  ANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMP----------TQLVHMYGDKKGK  1343
               M  KFEKY  +ID +N ++  + +LDPR KL+Y+             L     DKK +
Sbjct  453   KKMNEKFEKY-CNIDALNPILIASIVLDPRYKLDYVTFWYRSYLDSDILLSEDEKDKKVE  511

Query  1342  DYLEKLLAALNELY----------DDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGR  1193
             D++E+  + ++ LY          DD + + S SVV   G           E   + + R
Sbjct  512   DWVERFKSMMSRLYLHYKSEATSLDDQSAN-SESVVANQGGNRSKK-----EMFRSKLKR  565

Query  1192  PQHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIAR  1013
              +H                    L+ YLS+ I ++  +FD+L WWK   A +  L+ +AR
Sbjct  566   KEH--------------ADANNYLDKYLSDGIEDESPNFDVLVWWKGKYATYHALAIMAR  611

Query  1012  DILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             D+L+IP+++VASESAFS +GRVLD FRSSLTP IVEALVCTQDWLR
Sbjct  612   DVLSIPVTSVASESAFSTAGRVLDPFRSSLTPNIVEALVCTQDWLR  657


 Score = 80.9 bits (198),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHM  1981
              HKGE IA A+E+CL+EWG+  V T+T+DNA +ND  +  LK++        +  ++ H+
Sbjct  237   PHKGEVIAKAIENCLLEWGIEKVMTITLDNAKNNDTCVMDLKKRFNKRNMMLLGGQFFHV  296

Query  1980  RCIAHILNLVVQDSLKQCDIT  1918
             RC AH++NLVV+D +++   T
Sbjct  297   RCFAHVINLVVRDGIEEVKTT  317


 Score = 46.2 bits (108),  Expect(3) = 2e-72, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+ ITTD WTS+Q + YM +TAHF+D++W
Sbjct  194   RICITTDLWTSVQNLGYMALTAHFVDKDW  222



>ref|XP_007212946.1| hypothetical protein PRUPE_ppa022011mg [Prunus persica]
 gb|EMJ14145.1| hypothetical protein PRUPE_ppa022011mg [Prunus persica]
Length=724

 Score =   196 bits (498),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/360 (37%), Positives = 187/360 (52%), Gaps = 66/360 (18%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDD------YEYSDNSFKSDLGDSIPTSL---  1667
             K  +CLDV TRWNSTYLM+ +A+ ++KVFD       +  S+   K +  D     L   
Sbjct  327   KKVVCLDVKTRWNSTYLMINAAMEFEKVFDRLLEHDPFYRSECELKKNKEDGSELGLKKK  386

Query  1666  ---------------DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLY-CIL  1535
                            DW  + +L   L+ FY +T RISGS Y+T+NT+F E++     +L
Sbjct  387   KGGSSCHERGPINEDDWRKLRSLHTFLEDFYLLTKRISGSHYITSNTYFDEVTQTKDMLL  446

Query  1534  NEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMP---------  1382
              +M   D  +  M   M  KFEKY  +ID +N ++  + +LDPR KL+Y+          
Sbjct  447   QQMGSNDVFLSSMAKKMNEKFEKY-CNIDALNPILIASIVLDPRYKLDYVTFWYRSYLDS  505

Query  1381  -TQLVHMYGDKKGKDYLEKLLAALNELY----------DDYAVSYSPSVVPATGSGSVAS  1235
                L     DKK +D++E+  + ++ LY          DD + + S SVV   G      
Sbjct  506   DILLSEDEKDKKVEDWVERFKSMMSRLYLHYKSEATSLDDQSAN-SESVVANQGGNRSKK  564

Query  1234  VNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWK  1055
                  E   + + R +H                   +L+ YLS+ I ++  +FD+L WWK
Sbjct  565   -----EMFRSKLKRKEH--------------ADANNDLDKYLSDGIEDESPNFDVLVWWK  605

Query  1054  VNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
                A +  L+ +ARDIL+IP+ +VASESAFS +GRVLD FRSSLTP IVEALVCTQDWLR
Sbjct  606   GKYATYHALAIMARDILSIPVISVASESAFSTAGRVLDPFRSSLTPNIVEALVCTQDWLR  665


 Score = 81.3 bits (199),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHM  1981
              HKGE IA A+E+CL+EWG+  V T+T+DNA +ND  +  LK++        +  ++ H+
Sbjct  224   PHKGEVIAKAIENCLLEWGIEKVMTITLDNAKNNDTCVMDLKKRFNKRNMMLLGGQFFHV  283

Query  1980  RCIAHILNLVVQDSLKQCDIT  1918
             RC AH++NLVV+D +++   T
Sbjct  284   RCFAHVINLVVRDGIEEVKTT  304


 Score = 47.0 bits (110),  Expect(3) = 2e-72, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+ ITTD WTS+Q + YM +TAHF+D++W
Sbjct  181   RICITTDLWTSVQNLGYMALTAHFVDKDW  209



>ref|XP_009762657.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=500

 Score =   253 bits (647),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 149/339 (44%), Positives = 204/339 (60%), Gaps = 20/339 (6%)
 Frame = -2

Query  1834  YGIEQ---KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDS-----I  1679
             + +EQ   K +LCLDVPTRWNSTYLML+ A+ ++  F  Y  S+   +  L  S     I
Sbjct  100   FDVEQLNSKKTLCLDVPTRWNSTYLMLRRAIEFECAFSHYASSEIGLRHYLEHSYIDVGI  159

Query  1678  PT----SLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EAD  1514
             PT    S DW++V  + K L+ FY +T++ISGS YVT+N  F EI  +   L +++   D
Sbjct  160   PTGELLSSDWDNVKRITKFLEIFYLLTLKISGSRYVTSNIHFLEICAVAVYLKQLIANED  219

Query  1513  GAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYL  1334
               +  M  NMK KF+KY GD  KMN +IF + ILDPR K+E +   LV M+G   G    
Sbjct  220   IVLSEMAKNMKEKFDKYWGDPGKMNKIIFISCILDPRYKIESVGFALVKMFGVDPGATIQ  279

Query  1333  EKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHL-----LKAQ  1169
              ++   +  L+ +Y  S S  VV A+ S   +S++     +       Q++     L   
Sbjct  280   AEVTKYMTSLFSEYVKSSSKGVVLASSS-DCSSLDTSTSGLSGSQASTQNIGLLESLMQD  338

Query  1168  IKKQRMELLG-GKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPI  992
             IKK +    G   + EL+ YL E   +D   FD+L WWK+NSARFPIL+++ARDILA+P+
Sbjct  339   IKKYKSGSGGVDTRTELDKYLGEETEDDTKEFDVLLWWKLNSARFPILAEMARDILAVPV  398

Query  991   STVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             S+VASE AFS  GR+LD FRSSLTPK+V+ALVC QDWLR
Sbjct  399   SSVASECAFSTGGRLLDSFRSSLTPKLVQALVCLQDWLR  437


 Score = 97.4 bits (241),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  2142  IANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHI  1963
             +AN +  CL EWG+  +FTVTVDNASSNDV +  L +++   G++ +   +LH+RC+AHI
Sbjct  1     MANGIGRCLREWGINKIFTVTVDNASSNDVTVKELSKQLTKMGTNLMNGTHLHVRCMAHI  60

Query  1962  LNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKKHPCV  1804
             +NLVVQD LK+  ++++RVR  VRYVR SP++LK+F++  +     SKK  C+
Sbjct  61    MNLVVQDGLKESSVSIERVRHAVRYVRQSPARLKRFKECFDVEQLNSKKTLCL  113



>ref|XP_007219583.1| hypothetical protein PRUPE_ppa023353mg, partial [Prunus persica]
 gb|EMJ20782.1| hypothetical protein PRUPE_ppa023353mg, partial [Prunus persica]
Length=510

 Score =   209 bits (531),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/337 (37%), Positives = 194/337 (58%), Gaps = 11/337 (3%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLG--DSIPTSLDWES  1655
             I+ K  + LDVPTRWNSTY+ML++AL ++K F   E  D  FKS  G  ++ P   DW +
Sbjct  143   IDCKGLVVLDVPTRWNSTYMMLEAALKFKKAFSRLEDEDGHFKSYFGRGNTPPVEEDWAN  202

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAV-KLMGANMKA  1478
                 VK LK FYE T+R S +L+ TA+T F ++  + C L E+   D  +   M  NMK 
Sbjct  203   DVVFVKFLKSFYEFTLRCSATLHATAHTTFHDLFAIDCELAELSVVDNPLLSNMAQNMKL  262

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKG-----KDYLEKLLAAL  1313
             K++KY G +D +N  +  A +LDPR KL+ +   +  +Y +           +  LL  L
Sbjct  263   KYDKYWGSLDSVNQFLLIAVVLDPRYKLDNLSMHIADLYVENNAYVAEKTAGVRDLLFKL  322

Query  1312  NELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPV---GRPQHLLKAQIKKQRMELL  1142
               LY+   VS       ++ + S    ++V +   +      R + + +   K+Q+ +  
Sbjct  323   YGLYEAGFVSNPTQSFSSSTTSSSIGSSIVTDSSNSSSFGGDRKKAMKEKWKKRQQEKEA  382

Query  1141  GGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
                  E++ YLS+A  +D   FDIL WW+VN++++P+L+ IARD+LAIP+STVASES FS
Sbjct  383   VVLSHEIDRYLSDAAEQDIEQFDILNWWRVNASKYPVLAVIARDVLAIPVSTVASESTFS  442

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
               GR ++ FRSSL+P +VEAL+ TQ+WL+  +  + +
Sbjct  443   TGGRTINSFRSSLSPAMVEALIYTQNWLKSTSISLQV  479


 Score = 58.2 bits (139),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 59/113 (52%), Gaps = 20/113 (18%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  +++HKG  I   +E CLI+WG+                     +  V   G   + 
Sbjct  47    NFCVIQNHKGRTIGRLIEKCLIDWGIE--------------------RMTVWPNGGLLLD  86

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
               +LHMRC AHI+NL+V D LK+   +VK +R+ V YVRSSP +L+ F+   E
Sbjct  87    GVHLHMRCCAHIVNLIVTDGLKELHNSVKSIRDAVMYVRSSPQRLETFKSCIE  139


 Score = 51.2 bits (121),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RV +TTD+WTS+Q +NYMV+TAHF+D++W
Sbjct  11    RVCLTTDTWTSVQNMNYMVLTAHFLDDDW  39



>ref|XP_006279844.1| hypothetical protein CARUB_v10028251mg [Capsella rubella]
 gb|EOA12742.1| hypothetical protein CARUB_v10028251mg [Capsella rubella]
Length=618

 Score =   196 bits (499),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/344 (39%), Positives = 188/344 (55%), Gaps = 31/344 (9%)
 Frame = -2

Query  1846  GRV*YGIEQKTSLCLDVPTRWNSTYLMLQSAL----------IYQKVFDDY--EYSDNSF  1703
             GRV  G     SL LDV TRWNSTYLML SAL          +  K++ DY  E  + + 
Sbjct  257   GRVCRG-----SLPLDVNTRWNSTYLMLSSALKLRVAFERMVVEDKLYCDYFEEVDEKTK  311

Query  1702  KSDLGDSIPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV  1523
                 G   PTS DW+   +LVK LK FY+ T+  S S  VT+   + EI D+   LN M 
Sbjct  312   AKRFGP--PTSSDWDEAVSLVKFLKVFYKSTLAFSASKTVTSTLCYKEIVDIERNLNYMC  369

Query  1522  EA-DGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYG--DK  1352
              +    +K+    M+ KFEKY   ++ MN ++   ++ DPR+K+ +       +YG   K
Sbjct  370   TSLVEDIKMQAYVMRDKFEKYWNGLNNMNSLVIVGSVFDPRNKMCFASLCFDQLYGKGSK  429

Query  1351  KGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKA  1172
             +GKD    +++A+  LY+ Y    S  +     + SV  V  + +      G     L +
Sbjct  430   RGKDVHAPVVSAMESLYEYYTSRLSQPIDITVPTTSVPIV--ITDISDDDDGEMMDSLYS  487

Query  1171  QIKKQRMELLGGKKIELEYYLSEAI-TEDEGS----FDILRWWKVNSARFPILSKIARDI  1007
             Q+   R   +G    EL+ YLSE      E +    +D+L WW+ NS++FPILS++AR I
Sbjct  488   QLVDVRRNEVGCS--ELQIYLSEKTEVRVENALGLPYDVLSWWRCNSSKFPILSELARVI  545

Query  1006  LAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             L I +S++ASESAFS SGRVLD +RSSLTP +VE L+CTQ WLR
Sbjct  546   LGIQVSSMASESAFSTSGRVLDSYRSSLTPYMVEVLICTQQWLR  589


 Score = 82.4 bits (202),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVAL-GFLKRKVLSWGSSSV  2002
             SF  V  HKGE IA  L  CL EWG+  +F+VTVDNA +ND AL  F  R  L  G S V
Sbjct  141   SFKVVTDHKGETIAGQLLDCLDEWGIDKIFSVTVDNAKNNDKALENFKDRTRLRGGESLV  200

Query  2001  -KSKYLHMRCIAHILNLVVQDSLKQCD  1924
                ++LHM C AHILNL+V D  K+ +
Sbjct  201   CDGEFLHMHCCAHILNLIVGDGFKKAN  227


 Score = 39.3 bits (90),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 23/31 (74%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
             QRVS TTD WTS     NYMV+TAH+ID +W
Sbjct  103   QRVSFTTDIWTSSTTSCNYMVITAHWIDVQW  133



>ref|XP_011078707.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=751

 Score =   142 bits (357),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 92/263 (35%), Positives = 139/263 (53%), Gaps = 20/263 (8%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLG----DSIPTSLDW  1661
             IE K  L LDVPTRWNSTYLML++A   ++ FD YE  D ++K+DL     D +P   DW
Sbjct  437   IETKKLLSLDVPTRWNSTYLMLEAATCLKRAFDAYEDIDLAYKNDLSKKPFDGVPIESDW  496

Query  1660  ESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADG-AVKLMGANM  1484
             +    L+K LK FY +T+ I GS YVT+N  F E+ ++  +L   + +D   +  M   M
Sbjct  497   DRAKMLLKFLKHFYNLTLCIFGSSYVTSNIVFYEVCEVDLLLRRWLHSDDIELSDMARKM  556

Query  1483  KAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYL-EKLLAALNE  1307
             K KF+KY G I+KMN ++++  ILDPR KL ++      +YG     D + E++   L+E
Sbjct  557   KEKFDKYWGSIEKMNMVLYYGVILDPRHKLGFVEFSFDKLYGGIGQNDVMKERVRDGLHE  616

Query  1306  LYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQR--------M  1151
             L++DY + Y  +     G+      +       +   +   +   + + +R        M
Sbjct  617   LFNDYKLRYGHAF---QGTLESPGSSSSRVSSSSSSSKEMFMHDQESETRRFSLQQKYMM  673

Query  1150  ELLGGK---KIELEYYLSEAITE  1091
              + GGK   K ELE YL E + E
Sbjct  674   YMTGGKDHVKSELEKYLGEDVEE  696


 Score =   117 bits (294),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 87/116 (75%), Gaps = 2/116 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+  HK E ++  +E CL+EWG+  +FT+TVDNASSND A+ +LK+K+ +WG + + 
Sbjct  321   NFCPIIGHKSEEVSRGVEKCLLEWGIDRIFTITVDNASSNDGAMVYLKKKLENWGQNILG  380

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCD--ITvkrvrevvryvRSSPSKLKKFRDLAEY  1837
              KY+HMRCIAHI+NLVVQD LK  D    + R+R  VRYVR+SP++ KKF++ AE+
Sbjct  381   GKYVHMRCIAHIMNLVVQDGLKGKDEHEAISRIRGAVRYVRNSPARYKKFQECAEF  436


 Score = 57.4 bits (137),  Expect(3) = 3e-70, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QRV ITTD+WTSIQ++NYM +TAHFID+EW
Sbjct  284   QRVCITTDTWTSIQKVNYMCLTAHFIDDEW  313



>ref|XP_006377251.1| hypothetical protein POPTR_0011s02940g [Populus trichocarpa]
 gb|ERP55048.1| hypothetical protein POPTR_0011s02940g [Populus trichocarpa]
Length=595

 Score =   216 bits (551),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/332 (39%), Positives = 194/332 (58%), Gaps = 18/332 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I  K S+CLDV TRWNSTY+ML +A  +  VF   E +D           P   DWE   
Sbjct  248   IRSKKSVCLDVATRWNSTYMMLDAADKFDVVFMRLEETD--------PRSPALEDWEKAR  299

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAKF  1472
             + +K LK FY +T++  GSLYVT+N+ F E+  ++  ++++  + D  V  M  NM AK+
Sbjct  300   SFIKFLKLFYTVTLKFFGSLYVTSNSLFHEMISMHTSISQLCRSKDVYVSNMAKNMIAKY  359

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY GD D  N++++ A +LDPR KL+Y+      +Y  ++ +++  K+   L  L++ Y
Sbjct  360   KKYWGDQDTQNFLLYVAIVLDPRFKLKYVRFCFGRLYDVEEAENFTIKVKDTLLRLFEHY  419

Query  1291  A-VSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRME--LLGGKKIEL  1121
               V  +  VVP+ G+   A+VN+ +  V   +      L +Q KK   E   +  KKIE+
Sbjct  420   MNVDENVEVVPSVGTSINANVNVDLTVVNDDMLDD---LASQFKKHLEEEGCVQKKKIEV  476

Query  1120  EYYLSEAITEDEGSF--DILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRV  947
             + YL +   ED   F  DIL WW+ N+ ++ IL K+A+ +LAIP+STV SE+AFS  GR 
Sbjct  477   KRYLGDD-CEDPNDFKLDILGWWRCNATKYKILFKVAQHVLAIPVSTVVSEAAFSTGGRR  535

Query  946   LDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             LD FRSSL+P  V+ LVC Q+WL     PI+I
Sbjct  536   LDPFRSSLSPSTVQTLVCYQNWLSLAPIPINI  567


 Score = 79.0 bits (193),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 74/125 (59%), Gaps = 14/125 (11%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +HKGE I  A++SCL+EWG+  + TVTVDNASSN++ + +LKR           
Sbjct  146   NFCQVSNHKGETIGQAIKSCLLEWGIDKILTVTVDNASSNNLTIKYLKR-----------  194

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSK  1819
                + + C AHI+NL+V   LK  D  V ++R  VR+VRSSPS+   F   A+     SK
Sbjct  195   ---ITIGCCAHIVNLIVCAGLKDIDDLVVKIRNAVRFVRSSPSRQLDFNQCAKRLKIRSK  251

Query  1818  KHPCV  1804
             K  C+
Sbjct  252   KSVCL  256



>ref|XP_007227215.1| hypothetical protein PRUPE_ppa018881mg, partial [Prunus persica]
 gb|EMJ28414.1| hypothetical protein PRUPE_ppa018881mg, partial [Prunus persica]
Length=714

 Score =   184 bits (466),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/350 (35%), Positives = 183/350 (52%), Gaps = 76/350 (22%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVF----DDYE------YSDNSFKSDLGDSI  1679
             IE K  + LDVPTRWNSTY+ML+++L ++K F    +D E      + +N  + D+ D +
Sbjct  381   IECKGLVVLDVPTRWNSTYMMLEASLKFEKAFWRMGEDDEGPYISWFGEN--EPDVEDVV  438

Query  1678  ------------PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFF-------SEI  1556
                         PT+ DW +    V  LK FY+ T+++S +L+  ++T F        EI
Sbjct  439   VMSHYPRKREGPPTNEDWNNARTFVNFLKVFYDATLKMSVTLHPASHTTFHDLIAMEEEI  498

Query  1555  SDLYCILNEMV---EADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYM  1385
              DL     E++   +    +K M  NMK KF+KY GD+DK+N ++  A +LDPR KL  +
Sbjct  499   EDLLMEEEEILSETQTSKVLKDMALNMKMKFKKYWGDLDKLNQILMVALVLDPRYKLGNL  558

Query  1384  PTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFT  1205
                L   + +      LE  +   NE+ +     Y      A          +V+E    
Sbjct  559   EFILKSRFEN------LEDAVKKKNEIKEILKKLYEEKETRANDV-------VVLEH---  602

Query  1204  PVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILS  1025
                                       E++ Y+++ I +    FD+L+WWK+N  ++P L+
Sbjct  603   --------------------------EIDRYITDPIEDVVDEFDVLKWWKLNGVKYPGLA  636

Query  1024  KIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
              IA+D+LAIP+STVASES FS  GRV++ FR+SLTPKIVEAL+C+Q+WLR
Sbjct  637   LIAKDVLAIPVSTVASESCFSTGGRVINSFRASLTPKIVEALICSQNWLR  686


 Score = 97.4 bits (241),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 79/111 (71%), Gaps = 2/111 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--  2005
             +F  + +HKG  I   LESCL++W ++ + T+T DNASSN  A+ +LK K+  WG+ S  
Sbjct  263   NFCVISNHKGNSIGKLLESCLLDWDMKKILTITADNASSNTKAIDYLKSKMGHWGNGSLL  322

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
             ++ KY+H+RC AHI+NL+V+D LK+ + ++  +R  V+YVRSSP +L+ F+
Sbjct  323   LEGKYMHIRCCAHIVNLIVRDGLKKLEKSILCIRNAVKYVRSSPKRLEDFK  373


 Score = 32.7 bits (73),  Expect(3) = 2e-69, Method: Composition-based stats.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -1

Query  2240  INYMVVTAHFIDEEW  2196
             INYMV+TAHFID +W
Sbjct  241   INYMVITAHFIDGDW  255



>ref|XP_006384349.1| hypothetical protein POPTR_0004s13680g [Populus trichocarpa]
 gb|ERP62146.1| hypothetical protein POPTR_0004s13680g [Populus trichocarpa]
Length=560

 Score =   200 bits (509),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 134/341 (39%), Positives = 185/341 (54%), Gaps = 27/341 (8%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDY------------EYSDNSFKSDLGD  1685
             IE K SLCLDV  RWNSTYLML++A  ++KVF               E      K ++G 
Sbjct  213   IECKKSLCLDVAARWNSTYLMLEAAEKFEKVFVRLGEKEPRYMSYFLEVDSKGNKKNIGP  272

Query  1684  SIPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAV  1505
               P   DWE+   LVK LK FY + +R SGSL+VT+N FF+E+  +   L ++ +  G++
Sbjct  273   --PGLEDWENARTLVKFLKIFYMVKLRFSGSLHVTSNAFFNELIYMLTNLLQLCKNKGSI  330

Query  1504  -KLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEK  1328
                M  NM  KFEKY G     N++++ AN+LDPR KL+Y+      +Y   K +    K
Sbjct  331   LSGMAMNMMLKFEKYWGCEVNQNFLLYVANVLDPRLKLKYVKFCFGDLYAYDKAQLLTNK  390

Query  1327  LLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGR-PQHLLKAQIKKQRM  1151
             +   L  LY+ Y       VV         +V   VE     + R  +HL       Q +
Sbjct  391   VKDTLVSLYEFYL--KVDEVVDNNRHKQDVNVIDDVEVDVNTLARFKRHL-------QEV  441

Query  1150  ELLGGKKIELEYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASE  974
             + +  K  E+E YL +   + ++   DIL WWK N  ++  LSK+A+ +LAIPISTVASE
Sbjct  442   DNVENKN-EVERYLIDGCEDPNDDKLDILGWWKSNVLKYKTLSKVAQHVLAIPISTVASE  500

Query  973   SAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             SAFS  GRVLD FRSSL+   V+AL+C Q+WL   + P  I
Sbjct  501   SAFSTGGRVLDQFRSSLSLATVQALMCCQNWLHYGSIPTDI  541


 Score = 90.9 bits (224),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H GE I   +E+CL+EWG+  + T+T+DNASSN+V + +LK  +  W ++ + 
Sbjct  114   NFCQVSNHMGETIGQVIENCLLEWGIDKLLTITLDNASSNNVTISYLKNVMKDWPTNILS  173

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDIT  1918
             +++LH+RC AHI+NL+V D LK+ +I+
Sbjct  174   NEHLHVRCCAHIVNLIVCDGLKEINIS  200



>ref|XP_010266972.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
Length=399

 Score =   175 bits (444),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/269 (39%), Positives = 160/269 (59%), Gaps = 20/269 (7%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSD--LGDSIPTSLDWES  1655
             I+ K+ L L+V TRWNSTYLML +A  +++VF+ +E  D+ F+S+  + D IPT  DWE+
Sbjct  133   IQSKSLLYLNVSTRWNSTYLMLDAAQKFERVFERFEDHDSQFRSEFEMEDGIPTCFDWEN  192

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA-VKLMGANMKA  1478
             V  LV  L+ FY + +R+SGSLYVT+N F  EI+ + C+L + V +D   ++ M   MK 
Sbjct  193   VRRLVLFLQYFYNLIVRVSGSLYVTSNNFVHEINVVKCLLQKWVNSDDKNLREMAKRMKG  252

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYD  1298
             K++KY G+I+KMN +I+   +LDPR KLEY+   L   Y   KG ++ +++  AL ELY+
Sbjct  253   KYDKYWGNIEKMNKLIYITIVLDPRHKLEYVEFVLNETYQCAKGHEFAKRVREALYELYN  312

Query  1297  DYAVSYSPSVVPATGSGSVASVNLVVEFVFTPV--GRPQH------LLKAQIKKQRMELL  1142
             +Y   ++P       SGS  ++  V   + + +   +PQ       L  +Q KK +    
Sbjct  313   EYKSMFAPQ------SGSGQTIENVKCSILSEIESEQPQQSQAKKILTMSQFKKYKSVSR  366

Query  1141  GG-KKIELEYYLSEAITEDEGS--FDILR  1064
             GG  K EL+ YL+E     +G+  FDI +
Sbjct  367   GGDAKSELDKYLNEDTKHGQGNDDFDIFK  395


 Score =   115 bits (287),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SH+GE I  A+E CLIEW +  VFT+TVDNASSN+VA+ +LKRK+ +W +  + 
Sbjct  17    NFCPISSHRGEAIGKAVEKCLIEWEIDKVFTITVDNASSNNVAITYLKRKISNWETYILD  76

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
              K LHMRCIAHI+NLVV D LK+   ++   RE VRYVR S ++L+KF++  +
Sbjct  77    VKLLHMRCIAHIINLVVNDGLKEMGKSISCAREAVRYVRQSSARLQKFKEFVK  129



>ref|XP_007224939.1| hypothetical protein PRUPE_ppa021590mg [Prunus persica]
 gb|EMJ26138.1| hypothetical protein PRUPE_ppa021590mg [Prunus persica]
Length=641

 Score =   177 bits (449),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/340 (34%), Positives = 172/340 (51%), Gaps = 79/340 (23%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDD------YEYSDNSFKSDLGDSIPTSL---  1667
             K  +CLDV TRWNSTYLM+ +A+ ++KVFD       +  S+   K +  D     L   
Sbjct  333   KKVVCLDVKTRWNSTYLMINAAMEFEKVFDRLLEHDPFYRSECELKKNKEDGSELGLNKK  392

Query  1666  ---------------DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLY-CIL  1535
                            DW  + +L   L+ FY +T RIS S Y+T+NT+F E++     +L
Sbjct  393   KGGSGCHEGGPINEDDWRKLRSLHTFLEDFYLLTKRISSSHYITSNTYFDEVTQTKDMLL  452

Query  1534  NEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGD  1355
              +M   D  +  M   M  KFEKY  +ID +N ++  + +LDPR KL             
Sbjct  453   QQMGSNDVFLSSMAKKMNEKFEKY-CNIDALNPILIASIVLDPRYKL-------------  498

Query  1354  KKGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLK  1175
                                DY   +  S + + G+ S                  + + +
Sbjct  499   -------------------DYVTFWYRSYLDS-GNRS-----------------KKEMFR  521

Query  1174  AQIKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIP  995
             +++K++          +L+ YLS+ I ++  +FD+L WWK   A +  L+ +ARD+L+IP
Sbjct  522   SKLKRKEH---ADANNDLDKYLSDGIEDESPNFDVLVWWKGKCATYHALAIMARDVLSIP  578

Query  994   ISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             +++VASESAFS +GRVLD FRSSLTP IVEALVCTQDWLR
Sbjct  579   VTSVASESAFSTAGRVLDPFRSSLTPNIVEALVCTQDWLR  618


 Score = 87.0 bits (214),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMR  1978
             HKGE IA A+E+CL+EWG+  V T+T+DNA +ND  +  LK+++       +  ++ H+R
Sbjct  221   HKGEVIAKAIENCLLEWGIEKVMTITLDNAKNNDTCVMDLKKRLNKRNMMLLGGQFFHVR  280

Query  1977  CIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             C AH++NLVV+D +++   T+KR+R  V+YVRSS S+L+ F+  A
Sbjct  281   CFAHVINLVVRDGIEEVKTTIKRLRRSVKYVRSSSSRLQMFKKCA  325


 Score = 46.6 bits (109),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+ ITTD WTS+Q + YM +TAHF+D+ W
Sbjct  177   RICITTDLWTSVQNLGYMALTAHFVDKNW  205



>ref|XP_007202913.1| hypothetical protein PRUPE_ppa016147mg, partial [Prunus persica]
 gb|EMJ04112.1| hypothetical protein PRUPE_ppa016147mg, partial [Prunus persica]
Length=633

 Score =   160 bits (405),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/346 (35%), Positives = 177/346 (51%), Gaps = 60/346 (17%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKS-------DLGDSI---  1679
             I+ K  L L+  TRWNS YLML++AL  Q+ FD  E     + S       D  D I   
Sbjct  274   IDSKALLPLECKTRWNSVYLMLEAALKLQRGFDKLEEEVTDYVSYFHQSGGDRDDGILKK  333

Query  1678  -----------------PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISD  1550
                              PT+ DWE            Y+M         VT+N  F+E+  
Sbjct  334   KKRKVQEGEICTKKKKPPTTADWEYARAFANA----YKM---------VTSNIPFNEMLS  380

Query  1549  LYCILNEM-VEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQL  1373
             +   LN M V  D  +K +  +MK KF+KY G+I ++N ++    +LDPR K+ Y+    
Sbjct  381   IVDELNAMIVSEDIFLKKVATSMKKKFDKYWGNIQEVNQVLIVVVVLDPRYKMNYIQ---  437

Query  1372  VHMYGDKKGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGR  1193
              + + + + KD L ++  A  ++         P+ V +T   +V S   V          
Sbjct  438   -YSFDELEMKDLLMRMYEAYKKV--------EPAAVQSTAEANVESGGEVR----VECND  484

Query  1192  PQHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDE-GSFDILRWWKVNSARFPILSKIA  1016
             P+    A+ +K R  ++   K E++ YL EA  + E  +FD+L WW+ NS RFP+LSKIA
Sbjct  485   PRLKKFARTRKDR--VVVQIKNEVDKYLLEAAQDPEIANFDLLDWWRENSPRFPVLSKIA  542

Query  1015  RDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWL  878
             RD+ A+P+S+V  E+AFS+  RV+D FR+ LTPK +EALVCT+DWL
Sbjct  543   RDVFAVPVSSVPLEAAFSMGKRVVDPFRAYLTPKTIEALVCTKDWL  588


 Score = 96.3 bits (238),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  + +H+GE I   +E CL +WG+  VFT+T+DNA++ND  +  +KR++  WG+  + 
Sbjct  160   NFCQITNHRGEAIGRLVEDCLHDWGIDKVFTITLDNATANDGTIRHMKRQLKLWGTLLLD  219

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
                LHMRC AHILNL+V D L +   ++K +R+   Y RSSPS+L KFR
Sbjct  220   GDCLHMRCCAHILNLIVFDGLSELHDSIKSIRKACVYTRSSPSRLDKFR  268


 Score = 53.9 bits (128),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QRVS+TTD+WTS+Q +NYM +TAHFID+ W
Sbjct  126   QRVSLTTDTWTSLQNVNYMALTAHFIDDSW  155



>ref|XP_009775322.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=389

 Score =   236 bits (601),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 143/340 (42%), Positives = 196/340 (58%), Gaps = 45/340 (13%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLV  1640
             K  LCLDVPTRWNSTYLML+ A+ +++                      S DWE+V  + 
Sbjct  67    KKYLCLDVPTRWNSTYLMLRRAVEFEREL-------------------LSSDWENVKRIT  107

Query  1639  KLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EADGAVKLMGANMKAKFEKY  1463
             K L+ FY ++++ISGS YVT+N  F EI  +   L +++   D  +  M  NMK KF+KY
Sbjct  108   KFLEIFYLLSLKISGSCYVTSNIHFLEICAIAVYLKQLILNEDTVLSEMTKNMKEKFDKY  167

Query  1462  *GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVS  1283
              GD +KMN +IF + ILDP  K+E +   LV M+G         K+   +  L+ +Y  S
Sbjct  168   WGDPEKMNKIIFISCILDPCYKIESVGYALVKMFGVDPEATIQAKVTKYMTSLFSEYVKS  227

Query  1282  YSPSVVPATGS-------------GSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELL  1142
              S  VV A+ S             GS AS           +G  + L++  IKK +    
Sbjct  228   GSKGVVLASSSDCSSLDTSTSGLSGSQASTQ--------NIGLSESLMQ-DIKKYKSGSG  278

Query  1141  G-GKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAF  965
             G   + EL+ YLSE   +D   FD+L WWK+NSARF IL+++AR++LA+PISTVASE AF
Sbjct  279   GVDTRTELDKYLSEETEDDTKEFDVLLWWKLNSARFSILAEMARNVLAVPISTVASECAF  338

Query  964   SISGRVLDHFRSSLTPKIVEALVCTQDWLR--RPNTPISI  851
             S+ GR+LD FRSSLTPK+V+ALVC QDWL+  +   PIS+
Sbjct  339   SMGGRLLDSFRSSLTPKLVQALVCLQDWLQNEKLKQPISV  378


 Score = 53.1 bits (126),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -3

Query  2016  GSSSVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEY  1837
             G++ +   +LHMRC+AHI+NL+VQD LK+  I+++RVR  VRYVR SP++LK+F++  + 
Sbjct  2     GTNLMNGTHLHMRCMAHIMNLMVQDGLKESSISIERVRHAVRYVRQSPARLKRFQECFDD  61

Query  1836  SMELSKKHPCV  1804
                  KK+ C+
Sbjct  62    KQLNCKKYLCL  72



>emb|CDY53459.1| BnaCnng25180D [Brassica napus]
Length=732

 Score =   180 bits (456),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 184/345 (53%), Gaps = 33/345 (10%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFD----------DYEYSDNSFKSDLGDSIPTS  1670
             + SL LD  TRWNSTYLML SAL  +  F+          DY   ++  +       PTS
Sbjct  349   RGSLPLDCSTRWNSTYLMLNSALKLRVAFEKMLGEDKLYCDYFLEEDEKEKKKRVGPPTS  408

Query  1669  LDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDL-YCILNEMVEADGAVKLMG  1493
              DW+ V  L K LK F+  T+  S S  VT+   + EI  +   ++++    D  ++   
Sbjct  409   SDWDEVQRLKKFLKIFFNCTLAFSASKSVTSTLCYHEIVTIERNLISKCGSGDIEIRKQA  468

Query  1492  ANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAA-  1316
               M+ KFEKY   +  MN ++   ++ DPR+K+E+       +YG K+  +Y  KL A+ 
Sbjct  469   HIMRDKFEKYWDGLMNMNPLVIVGSVFDPRNKMEFASLCFEKLYG-KETIEY-RKLHASV  526

Query  1315  ---LNELYDDYAVSY-SPSVVPAT------GSGSVASVNLVVEFVFTPVGRPQHLLKAQI  1166
                L  LYD+Y++ +  P    A       G   +AS    +        R   L   ++
Sbjct  527   TKVLKNLYDEYSIMFGQPDQTDAAEDTSDHGDSELASAMFDLSDDEDGYERMDSLYSQRV  586

Query  1165  KKQRMELLGGKKIELEYYLSEA----ITEDEG-SFDILRWWKVNSARFPILSKIARDILA  1001
              ++R +       ELE YL+E     +  + G  +D+L WWK NS +FP+LS++A+D+LA
Sbjct  587   IEKRSDYAS----ELEIYLTEKTEPKVENNLGLGYDVLSWWKRNSGKFPLLSELAKDVLA  642

Query  1000  IPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPN  866
             + +S+VASESAFS SGR+ D +RSSLTP ++EAL+CTQ W++  N
Sbjct  643   VQVSSVASESAFSTSGRIFDPYRSSLTPYMIEALICTQQWMQSSN  687


 Score = 91.3 bits (225),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 72/111 (65%), Gaps = 4/111 (4%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSW---GSS  2008
             SF P+  HKGE IA  L  C+ EWG+  VFTVTVDNA +NDVA+     + + W   G+ 
Sbjct  229   SFKPITDHKGETIAGQLIDCIEEWGIEKVFTVTVDNARANDVAVKLFA-EAMRWRGVGAL  287

Query  2007  SVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKF  1855
                  +LHMRC AH+LNL+V+D L + + ++  +R  V+YVRSS ++LK F
Sbjct  288   VQDGAFLHMRCCAHVLNLIVRDGLARVNPSIVAIRNAVKYVRSSFTRLKSF  338


 Score = 37.4 bits (85),  Expect(3) = 8e-68, Method: Composition-based stats.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
             +RVS+TT+ W S     NYMV+TAH+ID  W
Sbjct  191   KRVSLTTEIWVSPTTSYNYMVITAHWIDGNW  221



>ref|XP_008779743.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
Length=663

 Score =   193 bits (490),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 175/318 (55%), Gaps = 21/318 (7%)
 Frame = -2

Query  1810  LCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLVKLL  1631
             L LDVPTRWNSTY ML+SAL ++ VF  Y+  D+++K      +P+  DW     + + L
Sbjct  338   LQLDVPTRWNSTYEMLESALEFKPVFSIYKERDSNYKW-----LPSEEDWIRATEVSQFL  392

Query  1630  KCFYEMTIRISGSLYVTANTFFSEISDLYCILNEM-VEADGAVKLMGANMKAKFEKY*GD  1454
             + F E T   SG  Y T+N F  EI ++   LN+M  +    V  M   M  KFEKY GD
Sbjct  393   EVFNEATEVFSGRQYPTSNLFLIEIWEVKKKLNDMSFDTRDFVMRMTRRMNEKFEKYWGD  452

Query  1453  IDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSP  1274
                 N ++    +LDPR K+  +      +YG    + +++ +  AL+ LY  Y      
Sbjct  453   C---NLLMAIGAVLDPRYKMWLIIFCFPKIYGVDVFQRHIDDVREALDMLYKAY------  503

Query  1273  SVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSEAI-  1097
               V + G  +V++ N+          R   +      KQ+ +++   K EL+ YL E I 
Sbjct  504   --VSSEGQINVSASNITSTSSKLKRKRRADVDFYMWAKQQRDVIPTNKTELDIYLEEDIY  561

Query  1096  -TEDEG--SFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSS  926
                DEG   FD L WWK N+ +F  LSK+ARDIL+IPI+TVASE+AFS  GRVLD +RSS
Sbjct  562   RPSDEGYDKFDALSWWKANTLKFRYLSKMARDILSIPITTVASEAAFSAGGRVLDQYRSS  621

Query  925   LTPKIVEALVCTQDWLRR  872
             L P  V+AL+CT+DWL  
Sbjct  622   LKPATVQALICTRDWLHH  639


 Score = 72.8 bits (177),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 66/108 (61%), Gaps = 1/108 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
              H G  IA+ +  CL EW + + V T+T+DNASSND A+  L+      G      K  H
Sbjct  221   PHTGITIADCILQCLTEWEIEDKVSTITLDNASSNDTAIKILRDNFAIRGKLYFNGKIFH  280

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +RC AH+LNL+VQD L +    ++ +RE V+Y++ SPS+L KF ++ +
Sbjct  281   VRCCAHVLNLMVQDGLAEIRDVIENIRESVKYLKMSPSRLHKFNEIVK  328


 Score = 42.0 bits (97),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T D WTS Q I Y+ +T HF+D EW
Sbjct  178   RISLTADLWTSNQTIGYICITGHFLDSEW  206



>ref|XP_009374959.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Pyrus x bretschneideri]
Length=877

 Score =   180 bits (457),  Expect(3) = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/359 (33%), Positives = 190/359 (53%), Gaps = 55/359 (15%)
 Frame = -2

Query  1825  EQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSF----KSDLGDSI-------  1679
             ++ +S+  DV TRWN+TY ML SA  +++VF    +  +SF    K ++   +       
Sbjct  285   DRMSSIPFDVVTRWNATYEMLNSAFKFKEVFSKMAFECDSFIAYFKEEVSKEVDGVTTKT  344

Query  1678  -----PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV--E  1520
                  P   DWE   +    LK FY+ T+ +S +L  T++   S +  L   + E +   
Sbjct  345   KRVGPPEVDDWERSMSFAHFLKKFYDATLTLSATLTPTSHLILSTVIALQVEIQEQILNA  404

Query  1519  ADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHM-YGDKKGK  1343
             A+  ++ +  +MK KF+KY G I+K+N ++F A +LDPR K + + T L  + YG  K +
Sbjct  405   ANATLQSVATSMKLKFDKYWGHIEKVNPILFVAQVLDPRYKFDMLETNLEELGYGWDKIR  464

Query  1342  DYLEKLLAALNELYDDYA--------------------VSYSPSVVPATGSGSVASVNLV  1223
             +   ++   + ELY+ Y                     V    SVV     G +  +++ 
Sbjct  465   EEKVRVKGYVTELYNAYKEGVVLSSSSTSSTSSSATSNVEQRSSVVLDDVGGVIVDIDVA  524

Query  1222  VEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYLS---EAITEDEGSFDILRWWKV  1052
                        + + + + + Q+ E+      E++ Y +   +++T +   F++L WWK 
Sbjct  525   SRMT-------KKIQRKRAEAQQNEIAN----EVDMYFNDPHQSLTYE--GFNLLDWWKG  571

Query  1051  NSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             N A++P LSK+A+D+LA+P STVASE+AFS+ GRV+D FR+SLTPK VEALVCT DWLR
Sbjct  572   NCAQYPTLSKVAKDVLALPSSTVASENAFSLGGRVVDPFRTSLTPKTVEALVCTSDWLR  630


 Score = 69.3 bits (168),  Expect(3) = 1e-66, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 64/110 (58%), Gaps = 22/110 (20%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +FV V SHKG+ I   LE CL +WG+  VF++TVDNAS+ND A+ ++KR++     S+VK
Sbjct  190   NFVQVTSHKGDDIGRCLEVCLNDWGIDKVFSITVDNASANDTAIAYMKRRL----KSNVK  245

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRD  1849
                  + C          D+++ C          V+++ SSP++L+ FR+
Sbjct  246   DGMTELSCEI--------DAIRNC----------VKFIHSSPARLESFRE  277


 Score = 54.7 bits (130),  Expect(3) = 1e-66, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RVSITTD+WTSIQ INYMV+TAHF+D  W
Sbjct  154   RVSITTDTWTSIQMINYMVITAHFLDTNW  182



>ref|XP_010686979.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Beta vulgaris subsp. vulgaris]
Length=714

 Score =   179 bits (453),  Expect(3) = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/324 (33%), Positives = 172/324 (53%), Gaps = 27/324 (8%)
 Frame = -2

Query  1822  QKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNL  1643
             Q   L L+  TRWNST+ ML  A+ ++KVF  Y   D+++     DS P   +W  +  L
Sbjct  381   QHRKLILECKTRWNSTFDMLDCAIKFRKVFPRYALHDHNY-----DSCPDDEEWGKIEKL  435

Query  1642  VKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAKFEK  1466
             + +L+ F + T  ISGS Y T+N F +E+  +  +L++  E+ D  VK M  +MK +F+K
Sbjct  436   LDVLRVFKDTTNSISGSEYPTSNLFLAEVQRIKVLLDKKSESHDDFVKSMVKSMKERFDK  495

Query  1465  Y*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAV  1286
             Y G+    + ++    +LDPR K+  +      M+     +D + K+   + +L+D+Y  
Sbjct  496   YWGEC---HLLMAIGTVLDPRLKMRAVEIAFPKMFPSHLVRDNINKVKEVMYQLFDEYVR  552

Query  1285  SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGK------KIE  1124
              YS   V  +G           E  F+   R      + + +   ++  G+      K E
Sbjct  553   MYSSCSVEESG-----------ECEFSSYARDGGATSSGLSELLQDVFSGETSVPHVKSE  601

Query  1123  LEYYLSEA-ITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRV  947
             ++ YL E      +  FD+L WWK  S +F ILS++A  ILA+PI+TVASE+ FS   RV
Sbjct  602   IDIYLDEGCFFSQDCKFDVLSWWKDKSNKFRILSRMAAHILAVPITTVASEATFSAGSRV  661

Query  946   LDHFRSSLTPKIVEALVCTQDWLR  875
             +D +R+SL P+ V+ L+CT DW R
Sbjct  662   IDPYRASLAPETVQMLMCTGDWCR  685


 Score = 77.4 bits (189),  Expect(3) = 1e-64, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 74/114 (65%), Gaps = 2/114 (2%)
 Frame = -3

Query  2154  KGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMR  1978
             KG  IA+A+ +CL EW + + VFT++VDNAS+ND  +  LK    S G      K  HMR
Sbjct  271   KGANIADAILTCLKEWEIEDKVFTISVDNASANDSCIQILKDNFASNGRLICGGKLFHMR  330

Query  1977  CIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDL-AEYSMELSK  1819
             C AHILN++VQ  LKQ    +++V + V ++ +S ++LK+F +L ++Y+++  K
Sbjct  331   CCAHILNIMVQHGLKQVQDIIEKVHDTVDFLNASEARLKRFGELVSQYNVQHRK  384


 Score = 42.0 bits (97),  Expect(3) = 1e-64, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTSI-QRINYMVVTAHFIDEEW  2196
             +RVS+TTD W S  Q+I YMV+TAHF+D +W
Sbjct  224   ERVSLTTDLWKSKPQKIEYMVLTAHFVDLDW  254



>ref|XP_009618720.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=479

 Score =   186 bits (473),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/338 (38%), Positives = 172/338 (51%), Gaps = 54/338 (16%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDS-----IPT----SL  1667
             K +LCLDVPT WNSTYLML+  + ++  F  Y  S+   +  L  S     IPT    S 
Sbjct  108   KKTLCLDVPTMWNSTYLMLRRDVEFESAFSHYASSEIGLRHYLEHSYIEFGIPTYEFLSS  167

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAVKLMGAN  1487
             DWE++  L                                  I NE    D  +  M   
Sbjct  168   DWENLKQL----------------------------------ITNE----DIVLSEMAKK  189

Query  1486  MKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNE  1307
             MK KF+KY GD  KMN +IF + ILDPR KLE +   LV M+G+  G     ++   +  
Sbjct  190   MKEKFDKYWGDPGKMNKIIFISYILDPRYKLESVGYALVKMFGEYFGATIQAEVKKYMTS  249

Query  1306  LYDDYAVSYSPSVVPATGSGS----VASVNLVVEFVFTP-VGRPQHLLKAQIKKQRMELL  1142
             L+ +Y  S S  +V A+ S       ++  L    V T   G  + L+K  IKK +    
Sbjct  250   LFSEYVKSSSKGIVLASSSDCSSLDTSTSGLSGSQVSTQNTGLLESLMK-DIKKYKSGSG  308

Query  1141  G-GKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAF  965
             G   + EL+ Y  E   +D   FD+L WWK+NSARF +L+++ARD+L + + +V SE AF
Sbjct  309   GVDTRTELDKYFGEETEDDTKEFDVLLWWKLNSARFLVLAEMARDVLHVSVLSVTSECAF  368

Query  964   SISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             S  GR+LD FRSSLTPK+V+ALVC QDWLR      S+
Sbjct  369   STGGRLLDSFRSSLTPKLVQALVCLQDWLRNEKLKQSV  406


 Score = 90.5 bits (223),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -3

Query  2142  IANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHI  1963
             +AN +  CL EWG+  +FT+TVDNASSND+ +  L +++   G++ +   +LH+RC+ HI
Sbjct  1     MANGIGMCLREWGINKIFTITVDNASSNDMTIKELSKQLTKIGTNLMNGNHLHVRCMTHI  60

Query  1962  LNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRD  1849
             +NLVVQD LK+  ++++ VR  VRYVR SP++LK+F++
Sbjct  61    MNLVVQDGLKESSVSIECVRHAVRYVRQSPARLKRFQE  98



>ref|XP_009767890.1| PREDICTED: uncharacterized protein LOC104218960 [Nicotiana sylvestris]
Length=576

 Score =   236 bits (603),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/285 (45%), Positives = 182/285 (64%), Gaps = 3/285 (1%)
 Frame = -2

Query  1696  DLGDSIP-TSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MV  1523
             D G++ P  S DW +V N+++ L  F+E+T ++SGS YVT N+ F ++S+LYC L   + 
Sbjct  217   DGGNAGPLESDDWVNVRNVIEFLARFHELTKKVSGSRYVTCNSHFEDVSELYCHLKMCLA  276

Query  1522  EADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGK  1343
               D  ++ M   M+ KF+KY G+ +KMN MIF A++LDPR+K EY+   L  ++G++KGK
Sbjct  277   SEDEHLRKMAQQMQEKFKKYWGEPEKMNKMIFIASVLDPRNKFEYVEGALEELFGEEKGK  336

Query  1342  DYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIK  1163
                 ++ A +N L+ +Y   YS    P + S S +S N       + +   +   K  +K
Sbjct  337   KINAEVYAYMNSLFGEYLKKYSTESCPQSPSSSTSSNNTSNTPSGSVISASKIRTKLSLK  396

Query  1162  KQRMEL-LGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPIST  986
             KQ+ +   GG K EL+ Y+SE        FDIL WWK ++ RFPILS++ARD+LAIPIS+
Sbjct  397   KQKEDNGSGGAKSELDKYISEEQEPFSEEFDILSWWKTHAPRFPILSELARDVLAIPISS  456

Query  985   VASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             VASE AFS  GR+LD FRSSLTPK V+AL+C QDWLR    PI++
Sbjct  457   VASECAFSTGGRILDSFRSSLTPKCVQALICLQDWLREEKNPINV  501



>ref|XP_002455637.1| hypothetical protein SORBIDRAFT_03g015311 [Sorghum bicolor]
 gb|EES00757.1| hypothetical protein SORBIDRAFT_03g015311 [Sorghum bicolor]
Length=558

 Score =   191 bits (484),  Expect(3) = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/331 (38%), Positives = 180/331 (54%), Gaps = 37/331 (11%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI       LDVPTRWNSTYLML+SA+ Y+ VFD  E  D ++        P++ DW   
Sbjct  254   GISCDKRPSLDVPTRWNSTYLMLKSAIEYRAVFDVMESQDPNYVDK-----PSNTDWNMA  308

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEM-VEADGAVKLMGANMKAK  1475
               L  + K FY+ T  +SG+LY TAN  F  + ++   +  +    D ++ +M + M   
Sbjct  309   YLLCNVFKPFYDATNAVSGTLYPTANHCFHVLWEVKGKIETLESHTDISIAVMASKMNLN  368

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY    D     I    +LDPR KL  +  +L   +GDK G  Y E + A L  L+  
Sbjct  369   FQKY---WDICLLQICVPVVLDPRFKLSLLSFRLNAGFGDK-GPAYTEMVKATLQNLFSA  424

Query  1294  YAVSYSPSVVPATG-------SGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG  1136
             Y+     S+ P +         GS+   +   +F        QHL  A  K++R+     
Sbjct  425   YS-----SMAPDSNYSELEPNDGSIDEDDCWADF-------EQHL--AAQKRKRV-----  465

Query  1135  KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSIS  956
              K EL+ YL + +   +  FDIL+WW+++S ++P++S++ARD+LA P STVASESAFS S
Sbjct  466   -KSELDTYLQDDLFPRQKKFDILQWWRIHSTKYPVVSRMARDVLAAPASTVASESAFSTS  524

Query  955   GRVLDHFRSSLTPKIVEALVCTQDWLRRPNT  863
             GR++  +RS LT K V+ALVC QDWLR   T
Sbjct  525   GRIVSDYRSRLTSKRVQALVCLQDWLRAEGT  555


 Score = 66.2 bits (160),  Expect(3) = 1e-64, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
              H G  + NAL  CL EW L + +F++T+DNA++N+  +G L++ +L           LH
Sbjct  144   PHDGLTLFNALLKCLQEWKLEHKLFSITLDNATNNNNMVGSLRKNLLERHLMLGNGDLLH  203

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDL  1846
             MRC+AH+LNL+V++  K  D    R+R+ V+Y+RSS ++ ++F ++
Sbjct  204   MRCVAHVLNLIVKEGFKVIDGATDRIRDSVKYIRSSQARKQRFEEI  249


 Score = 40.8 bits (94),  Expect(3) = 1e-64, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RV +T D WTS Q + Y+ +T HFID +W
Sbjct  101   RVCLTADLWTSNQNLGYLCITCHFIDNDW  129



>ref|XP_007226758.1| hypothetical protein PRUPE_ppa018763mg [Prunus persica]
 gb|EMJ27957.1| hypothetical protein PRUPE_ppa018763mg [Prunus persica]
Length=694

 Score =   163 bits (413),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/355 (35%), Positives = 189/355 (53%), Gaps = 53/355 (15%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVF----DDYEYSDNSF----KSDLGDSI--  1679
             IE K  + LDVPTRWNST +ML+++L ++K F    +D E    S+    + D+ D +  
Sbjct  349   IECKGLVVLDVPTRWNSTCMMLEASLNFEKAFWRMGEDDEGPYISWFGEDEPDVEDGVVM  408

Query  1678  ----------PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFF-------SEISD  1550
                       PT+ DW +    V  LK FY+ T+++S +L+  ++T F        EI D
Sbjct  409   SHYPRKREGSPTNEDWNNARTFVNFLKVFYDATLKMSVTLHPASHTTFHDLIAIEEEIED  468

Query  1549  LYC----ILNEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMP  1382
             L      ILNE  +    +K M  NMK KF+KY GD+DK+N ++  A +LDPR KL  + 
Sbjct  469   LLMEEEEILNE-TQTSKVLKDMTLNMKMKFKKYWGDLDKLNQILMVALVLDPRYKLGNLE  527

Query  1381  TQLVHMYGDK----KGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEF  1214
               L   + +     K K+ ++++L    +LY++YA+   P   P T S   +S +     
Sbjct  528   FILKSRFENPEDAVKKKNEIKEILK---KLYEEYAMPPPPPPPPPTPSTQSSSYSSDTTT  584

Query  1213  VFTP--VGRPQHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSAR  1040
             + T   + R     +   +  R E      + LE+ +   IT+                 
Sbjct  585   MNTSSSLNRGGKKRRQMTENWRKETRANDVVVLEHEIDRYITDPIEDV------------  632

Query  1039  FPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             +P L+ IA+D+LAIP+STVASES FS SGRV++ FR+SLTPKIVEAL+C+Q+WLR
Sbjct  633   YPGLALIAKDVLAIPVSTVASESCFSTSGRVINSFRASLTPKIVEALICSQNWLR  687


 Score = 83.6 bits (205),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = -3

Query  2124  SCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--VKSKYLHMRCIAHILNLV  1951
             SCL++W ++ + T+T DNASSN  A+ +LK K+  WG+ S  ++ KY+H+RC AHI+NL+
Sbjct  249   SCLLDWDMKKILTITADNASSNTKAIDYLKSKMGHWGNGSLLLEGKYMHIRCCAHIVNLI  308

Query  1950  VQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
             V+D LK+ + ++  +R  V+YVRSSP +L+ F+
Sbjct  309   VRDGLKKLEKSILCIRHAVKYVRSSPKRLEDFK  341


 Score = 50.1 bits (118),  Expect(3) = 2e-64, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RV +TT++WTS+Q INYMV+TAHFID  W
Sbjct  210   RVCLTTNTWTSVQNINYMVITAHFIDNYW  238



>gb|KFK22491.1| hypothetical protein AALP_AAs58843U000100 [Arabis alpina]
Length=571

 Score =   177 bits (450),  Expect(3) = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/357 (34%), Positives = 185/357 (52%), Gaps = 44/357 (12%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYE-----YSDNSFKSDLGDSI----  1679
             G   + SL LDV TR NSTYLML+ A+ ++  FD  E     Y+D+  + D  +      
Sbjct  187   GRMTRGSLPLDVKTRRNSTYLMLKQAIKFRGGFDRMESEDKLYNDHFLEIDNDNRKRIGP  246

Query  1678  PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EADGAVK  1502
             P+  DW+SV  +VK L  FY+ T+ +S S  + A+  + EI ++   L+ +    D  VK
Sbjct  247   PSYNDWQSVQRMVKFLGIFYQSTLVVSASTTLNAHKCYGEIVNIASKLHLLCCSPDSEVK  306

Query  1501  LMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYL--EK  1328
             +    M  KF+KY   +  +N M+  A + DPR K+++    L  +YG +     +  E 
Sbjct  307   VKAEEMYLKFDKYWDGLKNINKMLIIATVFDPRKKMQFATLCLEGLYGQESSTAAVLGET  366

Query  1327  LLAALNELYDDYAVSY-------------------SPSVVPATGSGSVASVNLVVEFV--  1211
             LL  L  +Y++YA  Y                   S +    T      S ++  E +  
Sbjct  367   LLLILRNMYNEYAERYNQANVQVQQAQTQTQAETSSQNQSQNTKETQDQSQDIDEEMLDG  426

Query  1210  FTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEG----SFDILRWWKVNSA  1043
             + PV +  + L  +I  +          ELE YL EA+   E      FDIL WWKVN  
Sbjct  427   YNPVEQRYNTLLREIGVRDTN-------ELEAYLREAVENPEVMMGIEFDILSWWKVNCG  479

Query  1042  RFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRR  872
             ++PILS++ARD+ A+ +S+VASESAFS SGR+++ +RS LT  +VE L+CT+ WL++
Sbjct  480   KYPILSEMARDLFAMQVSSVASESAFSTSGRIIEPYRSCLTHYMVEVLMCTEQWLKQ  536


 Score = 80.9 bits (198),  Expect(3) = 3e-64, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKR--KVLSWGSSS  2005
              F  V  HKG+ IAN L  CL EWG+  VF VTVDNA++N  ALG  +    +L   S  
Sbjct  72    GFKYVTDHKGKTIANTLLDCLAEWGIEKVFCVTVDNATANSNALGKFQSSFSLLRADSFM  131

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCD  1924
             +   Y+HMRC  HI+NL+V+D L   D
Sbjct  132   MNGCYMHMRCAGHIINLIVKDGLADVD  158


 Score = 38.5 bits (88),  Expect(3) = 3e-64, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
             QRVS+TTD W S +   +YMV+TAH+ID+ W
Sbjct  34    QRVSLTTDIWISQVTGASYMVITAHYIDKYW  64



>ref|XP_009604434.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009604436.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Nicotiana tomentosiformis]
Length=399

 Score =   230 bits (587),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/293 (42%), Positives = 185/293 (63%), Gaps = 5/293 (2%)
 Frame = -2

Query  1726  YEYSDNSFKSDLGDSIPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDL  1547
             Y+Y + ++ +     + TS DW++V  +VK L+ FY +T+R+SGS+YVT+N +F +I +L
Sbjct  63    YKYCEKTYAAATKGDL-TSADWDNVRTMVKFLETFYFLTLRVSGSIYVTSNVYFVQICEL  121

Query  1546  YCILNEMVE-ADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLV  1370
               IL E +E  D ++K M   +K KF KY G+ +KMN MI  A+ILDP +KL+Y+P  +V
Sbjct  122   DLILKEWMEHEDASLKEMAKKIKEKFVKYWGEPEKMNNMIIIASILDPSNKLDYVPFAIV  181

Query  1369  HMYGDKKGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRP  1190
              M+G+K+G+  + ++   ++ L+D Y    S     A+   +  +V     F+     R 
Sbjct  182   RMFGEKEGEKLILEVKNYMDSLFDYYVKKISKGSTSASSGNTTTTVTGYGSFLKRGTMRT  241

Query  1189  QHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARD  1010
             +  LK +  K+    LG K  EL+ YL+E I  +   F IL+WWK+N  RF IL+++ARD
Sbjct  242   K--LKFEKYKEVTGGLGAKS-ELDRYLAEDIEPETDEFKILKWWKINEPRFSILAEMARD  298

Query  1009  ILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             +L IPIS+VASE AFS  G +LD FRSSLTPK+V++L+C QDWLR    PI +
Sbjct  299   VLVIPISSVASECAFSTGGHILDSFRSSLTPKLVQSLICLQDWLRSEPIPIKV  351



>ref|XP_009793089.1| PREDICTED: uncharacterized protein LOC104240006 [Nicotiana sylvestris]
Length=601

 Score =   235 bits (599),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 177/274 (65%), Gaps = 2/274 (1%)
 Frame = -2

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGA  1490
             DW +V N+++ L  F+E+T ++SGS YVT N+ F ++S+LYC L   + + DG ++ M  
Sbjct  80    DWVNVRNVIEFLARFHELTKKVSGSRYVTCNSHFEDVSELYCHLKMCLASEDGHLRKMAE  139

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
              M+ KF+KY G+ +KMN MIF A++LDPR+K EY+   L  ++G++KGK    ++ A +N
Sbjct  140   QMQEKFKKYWGEPEKMNKMIFIASVLDPRNKFEYVEGALEELFGEEKGKKINAEVYAYMN  199

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMEL-LGGK  1133
              L+ +Y   YS    P + S S +S N       + +   +   K  +KKQ+ +   GG 
Sbjct  200   SLFGEYLKKYSTESCPQSPSSSTSSNNTSNTPSGSVISASKIRTKLSLKKQKEDNGSGGA  259

Query  1132  KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
             K EL+ Y+SE        FDIL WWK ++ RFPILS++ARD+LAIPIS+VASE AFS  G
Sbjct  260   KSELDKYISEEQEPFSEEFDILSWWKTHAPRFPILSELARDVLAIPISSVASECAFSTGG  319

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             R+LD FRSSLT K V+AL+C QDW+R    PIS+
Sbjct  320   RILDSFRSSLTTKCVQALICVQDWIREEKNPISV  353



>ref|XP_009114427.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brassica rapa]
Length=851

 Score =   174 bits (442),  Expect(3) = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/349 (34%), Positives = 180/349 (52%), Gaps = 30/349 (9%)
 Frame = -2

Query  1843  RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD---NSFKSDLGDSI--  1679
             RV  G   + SL LDV TRWNST+LML  AL ++  FD  E  D   N +  ++ + +  
Sbjct  471   RVTTGKMTRGSLPLDVKTRWNSTFLMLSRALQFKVAFDKMEAEDRMYNDYFLEVENGVKR  530

Query  1678  ---PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DG  1511
                P + DW  V  L++ L  FY  T+ +S S  V A   + EI  +   L  +  + D 
Sbjct  531   CGPPAASDWSGVEKLIRFLVIFYNSTLIVSASSKVNAYKCYGEIVTIERNLTSLANSLDS  590

Query  1510  AVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK--KGKDY  1337
              +KL  ++M  KF KY   I  +N M+  A + DPR+K+ +       +YG    + K+ 
Sbjct  591   ELKLTASDMLKKFLKYWEGIKGLNKMLILATVFDPRNKMHFAKLCFEKLYGKDSYEAKEM  650

Query  1336  LEKLLAALNELYDDY-----------AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRP  1190
             L  ++  L  ++ +Y           A S   S VP   S   AS  +  E V    G  
Sbjct  651   LGSVIDLLQSMFKEYNLRFRESSGQPAQSTQASRVPVPESQEQASERM--ELVVDDFGYE  708

Query  1189  QHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEG----SFDILRWWKVNSARFPILSK  1022
             +  + A  K+   E     + ELE YL EA+   +      FDIL WW+V+  ++P+L++
Sbjct  709   R--MDAVYKELVAEKGEDTRDELEVYLKEAVETPKLLPGIEFDILSWWRVHKIKYPVLAE  766

Query  1021  IARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             +ARD+LA+ IS+VASESAFS +GR+L+  RS LT  ++E L+C++ W+ 
Sbjct  767   MARDLLAMQISSVASESAFSTTGRILEPHRSCLTHFMIEVLLCSEQWMH  815


 Score = 75.1 bits (183),  Expect(3) = 4e-63, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--V  2002
             F  V  HKG+ IAN L +CL +WG++ +F +TVDNA++N  ALG       S    +  +
Sbjct  360   FKYVIDHKGQTIANVLLACLEDWGIKKLFCITVDNATANTSALGRFHSVFSSISPDALVL  419

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCDI  1921
                YLHMRC AHI+NL+ ++ L  CD+
Sbjct  420   DGNYLHMRCAAHIINLIAKEGL--CDL  444


 Score = 43.1 bits (100),  Expect(3) = 4e-63, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
             QRVS+TTD WT+ +   +YMV+TAHFIDE W
Sbjct  321   QRVSLTTDIWTAQVTGASYMVITAHFIDELW  351



>ref|XP_007207805.1| hypothetical protein PRUPE_ppa024297mg, partial [Prunus persica]
 gb|EMJ09004.1| hypothetical protein PRUPE_ppa024297mg, partial [Prunus persica]
Length=691

 Score =   172 bits (436),  Expect(3) = 5e-63, Method: Compositional matrix adjust.
 Identities = 122/336 (36%), Positives = 190/336 (57%), Gaps = 22/336 (7%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNS-FKSDLGDSIPTSLDWESV  1652
             IE K  + LDVPTRWNSTY+ML++AL ++K F      D   + S  G+      D  + 
Sbjct  332   IECKGLMVLDVPTRWNSTYMMLKAALKFEKAFWRMREDDEGPYISWFGEDESDHGDGNNA  391

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFF-------SEISDLYC----ILNEMVEADGAV  1505
                V  LK FY+ T+++S +L+   +T F        EI DL      IL+E  +    +
Sbjct  392   RTFVNFLKIFYDTTLKMSVTLHPAFHTTFHDLIAMKEEIEDLLMEEEEILSE-TQTSKVL  450

Query  1504  KLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKL---EYMPTQLVHMYGDK-KGKDY  1337
             K M  NMK KF+KY GD+DK+N ++  A +L+PR KL   E++ T       D  K K+ 
Sbjct  451   KDMTLNMKMKFKKYYGDLDKLNQILMVALVLNPRYKLGNLEFILTSRFENPEDAVKKKNE  510

Query  1336  LEKLLAALNELYDDYAVSYSPSVVPATGSGSVA-SVNLVVEFVFTPVGRPQHLLKAQIKK  1160
             ++ +L    +LY++YA+S SP     + S   + +  +      +  G+ +  +    +K
Sbjct  511   IKDIL---KKLYEEYAMSLSPPPSTQSSSYCFSDTTTMHTSSSLSWRGKKRRQMTENWRK  567

Query  1159  -QRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTV  983
               R   +   + E++ Y+ + I +    FD L+WWK+N  ++  L+ IA+D+ AIP+STV
Sbjct  568   YTRANDVVVLEHEIDRYIIDPIEDVVDEFDGLKWWKLNEVKYLGLALIAKDVFAIPVSTV  627

Query  982   ASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             ASES FS  G++++ FR+SLTPKIVEAL+C+Q+WLR
Sbjct  628   ASESYFSTGGQLVNSFRASLTPKIVEALICSQNWLR  663


 Score = 86.7 bits (213),  Expect(3) = 5e-63, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 75/106 (71%), Gaps = 2/106 (2%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--VKSKYL  1987
             ++ G  I   LESCL++W ++ + T+T +NASSN   + +LK K+  WG+ S  ++ KY+
Sbjct  220   NYMGNSIGKLLESCLLDWDMKKILTITTNNASSNTNVIDYLKSKMGHWGNGSLVLEGKYM  279

Query  1986  HMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRD  1849
             H+RC AHI+NL+V+D LK+ + ++  +R  V+YVRSSP +L+ F++
Sbjct  280   HIRCCAHIVNLIVRDGLKKLEKSILCIRNAVKYVRSSPKRLEDFKN  325


 Score = 33.5 bits (75),  Expect(3) = 5e-63, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYM  2229
              RV +TTD+WTS+Q INYM
Sbjct  204   HRVCLTTDTWTSVQNINYM  222



>ref|XP_006285547.1| hypothetical protein CARUB_v10006988mg [Capsella rubella]
 gb|EOA18445.1| hypothetical protein CARUB_v10006988mg [Capsella rubella]
Length=683

 Score =   172 bits (436),  Expect(3) = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/335 (33%), Positives = 178/335 (53%), Gaps = 32/335 (10%)
 Frame = -2

Query  1822  QKTSLCLDVPTRWNSTYLMLQSALIYQKVF-----DDYEYSDNSFKSDLGDSI---PTSL  1667
             ++ SL +DV TRWNSTYLML  A+ ++  F     +D  Y+D   + D G+     P  L
Sbjct  346   KRGSLPMDVKTRWNSTYLMLTKAIKFKAAFQKMYAEDKPYNDYFLELDKGNKKIGPPEML  405

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGA  1490
             DW  V  L K L  FYE T+ +SGS  V +   + EI D+   L E+  + D  +K    
Sbjct  406   DWSKVERLEKFLAIFYESTLVVSGSTSVNSFKCYGEIVDICTSLRELSYSFDQELKKNAT  465

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK--KGKDYLEKLLAA  1316
             +M  KF+KY   +  MN M+  A + DPR K+++       ++G +  + K+    +   
Sbjct  466   DMLKKFDKYWEGLKNMNKMLIVATVFDPRKKMKFAELCFDDLFGKETVENKEMQTSVKDI  525

Query  1315  LNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG  1136
             L  L+D+Y++    S         + S             R +  ++++  + + E   G
Sbjct  526   LRSLFDEYSLRLEQSTERWDDDLDLVS------------SRKRRKVESRFTEMQNE--KG  571

Query  1135  KKI---ELEYYLSEAITEDE----GSFDILRWWKVNSARFPILSKIARDILAIPISTVAS  977
              K+   EL+ YL E+    +      +D+L WWKVN+ ++PIL++IARD+LA+ +S+VAS
Sbjct  572   VKVSTDELDVYLKESCETPDVMHGMEYDVLSWWKVNAHKYPILAEIARDVLAVQVSSVAS  631

Query  976   ESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRR  872
             ESAFS SGR++   RSSLT  +VE L+C   W+++
Sbjct  632   ESAFSTSGRIISPARSSLTHYMVEVLMCLDQWMKQ  666


 Score = 82.0 bits (201),  Expect(3) = 1e-62, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKV--LSWGSSSV  2002
             F  V  HKG+ I+N L  CL EWG++ VF VTVDNA+SN +AL   ++    +S  S  +
Sbjct  228   FKSVTDHKGQTISNVLLECLAEWGIKKVFCVTVDNATSNSLALRNFEKSFAEISHDSLVL  287

Query  2001  KSKYLHMRCIAHILNLVVQDSL  1936
               ++LHMRC AHILNL+V D L
Sbjct  288   SGEFLHMRCNAHILNLIVNDGL  309


 Score = 37.4 bits (85),  Expect(3) = 1e-62, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (71%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSW-TSIQRINYMVVTAHFIDEEW  2196
             QRVS+TTD W  S    +YMV+TAH+ID  W
Sbjct  189   QRVSLTTDIWVASPTGASYMVITAHYIDTHW  219



>ref|XP_007213385.1| hypothetical protein PRUPE_ppa026473mg [Prunus persica]
 gb|EMJ14584.1| hypothetical protein PRUPE_ppa026473mg [Prunus persica]
Length=696

 Score =   182 bits (462),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 185/320 (58%), Gaps = 16/320 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             +E K  L  DVPTRWNST+LM+ SAL YQ+ F   + SD+++K  L        +W  + 
Sbjct  348   LECKRGLRQDVPTRWNSTFLMIDSALYYQRAFLHLQLSDSNYKHSLSQD-----EWGKLE  402

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEM-VEADGAVKLMGANMKAKF  1472
              L K LK FY++T   SG+ Y TAN +F ++  +   L +  V++D  +K M   M  KF
Sbjct  403   KLSKFLKVFYDVTCLFSGTKYPTANLYFPQVFVVEDTLRKAKVDSDSFMKSMATQMMEKF  462

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYG-DKKGKDYLEKLLAALNELY-D  1298
             +KY     + + ++  A ILDPR K++++      +YG + +    +  +L +L +LY  
Sbjct  463   DKY---WKEYSLILAIAVILDPRYKIQFVEFCYKRLYGYNSEEMTKVRDMLFSLFDLYFR  519

Query  1297  DYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELE  1118
              Y+ S S S   +  +G+ + V+ +V      V +     +++           +K +L+
Sbjct  520   IYSSSESVSGTSSASNGARSHVDDMVSKECLDVMKEFDNFESE-----EFTTSAQKTQLQ  574

Query  1117  YYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDH  938
              YL E   + +   ++L +WKVN  R+P LS +ARD+L+IPISTVASESAFS+ GRVLD 
Sbjct  575   LYLDEPKIDRKTKLNVLDFWKVNQFRYPELSILARDLLSIPISTVASESAFSVGGRVLDQ  634

Query  937   FRSSLTPKIVEALVCTQDWL  878
             +RS+L P+ VEALVCT+DW+
Sbjct  635   YRSALKPENVEALVCTRDWI  654


 Score = 68.2 bits (165),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 2/109 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             SF+P   H G  +   +   L +WG+ + +F++T+DNASSND  +  LK ++    +  +
Sbjct  232   SFMP-PPHTGVALCEKIYRLLTDWGVEKKLFSMTLDNASSNDTFVELLKGQLNLKDALLM  290

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKF  1855
               K+ H+RC AHILNL+VQD LK  D +V ++RE ++YVR S  + +KF
Sbjct  291   NGKFFHIRCCAHILNLIVQDGLKHIDDSVGKIRESIKYVRGSQGRKQKF  339


 Score = 37.4 bits (85),  Expect(3) = 1e-61, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RV +T+D WTSI    Y+ +T HFID  W
Sbjct  194   RVCLTSDLWTSITTDGYLCLTVHFIDVNW  222



>ref|XP_007216820.1| hypothetical protein PRUPE_ppa022981mg, partial [Prunus persica]
 gb|EMJ18019.1| hypothetical protein PRUPE_ppa022981mg, partial [Prunus persica]
Length=570

 Score =   155 bits (392),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 173/358 (48%), Gaps = 91/358 (25%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDY-EYSDNSF-----------------  1703
             I+ K  + +DVP RWNSTYLML +AL ++K FD   +  D+S+                 
Sbjct  263   IKCKWLVVMDVPIRWNSTYLMLVAALKFRKAFDRMGDDPDSSYLMYFKEEERDDEIIEGI  322

Query  1702  ----------KSDLGDSIPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFS---  1562
                       K++     P+  DWE     V  LK FY +T++IS SL+ T+++ F    
Sbjct  323   EGSGKGKGKSKTNKKVGPPSDEDWEKAVTFVMFLKTFYGVTLKISASLHPTSHSTFHDLL  382

Query  1561  ----EISDLYCI-----LNEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILD  1409
                 EI +LY       + E    D  +  M  +MK K++KY G++ K+N  +    ++D
Sbjct  383   AIDREIRELYRYDVTIPIEERTAMDTLLNDMATSMK-KYDKYWGELHKVNPFLMIGVVID  441

Query  1408  PRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELY-DDYAVSYSPSVVPATGSGSVASV  1232
             PR KL      L H++                 E++ +D       +++         S 
Sbjct  442   PRFKLR----NLKHIF----------------EEIFENDSTCRKRKTMMEKWKKIQQESE  481

Query  1231  NLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKV  1052
             N+VV                               E++ YL + +   +  FDILRWW++
Sbjct  482   NVVVTH-----------------------------EVDRYLLDPLESIDEEFDILRWWRI  512

Query  1051  NSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWL  878
             N  ++P L+ IA+D+LAIP ST+ASES FS SGRV+D FRSSL+P++VEAL+C+Q+W+
Sbjct  513   NGLKYPTLASIAKDLLAIPTSTIASESCFSTSGRVIDSFRSSLSPRMVEALICSQNWI  570


 Score = 86.3 bits (212),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 76/115 (66%), Gaps = 2/115 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--  2005
             +F  + SHK E I   LE+CLI+WG + + T+T DNA +N  A+ ++++K+  W  S+  
Sbjct  145   NFCLIDSHKWESIGKLLENCLIDWGHQKILTITADNADANTKAIEYVRKKINGWKDSNSV  204

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +   ++HMRC AHI+NL+V++ LK+ + ++  +   V++VRSSPS+L  F+   E
Sbjct  205   LGGVHMHMRCSAHIINLIVKEGLKRLESSIVAICNAVKFVRSSPSRLSYFKMCVE  259


 Score = 45.8 bits (107),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
              R+ +TTD+WTS+  +NYMV+TAHF+D ++
Sbjct  108   HRICLTTDTWTSVPNVNYMVLTAHFVDSDY  137



>ref|XP_009151481.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brassica rapa]
Length=787

 Score =   166 bits (420),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/364 (34%), Positives = 181/364 (50%), Gaps = 42/364 (12%)
 Frame = -2

Query  1843  RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSI-----  1679
             RV  G   + SL LDV TRWNSTYLML  AL ++  F+  E  D  +     +++     
Sbjct  393   RVEAGKMTRGSLPLDVKTRWNSTYLMLDQALKFRLAFEKMESEDKPYNDYFMETVDGKKR  452

Query  1678  ---PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDL---YCILNEMVEA  1517
                P+  DWE V  LV  L  FY  T+ +S S  +T++  ++EI  +    C+++     
Sbjct  453   IGPPSRTDWEEVERLVHFLVIFYNSTLILSASKSITSHKIYNEIVTITRNVCMISSAPGP  512

Query  1516  DGAVKLMGANMKAKFEKY*G------DIDK-------MNYMIFFANILDPRDKLEYMPTQ  1376
             D +++    +M  K  KY        + +K       MN ++  A + DPR K+ +    
Sbjct  513   DDSLRYKALSMMGKLRKYWNPFWEEDEAEKSKSKSCQMNKLMIVATVFDPRKKMNFANLC  572

Query  1375  LVHMYGDKKGKDYL---EKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFT  1205
                +YG K+  +Y    E +L  L  LYD+Y++  + S   + GS S    +   +    
Sbjct  573   FEKLYG-KESIEYTLLSESILEILKRLYDEYSLVANRSGGGSGGSQSQGGSSSQTQDQDA  631

Query  1204  PVGRPQHLLKAQIKKQRMELLGGKKI----------ELEYYLSEAI----TEDEGSFDIL  1067
                     L   I  +RM+ L  + I          ELE YL E +    T     +D+L
Sbjct  632   GAVFESRDLGNGIGYERMDNLYEELIQEAGTEDSTNELELYLKEKVEITKTMVGTEYDVL  691

Query  1066  RWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQ  887
              WW+ NS +FP LS++A DILA+ +S+VASESAFS SGRVLD + S LT  +VE LVCTQ
Sbjct  692   SWWRRNSLKFPTLSRVAADILAVQVSSVASESAFSTSGRVLDTYMSCLTHFMVEVLVCTQ  751

Query  886   DWLR  875
              WL+
Sbjct  752   QWLK  755


 Score = 84.3 bits (207),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 75/121 (62%), Gaps = 6/121 (5%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--V  2002
             F  V  HKG  IA  L  CL EW +R VF +TVDNA++N  A+   K + +S G  +  +
Sbjct  282   FKNVDDHKGSTIAKVLIDCLAEWDIRRVFCITVDNATANTSAMKKFKEEFMSHGDDALVL  341

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELS  1822
               ++LH+RC+ HILNL+V++ L + D ++  +R  ++YVRSS ++LK F    E+ +E  
Sbjct  342   NGEFLHVRCVTHILNLIVKEGLNEIDDSIIAIRNAIQYVRSSTNRLKSF----EFRVEAG  397

Query  1821  K  1819
             K
Sbjct  398   K  398


 Score = 37.4 bits (85),  Expect(3) = 2e-61, Method: Composition-based stats.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
             QR+S+TTD W +     +YMV+TAHF+D  W
Sbjct  243   QRLSLTTDIWVAPYTSASYMVITAHFVDASW  273



>ref|XP_007198910.1| hypothetical protein PRUPE_ppa025415mg [Prunus persica]
 gb|EMJ00109.1| hypothetical protein PRUPE_ppa025415mg [Prunus persica]
Length=586

 Score =   144 bits (362),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/330 (32%), Positives = 167/330 (51%), Gaps = 39/330 (12%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGD---------SIP  1676
             I+   ++ +DV TRWNSTY ML  A  Y+ VF+     + +F++   +           P
Sbjct  255   IDGMANVPMDVATRWNSTYKMLDCAFKYKIVFNRMAAENVAFQAYFEEIDKDGMKRVGPP  314

Query  1675  TSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILN-EMVEADGAVKL  1499
             ++ DWE   + V  LK FY+ T+++S +  VT+N  F E+  L   +  +M ++  A+  
Sbjct  315   SNEDWEKSISFVHFLKKFYDTTLKLSATKTVTSNIIFHELVSLQVEIELKMSDSRDAI--  372

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYG-DKKGKDYLEKLL  1322
                               +  MIF A +LDPR KL+ +     ++   D K  + + ++ 
Sbjct  373   ------------------LQRMIFVALVLDPRFKLQMLKISFQNLKAEDNKIDEVVREVR  414

Query  1321  AALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELL  1142
               L  LY++Y  +      P    G   +V   +E       +  H L  Q K++++  +
Sbjct  415   TCLFNLYNEYRGADGLVSQPM-NEGEDENVGNDLEGYHDVQTKMFHQLVQQRKEEQLVEI  473

Query  1141  GGKKIELEYYLSEAITED-EGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAF  965
                  E++ YL++         F +L WWK N +R+PI SKIA+DI  IP STVASE+AF
Sbjct  474   SN---EVDKYLTDPFENPFTKGFKLLNWWKGNESRYPI-SKIAKDIFTIPSSTVASENAF  529

Query  964   SISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             S+  R++D F+SSLTPK+VEA   T DWLR
Sbjct  530   SLGKRIVDPFKSSLTPKMVEA--STSDWLR  557


 Score = 90.9 bits (224),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 79/118 (67%), Gaps = 3/118 (3%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  + SHKG  I   L +CL  WG+  +FT+TVDNAS+ND  + +++ ++  + +  + 
Sbjct  139   NFTKITSHKGIDIGKTLCACLNAWGIEKLFTITVDNASANDGPVVYVRNRMKDFNNLLLD  198

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMEL  1825
              KYLH+RC  HILNL+V+D LK+   +++ +R  V+Y+ SSPS+L  FRD   +S+E+
Sbjct  199   GKYLHLRCACHILNLIVKDGLKELLSSIEGIRNCVKYIHSSPSRLDSFRD---HSLEM  253


 Score = 52.4 bits (124),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -1

Query  2279  VSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             VSITTD+WTSIQ INYMVV AHF+D EW
Sbjct  104   VSITTDTWTSIQNINYMVVIAHFMDSEW  131



>ref|NP_001042787.2| Os01g0290300 [Oryza sativa Japonica Group]
 dbj|BAF04701.2| Os01g0290300 [Oryza sativa Japonica Group]
Length=751

 Score =   165 bits (418),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/325 (33%), Positives = 164/325 (50%), Gaps = 18/325 (6%)
 Frame = -2

Query  1834  YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWES  1655
             Y ++    L LDV TRWNSTY ML + + Y+  F  Y+  D S+     DS     DW S
Sbjct  422   YSVKVGRGLALDVKTRWNSTYKMLDTCIDYKDAFGYYKEVDTSYVWKPSDS-----DWVS  476

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKA  1478
                +  +L    E +   SGSLY TAN F+  I  +   L E  ++ D  ++ MGA M  
Sbjct  477   FGKIRPILGTMAEASTAFSGSLYPTANCFYPYIVKVKRALIEAQKSEDTYLRSMGAAMLD  536

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYD  1298
             KF+KY    ++ N ++  A ILDPR K+ Y+      ++   + +  +  +   L  LY+
Sbjct  537   KFDKY---WEEKNNVMVIATILDPRFKMRYIKWCFAQIFDPIRCEIEINDINQELERLYN  593

Query  1297  DYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRP-QHLLKAQIKKQRMELLGGKKIEL  1121
              Y + +   +     +    S ++        +    Q  L++ + +         K EL
Sbjct  594   KYEILHRQKMGENGTNRQSTSASVDTTSSMASIASDFQSFLQSTVTE-------SSKSEL  646

Query  1120  EYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVL  944
               YL EA    D   F++LR+W VN  RFP++S +A+  L +P+S+V+SE  FS +GRVL
Sbjct  647   LIYLDEANEAIDNKHFNLLRYWNVNCHRFPVVSSLAKRFLTVPVSSVSSECTFSTAGRVL  706

Query  943   DHFRSSLTPKIVEALVCTQDWLRRP  869
             D +RSSL P  V+ALVC   W+R P
Sbjct  707   DDYRSSLKPATVQALVCASSWIRGP  731


 Score = 79.7 bits (195),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 78/123 (63%), Gaps = 3/123 (2%)
 Frame = -3

Query  2178  SFVPV-KSHKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSS  2005
             +F+ V   H G  IA A+  C++EW + + V T+T+DNA++ND A+  LK K+L+  +S 
Sbjct  306   NFIEVDPPHTGIVIAQAVFECMVEWKIEDKVTTITLDNATNNDTAVTNLKAKLLARKNSV  365

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA-EYSME  1828
                 Y H+RC AHI+NLVV D L+  D  +  +R  V+Y + SPS++ KF ++   YS++
Sbjct  366   FDPSYFHIRCAAHIVNLVVNDGLQPIDNLISCLRNTVKYFKRSPSRMYKFVEVCNNYSVK  425

Query  1827  LSK  1819
             + +
Sbjct  426   VGR  428


 Score = 41.6 bits (96),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             + +S+TTD WTS Q + YM + AH+IDE W
Sbjct  269   ESISLTTDLWTSNQNLQYMCLVAHYIDENW  298



>gb|AAV25287.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAW56923.1| hypothetical protein [Oryza sativa Japonica Group]
Length=676

 Score =   176 bits (445),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/334 (35%), Positives = 171/334 (51%), Gaps = 37/334 (11%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLV  1640
             K S   D PTRWNSTY M+   L+Y+ V D       S+ +  G+  PT L+W+ V ++ 
Sbjct  355   KLSFSFDTPTRWNSTYKMIVEGLMYRSVLD-------SYANQHGEVAPTELEWQKVESIC  407

Query  1639  KLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEM-VEADGAVKLMGANMKAKFEKY  1463
               LK F E T+ +S     TA+ F   +  +   LN+   +    +K++ A M +KF KY
Sbjct  408   AFLKVFEEATLSVSADRKPTAHRFLPLVLQIRHALNDPDWQTSDILKVLAAAMLSKFVKY  467

Query  1462  *GDIDKMNYMIFFANILDPRDKLEYMP----------TQLVHMYGDKKG--KDYLEKLLA  1319
                    N  +  A +LDPR K +Y+           T++V   G  +   KDY EK   
Sbjct  468   WDS--GFNSALVIATMLDPRRKGDYLNFFYEKTSNSVTEIVEKVGSAEDWLKDYYEKYEG  525

Query  1318  ALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG  1139
              +    D++ +S+S     + GS  +    L  EF               + K R     
Sbjct  526   FVRR-NDEHMLSHSREGSSSVGSPVLGKRKLEEEFA--------------LYKSRRRTAR  570

Query  1138  GKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSI  959
               K E   YL E + ED  SFD+L WWK ++ +FP+LS +ARD LAIP+STV+SE AFS 
Sbjct  571   QTKSEFAIYLEEDVEEDSESFDVLDWWKRHAQKFPVLSSMARDFLAIPLSTVSSELAFSC  630

Query  958   SGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPI  857
              GR+L   RSSLTP+++EAL+C +DWL + N P+
Sbjct  631   GGRILGDTRSSLTPEMLEALICAKDWLIKANDPL  664


 Score = 66.2 bits (160),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 70/106 (66%), Gaps = 3/106 (3%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHM  1981
             H G  I  A+ SCL  WG+R+ +FT+T+DNAS+N+ A   L +      +   + ++LH+
Sbjct  244   HTGFAIEEAIMSCLTYWGIRSKLFTITLDNASNNNSACQELIKN--HKNALMFEGQHLHV  301

Query  1980  RCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             RC AHILN++VQD +K    T+ ++RE+++++ SS S+++ F  +A
Sbjct  302   RCCAHILNILVQDDMKIIKPTIHKLRELLKHLDSSVSRMQDFNSMA  347


 Score = 44.7 bits (104),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -1

Query  2279  VSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             V +T+D WTSIQ I YMVVTAH+ID E+
Sbjct  201   VCLTSDMWTSIQNIGYMVVTAHYIDREF  228



>ref|NP_001054942.2| Os05g0219300 [Oryza sativa Japonica Group]
 dbj|BAF16856.2| Os05g0219300 [Oryza sativa Japonica Group]
Length=772

 Score =   175 bits (444),  Expect(3) = 7e-61, Method: Compositional matrix adjust.
 Identities = 118/338 (35%), Positives = 172/338 (51%), Gaps = 37/338 (11%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
              +  K S   D PTRWNSTY M+   L+Y+ V D       S+ +  G+  PT L+W+ V
Sbjct  399   NLPSKLSFSFDTPTRWNSTYKMIVEGLMYRSVLD-------SYANQHGEVAPTELEWQKV  451

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEM-VEADGAVKLMGANMKAK  1475
              ++   LK F E T+ +S     TA+ F   +  +   LN+   +    +K++ A M +K
Sbjct  452   ESICAFLKVFEEATLSVSADRKPTAHRFLPLVLQIRHALNDPDWQTSDILKVLAAAMLSK  511

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMP----------TQLVHMYGDKKG--KDYLE  1331
             F KY       N  +  A +LDPR K +Y+           T++V   G  +   KDY E
Sbjct  512   FVKYWDS--GFNSALVIATMLDPRRKGDYLNFFYEKTSNSVTEIVEKVGSAEDWLKDYYE  569

Query  1330  KLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRM  1151
             K    +    D++ +S+S     + GS  +    L  EF               + K R 
Sbjct  570   KYEGFVRR-NDEHMLSHSREGSSSVGSPVLGKRKLEEEFA--------------LYKSRR  614

Query  1150  ELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASES  971
                   K E   YL E + ED  SFD+L WWK ++ +FP+LS +ARD LAIP+STV+SE 
Sbjct  615   RTARQTKSEFAIYLEEDVEEDSESFDVLDWWKRHAQKFPVLSSMARDFLAIPLSTVSSEL  674

Query  970   AFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPI  857
             AFS  GR+L   RSSLTP+++EAL+C +DWL + N P+
Sbjct  675   AFSCGGRILGDTRSSLTPEMLEALICAKDWLIKANDPL  712


 Score = 66.2 bits (160),  Expect(3) = 7e-61, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 71/106 (67%), Gaps = 3/106 (3%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHM  1981
             H G  I  A+ SCL  WG+R+ +FT+T+DNAS+N+ A   L +   +  +   + ++LH+
Sbjct  292   HTGFAIEEAIMSCLTYWGIRSKLFTITLDNASNNNSACQELIKNHKN--ALMFEGQHLHV  349

Query  1980  RCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             RC AHILN++VQD +K    T+ ++RE+++++ SS S+++ F  +A
Sbjct  350   RCCAHILNILVQDDMKIIKPTIHKLRELLKHLDSSVSRMQDFNSMA  395


 Score = 43.9 bits (102),  Expect(3) = 7e-61, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -1

Query  2279  VSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             V +T+D WTSIQ I YMVVTAH+ID E+
Sbjct  249   VCLTSDMWTSIQNIGYMVVTAHYIDREF  276



>ref|XP_010473769.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
Length=655

 Score =   157 bits (398),  Expect(3) = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/337 (34%), Positives = 168/337 (50%), Gaps = 39/337 (12%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQ----------KVFDDYEYSDNSFKSDLGDSIPTS  1670
             + SL LDV TRWNSTYLML +AL  +          K++D+Y   D+          P  
Sbjct  336   RGSLPLDVVTRWNSTYLMLTAALKLRVAFEKMLSEDKLYDEYFLEDDEKTKQSRVGPPMY  395

Query  1669  LDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDL-YCILNEMVEADGAVKLMG  1493
              DWE    LVK LK FY+ T+  S S  V +   + EI ++   ++ +   +D  V+   
Sbjct  396   SDWEKAARLVKFLKVFYKCTLTFSASTTVISTVSYKEIVNIERNLITKCGNSDEEVRKHA  455

Query  1492  ANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLE-----K  1328
               M+ KFEKY   +  MN ++   ++ DPR+K+++       +Y    GKD +E     K
Sbjct  456   HIMRDKFEKYWDGLIIMNPLVIVGSVFDPRNKMQFASLCFEQLY----GKDTIECRKLTK  511

Query  1327  LLAA-LNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRM  1151
             L+ + + +LY++Y+   S  V       S A+  +               L         
Sbjct  512   LVTSVMKKLYEEYSFRLSIPVEVEQPEASQAANTMAA-------------LSDDNDDDGC  558

Query  1150  ELLGGKKIELEYYLSEAI-----TEDEGSFDILRWWKVNSARFPILSKIARDILAIPIST  986
             E +     EL+ YL+E       T     +D+L WWK N+ +F ILS +A+D+LAI +S+
Sbjct  559   EGVVVGCSELDIYLTEKTNVRVETALGFPYDVLSWWKCNTQKFLILSAMAKDVLAIQVSS  618

Query  985   VASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             V SE  FS S RVLD +RSSLTP +VE L+ TQ WLR
Sbjct  619   VGSELVFSTSDRVLDSYRSSLTPYMVEVLMLTQQWLR  655


 Score = 85.9 bits (211),  Expect(3) = 2e-60, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 70/111 (63%), Gaps = 2/111 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVL--SWGSSS  2005
             SF  V  HKGE IA  L +CL +WG+  VFTVTVDNA  ND  L   +  ++    G+  
Sbjct  224   SFKIVTDHKGETIAGQLLNCLEDWGIEKVFTVTVDNAKGNDKGLKVFREALMLKEVGALV  283

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
                +++HMRC AHILNL+V D LK  + ++  +R  ++YVRSS ++LK F+
Sbjct  284   SNGEFMHMRCCAHILNLIVGDGLKMANNSIVAIRNAIKYVRSSFTRLKSFQ  334


 Score = 40.8 bits (94),  Expect(3) = 2e-60, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 23/31 (74%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQ-RINYMVVTAHFIDEEW  2196
             QRVS+TTD W S    +NYMVVT H+IDE W
Sbjct  186   QRVSLTTDIWVSQSTSVNYMVVTGHWIDENW  216



>ref|XP_006376015.1| hypothetical protein POPTR_0013s07990g [Populus trichocarpa]
 gb|ERP53812.1| hypothetical protein POPTR_0013s07990g [Populus trichocarpa]
Length=579

 Score =   158 bits (399),  Expect(3) = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/320 (35%), Positives = 167/320 (52%), Gaps = 45/320 (14%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSF-----------KSDLGDS  1682
             I  K S+ LDV TRWN TY+ML  A  +  VF   E  D  +           + +LG  
Sbjct  292   IGSKKSVFLDVATRWNPTYMMLDVADKFDVVFMRLEEIDPRYLSYFEVDSKGKQKNLGP-  350

Query  1681  IPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAV  1505
              P   DWE   + VKLLK FY +T++ SGSLYVT+N+FF E+  ++  ++++  + D  V
Sbjct  351   -PALEDWEKARSFVKLLKLFYTVTLKFSGSLYVTSNSFFHELIFMHTSISQLCRSEDVYV  409

Query  1504  KLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKL  1325
               M  NM AK++KY GD D  N++++ A +LDPR KL+Y+      +Y  ++ K++  K+
Sbjct  410   SKMVKNMMAKYKKYWGDQDTQNFLLYMAIVLDPRFKLKYVRFCFGRLYDVEEAKNFTIKV  469

Query  1324  LAALNELYDDYA-VSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRME  1148
                L  L++ Y  V  +  VV + G+    +VN+ +  V   +      L +Q KK    
Sbjct  470   KDTLLRLFEHYMNVDENVEVVHSVGNSINENVNVDLMVVNDDMLND---LASQFKKH---  523

Query  1147  LLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESA  968
                               E+EG        + N+ ++ I SK+A+ +L I +STV SES 
Sbjct  524   -----------------LEEEGG-------RCNATKYKIFSKVAQRVLTIMVSTVVSEST  559

Query  967   FSISGRVLDHFRSSLTPKIV  908
             FS  GR+LD FRSSL+P  V
Sbjct  560   FSTGGRILDPFRSSLSPSTV  579


 Score = 81.3 bits (199),  Expect(3) = 2e-60, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = -3

Query  2142  IANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHI  1963
             I N  +SCL+EW + N+ TVTVDNASSN++ + +LKR   +W ++ + + ++H+RC AHI
Sbjct  188   ILNFCQSCLLEWRIDNILTVTVDNASSNNLTIKYLKRVTSNWATNILSNDFMHVRCCAHI  247

Query  1962  LNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +NL+V   LK  D +V ++R  VR+VR SPS+   F   AE
Sbjct  248   VNLIVCAGLKDIDDSVVKIRNAVRFVRFSPSRQLVFNQCAE  288


 Score = 44.3 bits (103),  Expect(3) = 2e-60, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             +R+ +TTD+WTSI  INYM +T H+IDE W
Sbjct  153   RRICLTTDTWTSIININYMCLTGHWIDEGW  182



>ref|XP_009145548.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brassica rapa]
Length=634

 Score =   170 bits (430),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/337 (32%), Positives = 176/337 (52%), Gaps = 22/337 (7%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSI--------PTSLD  1664
             + SL LD  TRWNSTYLML  AL ++  FD  E  D  +     +++        PTS D
Sbjct  260   RGSLSLDCKTRWNSTYLMLSRALKFRAAFDRMEVEDKLYNDHFQETVEGKKRVGPPTSED  319

Query  1663  WESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDL-YCILNEMVEADGAVKLMGAN  1487
             W+ V  LVK L  FY  T+ +S S   ++   ++EI  +   ++      D  ++     
Sbjct  320   WDKVEGLVKFLVIFYNSTLVVSASNSPSSYKCYNEIVTIERNLITLSTSTDEKLRTKAMV  379

Query  1486  MKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK--KGKDYLEKLLAAL  1313
             M+AKF KY   +  +N ++  A++ DPR+K+++       +YG    + K   + +   +
Sbjct  380   MRAKFNKYWDGLKDINRLLIVASVFDPRNKMKFAGLCFEKLYGKDSPQSKVLYDSVTDVM  439

Query  1312  NELYDDYAVSYSPSVVPATGSGSVASVNLVV--EFVFTPVGRPQHLLKA--QIKKQRMEL  1145
               L+D+Y  S +    PA GS S +        E         ++  +    + K+ +  
Sbjct  440   ERLFDEYNASAASHTAPAFGSSSQSQSVQESQDEAAMDSSDENEYGYERMDSLYKEMVNE  499

Query  1144  LGGK--KIELEYYLSEAITEDEGS-----FDILRWWKVNSARFPILSKIARDILAIPIST  986
             LG +    ELE YL E +   + +     FD+L WW++NS+++P L+ IA+D+LA+ +S+
Sbjct  500   LGFQDASTELELYLKEKVEIPKPNPLGIPFDVLGWWRINSSKYPTLAAIAKDVLAMQVSS  559

Query  985   VASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             VASESAFS S R+LD  RS LT  ++E L+CT+ WL+
Sbjct  560   VASESAFSTSNRILDPSRSCLTHYMIEVLMCTEQWLK  596


 Score = 73.9 bits (180),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--V  2002
             F  V  HKG  I + L  C+ EWG++ VFT+TVDNA++N  AL   +    + G     +
Sbjct  141   FKHVADHKGVTICSVLLECMAEWGIKKVFTITVDNATANTNALKLFRDAFNALGPECLVL  200

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCD  1924
               + LH+RC AHI+NLVV+D + + D
Sbjct  201   GGELLHLRCCAHIINLVVRDGMLEVD  226


 Score = 39.3 bits (90),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQ-RINYMVVTAHFIDEEW  2196
             QRVS+TTD W +     +YMV+TAHFID+ W
Sbjct  102   QRVSLTTDIWVAPSTAASYMVITAHFIDDRW  132



>ref|XP_009138234.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brassica rapa]
Length=862

 Score =   170 bits (430),  Expect(3) = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/337 (32%), Positives = 176/337 (52%), Gaps = 22/337 (7%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSI--------PTSLD  1664
             + SL LD  TRWNSTYLML  AL ++  FD  E  D  +     +++        PTS D
Sbjct  488   RGSLSLDCKTRWNSTYLMLSRALKFRAAFDRMEVEDKLYNDHFQETVEGKKRVGPPTSED  547

Query  1663  WESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDL-YCILNEMVEADGAVKLMGAN  1487
             W+ V  LVK L  FY  T+ +S S   ++   ++EI  +   ++      D  ++     
Sbjct  548   WDKVEGLVKFLVIFYNSTLVVSASNSPSSYKCYNEIVTIERNLITLSTSTDEKLRTKAMV  607

Query  1486  MKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK--KGKDYLEKLLAAL  1313
             M+AKF KY   +  +N ++  A++ DPR+K+++       +YG    + K   + +   +
Sbjct  608   MRAKFNKYWDGLKDINRLLIVASVFDPRNKMKFAGLCFEKLYGKDSPQSKVLYDSVTDVM  667

Query  1312  NELYDDYAVSYSPSVVPATGSGSVASVNLVV--EFVFTPVGRPQHLLKA--QIKKQRMEL  1145
               L+D+Y  S +    PA GS S +        E         ++  +    + K+ +  
Sbjct  668   ERLFDEYNASAASHTAPAFGSSSQSQSVQESQDEAAMDSSDENEYGYERMDSLYKEMVNE  727

Query  1144  LGGK--KIELEYYLSEAITEDEGS-----FDILRWWKVNSARFPILSKIARDILAIPIST  986
             LG +    ELE YL E +   + +     FD+L WW++NS+++P L+ IA+D+LA+ +S+
Sbjct  728   LGFQDASTELELYLKEKVEIPKPNPLGIPFDVLGWWRINSSKYPTLAAIAKDVLAMQVSS  787

Query  985   VASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             VASESAFS S R+LD  RS LT  ++E L+CT+ WL+
Sbjct  788   VASESAFSTSNRILDPSRSCLTHYMIEVLMCTEQWLK  824


 Score = 73.6 bits (179),  Expect(3) = 4e-60, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--V  2002
             F  V  HKG  I + L  C+ EWG++ VFT+TVDNA++N  AL   +    + G     +
Sbjct  369   FKHVADHKGVTICSVLLECMAEWGIKKVFTITVDNATANTNALKLFRDAFNALGPECLVL  428

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCD  1924
               + LH+RC AHI+NLVV+D + + D
Sbjct  429   GGELLHLRCCAHIINLVVRDGMLEVD  454


 Score = 38.9 bits (89),  Expect(3) = 4e-60, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQ-RINYMVVTAHFIDEEW  2196
             QRVS+TTD W +     +YMV+TAHFID+ W
Sbjct  330   QRVSLTTDIWVAPSTAASYMVITAHFIDDRW  360



>ref|XP_010324119.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Solanum lycopersicum]
Length=401

 Score =   162 bits (409),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/298 (38%), Positives = 162/298 (54%), Gaps = 41/298 (14%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD-------NSFKSDLGDS----  1682
             I  K SLCLDVPTRWNSTY ML  A  ++  F  Y + D        +F SD  ++    
Sbjct  105   ITCKKSLCLDVPTRWNSTYSMLDIAQHFELAFKRYSFYDIGYLNHLRTFGSDSSENKDET  164

Query  1681  ---------------------IPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFF  1565
                                  I +S DW++V ++VK L+ FY +T+++SGS YVT+NT F
Sbjct  165   SVDDGTSVEDEFSVEDGTIANILSSGDWKNVRSMVKFLETFYVLTLKVSGSNYVTSNTHF  224

Query  1564  SEISDLYCILNEMV-EADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEY  1388
              EI++L  IL EM+   D  +K M  +M  KF+KY G+  KMN MIF +++LDPR+KL+Y
Sbjct  225   VEIAELNLILKEMMTNEDRNLKEMAESMNEKFKKYWGEQKKMNKMIFISSVLDPRNKLDY  284

Query  1387  MPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSPSV---VPATGSGSVASVNLVVE  1217
             +P  +V M+G K G+    ++   + +L+ +Y V  SP     VP++ + S  S ++   
Sbjct  285   VPFAIVDMFGKKVGEKLCTEVKKYMKKLF-EYYVKKSPKSSLHVPSSSTSSGNSSSISSV  343

Query  1216  F-VFTPVGRPQHLLKAQIKKQRMELLG--GKKIELEYYLSEAITEDEGSFDILRWWKV  1052
                   V R +   K Q +K + E+ G    K ELE YL+E I  D   FDIL WWKV
Sbjct  344   SGCGNFVNRGRLRTKQQFEKHK-EVSGSSSNKSELERYLAEDIELDSDDFDILMWWKV  400


 Score = 99.8 bits (247),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -3

Query  2130  LESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHILNLV  1951
             + +CL+EWGL NV T+TVDNASSNDV +  + +K+ +WG++ +  ++LH+RC+AHILNL+
Sbjct  5     ITNCLLEWGLDNVLTITVDNASSNDVTVKEMSKKLSNWGTNIMDGEHLHVRCMAHILNLI  64

Query  1950  VQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKKHPCV  1804
             VQD LK+   +VK VR+ V+Y++ SP++L+KF++  E  +   KK  C+
Sbjct  65    VQDGLKEIGKSVKLVRQAVKYIKQSPARLRKFKECCESKLITCKKSLCL  113



>ref|XP_006373948.1| hypothetical protein POPTR_0016s11380g [Populus trichocarpa]
 gb|ERP51745.1| hypothetical protein POPTR_0016s11380g [Populus trichocarpa]
Length=521

 Score =   163 bits (413),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 175/319 (55%), Gaps = 37/319 (12%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDW---E  1658
             I+ K SLCLDV TRWNSTYLML++A  ++KVF             LG S P  + +   E
Sbjct  236   IKCKKSLCLDVATRWNSTYLMLEAAEKFEKVF-----------MRLGQSEPRYMSYLLEE  284

Query  1657  SVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMK  1481
             +   L+K LK FY +T++ SGSL+VT+N+FF+E+  ++  L ++ ++ D  +  M  NM 
Sbjct  285   NARTLLKFLKIFYMVTLKFSGSLHVTSNSFFNELIYMHTNLLQLCKSRDNLLSGMVMNMM  344

Query  1480  AKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELY  1301
             ++FEKY G     N++++ AN+L+PR KL+Y+      +Y   K +   +K+   L  LY
Sbjct  345   SRFEKYWGCGANQNFLLYVANVLNPRLKLKYVEFYFGELYDYDKAQLLTKKVKDNLVSLY  404

Query  1300  DDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
             + Y    +  VV          VN  ++ +   V       +   ++  +E     + E+
Sbjct  405   EFYL--KADEVVDDNRHKQ--DVNDAIDDIEVDVNTLARFKRHLQEEDSVE----NRNEV  456

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLD  941
             E YL +   ED           +N  +  IL  +A+ +LAIPISTVASESAFS  GR+LD
Sbjct  457   ERYLVDG-CED-----------LNDDKLDIL--VAQHVLAIPISTVASESAFSTGGRILD  502

Query  940   HFRSSLTPKIVEALVCTQD  884
              FRSSL P  V+AL+C Q+
Sbjct  503   QFRSSLYPATVQALICCQN  521


 Score = 98.2 bits (243),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H GE I   +E+CL++WG+  + TVTVDNASSN V + +LK  +  W ++ + 
Sbjct  120   NFCQVSNHMGETIGQVIENCLLDWGIDKLLTVTVDNASSNSVTISYLKNVMKDWPTNILS  179

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +++LH+RC AHI NL+V D LK+ +++V ++R  +R++RSSPS+L  F+  AE
Sbjct  180   NEHLHVRCCAHIENLIVCDGLKEMNVSVVKIRNAIRFMRSSPSRLLAFKKCAE  232



>emb|CAN80126.1| hypothetical protein VITISV_013417 [Vitis vinifera]
Length=1266

 Score =   172 bits (435),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/312 (35%), Positives = 161/312 (52%), Gaps = 15/312 (5%)
 Frame = -2

Query  1810  LCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLVKLL  1631
             LCLD  TRWNSTYLML  A+ Y+ VF   +      +  L  ++P+  +W     + + L
Sbjct  423   LCLDCKTRWNSTYLMLSIAITYKDVFPRLKQ-----REKLYTTVPSEEEWNLAREICERL  477

Query  1630  KCFYEMTIRISGSLYVTANTFFSEISDLY-CILNEMVEADGAVKLMGANMKAKFEKY*GD  1454
             K FY +T   SG  Y TANTFF ++ ++   + + ++ ++  V  M ++M  KF+KY   
Sbjct  478   KLFYNITKLFSGRNYPTANTFFIKVCEIKEALYDWLICSNEVVSTMASSMLEKFDKY---  534

Query  1453  IDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSP  1274
                 + ++  A +LDPR K++ +      MYG +   + + K+     +L  +Y      
Sbjct  535   WSGCHIVMAIAVVLDPRYKMKILEFYFPIMYGSEASSE-IGKIRQLCYDLLSEY--QSKS  591

Query  1273  SVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSEAIT  1094
              +   T S   +SV+ + E  +        L K  +        G  K EL+YYL E + 
Sbjct  592   KMGQQTSSHGASSVSNLFELTYD---EQDPLSKFDLFVHSTSEEGHAKSELDYYLEETVL  648

Query  1093  EDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPK  914
                  FD+L WWK N  ++P L  I RDI AIP+STVASESAFS  GR++   RS L P 
Sbjct  649   PRISDFDVLSWWKTNGIKYPTLQMIVRDIYAIPVSTVASESAFSTGGRMVSKHRSRLHPN  708

Query  913   IVEALVCTQDWL  878
              +EAL+C Q WL
Sbjct  709   TLEALMCAQSWL  720


 Score = 63.9 bits (154),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +VP   H  E +++ L   L++W + R + T+TVDN SSND  +  L  K+ S GS  + 
Sbjct  302   YVP-PPHTKEVLSDVLLDFLLDWNMDRKLSTITVDNCSSNDGMIDILSEKLSSSGSLLLN  360

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              K  HMRC AH+LNL+V++ L    + ++++RE V Y  ++PS+++KF D A
Sbjct  361   GKIFHMRCAAHVLNLIVKEGLDVIRVEIEKIRESVAYWSATPSRVEKFEDAA  412


 Score = 45.4 bits (106),  Expect(3) = 1e-59, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R++ITTD WTS Q+  YM +T H+IDE W
Sbjct  263   RMAITTDMWTSNQKKGYMAITVHYIDESW  291



>ref|XP_009763023.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=388

 Score =   173 bits (439),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 163/291 (56%), Gaps = 17/291 (6%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLG-DSIP--------TSL  1667
             K  LCLDVPTRWNSTYLML  A+ Y++   +Y   D      L  DSI         T  
Sbjct  102   KKFLCLDVPTRWNSTYLMLSRAIEYERAIKEYSDRDIGLSRYLMFDSISDGKLVGMLTRT  161

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGA  1490
             DW++V  + ++L+ FY +T+++SGSLYVT+N  F EI  ++  LN ++ + D  +  M +
Sbjct  162   DWDNVKRIARILEIFYNLTLKVSGSLYVTSNAHFLEIGQVFVYLNRLITSEDEFLSEMAS  221

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
             +   KFEKY G+  KMN MIF A +LDP  K   +   L  M+GD+ G    +++   ++
Sbjct  222   SKWKKFEKYWGEPKKMNKMIFIACLLDPCYKFTTVSFVLKKMFGDE-GTIIEKEVHTYMS  280

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQ-HLLKAQIKKQRMELLG-G  1136
              L+++Y      SV   TG G V++      F       P    L  +I+K +   +G  
Sbjct  281   SLFNEYVFK---SVSKDTG-GKVSTSLPSSSFSTMETSTPGLGELLDEIRKYKAASVGVD  336

Query  1135  KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTV  983
              KIELE YL+E        FDIL  WKVNS RFPIL+K+ARD+LAIPIS V
Sbjct  337   SKIELEKYLAETPENKRPYFDILACWKVNSPRFPILAKMARDVLAIPISRV  387


 Score = 85.9 bits (211),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = -3

Query  2118  LIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHILNLVVQDS  1939
             L EWGL+ +FTVTVDN SSNDV +     K+  W ++S+  ++LH+RC+AHI+NL+V+D 
Sbjct  7     LREWGLQEIFTVTVDNVSSNDVTIEKFSDKLDDWATNSMNGQHLHVRCMAHIVNLIVKDG  66

Query  1938  LKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKKHPCV  1804
             LK+  I+   +   V Y+R SP++L+KF++  E S  + KK  C+
Sbjct  67    LKELGIS---IARTVIYIRQSPARLRKFQECCE-SKNIVKKFLCL  107



>ref|XP_010677727.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   116 bits (291),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 107/197 (54%), Gaps = 29/197 (15%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I  K  LCLDVPTRWNSTYLML + +  +  F+ +                         
Sbjct  318   INTKRLLCLDVPTRWNSTYLMLSAVIDLKGAFERFS------------------------  353

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAKF  1472
                + L+ FY++T+R+SGSL VT+N FF E+ ++  +L E+  + D  + ++ + MK K+
Sbjct  354   ---EFLQAFYDLTLRVSGSLCVTSNLFFDELVNVALLLKELESSEDFEMCVIASKMKEKY  410

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY GD++KMN +IF A +LDPR KL+Y+   +  +Y        +  L  ALN +Y++Y
Sbjct  411   DKYWGDVEKMNMLIFIAVVLDPRYKLDYVEWMITQIYRVDVASTLITNLREALNAMYEEY  470

Query  1291  AVSYSPSVVPATGSGSV  1241
                +S S V    +G +
Sbjct  471   R-GFSSSDVLKEEAGII  486


 Score =   110 bits (275),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  + SHKGE I   +E CL++W L  VF +TVDNASSND A+G+L+RK   W S  +K
Sbjct  202   NFCLISSHKGEEIGKEVEKCLLDWELEKVFCITVDNASSNDTAIGYLRRKNNHWKSRFLK  261

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
              +YLHMRC+AHI+NLVV D LK  + +V RVR  VR+++ SP++L +F+
Sbjct  262   GRYLHMRCVAHIINLVVSDGLKTMNESVNRVRHAVRFIKQSPARLLRFK  310


 Score = 52.4 bits (124),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RVS+TTDSWTSIQ+INYM +T HFID  W
Sbjct  166   RVSLTTDSWTSIQQINYMCLTVHFIDNNW  194



>ref|XP_010513423.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
Length=891

 Score =   154 bits (389),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 108/345 (31%), Positives = 172/345 (50%), Gaps = 62/345 (18%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQ----------KVFDDY--EYSDNSFKSDLGDSIP  1676
             + SL +DVPTRWNSTYLML SAL  +          K++DDY  E  + + K  +G  + 
Sbjct  483   RGSLPMDVPTRWNSTYLMLTSALKLRVPFERMLSEDKLYDDYFLEIDEQTKKKRVGPPL-  541

Query  1675  TSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDL-YCILNEMVEADGAVKL  1499
                                     I     VT++  ++EI ++   ++ +   ++  V+ 
Sbjct  542   ----------------------FLIGKMFQVTSSLCYNEIVNIERNLITKCGNSNEKVRK  579

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK--KGKDYLEKL  1325
                 M+ KFEKY   +  MN ++  A++ DPR+K+++    +  +YG    + K     +
Sbjct  580   DAHTMRDKFEKYWDGLINMNPLVIVASVFDPRNKMQFANLCIEQLYGKDTVECKQLTSSV  639

Query  1324  LAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMEL  1145
              + + +LY++Y   +S  +     + S  +     E               +   +RME+
Sbjct  640   SSVMKKLYEEYNFRHSKPIEVEEPADSEPAPTTTCELSDDD---------DEDGCERMEV  690

Query  1144  LGGKKI----------ELEYYLSEAI-----TEDEGSFDILRWWKVNSARFPILSKIARD  1010
             +  K +          EL+ YL+E       T     +D+L WWK NS +FPILS++A+D
Sbjct  691   IYNKLVNSKRKVDGCSELDIYLNEKTEMRVETTLGFPYDVLSWWKCNSQKFPILSEVAKD  750

Query  1009  ILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             +LAI +S+VASES FS SGR+LD +RSSLTP +VE L+CTQ WLR
Sbjct  751   VLAIQVSSVASESVFSTSGRILDPYRSSLTPYMVEMLLCTQQWLR  795


 Score = 85.1 bits (209),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 55/84 (65%), Gaps = 2/84 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKV-LSWGSSSV  2002
             SF  V  HKG  IA  L  CL EWG++ VFTVTVDNA  ND AL   K ++ L  G + V
Sbjct  363   SFKVVTDHKGSTIAGQLLDCLEEWGIQKVFTVTVDNAKGNDKALKEFKDEMRLRGGEALV  422

Query  2001  K-SKYLHMRCIAHILNLVVQDSLK  1933
             +   ++HMRC AHILNL+V DSLK
Sbjct  423   RDGDFIHMRCCAHILNLIVGDSLK  446


 Score = 40.0 bits (92),  Expect(3) = 5e-59, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSW-TSIQRINYMVVTAHFIDEEW  2196
             QR+S+TT  W +S   +NYMVVT H+IDE W
Sbjct  325   QRISLTTYIWVSSTTSVNYMVVTGHWIDENW  355



>ref|XP_007221311.1| hypothetical protein PRUPE_ppa025777mg, partial [Prunus persica]
 gb|EMJ22510.1| hypothetical protein PRUPE_ppa025777mg, partial [Prunus persica]
Length=697

 Score =   178 bits (451),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 118/320 (37%), Positives = 183/320 (57%), Gaps = 16/320 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             +E K  L  DVPTRWNST+LM+ SAL YQ+ F   + SD+++K  L        +W  + 
Sbjct  349   LECKRGLRQDVPTRWNSTFLMIDSALYYQRAFLHLQLSDSNYKHSLSQD-----EWGKLE  403

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEM-VEADGAVKLMGANMKAKF  1472
              L K LK FY++T   SG+ Y TAN +F ++  +   L +  V++D  +K M   M   F
Sbjct  404   KLSKFLKVFYDVTCLFSGTKYPTANLYFPQVFVVEDTLRKAKVDSDSFMKSMATQMMEMF  463

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYG-DKKGKDYLEKLLAALNELY-D  1298
             +KY     + + +   A ILDPR K++++      +YG + +    +  +L +L +LY  
Sbjct  464   DKY---WKEYSLIPAIAVILDPRYKIQFVEFCYKRLYGYNSEEMTKVRDMLFSLFDLYFQ  520

Query  1297  DYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELE  1118
              Y+ S S S   +  +G+ + V+ +V      V +     +++           +K +L+
Sbjct  521   IYSSSESVSGTSSASNGARSHVDDMVSKECLDVMKEFDNFESE-----EFTTSAQKTQLQ  575

Query  1117  YYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDH  938
              YL E   + +   ++L +WKVN  R+P LS +ARD+L+IPISTVASESAFS+ GRVLD 
Sbjct  576   LYLDEPKIDRKTKLNVLDFWKVNQFRYPELSILARDLLSIPISTVASESAFSVGGRVLDQ  635

Query  937   FRSSLTPKIVEALVCTQDWL  878
             +RS+L P+ VEALVCT+DW+
Sbjct  636   YRSALKPENVEALVCTRDWI  655


 Score = 65.5 bits (158),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 70/113 (62%), Gaps = 2/113 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             SF+P   H G  +   +   L +WG+ + +F++T+DNASSND  +  LK +     +  +
Sbjct  233   SFMP-PPHTGVTLCEKIYKLLTDWGVEKKLFSMTLDNASSNDTFVELLKGQPNLKDALLM  291

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
               K+ ++RC AHILNL+VQD LK  D +V ++RE ++YVR S  + +KF + A
Sbjct  292   NGKFFYIRCCAHILNLIVQDGLKHIDDSVGKIRESIKYVRGSQGRKQKFLNCA  344


 Score = 35.4 bits (80),  Expect(3) = 5e-59, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RV + +D WTSI    Y+ +T HFID  W
Sbjct  195   RVCLASDLWTSITTDGYLCLTVHFIDVNW  223



>gb|AAG51228.1|AC035249_3 Tam3-like transposon protein; 93317-95488 [Arabidopsis thaliana]
 gb|AAG51515.1|AC068324_3 hAT-element transposase, putative [Arabidopsis thaliana]
Length=723

 Score =   165 bits (417),  Expect(3) = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/348 (32%), Positives = 172/348 (49%), Gaps = 31/348 (9%)
 Frame = -2

Query  1843  RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSI-----  1679
             +V  G   + SL LDV TRWNSTYLML  A+ ++  FD  E  D  +     + +     
Sbjct  346   KVVTGKMTRGSLPLDVKTRWNSTYLMLTRAIKFKVAFDKMEAEDKLYNDHFLEVVDGEKR  405

Query  1678  ---PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DG  1511
                PT++DW  V  LVK L  FY  T+ +S S  V +   + EI  +   L  M  + D 
Sbjct  406   IGPPTTIDWREVERLVKFLGLFYTATLVVSASSIVCSYKCYGEIVTIEKNLLGMTHSYDK  465

Query  1510  AVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYG--DKKGKDY  1337
              ++     M+ KF+KY      +N M+  A++ DPR K+E+       +YG    + K+ 
Sbjct  466   ELREKAVEMREKFDKYWDGQKNINRMLIIASVFDPRQKMEFAKMCFEKLYGVDTSEAKEM  525

Query  1336  LEKLLAALNELYDDYAVSY----SPSVVPATGSGSVASVNLVVEFV------FTPVGRPQ  1187
                +   +  +  +Y V +    + S      S + A      E        F  + R  
Sbjct  526   YNSVYDVMKAMLKEYTVIFKGPNTQSSQSNPPSSTAARDTFACELAEDSNVEFERMDRSY  585

Query  1186  HLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEG----SFDILRWWKVNSARFPILSKI  1019
               +  +I+      +   K EL+ YL   +   +      +D+L WW++NS ++P+LS+I
Sbjct  586   KEMVNEIR------VTDPKDELDIYLKAEVENPKTLPGMEWDVLSWWRLNSQKYPVLSEI  639

Query  1018  ARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             ARD+LA+ +S+VASESAFS SGR+L+  RS LT  +VE LVC + WL+
Sbjct  640   ARDVLAMQVSSVASESAFSTSGRLLEPSRSCLTHYMVETLVCLEQWLK  687


 Score = 75.9 bits (185),  Expect(3) = 7e-59, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--V  2002
             F  +  HKG  I+  L  CL EWG+  +FT+TVDNA++N  AL   +R + S  + S  +
Sbjct  235   FKYIADHKGATISRVLLECLTEWGIERIFTITVDNATANTSALRKFQRALQSQRADSLVL  294

Query  2001  KSKYLHMRCIAHILNLVVQDSL  1936
                ++HMRC AHI+NL+V++ L
Sbjct  295   NGDFMHMRCCAHIINLIVKEGL  316


 Score = 38.1 bits (87),  Expect(3) = 7e-59, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
             +RVS+TTD WT+     +YMV+T HFIDE W
Sbjct  196   RRVSLTTDIWTAQATGASYMVITVHFIDEYW  226



>ref|XP_009623579.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=510

 Score =   219 bits (557),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 191/317 (60%), Gaps = 8/317 (3%)
 Frame = -2

Query  1786  WNSTYLMLQSALIYQKVFDD--YEYSDNSFKSDLGDSIP-TSLDWESVNNLVKLLKCFYE  1616
             W     +++ ALI   V D+  + + +N   S  G   P  S DW +V ++++ L  F+E
Sbjct  116   WKFDQEVVRRALIEMIVIDELLFSFIENESGSSAG---PLESDDWVNVRSVIEFLARFHE  172

Query  1615  MTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKLMGANMKAKFEKY*GDIDKMN  1439
             +T ++SGS YVT N+ F ++S+LYC L   +V  D  ++ M   M+ KF+KY G  +KMN
Sbjct  173   LTKKVSGSCYVTCNSHFEDVSELYCHLKMCLVSEDKHLRKMAERMQEKFKKYWGGPEKMN  232

Query  1438  YMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSPSVVPA  1259
              +IF A++LDP +K EY+   L  ++G++KGK    ++ A +N L+++Y   YS    P 
Sbjct  233   KIIFIASVLDPHNKFEYVVGALEELFGEEKGKKINAEVYAYMNSLFEEYLKKYSTGSCPQ  292

Query  1258  TGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMEL-LGGKKIELEYYLSEAITEDEG  1082
             + S S +S N+      + +       K  +KKQ+ +   GG K +L+ Y+SE       
Sbjct  293   SPSSSTSSNNISNTSSGSVITASLIRTKLHLKKQKEDNGSGGAKSKLDKYISEEQEPFSE  352

Query  1081  SFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEA  902
              FDIL WWK ++ RFPIL ++ARD+LAIPIS+VASE AFS   R+LD FRSSLTPK V+A
Sbjct  353   EFDILSWWKTHAPRFPILLELARDVLAIPISSVASECAFSTGDRILDSFRSSLTPKCVQA  412

Query  901   LVCTQDWLRRPNTPISI  851
             LVC QDWLR     IS+
Sbjct  413   LVCVQDWLREEKNSISV  429



>ref|XP_009338975.1| PREDICTED: uncharacterized protein LOC103931266 [Pyrus x bretschneideri]
Length=1143

 Score =   181 bits (459),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 122/349 (35%), Positives = 194/349 (56%), Gaps = 33/349 (9%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSF----KSDLGDSI------  1679
              ++ +S+  DV TRWN+TY ML SA  +++VF    +  +SF    K ++   +      
Sbjct  546   FDRMSSIPFDVVTRWNATYEMLNSAFKFKEVFSKMAFECDSFIAYFKEEVSKEVDGVTTK  605

Query  1678  ------PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV--  1523
                   P   DWE   +    LK FY+ T+ +S +L  T++   S +  L   + E +  
Sbjct  606   TKRVGPPEVDDWERSMSFAHFLKKFYDATLTLSATLTPTSHLILSTVIALQVEIQEQILN  665

Query  1522  EADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHM-YGDKKG  1346
              A+  ++ +  +MK KF+KY G I+K+N ++F A +LDPR K + + T L  + YG  K 
Sbjct  666   AANATLQSVATSMKLKFDKYWGHIEKVNPILFVAQVLDPRYKFDMLETNLEELGYGWDKI  725

Query  1345  KDYLEKLLAALNELYDDY--AVSYSPSVVPATGSGSVASVNLVVEFVFTPVG------RP  1190
             ++   ++   + ELY+ Y   V  S S   +T S + ++V      V   VG        
Sbjct  726   REEKVRVKGYVTELYNAYKEGVVLSSSSTSSTSSSATSNVEQRSSVVLDDVGGVIVDIDV  785

Query  1189  QHLLKAQIKKQRMELLGGK-KIELEYYLS---EAITEDEGSFDILRWWKVNSARFPILSK  1022
                +  +I+++R E    +   E++ Y +   +++T +   F++L WWK N A++P LSK
Sbjct  786   ASRMTKKIQRKRAEAQQNEIANEVDMYFNDPHQSLTYE--GFNLLDWWKGNCAQYPTLSK  843

Query  1021  IARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             +A+D+LA+P STVASE+AFS+ GRV+D FR+SLTPK VEALVCT DWLR
Sbjct  844   VAKDVLALPSSTVASENAFSLGGRVVDPFRTSLTPKTVEALVCTSDWLR  892


 Score = 76.3 bits (186),  Expect(2) = 8e-59, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -3

Query  2106  GLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHILNLVVQDSLKQC  1927
             GLR VF++TVDNAS+ND A+ ++KR++ S G+  +   +LHMRC  HILNL+V+D + + 
Sbjct  455   GLR-VFSITVDNASANDTAIAYMKRRLKSNGTLLLDGAHLHMRCACHILNLIVKDGMTEL  513

Query  1926  DITvkrvrevvryvRSSPSKLKKFRD  1849
                +  +R  V+++ SSP++L+ FR+
Sbjct  514   SCEIDAIRNCVKFIHSSPARLESFRE  539



>ref|XP_010417754.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
Length=397

 Score =   214 bits (545),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 130/322 (40%), Positives = 184/322 (57%), Gaps = 13/322 (4%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGD---SIPTSLDWE  1658
             +E K  LCLDV TRWNST+LMLQSA+  +K FD  E  D  +  +L     + P+  DW 
Sbjct  52    VETKAGLCLDVETRWNSTFLMLQSAVALKKGFDMLELEDEKYVVELTKICKAAPSDSDWA  111

Query  1657  SVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEM-VEADGAVKLMGANMK  1481
                 L  +L+ FY+ T+ ISGS YVT NT+  EI  +  ++ +M    D   K M   MK
Sbjct  112   YATALSPILQYFYDATVNISGSKYVTGNTYMKEIFGVGWMIMKMDTMGDEYKKAMAEKMK  171

Query  1480  AKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELY  1301
              KF KY G+ D  N MI+ A +LDP+ K+ ++   +   Y + +    + K+  AL++L+
Sbjct  172   LKFYKYWGNFDNTNMMIYVAAVLDPQYKMRWVKWMIQGTYPNSEASCLITKITNALDKLF  231

Query  1300  DDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
             +     Y  S+      GS  +VN  ++       R   + +    ++ +E     K EL
Sbjct  232   E-----YYTSLQLQESVGSEGNVNSGLDRSKDRTQRHVMMDEMFDDEESVET-DSTKSEL  285

Query  1120  EYYLSEAITEDEGS--FDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRV  947
             EYYL + I ED  +  FDIL WW    +++ +LS +ARD+LAI +STV SESAFS   RV
Sbjct  286   EYYL-DYIREDRKNPDFDILHWWNTTGSKYKVLSLMARDMLAIHVSTVTSESAFSAGSRV  344

Query  946   LDHFRSSLTPKIVEALVCTQDW  881
             LD FRSSLTP++VEAL+CTQDW
Sbjct  345   LDRFRSSLTPRVVEALICTQDW  366


 Score = 42.7 bits (99),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -3

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKKHPCV  1804
             MRC AHIL L+V+D L++    + R+R  VRYVRSSPS+LK+FR+  E+    +K   C+
Sbjct  1     MRCGAHILGLIVRDGLQEVHGAILRIRSAVRYVRSSPSRLKRFRECLEHQKVETKAGLCL  60



>ref|XP_007198867.1| hypothetical protein PRUPE_ppa018871mg [Prunus persica]
 gb|EMJ00066.1| hypothetical protein PRUPE_ppa018871mg [Prunus persica]
Length=553

 Score =   152 bits (385),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/326 (33%), Positives = 167/326 (51%), Gaps = 36/326 (11%)
 Frame = -2

Query  1816  TSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGD---------SIPTSLD  1664
              +L +DV T WNSTY M   A  Y+ VF+     + +F++   +           P++ D
Sbjct  223   ANLPMDVVTSWNSTYRMFDCAFKYKIVFNRMAAENVAFQAYFEEIDKDGMKRVGPPSNED  282

Query  1663  WESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILN-EMVEADGAVKLMGAN  1487
             WE     V  LK FY+ T+++S +  + +N  F E+  L   +  +M ++  AV      
Sbjct  283   WEKSIPFVHFLKKFYDTTLKLSATKTIISNIIFHELVSLQVEIELQMSDSRDAV------  336

Query  1486  MKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK-KGKDYLEKLLAALN  1310
                           +  MIF A +LDPR KL+ +     ++  ++ K  + + ++   L 
Sbjct  337   --------------LQRMIFVALVLDPRFKLQMLKISFQNLKAEENKIDEVVHEVRTCLF  382

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK  1130
              L+++Y  +    + P    G   +V   +E       +  H L  Q K++++  +    
Sbjct  383   NLHNEYRGADGLVIQP-MNEGEDENVGNDLEGYDDVQTKMFHQLVQQRKEEQLVEISN--  439

Query  1129  IELEYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
              E++ YL++         F +L WWK N +R+PILSKIA+DI AIP STVAS +AFS+  
Sbjct  440   -EVDKYLTDPFESLFTKGFKLLNWWKGNESRYPILSKIAKDIFAIPSSTVASGNAFSLGK  498

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLR  875
             R++D FRSSLTPK+VEALVCT DWLR
Sbjct  499   RIVDPFRSSLTPKMVEALVCTSDWLR  524


 Score = 72.8 bits (177),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 67/112 (60%), Gaps = 15/112 (13%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  + SHKG  I   L +CL  WG+  +F++TVDNAS+ND A+ ++  +          
Sbjct  118   NFTKITSHKGIEIGKTLCACLNAWGIEKLFSITVDNASANDGAVVYVGNR----------  167

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
                  M+C  HILNL+V+D LK+   ++K +R  V+Y+ SSPS+L  FRD A
Sbjct  168   -----MKCACHILNLIVKDELKELLSSIKGIRNCVKYIHSSPSRLDSFRDHA  214


 Score = 52.4 bits (124),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
              RVSITTD+WT IQ INYMVV AHF+D EW
Sbjct  81    HRVSITTDTWTLIQNINYMVVIAHFMDSEW  110



>gb|AAM18172.1|AC092172_32 Putative activator-like transposable element [Oryza sativa Japonica 
Group]
 gb|AAP52767.1| hAT family dimerisation domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=737

 Score =   189 bits (480),  Expect(3) = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/329 (38%), Positives = 177/329 (54%), Gaps = 28/329 (9%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             G++    L LDVPTRWNST+LML+ A+ Y+  F+         +       PT  DW   
Sbjct  374   GLDITCGLSLDVPTRWNSTFLMLKQAIHYRLAFNRLFL---RHRHKYLKCAPTDDDWTMA  430

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-----ADGAVKLMGAN  1487
              +L   LK FY+ T+  SGS Y TAN FF++    +C +   VE     ++  +  MG +
Sbjct  431   KSLCTCLKRFYDATLIFSGSSYPTANLFFTK----FCQIKMAVEDWCHSSNTVIATMGKS  486

Query  1486  MKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNE  1307
             MK K++KY    +K N  +  A  LDPR K   +      +YG+   K ++   +A +N+
Sbjct  487   MKPKYDKY---WEKSNMALSVACFLDPRFKRTLLEYYADKVYGESAPK-HMADFMAIINK  542

Query  1306  LYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG---G  1136
             L+D YA S   S +PA  +  V +  LV +      G     L A + +          G
Sbjct  543   LFDTYASSQPTSKIPA--ATDVQNNPLVTK---EYDGESDDELDADVLQYLRASTAPGIG  597

Query  1135  KKIELEYYLSEAITE----DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESA  968
              K ELE Y+ + + E    D+  F+IL WW +     PILS++ARD+LAI +STVASESA
Sbjct  598   TKSELEVYMDQPLLEWDIKDKSPFNILHWWSLKQHELPILSRLARDVLAIQVSTVASESA  657

Query  967   FSISGRVLDHFRSSLTPKIVEALVCTQDW  881
             FS  GRV+D FRS L P+IV+AL+CT+DW
Sbjct  658   FSAGGRVIDPFRSCLDPEIVQALICTKDW  686


 Score = 54.3 bits (129),  Expect(3) = 2e-58, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 40/77 (52%), Gaps = 1/77 (1%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHM  1981
             H G  +       +++W L R +  +T+DNAS+NDV    L +K+           + H+
Sbjct  264   HSGNNLCKVFYDSVLDWNLDRKLLALTLDNASANDVCARGLVQKLNKIQPLICDGAFFHV  323

Query  1980  RCIAHILNLVVQDSLKQ  1930
             RC  HI NLV QD LKQ
Sbjct  324   RCFNHIFNLVAQDGLKQ  340


 Score = 33.5 bits (75),  Expect(3) = 2e-58, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R   T D WTS Q   YM +T H+ID+ W
Sbjct  220   RFCTTMDMWTSNQNKCYMCITVHWIDDNW  248



>gb|EPS65408.1| hypothetical protein M569_09369 [Genlisea aurea]
Length=333

 Score =   212 bits (539),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 180/312 (58%), Gaps = 15/312 (5%)
 Frame = -2

Query  1768  MLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLVKLLKCFYEMTIRISGSL  1589
             ML+ A+ +QK FD  E +D  + ++LG+ IPT  DW   N L+  LK FY+ T+++S S 
Sbjct  1     MLEKAVKFQKAFDLLEAADRKYVNELGNKIPTEDDWSYANKLLPFLKIFYDTTLKLSASY  60

Query  1588  YVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANIL  1412
             YVT N +  EI  +  +L +M ++ D     M   MK K++KY G ID +N +IF A +L
Sbjct  61    YVTGNEYMKEIYGIGFLLLKMCQSEDPETSQMATKMKGKYDKYWGQIDNINVLIFVATVL  120

Query  1411  DPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYA--VSYSPSVVPATGSGSVA  1238
             DPR KL Y+   +   Y  +       K+   L  ++D Y   +  S  V       +  
Sbjct  121   DPRYKLSYVSLVIDKAYVVEVATALKSKINTVLYSMFDVYGAPLLQSKQVTHQVEDKTSM  180

Query  1237  SVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG--GKKIELEYYLSEAITE-DEGSFDIL  1067
              V+ +V       G    +    +  + ++ LG    K EL+ YL E   + ++ SF IL
Sbjct  181   DVDHIV-------GAADFM--NSMFDEEVDNLGITENKTELDIYLLEMKADRNDKSFSIL  231

Query  1066  RWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQ  887
              WWK N++R+P+L  +ARD+L++P+STVASESAFS  GRVLD FRSSLTPK+VEALVCTQ
Sbjct  232   NWWKSNASRYPVLGMMARDLLSMPVSTVASESAFSTGGRVLDPFRSSLTPKMVEALVCTQ  291

Query  886   DWLRRPNTPISI  851
             DWLR+ +  I I
Sbjct  292   DWLRKNHESICI  303



>ref|XP_007225084.1| hypothetical protein PRUPE_ppa017579mg [Prunus persica]
 gb|EMJ26283.1| hypothetical protein PRUPE_ppa017579mg [Prunus persica]
Length=629

 Score =   120 bits (302),  Expect(3) = 4e-58, Method: Compositional matrix adjust.
 Identities = 85/286 (30%), Positives = 145/286 (51%), Gaps = 25/286 (9%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSF----------KSDLGDSI  1679
             +++  ++ +DVPTRWN+TY ML+ A  Y++VF+   YS   F          K  +   +
Sbjct  351   MDKMANVPMDVPTRWNATYKMLEGAFKYRQVFEKMTYSCEVFQAYFLEEEKVKKVMAKRV  410

Query  1678  --PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE--ADG  1511
               P   DWE     V  LK  Y+ T+++S +   T+   F E+  L   +   ++   + 
Sbjct  411   GPPKDDDWEKALAFVHFLKKIYDATLKLSATKTCTSPIIFLELVALQVQIEAKMKDPRNP  470

Query  1510  AVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLE  1331
              ++ + + MK KF+KY G  D +N +IF  N+LDPR KL+ +     ++ GD + +D + 
Sbjct  471   TMQRVASLMKLKFDKYWGSFDVVNKLIFLGNVLDPRMKLQMLQISFGNLGGDARKQDEIV  530

Query  1330  K-LLAALNELYDDY-AVSYSPSVVPATG-SGSVASVNLVVEFVFTPVGRPQHLLKAQIKK  1160
             K ++  LNELY++Y  V    S +        VA +   V+  F  +   Q L++ +  +
Sbjct  531   KEVVKCLNELYNEYKGVGGGVSQIDEDEIDDEVAQIGDDVDVTFQLM---QQLVQKRKDE  587

Query  1159  QRMELLGGKKIELEYYLSEAITED-EGSFDILRWWKVNSARFPILS  1025
             Q +E+      E++ YL++         F++L WWK N  R+PILS
Sbjct  588   QSVEISN----EVDKYLTDPFESPLSKQFNLLNWWKGNQTRYPILS  629


 Score =   101 bits (252),  Expect(3) = 4e-58, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             SF  + SHKG  I   L++CL +WG+  VFT+TVDNAS+ND A+ ++ + + +  +  + 
Sbjct  235   SFTKITSHKGIDIGKTLDACLTDWGIHKVFTITVDNASANDGAVEYMAQSLKAMNTLMLD  294

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              KYLH+RC  HILNL+V+D LK+   +++ +R  V+++ SSP++L KFR+ A
Sbjct  295   GKYLHLRCACHILNLIVKDGLKELSASIEGIRNCVKFIHSSPARLDKFREFA  346


 Score = 53.9 bits (128),  Expect(3) = 4e-58, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             +RVSITTD+WTSIQ INYMVVT HF+D +W
Sbjct  198   KRVSITTDTWTSIQNINYMVVTIHFMDSDW  227



>emb|CDX79550.1| BnaC03g18860D [Brassica napus]
Length=623

 Score =   174 bits (442),  Expect(3) = 5e-58, Method: Compositional matrix adjust.
 Identities = 123/357 (34%), Positives = 185/357 (52%), Gaps = 40/357 (11%)
 Frame = -2

Query  1852  GFG--RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSI  1679
             G G  RV  G   + SL LD  TRWNSTYLML +AL ++ VF+     D  +   L ++ 
Sbjct  245   GLGELRVLKGKVSRGSLSLDCITRWNSTYLMLCAALKFRVVFEKLLAEDMMYNDYLNEAE  304

Query  1678  ---------PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEI----SDLYCI  1538
                      PTS  W+ V  LVK LK F+  T+  S S  VT+   ++EI     +L  +
Sbjct  305   ESGHKRVGPPTSHGWDEVQRLVKFLKLFFGCTLAFSASKTVTSTICYNEIVVIERNLVSL  364

Query  1537  LNEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYG  1358
              N     DG +K+    M+ KFEKY   +  MN +I  A++LD R+K+++    L  +YG
Sbjct  365   SNR---KDGLLKIQAREMRNKFEKYWDGLINMNPLIIIASVLDLRNKMQFACICLAKLYG  421

Query  1357  DKKGKDYLEK------LLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVG  1196
                 KD +E       +   L +LY++YAV   P     +   +  +V      +F    
Sbjct  422   ----KDSVESTHLRSSIRTLLKDLYEEYAVKMRPQSQGDSAGNTSENVEHETGNMFDISD  477

Query  1195  RPQH-----LLKAQIKKQRMELLGGKKIELEYYLSE---AITED--EGSFDILRWWKVNS  1046
               +       L ++++ +     G  K+++  YL E     T D     FD+L  W+ NS
Sbjct  478   DDEEYEGRDFLYSEMESEVTNDEGSSKLDI--YLMEIPVPRTSDSIRREFDVLLTWRRNS  535

Query  1045  ARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             A++P+LS++ +D+LA+ +S VASES FS SGR+LD +RS LTP ++E LVCT  WL+
Sbjct  536   AKYPVLSELVKDVLAVQVSYVASESTFSTSGRILDPYRSCLTPYMIETLVCTHQWLQ  592


 Score = 77.0 bits (188),  Expect(3) = 5e-58, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 47/84 (56%), Gaps = 2/84 (2%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV--  2002
             F PV  HKGE IA  L  CL +WG+  VFTVTVDN   ND A+          G  ++  
Sbjct  165   FKPVTYHKGEPIAEHLSQCLEDWGIDKVFTVTVDNTKGNDKAIRLFTEACRQVGPYALVK  224

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQ  1930
                 LHMRC AH+LNL V+D L +
Sbjct  225   NGVLLHMRCCAHVLNLTVRDGLGE  248


 Score = 24.3 bits (51),  Expect(3) = 5e-58, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -1

Query  2234  YMVVTAHFIDEEW  2196
             YMVVTAH+I++ W
Sbjct  144   YMVVTAHWIEKNW  156



>ref|XP_010686703.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Beta vulgaris subsp. vulgaris]
Length=691

 Score =   176 bits (445),  Expect(3) = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/321 (36%), Positives = 165/321 (51%), Gaps = 27/321 (8%)
 Frame = -2

Query  1825  EQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNN  1646
             E K  L LD  TRWNSTY ML  A+ Y++VF      DN +K+      P   DW  V  
Sbjct  358   EFKRKLALDCKTRWNSTYEMLSVAISYREVFVVLGARDNLYKNP-----PICEDWIKVEK  412

Query  1645  LVKLLKCFYEMTIRISGSLYVTANTFFSEISDL-YCILNEMVEADGAVKLMGANMKAKFE  1469
             + + L+ F  +T+  S S Y TAN +F ++  L + + N ++     V+ M   M  K+ 
Sbjct  413   ICEKLELFSTITLDFSASKYPTANIYFPKVCALRFALTNWLLSPYDYVRKMAEVMLEKYN  472

Query  1468  KY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYA  1289
             KY   +   N ++  A ILDPR K+  +      +Y   +    + K+   L +L D+Y 
Sbjct  473   KYWAGV---NSLLGVATILDPRYKMALIRFHFAKLYNGSEIDREVNKIQDLLKQLVDEYG  529

Query  1288  V----SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
                  + S S  P   +  V    L+ EF             A+  +Q    +  K  +L
Sbjct  530   SENGRAQSSSNRPCVSTSEVTGDVLMQEF-------------AEFLEQDQSQMNNKS-DL  575

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLD  941
             E YL +       +FDIL WWK N   +PIL +IARDIL+IP+S+VASESAFS SGRVL 
Sbjct  576   EKYLGDPNVPLVANFDILNWWKTNGNSYPILQRIARDILSIPVSSVASESAFSTSGRVLS  635

Query  940   HFRSSLTPKIVEALVCTQDWL  878
              +RS L P+ VEAL+CTQ+W+
Sbjct  636   PYRSRLLPETVEALMCTQNWI  656


 Score = 62.4 bits (150),  Expect(3) = 5e-58, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 3/81 (4%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLR-NVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +VP   H    +A  L+ C+  W +   +  +TVDN ++ND  +  L R    +GS  + 
Sbjct  242   YVPA-PHTAVVLAETLKECIQSWNIDLKLSAITVDNCTTNDAMMDIL-RDEFPYGSLMLH  299

Query  1998  SKYLHMRCIAHILNLVVQDSL  1936
              ++ HMRC AHILNL+VQD L
Sbjct  300   GEFFHMRCCAHILNLIVQDGL  320


 Score = 37.7 bits (86),  Expect(3) = 5e-58, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 21/30 (70%), Gaps = 1/30 (3%)
 Frame = -1

Query  2282  RVSITTDSWTSI-QRINYMVVTAHFIDEEW  2196
             R+++TTD WT+  Q   YM VTAHFID  W
Sbjct  202   RIALTTDMWTANNQSKGYMAVTAHFIDSSW  231



>ref|XP_008655155.1| PREDICTED: uncharacterized protein LOC100381392 isoform X1 [Zea 
mays]
 ref|XP_008655156.1| PREDICTED: uncharacterized protein LOC100381392 isoform X1 [Zea 
mays]
 gb|ACL53668.1| unknown [Zea mays]
 gb|ACN31838.1| unknown [Zea mays]
Length=590

 Score =   189 bits (481),  Expect(3) = 5e-58, Method: Compositional matrix adjust.
 Identities = 121/325 (37%), Positives = 178/325 (55%), Gaps = 21/325 (6%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             G++ K +L LDV TRWNSTY+M++ A+ Y+  FD     D   K   G   P+S DW + 
Sbjct  247   GLDPKKTLSLDVATRWNSTYIMIRDAIYYKNAFDRLAKKD---KDKYGHINPSSTDWLNA  303

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
              N+ K LK FY++T+  SG+ Y TAN FF + S++   +    ++ D  +  M  +M+ K
Sbjct  304   TNISKCLKKFYDVTLLFSGTSYPTANHFFRKFSEIKMAIARWCDSSDLVICTMAFSMRHK  363

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKL--LAALNELY  1301
             F+KY    +  N  +     LDPR K   +   +  MYG  K +  LEKL  +  +NEL+
Sbjct  364   FDKY---WEMNNLALAVGAFLDPRYKHRMIELYMSKMYGSDKAE--LEKLVFMNVINELF  418

Query  1300  DDYAVSYSPSVVPA--TGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI  1127
                  +Y  +V+ A  T  GS +  +  V    T +   +       +         K  
Sbjct  419   -----AYYSAVINAKSTTKGSSSRESEFVPHKNTCLVDEEEDEVDLDELYATTSNDKKVS  473

Query  1126  ELEYYLSE---AITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSIS  956
             EL+ Y+SE    + ++E +FDIL WWK     FPILS +ARD+L++ +STVASESAFS  
Sbjct  474   ELDLYMSEDLVKVNDNEATFDILSWWKGQVTNFPILSTLARDVLSMQVSTVASESAFSSG  533

Query  955   GRVLDHFRSSLTPKIVEALVCTQDW  881
             GR++D FRS L P+ +EALVC +DW
Sbjct  534   GRIVDAFRSRLKPEFIEALVCCKDW  558


 Score = 43.9 bits (102),  Expect(3) = 5e-58, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 46/79 (58%), Gaps = 9/79 (11%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFL---KRKVLSWGSSSVKSK  1993
             SH G  +++   + ++ W L + +F +++DNA++N VA+  +    +++L         K
Sbjct  139   SHGGIKLSDTFFANVLNWNLDKKMFALSLDNAAANKVAVEIVIENAKELLV-----CDGK  193

Query  1992  YLHMRCIAHILNLVVQDSL  1936
             + H+RC  HILNLV +D L
Sbjct  194   FFHVRCANHILNLVARDGL  212


 Score = 42.0 bits (97),  Expect(3) = 5e-58, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RVS T D+WTSIQ  +Y+ VTAH+ID+ W
Sbjct  96    RVSFTMDTWTSIQNKSYLCVTAHWIDDHW  124



>ref|XP_007199162.1| hypothetical protein PRUPE_ppa019737mg [Prunus persica]
 gb|EMJ00361.1| hypothetical protein PRUPE_ppa019737mg [Prunus persica]
Length=630

 Score =   166 bits (419),  Expect(3) = 6e-58, Method: Compositional matrix adjust.
 Identities = 120/334 (36%), Positives = 180/334 (54%), Gaps = 24/334 (7%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVF------DDYEYSDNSFKSDLGD-SI---  1679
             I+ K  L L+  TRWNS Y ML++AL  ++ F      DD        K + G+ SI   
Sbjct  262   IDSKGLLPLECKTRWNSVYHMLEAALKLKRGFNSGGDRDDGILKKKKRKVEEGEISITKK  321

Query  1678  ---PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA  1508
                PT+ DWE     VK LK FYE TI+ S    +T+N   +E+  +   LN M+ +D  
Sbjct  322   LKPPTTADWEYARAFVKFLKIFYEETIKFSAYKTITSNIPCNEMLSIVDELNSMIRSDDI  381

Query  1507  -VKLMGANMKAKFEKY*G-DIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGD-KKGKDY  1337
              +K +  +M  KF+KY G +I ++N ++  A +LDP  K++Y+      +  D  K    
Sbjct  382   FLKKVATSMIKKFDKYWGSNIQEVNQVLIVAVVLDPHYKMDYVQYSFDEVESDDSKVSAM  441

Query  1336  LEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQ  1157
             +E +   L  +Y+ Y     P+   +    +V S   V       V      LK  ++ +
Sbjct  442   VEGVKDLLMWMYEAYK-KEEPAAAQSNAEANVKSGGEV------RVECNDLRLKKFVRTR  494

Query  1156  RMELLGGKKIELEYYLSEAITEDEGS-FDILRWWKVNSARFPILSKIARDILAIPISTVA  980
             +  ++   K E++ YL EA  + E + FD+L WW+ NS RF +LSKIA D+ A+PIS+V 
Sbjct  495   KDRVMVQIKNEVDKYLLEAAQDPEITYFDLLDWWRENSPRFSVLSKIAMDVFAVPISSVP  554

Query  979   SESAFSISGRVLDHFRSSLTPKIVEALVCTQDWL  878
             S++ FS+  RV+D FR+SLTPKIVEALV  +DWL
Sbjct  555   SKTVFSMGKRVVDPFRASLTPKIVEALVSPKDWL  588


 Score = 73.6 bits (179),  Expect(3) = 6e-58, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 60/109 (55%), Gaps = 14/109 (13%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  + +H+G+ I   +E CL +W +  VFT+T+DN  + D A+  +KR++  WG+    
Sbjct  160   NFYQITNHRGDAIGRLVEDCLHDWVIDKVFTITLDNVVAYDEAIRHMKRQLKLWGTLLPD  219

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
                LHMRC AHILNL+  D    C  T           RSSPS+L K R
Sbjct  220   GDRLHMRCCAHILNLIEFDI---CVYT-----------RSSPSRLDKVR  254


 Score = 36.2 bits (82),  Expect(3) = 6e-58, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -1

Query  2279  VSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             VS+TT +W S+  +N M + AHFID+ W
Sbjct  125   VSLTTYTWISLHNVNCMALIAHFIDDSW  152



>gb|EAZ01015.1| hypothetical protein OsI_23049 [Oryza sativa Indica Group]
Length=342

 Score =   210 bits (535),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 126/325 (39%), Positives = 183/325 (56%), Gaps = 32/325 (10%)
 Frame = -2

Query  1786  WNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL----GDSIPTSLDWESVNNLVKLLKCFY  1619
             WNSTY ML  A  Y+K F+ Y   D  +K DL    G  +P   DW+    + + L+ FY
Sbjct  2     WNSTYHMLNIAQQYEKAFERYSDEDPYYKLDLEGHDGPGVPEKSDWDKARKMAEFLEHFY  61

Query  1618  EMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAKFEKY*GDI---  1451
             E+T+R+S +   T++TFF EI+ +  +L +   + D     MG  M  K++KY G+I   
Sbjct  62    ELTLRVSATSRPTSHTFFHEIAGVVVLLRQWCNSEDLLCAEMGKRMLLKYQKYWGEIGPG  121

Query  1450  -DKMNYMIFFANILDPRDKLE-YMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYS  1277
                +N ++FF   LDPR KL  Y+    + M+GD+ G+     ++ + + L+ +Y   Y+
Sbjct  122   VQNLNLIVFFCVALDPRYKLNSYIKMATMVMFGDEIGEQLWTTVVNSFHSLFHEYKEIYT  181

Query  1276  PS---VVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGK----KIELE  1118
             P+     P    GS+++               + L+++ I  Q+M   G      K EL+
Sbjct  182   PNEPVAAPNDIQGSLST--------------SKRLMRS-IVAQQMSNNGASRSIAKSELD  226

Query  1117  YYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDH  938
              Y SE   ED   FDIL++WK NS R P+LS++ARD+LAIPIS+VASESAFS  GR LD 
Sbjct  227   KYFSEDNEEDTKGFDILKYWKDNSTRLPLLSRMARDLLAIPISSVASESAFSAGGRTLDD  286

Query  937   FRSSLTPKIVEALVCTQDWLRRPNT  863
             FRSSLTP +VE L+C  DWLR  N+
Sbjct  287   FRSSLTPTMVERLICANDWLRGCNS  311



>ref|XP_006857388.1| hypothetical protein AMTR_s00067p00136180 [Amborella trichopoda]
 gb|ERN18855.1| hypothetical protein AMTR_s00067p00136180 [Amborella trichopoda]
Length=685

 Score =   182 bits (463),  Expect(3) = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/327 (35%), Positives = 173/327 (53%), Gaps = 30/327 (9%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI+ K ++ LDVPTRWNSTY ML   L  ++ F  +   D+     + + +P+  +WE V
Sbjct  365   GIQSKQNIFLDVPTRWNSTYHMLDVTLELREAFSCFAQCDS-----MCNMVPSEDEWERV  419

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEM-VEADGAVKLMGANMKAK  1475
               +   LK FY++T    GS Y TAN +F E+  ++  L E  +  +  +  M   MK K
Sbjct  420   KEICDCLKLFYDITNTFLGSKYPTANLYFPEVYQMHLRLVEWSMSLNKHISSMAIKMKEK  479

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY       N ++  A ++DPR KL+++      +YG+   + ++  +   + +L ++
Sbjct  480   FDKY---WKISNLVLAIAVVIDPRFKLKFVEYSYSQIYGND-AEHHIRMVRQGVYDLCNE  535

Query  1294  YAV--------SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG  1139
             Y            S +V  +T SG V +   +    F    R     +A           
Sbjct  536   YESKEPLASNSESSLAVSASTSSGGVDTHGKLWAMEFEKFVRESSSNQA-----------  584

Query  1138  GKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSI  959
              +K EL+ YL E I      F+I  WW++N+ RFP LSK+ARDIL IP+STV S+S F I
Sbjct  585   -RKSELDRYLEEPIFPRNLDFNIRNWWQLNAPRFPTLSKMARDILGIPVSTVTSDSTFDI  643

Query  958   SGRVLDHFRSSLTPKIVEALVCTQDWL  878
              G+VLD +RSSL P+ ++AL+C QDWL
Sbjct  644   GGQVLDQYRSSLLPETIQALMCAQDWL  670


 Score = 55.8 bits (133),  Expect(3) = 2e-57, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             SFV + S  G  IA  L   L +W + + +F++T+++AS NDVA   L+ ++    S  +
Sbjct  249   SFVNLPSRTGGAIAEVLLDLLSQWNVDKKLFSITLNSASYNDVAASSLRSRLSRNSSLPL  308

Query  2001  KSKYLHMRCIAHILNLVVQDSLK  1933
             + K  H+ C +H++NL+VQD L+
Sbjct  309   EGKIFHLCCCSHVVNLMVQDGLE  331


 Score = 35.4 bits (80),  Expect(3) = 2e-57, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S++ + W+S Q + Y+ + AH+ID+ W
Sbjct  213   RISLSANIWSSCQNLEYLCLIAHYIDDAW  241



>ref|XP_006283232.1| hypothetical protein CARUB_v10004265mg [Capsella rubella]
 gb|EOA16130.1| hypothetical protein CARUB_v10004265mg [Capsella rubella]
Length=701

 Score =   157 bits (397),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/344 (33%), Positives = 180/344 (52%), Gaps = 40/344 (12%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSAL----IYQKVFDD--------YEYSDNSFKSDLGDSIP  1676
             K+SL LD  TRW+STYLML++AL     ++K+ D+         E    + K  +G   P
Sbjct  324   KSSLSLDSITRWDSTYLMLKAALKLRVAFEKMLDEDKLYGEYFLETEKETGKKRVGP--P  381

Query  1675  TSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA-VKL  1499
              S  W+ +  LV  L+ F+  T+  S      ++   ++I+++   L E+   D   V+ 
Sbjct  382   ISATWDELERLVGFLRIFFHCTVGYSKHKSEASSNGHNDIANIDWNLIELSNNDDEEVQK  441

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEY--MPTQLVHMYGDKKGKDYLE--  1331
                +M+ KFEKY   +  +N ++  A++ DPR K+++  +  +++H      GKD LE  
Sbjct  442   QAKSMRDKFEKYWDGLININPLVIVASVFDPRKKMKFSSLCFEMLH------GKDSLEAN  495

Query  1330  KLLAALN----ELYDDYAV-----SYSPSVVPATGSGSVASVNLVVEFVFTPVG-RPQHL  1181
              L +++N     LY++Y       S   +    +  G      +V +     +  R   L
Sbjct  496   HLTSSINTVMRHLYEEYITMLDKQSQEDAAANQSDHGDSKQSIVVSDLPDNELFIRTDSL  555

Query  1180  LKAQIKKQRMELLGGKKIELEYYLSEAITEDE--GSFDILRWWKVNSARFPILSKIARDI  1007
              +  +KK R E  G    ELE YL E +        +D+L WWK  S  +P+LS++ARD+
Sbjct  556   YEMMLKKMREEQAGK---ELENYLIEPVERQSLGSDYDVLSWWKRKSWNYPVLSELARDV  612

Query  1006  LAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             LAI +S+ A ESAF  SGR+LD +RSSLTP I EA++C+Q WL+
Sbjct  613   LAIQMSSFAPESAFCTSGRILDPYRSSLTPYITEAVICSQQWLQ  656


 Score = 86.3 bits (212),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV-  2002
             SF PV   +GE IA  L  CL EWG+  VFTVTV+N  SND AL   K  +   G++++ 
Sbjct  204   SFKPVTDKEGETIARNLIECLDEWGIEKVFTVTVNNTESNDKALTLFKEAMRLKGANALV  263

Query  2001  -KSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
                ++LHMRC AHI+NL+V++S+++   ++  VR  V+YV+SS ++LK F   AE
Sbjct  264   KDGEFLHMRCCAHIVNLIVKESIERASDSIAAVRNAVKYVQSSFTRLKSFELCAE  318


 Score = 29.3 bits (64),  Expect(3) = 4e-57, Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRI-NYMVVTAHFIDEEW  2196
             +RVS+T D W +   + +YM+VTA +ID  W
Sbjct  166   KRVSLTVDIWEAPTTLCSYMIVTAFWIDVNW  196



>ref|XP_007221437.1| hypothetical protein PRUPE_ppa026657mg, partial [Prunus persica]
 gb|EMJ22636.1| hypothetical protein PRUPE_ppa026657mg, partial [Prunus persica]
Length=759

 Score =   156 bits (394),  Expect(3) = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/363 (31%), Positives = 177/363 (49%), Gaps = 78/363 (21%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNS-----FKSDLGD-------  1685
             IE K  + +DVPTRWNS+YLML +AL ++K FD      +S     FK + GD       
Sbjct  371   IECKGLVVMDVPTRWNSSYLMLDAALKFRKAFDRMGDDPDSSYLMYFKEEEGDDERIEGI  430

Query  1684  ----------------SIPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFF----  1565
                              +P+  DWE V   V  LK FY++T++IS SL+ T+++ F    
Sbjct  431   EGSGKGKGKSKTNKRVGLPSDEDWEKVMTFVMFLKTFYDVTLKISASLHPTSHSTFHDLL  490

Query  1564  ---SEISDLY-----CILNEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILD  1409
                 EI +LY       + E    D  +  M A+MK K++KY G++ K+N  +    ++D
Sbjct  491   AIDGEIRELYRYDVTIPIEEQTAMDTLLNDMAASMKKKYDKYWGELHKVNPFLMTGVVID  550

Query  1408  PRDKLEYMPTQLVHMYGDKKGKDYL-----EKLLAALNELYDDYAVSYSPSVVPATGSGS  1244
             P+ KL  +      ++ +    D L      ++   L  +Y+ Y  S +     +T + S
Sbjct  551   PQFKLRNLKHIFEEIFENDPTCDRLVAQRTNEVKQLLMNMYEVYKPSSNNIGATSTTNES  610

Query  1243  VASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEGSFDILR  1064
               S N                      +    L+ G    ++ YL + +   +  FD L 
Sbjct  611   GGSTN---------------------NETDSSLIFG----VDRYLLDPLESIDEEFDGL-  644

Query  1063  WWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQD  884
                    ++P L+ IA+D+LAIP  T+ASES FS SGRV+D FRSSL+P++VEAL+C+Q+
Sbjct  645   -------KYPTLASIAKDVLAIPTFTIASESCFSTSGRVIDSFRSSLSPRMVEALICSQN  697

Query  883   WLR  875
             W+R
Sbjct  698   WIR  700


 Score = 68.2 bits (165),  Expect(3) = 5e-57, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 73/137 (53%), Gaps = 28/137 (20%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSW------  2017
             +F  + SHK E I   LE+CLI+WG   + T+T +NA++N  A+ ++++K+  W      
Sbjct  227   NFCVIDSHKWESIRKLLENCLIDWGHEKILTITANNAATNTKAIEYVRKKINGWKDSNRQ  286

Query  2016  ----------------GSSSVKSKY------LHMRCIAHILNLVVQDSLKQCDITvkrvr  1903
                               S  K+K+      +HM C AHI+NL+V + LK+ + ++  +R
Sbjct  287   LGHSCPTSARCRTRTGSGSDSKAKFGSGPVNMHMSCSAHIINLIVNEGLKRLESSIVAIR  346

Query  1902  evvryvRSSPSKLKKFR  1852
               V+++R SPS+   F+
Sbjct  347   NAVKFLRFSPSRFSYFK  363


 Score = 48.1 bits (113),  Expect(3) = 5e-57, Method: Composition-based stats.
 Identities = 17/30 (57%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
              R+ +TTD+WTS+Q +NYMV+TAHF+D ++
Sbjct  190   HRICLTTDTWTSVQNVNYMVLTAHFVDSDY  219



>ref|XP_007213553.1| hypothetical protein PRUPE_ppa018046mg, partial [Prunus persica]
 gb|EMJ14752.1| hypothetical protein PRUPE_ppa018046mg, partial [Prunus persica]
Length=610

 Score =   139 bits (349),  Expect(3) = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/319 (32%), Positives = 148/319 (46%), Gaps = 53/319 (17%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    ++CLDVPTRWNSTYLML+ A  YQK F+            L  +  T L      
Sbjct  336   ISSHKAICLDVPTRWNSTYLMLEVAEKYQKAFEH-----------LRGTRYTVL------  378

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAKF  1472
                     F+E+       LYVT+N F  ++  ++  L     + D  +K+M  NM  K+
Sbjct  379   --------FFEI-------LYVTSNLFLKQLCMVHAQLQSWSHSKDVFLKIMAENMLKKY  423

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             EKY G   ++N  +F   +LDPR K  Y+      + G+ K      K+ + LNEL D Y
Sbjct  424   EKYWGSYQQINMYLFVVVLLDPRYKECYLQYYFSLLCGEDKTSKMTSKVRSKLNELCDQY  483

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYY  1112
              + Y  +V     + + + + +    V          +K   K    E     K E++ Y
Sbjct  484   KLLYHENVAHKDETHNPSEMEIDSNEVDFATAFTTGFMKLVEKTDGEEF----KTEVDRY  539

Query  1111  LSEAITEDEG-SFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHF  935
             L E     +  +FD+L WWK+NS ++   S                ES F+  GR+LD F
Sbjct  540   LIETCENPKNENFDLLGWWKMNSEKYIRFS---------------YESTFTTGGRILDPF  584

Query  934   RSSLTPKIVEALVCTQDWL  878
             RSSL+P+ VE L+CTQ+WL
Sbjct  585   RSSLSPRTVEVLICTQNWL  603


 Score = 86.3 bits (212),  Expect(3) = 1e-56, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  + + KG+ I  A+ +CL+EWG+  V TVTVDNA+SND A  FL +KV +W  S +K
Sbjct  220   NFRTIVNRKGDTIGRAIATCLLEWGIDKVLTVTVDNATSNDHAGTFLSKKVNNWNGSILK  279

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
              + +HM+  AHILNL+V++ L+    ++ R+R V RYV+ S ++ +KF+  AE
Sbjct  280   GENMHMKYCAHILNLIVKEGLEDFHESITRIRNVARYVKYSLARSQKFKACAE  332


 Score = 45.8 bits (107),  Expect(3) = 1e-56, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QRVS+TTD+W+S Q + YM +TAH+ID++W
Sbjct  183   QRVSLTTDTWSSHQNLIYMCLTAHYIDDQW  212



>gb|ADN33674.1| transposase [Cucumis melo subsp. melo]
Length=347

 Score =   207 bits (526),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 180/326 (55%), Gaps = 23/326 (7%)
 Frame = -2

Query  1804  LDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLVKLLKC  1625
             +DVPTRWNST+ ML  A+  QK F+  E  D S+     D IPT+ DW++    VK LK 
Sbjct  1     MDVPTRWNSTFTMLDGAIKCQKTFERLEEHDPSYLP--KDDIPTTEDWDNAKVFVKFLKT  58

Query  1624  FYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-----DGAVKLMGANMKAKFEKY*  1460
             F E+T++ S S+ VT+N FF E+    C++ E++       +  +  M  +M+ KF KY 
Sbjct  59    FSEVTMKFSASMSVTSNIFFHEL----CLIQEIIREYSSYENALLSQMTLSMQTKFNKYW  114

Query  1459  G--DIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAV  1286
             G    +K N +++ + +LDPR KL Y+         +   K +  K+  A   L DDY +
Sbjct  115   GITTSEKTNLLLYVSVVLDPRYKLAYVNYCFNEFLEEDCAKIWTNKVEEAFRRLCDDYYM  174

Query  1285  -------SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI  1127
                    S + S  P  G G   S + +     +   + +  +  + K+     L   K 
Sbjct  175   RMSKEKYSQTQSCTPIEGFG-FQSQSEIPSISSSGSYKARATVHDRFKQSNKTCLDDAKT  233

Query  1126  ELEYYLSEAITEDEGS--FDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
             E+  YL EA  +  G    D+L WWKVN++RF I+S++ARDI +IPISTV SESAFS  G
Sbjct  234   EVTRYLDEARIDCMGDEYLDLLTWWKVNASRFKIISQVARDIYSIPISTVPSESAFSTGG  293

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLR  875
             RVLD FRSSLTP+  EAL+C Q+W++
Sbjct  294   RVLDSFRSSLTPQTAEALICAQNWIQ  319



>ref|XP_010272686.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
Length=664

 Score =   178 bits (452),  Expect(3) = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/324 (35%), Positives = 170/324 (52%), Gaps = 21/324 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I  +  LCLD P RWN+TYLML  AL Y+  F   +  D+++        P+ ++WE V+
Sbjct  334   IYNEKGLCLDCPMRWNTTYLMLAVALEYRDAFSLLQEHDSAYTM-----APSDIEWERVS  388

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAKF  1472
              +   LK FYE++   SG  + TAN +F EI D++  L E  ++ D  +  MG  MK+KF
Sbjct  389   TICNYLKLFYEVSNVFSGIKHPTANLYFPEICDIHLQLIEWCKSSDVVISTMGLKMKSKF  448

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY       N  +  A ILDPR K++ +      +YG     + ++ +  ++ ELY++Y
Sbjct  449   DKY---WSTCNLALAVAVILDPRFKMKLVEYYYPQIYG-SSASERIKVVFDSIKELYNEY  504

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQ-----HLLKAQIKKQRMELLGGKKI  1127
             ++  + + +       V   N         V   +       L      QR       K 
Sbjct  505   SICSTLASLDQGLGWEVRGNNRFTGTCLPSVNNDRLSGFDKFLNETSNSQR------AKS  558

Query  1126  ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRV  947
             +L+ YL E +      F+IL WWKV+  R+PILS +ARD+L IP++TV   S  S+  RV
Sbjct  559   DLDKYLEEPVFPRNLDFNILNWWKVHMPRYPILSMMARDVLGIPMATVPLGSTISVGDRV  618

Query  946   LDHFRSSLTPKIVEALVCTQDWLR  875
             LD +RSSL P I++AL+ TQDWL+
Sbjct  619   LDPYRSSLNPDILQALISTQDWLQ  642


 Score = 58.2 bits (139),  Expect(3) = 4e-56, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 79/127 (62%), Gaps = 2/127 (2%)
 Frame = -3

Query  2178  SFVPV-KSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSS  2005
             +FV V  SH  + ++  L +CL+EW + R +F++T+D+ S+ND  +  ++ ++       
Sbjct  216   NFVMVDPSHTEDLLSEVLMTCLMEWDIDRKLFSMTLDDCSTNDNFVFRIRDRLTQNRLLL  275

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMEL  1825
                +   +RC +HILNL+VQD+L+  +  + ++RE VRYV+SS ++ +KF +LA+     
Sbjct  276   SNGQLFDVRCASHILNLIVQDALEAINEVIHKIRESVRYVKSSQARQEKFNELAQQVRIY  335

Query  1824  SKKHPCV  1804
             ++K  C+
Sbjct  336   NEKGLCL  342


 Score = 32.7 bits (73),  Expect(3) = 4e-56, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   W S +   Y+ +TA +IDE W
Sbjct  180   RLSLTAGMWASCENGGYLCLTAQYIDETW  208



>ref|XP_007199292.1| hypothetical protein PRUPE_ppa023051mg [Prunus persica]
 gb|EMJ00491.1| hypothetical protein PRUPE_ppa023051mg [Prunus persica]
Length=507

 Score =   177 bits (448),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 115/323 (36%), Positives = 182/323 (56%), Gaps = 30/323 (9%)
 Frame = -2

Query  1804  LDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDS---------IPTSLDWESV  1652
             +DV T W STY ML  A  Y+ +F+     + +F++ + ++         +P++ DWE  
Sbjct  195   IDVVTMWISTYKMLDCAFKYKILFNRMAAENVAFQAYVEETDKDGMKRVGLPSNEDWEKS  254

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILN-EMVE-ADGAVKLMGANMKA  1478
              + V  LK FY+ T+++S +  VT+N  F E+  L   +  +M +  D  ++ + ++MK 
Sbjct  255   ISFVHFLKKFYDTTLKLSATKTVTSNIIFHELVSLQVEIELKMSDPRDPVLRRVASSMKK  314

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKD-YLEKLLAALNELY  1301
             KF+KY G  + +N MIF A +LDPR KL+ +     ++  ++   D  + ++   L  LY
Sbjct  315   KFDKYWGRFESVNKMIFVAFVLDPRFKLQMLKISFQNLKAEENKIDEVVREVRTCLFNLY  374

Query  1300  DDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
             ++Y            G+  + S  +  E     VG    L    +K++++  +     E+
Sbjct  375   NEY-----------RGADGLVSQQMN-EGEDENVG--NDLEGYDVKEEQLVEISN---EV  417

Query  1120  EYYLSEAITED-EGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVL  944
             + YL++         F +L WWK N +R+PILSKIA+DI AIPISTVASE+AFS+  R++
Sbjct  418   DKYLTDPFESPFTKGFKLLNWWKGNESRYPILSKIAKDIFAIPISTVASENAFSLGKRIV  477

Query  943   DHFRSSLTPKIVEALVCTQDWLR  875
             D FRSSLTPK+VEALVCT DWLR
Sbjct  478   DPFRSSLTPKMVEALVCTSDWLR  500


 Score = 71.2 bits (173),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -3

Query  2106  GLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHILNLVVQDSLKQC  1927
             G+  +F++TVDNAS+ND A+ ++  ++  + +  +  KYLH+RC  HILNL+V+D LK+ 
Sbjct  95    GIEKLFSITVDNASANDGAVVYVGNRMKDFNNLLLDGKYLHLRCACHILNLIVKDGLKEL  154

Query  1926  DITvkrvrevvryvRSSPSKLKKFRDLA  1843
               ++  +R  V+Y+ SSPS+L  FRD A
Sbjct  155   RSSIDGIRNCVKYIHSSPSRLDSFRDHA  182



>ref|XP_003592705.1| HAT family dimerization domain containing protein [Medicago truncatula]
 ref|XP_003636729.1| HAT family dimerization domain containing protein [Medicago truncatula]
Length=576

 Score =   130 bits (327),  Expect(3) = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 152/326 (47%), Gaps = 82/326 (25%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSI---PTSLDW  1661
             G+  K  L LDV TRWNSTYLML  A  Y+ VF   E++D++F + LG  +   P   DW
Sbjct  286   GVCSKAMLTLDVVTRWNSTYLMLNIAEKYKHVFYRLEHADDAFVTSLGGELGGYPDHDDW  345

Query  1660  ESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE--ADGAVKLMGAN  1487
             E     VK LK FY+ T   SGSL VTAN+FF ++ +++  LN+      D  +K M AN
Sbjct  346   ERSRVFVKFLKTFYDATPSFSGSLIVTANSFFKQLMEIHKTLNKWRHNVTDPILKTMTAN  405

Query  1486  MKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNE  1307
             M+ KF+KY  + D +NY++F A  LDPR KL                 ++ E L      
Sbjct  406   MQLKFDKY-WESDAINYLLFVAIYLDPRYKL----------------FEHYEALHPV--S  446

Query  1306  LYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI  1127
             L    + + S ++V  + +G+    +    F            + ++KK+++E+   +KI
Sbjct  447   LESGGSNASSSNMVSQSTTGNEEDEDWDTMF------------RMKVKKKQLEV---QKI  491

Query  1126  ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRV  947
             ELE YL +   +D   F+IL +WK                                    
Sbjct  492   ELERYLEDGPEDDVFRFNILTFWK------------------------------------  515

Query  946   LDHFRSSLTPKIVEALVCTQDWLRRP  869
                      P IVEAL+CTQ+W++ P
Sbjct  516   -------FFPSIVEALICTQNWIKSP  534


 Score = 89.7 bits (221),  Expect(3) = 4e-56, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSW-GSSSV  2002
             SF  +  HKG+ I  ALE+C+ +WG+R++  VTVDNAS+N++A+ +L R V  W G +  
Sbjct  188   SFNLIADHKGKTIGIALENCMKDWGIRSICWVTVDNASANNLAINYLNRGVRVWNGRTLF  247

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCD  1924
               +YLHMRC A ILNL+V D LK  D
Sbjct  248   NGEYLHMRCCARILNLIVLDGLKDTD  273


 Score = 48.9 bits (115),  Expect(3) = 4e-56, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             Q VS+TTD+WTSIQ +NYM VTAH+I +EW
Sbjct  151   QIVSLTTDTWTSIQNMNYMCVTAHYIRDEW  180



>ref|XP_008798027.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
Length=674

 Score =   178 bits (452),  Expect(3) = 5e-56, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 177/328 (54%), Gaps = 30/328 (9%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
              +E K  L  DVPTRWNST+LML+SAL Y++ F   + SD+++K       P+  +W  V
Sbjct  327   SLESKKCLRQDVPTRWNSTFLMLESALFYRRAFLHLKLSDSNYKH-----CPSEEEWGKV  381

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAK  1475
               + KLL  FY+ T+  S + Y T+N +F ++  +   L  EM  AD  ++ M   M  K
Sbjct  382   EKISKLLSVFYDATLVFSRAKYPTSNLYFPQVFLIELTLRQEMQSADAFIQRMTRQMYEK  441

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             FEKY  D    + ++  A +LDPR K +++      + G   G     ++   +  L++ 
Sbjct  442   FEKYWSD---HSLILAMAVVLDPRYKFQFVEYCYKKLNG--YGSTESMRIRDCMFSLFNQ  496

Query  1294  YAVSYSPSVVPA--------TGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG  1139
             Y ++ S ++  +        TG+ S  S             R     K     +  + + 
Sbjct  497   YMLASSKTLTTSTSTHGDMETGTSSETS----------KACRKADPFKDFDTFESFDFVT  546

Query  1138  -GKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
               +K +LE YL E   + + + DIL +WK N  ++P LS +ARDIL IPISTVASESAFS
Sbjct  547   TAQKSQLELYLDEPRVDRKSNLDILDFWKANQFQYPQLSLMARDILTIPISTVASESAFS  606

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWL  878
             I GRVLD++RS+L P I EAL+CT+DW+
Sbjct  607   IGGRVLDNYRSALKPDIAEALICTRDWV  634


 Score = 47.0 bits (110),  Expect(3) = 5e-56, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = -3

Query  2118  LIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHILNLVVQD  1942
             L++W +   +  +T+DNAS +DV +  LK ++    +     ++ H++C AHILNL+VQ+
Sbjct  231   LLDWRIEEKLCCMTLDNASIDDVFVDMLKIQLNLNNALYSDGEFFHVQCCAHILNLIVQE  290

Query  1941  SLKQCD  1924
              LK+ D
Sbjct  291   GLKEID  296


 Score = 43.5 bits (101),  Expect(3) = 5e-56, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T D WTSI    Y+ +TAHFIDEEW
Sbjct  174   RISLTLDLWTSITTDGYLCLTAHFIDEEW  202



>gb|AAP54387.2| hAT family dimerisation domain containing protein [Oryza sativa 
Japonica Group]
Length=756

 Score =   162 bits (411),  Expect(3) = 6e-56, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 165/328 (50%), Gaps = 38/328 (12%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             ++ +  L LD  TRWNSTY ML  AL   + FD     +  F     D  P+  +W   +
Sbjct  427   VKMENKLGLDCKTRWNSTYRMLSIALPCARAFDRATRVEKLF-----DCAPSEEEWAFAS  481

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLY-CILNEMVEADGAVKLMGANMKAKF  1472
              +V  LK F ++T   SG+ YVT+N    +I +    I    V  D  ++ M   M  KF
Sbjct  482   EVVDRLKLFNDITAVFSGTNYVTSNIQLLKICEAKEQIRKWAVCGDSTIEEMSVEMIQKF  541

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYD--  1298
             +KY  DI      +  A ILDPR K++Y+    +     +  ++   K+    + LYD  
Sbjct  542   DKYWKDI---QGPMGLATILDPRFKIDYL-LGFIETITGQSSEECATKVAEVKDTLYDLM  597

Query  1297  -DYAV-----SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG  1136
              +Y V     +   S  P   S  ++S+                   A++  +R   +  
Sbjct  598   KEYEVEDDEDNTESSAPPLVNSDLLSSIT------------------ARVTSRRPAAIRV  639

Query  1135  KKIELEYYLS-EAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSI  959
             K  EL+ YL  E ++ +  +F IL WWKV    FP L K+ARDI AIP+STVASESAFS 
Sbjct  640   KS-ELDRYLEDELVSINTENFKILDWWKVAGTSFPTLRKVARDIFAIPVSTVASESAFST  698

Query  958   SGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             SGRVL   RS LTP+++EAL+C+QDWLR
Sbjct  699   SGRVLSEHRSRLTPELLEALMCSQDWLR  726


 Score = 65.5 bits (158),  Expect(3) = 6e-56, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 70/119 (59%), Gaps = 13/119 (11%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFL-----KRKVLSWG  2014
             +VP   H  E I   L   L+EW L   + T+T+DN ++ND  +  L     KRK++   
Sbjct  313   YVPA-PHTAEVICEHLYEALVEWNLDEKISTLTLDNCTTNDKVISELIKKIGKRKLM---  368

Query  2013  SSSVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEY  1837
                ++ K LHMRC AHILNL+V+D L     ++ +VRE V +  ++P +++KF ++A++
Sbjct  369   ---LEGKLLHMRCAAHILNLIVRDGLDVIKDSIAKVRESVAFWTATPKRVEKFEEIAKH  424


 Score = 40.8 bits (94),  Expect(3) = 6e-56, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 1/30 (3%)
 Frame = -1

Query  2282  RVSITTDSWTSI-QRINYMVVTAHFIDEEW  2196
             RV ITTD WTS  Q+  YM +TAHFID+ W
Sbjct  273   RVGITTDLWTSDNQKRGYMAITAHFIDDSW  302



>ref|NP_001064234.2| Os10g0170600 [Oryza sativa Japonica Group]
 gb|AAM74247.1|AC074355_9 Putative transposable element [Oryza sativa Japonica Group]
 gb|AAP52341.1| hAT family dimerisation domain containing protein [Oryza sativa 
Japonica Group]
 dbj|BAF26148.2| Os10g0170600 [Oryza sativa Japonica Group]
Length=772

 Score =   162 bits (409),  Expect(3) = 9e-56, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 165/328 (50%), Gaps = 38/328 (12%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             ++ +  L LD  TRWNSTY ML  AL   + FD     +  F     D  P+  +W   +
Sbjct  443   VKMENKLGLDCKTRWNSTYRMLSIALPCARAFDRAIRVEKLF-----DCAPSEEEWAFAS  497

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLY-CILNEMVEADGAVKLMGANMKAKF  1472
              +V  LK F ++T   SG+ YVT+N    +I +    I    V  D  ++ M   M  KF
Sbjct  498   EVVDRLKLFNDITAVFSGTNYVTSNIQLLKICEAKEQIRKWAVCGDSTIEEMSVEMIQKF  557

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYD--  1298
             +KY  DI      +  A ILDPR K++Y+    +     +  ++   K+    + LYD  
Sbjct  558   DKYWKDI---QGPMGLATILDPRFKIDYL-LGFIETITGQSSEECATKVAEVKDTLYDLM  613

Query  1297  -DYAV-----SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG  1136
              +Y V     +   S  P   S  ++S+                   A++  +R   +  
Sbjct  614   KEYEVEDDEDNTESSAPPLVNSDLLSSIT------------------ARVTSRRPAAIRV  655

Query  1135  KKIELEYYLS-EAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSI  959
             K  EL+ YL  E ++ +  +F IL WWKV    FP L K+ARDI AIP+STVASESAFS 
Sbjct  656   KS-ELDRYLEDELVSINTENFKILDWWKVAGTSFPTLRKVARDIFAIPVSTVASESAFST  714

Query  958   SGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             SGRVL   RS LTP+++EAL+C+QDWLR
Sbjct  715   SGRVLSEHRSRLTPELLEALMCSQDWLR  742


 Score = 65.5 bits (158),  Expect(3) = 9e-56, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 70/119 (59%), Gaps = 13/119 (11%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFL-----KRKVLSWG  2014
             +VP   H  E I   L   L+EW L   + T+T+DN ++ND  +  L     KRK++   
Sbjct  329   YVPA-PHTAEVICEHLYEALVEWNLDEKISTLTLDNCTTNDKVISELIKKIGKRKLM---  384

Query  2013  SSSVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEY  1837
                ++ K LHMRC AHILNL+V+D L     ++ +VRE V +  ++P +++KF ++A++
Sbjct  385   ---LEGKLLHMRCAAHILNLIVRDGLDVIKDSIAKVRESVAFWTATPKRVEKFEEIAKH  440


 Score = 40.8 bits (94),  Expect(3) = 9e-56, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 1/30 (3%)
 Frame = -1

Query  2282  RVSITTDSWTSI-QRINYMVVTAHFIDEEW  2196
             RV ITTD WTS  Q+  YM +TAHFID+ W
Sbjct  289   RVGITTDLWTSDNQKRGYMAITAHFIDDSW  318



>ref|XP_010527738.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Tarenaya hassleriana]
Length=691

 Score =   163 bits (413),  Expect(3) = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/322 (33%), Positives = 175/322 (54%), Gaps = 20/322 (6%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             G+E   SL LDV TRWNSTYLML+ A+ Y++ F   +  D ++K +     P+S +W   
Sbjct  331   GVESGMSLSLDVATRWNSTYLMLKIAIKYERAFSSLQLLDRNYKYN-----PSSQEWRRG  385

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE--ADGAVKLMGANMKA  1478
               + + L+ FYE+T   SGS Y T+N +F ++  + C+L E ++   D  ++ M +NMK 
Sbjct  386   QKICEFLEPFYEITNLFSGSKYPTSNLYFFQVWRIECLLKEYMKNGEDDIIQSMASNMKE  445

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYD  1298
             KF+KY    ++ +  + F  +LDPR KLE +      +      K+ +  +   L  L+D
Sbjct  446   KFDKY---WEEYSVTLAFGAVLDPRMKLELLEFAYNEV-DPTTSKEKIAHVKENLVLLFD  501

Query  1297  DYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELE  1118
              Y    + S+  ++  G+++    V        GR    L A    ++       +  LE
Sbjct  502   QYK---NRSLTASSSRGAISPSWCVAR----GRGRSLTALNAFKAYEKRTAAQEGRSALE  554

Query  1117  YYLSEAITE--DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVL  944
              YL +   E  +    D+L++W+ +  R+  L+++A DIL+IPI+TVASES+FSI   +L
Sbjct  555   MYLDDKRLEMNEFDDIDVLQFWESHKQRYGPLAQMACDILSIPITTVASESSFSIGAHLL  614

Query  943   DHFRSSLTPKIVEALVCTQDWL  878
             + +RS L    VEAL+CT++WL
Sbjct  615   NKYRSRLRSSNVEALICTRNWL  636


 Score = 67.4 bits (163),  Expect(3) = 2e-55, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (61%), Gaps = 1/107 (1%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHM  1981
             H G  +A  +  CL +WG+ + +F++T+DNAS+ND     LK ++          K+ H+
Sbjct  222   HSGNQLAKKVLDCLKDWGIEKKIFSLTLDNASANDTMQKILKDQLCLQQGLLCDGKFFHV  281

Query  1980  RCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             RC AHILNL+VQ+ LK  D  + ++RE V+YV+ S  ++K F +  E
Sbjct  282   RCCAHILNLIVQEGLKLVDSALHKIRESVKYVKWSEGRMKMFEECCE  328


 Score = 36.6 bits (83),  Expect(3) = 2e-55, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+ +TTD W SI    Y+ +TAH++D+ W
Sbjct  178   RICLTTDVWRSIAIEGYICITAHYVDDRW  206



>gb|AAG13541.1|AC023240_14 putative Tam3-transposase [Oryza sativa Japonica Group]
Length=568

 Score =   161 bits (408),  Expect(3) = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/332 (35%), Positives = 167/332 (50%), Gaps = 46/332 (14%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             ++ +  L LD  TRWNSTY ML  AL   + FD     +  F     D  P+  +W   +
Sbjct  254   VKMENKLGLDCKTRWNSTYRMLSIALPCARAFDRATRVEKLF-----DCAPSEEEWAFAS  308

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-----ADGAVKLMGANM  1484
              +V  LK F ++T   SG+ YVT+N    +I    C   E +       D  ++ M   M
Sbjct  309   EVVDRLKLFNDITAVFSGTNYVTSNIQLLKI----CEAKEQIRKWAVCGDSTIEEMSVEM  364

Query  1483  KAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNEL  1304
               KF+KY  DI      +  A ILDPR K++Y+   +  + G +  ++   K+    + L
Sbjct  365   IQKFDKYWKDIQGP---MGLATILDPRFKIDYLLGFIETITG-QSSEECATKVAEVKDTL  420

Query  1303  YD---DYAV-----SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRME  1148
             YD   +Y V     +   S  P   S  ++S+                   A++  +R  
Sbjct  421   YDLMKEYEVEDDEDNTESSAPPLVNSDLLSSIT------------------ARVTSRRPA  462

Query  1147  LLGGKKIELEYYLS-EAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASES  971
              +  K  EL+ YL  E ++ +  +F IL WWKV    FP L K+ARDI AIP+STVASES
Sbjct  463   AIRVKS-ELDRYLEDELVSINTENFKILDWWKVAGTSFPTLRKVARDIFAIPVSTVASES  521

Query  970   AFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             AFS SGRVL   RS LTP+++EAL+C+QDWLR
Sbjct  522   AFSTSGRVLSEHRSRLTPELLEALMCSQDWLR  553


 Score = 65.5 bits (158),  Expect(3) = 2e-55, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 70/119 (59%), Gaps = 13/119 (11%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFL-----KRKVLSWG  2014
             +VP   H  E I   L   L+EW L   + T+T+DN ++ND  +  L     KRK++   
Sbjct  140   YVPA-PHTAEVICEHLYEALVEWNLDEKISTLTLDNCTTNDKVISELIKKIGKRKLM---  195

Query  2013  SSSVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEY  1837
                ++ K LHMRC AHILNL+V+D L     ++ +VRE V +  ++P +++KF ++A++
Sbjct  196   ---LEGKLLHMRCAAHILNLIVRDGLDVIKDSIAKVRESVAFWTATPKRVEKFEEIAKH  251


 Score = 40.4 bits (93),  Expect(3) = 2e-55, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 1/30 (3%)
 Frame = -1

Query  2282  RVSITTDSWTSI-QRINYMVVTAHFIDEEW  2196
             RV ITTD WTS  Q+  YM +TAHFID+ W
Sbjct  100   RVGITTDLWTSDNQKRGYMAITAHFIDDSW  129



>ref|XP_009113627.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brassica rapa]
Length=832

 Score =   156 bits (395),  Expect(3) = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/333 (35%), Positives = 175/333 (53%), Gaps = 38/333 (11%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI +   L LDV  RWNSTY ML+ A+ ++K F   E    +F        PT+ +W   
Sbjct  485   GITENAGLILDVQARWNSTYFMLERAIKFRKAFVKLE----TFDKRGYKVAPTAEEWTRA  540

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLY--CILNEMVEADGAVKLMGANMKA  1478
             + + + L  F E+T  +SG+ Y T+N +F ++  ++    +NE  E D  V+ M   MK 
Sbjct  541   DKICQFLCPFAEITKLMSGANYPTSNLYFYQVWSIHEWLQMNECSE-DEIVRKMVPPMKE  599

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHM---YGDKKGKDYLEKLLAALNE  1307
             KF+KY    D+++ +   A + DPR KL  +   L  +     D K K+  +KL + L E
Sbjct  600   KFDKY---WDEVSGVFAMAAVFDPRFKLSIVECCLGKLDMSTRDVKLKNLRQKL-SILFE  655

Query  1306  LYDDYAVSYSPSVVP-------ATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRME  1148
              YD  + + SPS  P        T +GS+       EF                K +++ 
Sbjct  656   SYDKKSKANSPSTEPRETVPQNVTSAGSMGLFGNYQEF---------------FKFRKVN  700

Query  1147  LLGGKKIELEYYLSEAITEDEG--SFDILRWWKVNSARFPILSKIARDILAIPISTVASE  974
                  K  LE YL E   + +   S DIL++WK N+ R+  L+ +A D+L+IPI+TVASE
Sbjct  701   GAATGKTALEAYLDEPPLDIDSLESLDILQFWKTNTHRYGDLAAMACDLLSIPITTVASE  760

Query  973   SAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             S+FSI  RVL+ +RS L PK V+AL+CT++W++
Sbjct  761   SSFSIGSRVLNKYRSRLLPKNVQALICTRNWIK  793


 Score = 65.9 bits (159),  Expect(3) = 3e-55, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
              H G  +A  L   L EWGL + VF++T+DNASSND     +K ++L         ++ H
Sbjct  375   PHNGMSVAVHLLESLQEWGLDKKVFSITLDNASSNDSMQDIVKSQLLLNDDLLCGGEFFH  434

Query  1983  MRCIAHILNLVVQDSLK  1933
             +RC AHILNL+VQD LK
Sbjct  435   VRCAAHILNLIVQDGLK  451


 Score = 44.3 bits (103),  Expect(3) = 3e-55, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RVS T+D WTS++R  YM VTAH+ID  W
Sbjct  332   RVSFTSDLWTSLKREGYMCVTAHYIDRNW  360



>emb|CDP00328.1| unnamed protein product [Coffea canephora]
Length=748

 Score =   161 bits (408),  Expect(3) = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/326 (35%), Positives = 175/326 (54%), Gaps = 20/326 (6%)
 Frame = -2

Query  1816  TSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLVK  1637
              +L  D  TRWNSTY ML  AL +Q+VF  ++  + S+     D  PT  DW++V  +  
Sbjct  420   NALLYDCKTRWNSTYEMLAWALKFQEVFPRFKDREPSY-----DFCPTIEDWKNVEKVCN  474

Query  1636  LLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EADGAVKLMGANMKAKFEKY*  1460
             +L+ F+  T  ISGS Y T+N + +E+  +  +L+    +AD  V+ M   MK KF+KY 
Sbjct  475   ILQVFWTATHIISGSDYPTSNLYLNEVCRIKVLLDSKANDADYFVRTMVQRMKVKFDKYW  534

Query  1459  GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSY  1280
             G+    N ++  A ILDPR K+  +      +Y   + +  ++K+  AL +LY +Y   +
Sbjct  535   GEC---NLLMSIAAILDPRCKMRVINYCFPLIYPPHEVQLNIDKVRQALYDLYAEYVEIH  591

Query  1279  SPSVVPATGSGSVA---SVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYL  1109
                   A  S  V    SVN+      + +     + +       +E +  +K EL+ Y 
Sbjct  592   ISGSSDAGASSQVVTNDSVNMTSSGSSSTITHVTGMSEFLSHIATVESVQPQKNELDTYF  651

Query  1108  SEAI---TEDEG----SFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGR  950
              + +   TED      + D L+WWK ++ ++ IL K+A DILAIPISTVASE+ FS   R
Sbjct  652   EDGLLTATEDSALDIVNLDALKWWK-STTKYKILPKMAADILAIPISTVASEATFSAGTR  710

Query  949   VLDHFRSSLTPKIVEALVCTQDWLRR  872
             V+D +R+SL P+ VE L+C  DW R+
Sbjct  711   VIDSYRASLAPETVEMLMCAGDWCRK  736


 Score = 70.1 bits (170),  Expect(3) = 3e-55, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = -3

Query  2178  SFVPVKSHK-GEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSS  2005
             +FV V   + G  IA+A+  CL++WGL   V+TV+VDNAS+ND AL  LK          
Sbjct  299   NFVHVPPPRPGIAIADAIFKCLMDWGLETKVYTVSVDNASNNDTALRCLKDAFSRNKCLL  358

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQ  1930
              K K  H+RC AHILNL+VQD L +
Sbjct  359   AKGKLFHVRCCAHILNLLVQDGLSE  383


 Score = 35.0 bits (79),  Expect(3) = 3e-55, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = -1

Query  2279  VSITTDSWTSI-QRINYMVVTAHFIDEEW  2196
             +S+TTD W S  Q+I YMV+T H+ID  W
Sbjct  263   ISLTTDLWKSKNQKIEYMVITGHWIDTHW  291



>ref|NP_001050494.2| Os03g0563400 [Oryza sativa Japonica Group]
 dbj|BAF12408.2| Os03g0563400, partial [Oryza sativa Japonica Group]
Length=665

 Score =   161 bits (407),  Expect(3) = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/329 (33%), Positives = 169/329 (51%), Gaps = 32/329 (10%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLV  1640
             K  L +DVP RWN+T+ M+  AL+Y+ V        NS+ ++ G+  P+  +W +  ++ 
Sbjct  350   KFGLTVDVPNRWNTTFKMVLEALVYRAVL-------NSYANENGEVAPSDEEWLTAESIC  402

Query  1639  KLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA----VKLMGANMKAKF  1472
             + LK F E T  +S     TA++F   +    CI + + + D      +  + + M  KF
Sbjct  403   EFLKAFEEATRLVSADRKPTAHSFLHLV---LCIRHALSDFDSQTTSILTQLASAMHMKF  459

Query  1471  EKY*GDI--DKMNYMIFFANILDPR---DKLEYMPTQLVHMYGDKKGK-DYLEKLLAALN  1310
              KY  +   +  N  +  + +LDPR   D LE+   ++     + + K D + + + +  
Sbjct  460   AKYWDEKLPNNFNLALVISTVLDPRRKRDYLEFFYAKVSPNMNEAETKVDSVIEWMKSYF  519

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLK--AQIKKQRMELLGG  1136
              +Y+  A     S +  +G G  + V        +PV   + L +  A  K  R  L   
Sbjct  520   RVYEGIARRRGVSCLSHSGQGEASGVG-------SPVLGKRKLDQEFAIFKSNRTRL---  569

Query  1135  KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSIS  956
              K E+E YL E   +D   FD+L WWK N+ RFP+L+ +  D LAIP+S V SESAFS  
Sbjct  570   HKSEIETYLEEVCEDDSKDFDVLAWWKRNAKRFPVLAIMTWDFLAIPLSIVPSESAFSCG  629

Query  955   GRVLDHFRSSLTPKIVEALVCTQDWLRRP  869
             GR+L   RSSLTP ++EALVC +DWL +P
Sbjct  630   GRILGDTRSSLTPDMLEALVCAKDWLFKP  658


 Score = 62.4 bits (150),  Expect(3) = 3e-55, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 73/126 (58%), Gaps = 12/126 (10%)
 Frame = -3

Query  2178  SFVPVK-SHKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFL----KRKVLSW  2017
             S  PVK  H    I  A+  CL +WGLR  +FT+T+DNAS+N  A   +    K ++L  
Sbjct  231   SLKPVKYPHTSFAIEEAMMRCLTDWGLRGKLFTLTLDNASNNTAACEEMVKNQKNELLFE  290

Query  2016  GSSSVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEY  1837
             G      ++ H+RC AHILNL+VQD ++     + ++ E+++Y+ +S S+++ F  +A  
Sbjct  291   G------RHFHVRCCAHILNLLVQDGMRLIRGAIHKIHELLKYIENSASRIQAFNSIANS  344

Query  1836  SMELSK  1819
             S   SK
Sbjct  345   SCLCSK  350


 Score = 42.7 bits (99),  Expect(3) = 3e-55, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RV +T+D WTS Q + YMVVTAH+ID E+
Sbjct  195   RVCLTSDMWTSNQNLRYMVVTAHYIDAEF  223



>gb|AAX95609.1| hAT family dimerisation domain, putative [Oryza sativa Japonica 
Group]
 gb|ABF97129.1| hAT family dimerisation domain containing protein [Oryza sativa 
Japonica Group]
Length=687

 Score =   161 bits (407),  Expect(3) = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/329 (33%), Positives = 169/329 (51%), Gaps = 32/329 (10%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLV  1640
             K  L +DVP RWN+T+ M+  AL+Y+ V        NS+ ++ G+  P+  +W +  ++ 
Sbjct  372   KFGLTVDVPNRWNTTFKMVLEALVYRAVL-------NSYANENGEVAPSDEEWLTAESIC  424

Query  1639  KLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA----VKLMGANMKAKF  1472
             + LK F E T  +S     TA++F   +    CI + + + D      +  + + M  KF
Sbjct  425   EFLKAFEEATRLVSADRKPTAHSFLHLV---LCIRHALSDFDSQTTSILTQLASAMHMKF  481

Query  1471  EKY*GDI--DKMNYMIFFANILDPR---DKLEYMPTQLVHMYGDKKGK-DYLEKLLAALN  1310
              KY  +   +  N  +  + +LDPR   D LE+   ++     + + K D + + + +  
Sbjct  482   AKYWDEKLPNNFNLALVISTVLDPRRKRDYLEFFYAKVSPNMNEAETKVDSVIEWMKSYF  541

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLK--AQIKKQRMELLGG  1136
              +Y+  A     S +  +G G  + V        +PV   + L +  A  K  R  L   
Sbjct  542   RVYEGIARRRGVSCLSHSGQGEASGVG-------SPVLGKRKLDQEFAIFKSNRTRL---  591

Query  1135  KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSIS  956
              K E+E YL E   +D   FD+L WWK N+ RFP+L+ +  D LAIP+S V SESAFS  
Sbjct  592   HKSEIETYLEEVCEDDSKDFDVLAWWKRNAKRFPVLAIMTWDFLAIPLSIVPSESAFSCG  651

Query  955   GRVLDHFRSSLTPKIVEALVCTQDWLRRP  869
             GR+L   RSSLTP ++EALVC +DWL +P
Sbjct  652   GRILGDTRSSLTPDMLEALVCAKDWLFKP  680


 Score = 62.0 bits (149),  Expect(3) = 4e-55, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 73/126 (58%), Gaps = 12/126 (10%)
 Frame = -3

Query  2178  SFVPVK-SHKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFL----KRKVLSW  2017
             S  PVK  H    I  A+  CL +WGLR  +FT+T+DNAS+N  A   +    K ++L  
Sbjct  253   SLKPVKYPHTSFAIEEAMMRCLTDWGLRGKLFTLTLDNASNNTAACEEMVKNQKNELLFE  312

Query  2016  GSSSVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEY  1837
             G      ++ H+RC AHILNL+VQD ++     + ++ E+++Y+ +S S+++ F  +A  
Sbjct  313   G------RHFHVRCCAHILNLLVQDGMRLIRGAIHKIHELLKYIENSASRIQAFNSIANS  366

Query  1836  SMELSK  1819
             S   SK
Sbjct  367   SCLCSK  372


 Score = 42.7 bits (99),  Expect(3) = 4e-55, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RV +T+D WTS Q + YMVVTAH+ID E+
Sbjct  217   RVCLTSDMWTSNQNLRYMVVTAHYIDAEF  245



>ref|NP_001044546.2| Os01g0802400 [Oryza sativa Japonica Group]
 dbj|BAF06460.2| Os01g0802400 [Oryza sativa Japonica Group]
Length=685

 Score =   157 bits (396),  Expect(3) = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/315 (33%), Positives = 164/315 (52%), Gaps = 21/315 (7%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLV  1640
             K+   LDVPTRWNST+ M++  L Y+ +        NS+ S+  + +PT  +W    ++ 
Sbjct  328   KSGFTLDVPTRWNSTFKMIREILPYKAIL-------NSYASENCELLPTDEEWLHAESIC  380

Query  1639  KLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA----VKLMGANMKAKF  1472
             + LK F E T  +S     TA+TF   +    CI + + + D      +K + A M  KF
Sbjct  381   EFLKAFEEATRGVSAHRTPTAHTFLPHV---LCIRHALSDPDWQTSDLLKRLAAPMHTKF  437

Query  1471  EKY*GD--IDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYD  1298
              KY  +   +  N  +    +LDPR K +Y+     +      G +   K+ + + E+  
Sbjct  438   AKYWDEKLANNFNLALVITTVLDPRRKRDYL--DFFYEKVSPHGSNVESKVDSIIEEMKS  495

Query  1297  DYAVSYSPSVVPATGSGSVASVNLVVEFVFTPV-GRPQHLLKAQIKKQRMELLGGKKIEL  1121
              + V     +    G   ++  +  V  V +PV G+ +   +  + K   ++   +K E+
Sbjct  496   YFHVY--EGIARKMGVSYMSQSSERVSVVGSPVLGKRKLEHEFTLFKSNRKVARTQKSEI  553

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLD  941
             + YL E   +D   FD+L WWK NS +FP+L+ +ARD LAIP+STV SESAFS  GR+L 
Sbjct  554   DTYLEEVCEDDSEDFDVLAWWKKNSKKFPVLAIMARDFLAIPLSTVPSESAFSSGGRILG  613

Query  940   HFRSSLTPKIVEALV  896
               RSSLTP+++EAL+
Sbjct  614   DTRSSLTPEMLEALL  628


 Score = 66.2 bits (160),  Expect(3) = 4e-55, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 70/114 (61%), Gaps = 4/114 (4%)
 Frame = -3

Query  2178  SFVPVK-SHKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSS  2005
             S  PVK  H    I  A+  CL EWGL + +FT+T+DNAS+N  A   L + +       
Sbjct  209   SLKPVKYPHTSFAIEEAMMRCLTEWGLSSKLFTLTLDNASNNTAACQELVKTLKD--ELV  266

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             ++ K+ H+RC AHILNL+VQD ++     + ++RE+++Y+  SPS+++ F  +A
Sbjct  267   LEGKHFHVRCCAHILNLLVQDGMRVIRAAIDKIREILKYIEHSPSRIQAFNSIA  320


 Score = 42.7 bits (99),  Expect(3) = 4e-55, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RV +T+D WTS Q + YMVVTAH++D E+
Sbjct  173   RVCLTSDMWTSNQNLGYMVVTAHYVDAEF  201



>gb|KHN12551.1| Putative AC transposase, partial [Glycine soja]
Length=534

 Score =   162 bits (409),  Expect(3) = 5e-55, Method: Compositional matrix adjust.
 Identities = 114/327 (35%), Positives = 176/327 (54%), Gaps = 28/327 (9%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI+ K  L LDVPTRWNSTY+ML+SAL Y++ F  +   D  +K       P++ +W+  
Sbjct  227   GIDTKVGLRLDVPTRWNSTYIMLESALRYRRAFASFTIHDTKYKC-----YPSNKEWKRA  281

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAV-KLMGANMKAK  1475
               L +  K FY+MT  ISG+ Y T+N +F ++  +  +L E ++ D  V + M   M  K
Sbjct  282   EKLCEFFKPFYKMTNLISGTSYPTSNEYFMQVWKIEWLLRETLKCDDPVLQNMAVLMMEK  341

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLE---YMPTQLVHMYGDKKGKDYLEKLLAALNEL  1304
             F KY  D    N ++  A ILDPR KLE   +  ++L     D+K  +  EK+     +L
Sbjct  342   FGKYWSD---YNVILSIAMILDPRMKLEALRFYYSKLDASTCDEKINNIKEKMY----KL  394

Query  1303  YDDYAVSYSPSVVPATGSGSVASVNLVVEF---VFTPVGRPQHLLKAQIKKQRMELLGGK  1133
             +D+Y    S S   ++        +  +E    +  P     + +   +       + GK
Sbjct  395   FDEYVSVKSSSSTASSSQQPTVEEDFSIEENQEMDDPYNEYINYVSQNVN------VNGK  448

Query  1132  KIELEYYLSEAITEDE--GSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSI  959
               EL+ YL+E   + +     DIL +WK    R+P L ++A ++L+IPI+ VASESAFSI
Sbjct  449   S-ELDLYLAETPFQPKFFPKLDILSYWKDRQERYPNLCRLACEVLSIPITIVASESAFSI  507

Query  958   SGRVLDHFRSSLTPKIVEALVCTQDWL  878
               RVL+ +R+SL P  V+AL+ TQ+W+
Sbjct  508   GARVLNKYRASLLPSNVQALILTQNWI  534


 Score = 69.3 bits (168),  Expect(3) = 5e-55, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
              H GE +AN +   L EW + R +F++T+DNAS+ND     L  ++    S    S++LH
Sbjct  116   PHTGEDLANKVFEVLTEWEIDRKIFSITLDNASANDRMQELLGEQLRLQNSLLCDSEFLH  175

Query  1983  MRCIAHILNLVVQDSLKQCDI  1921
             +RC AH+LNL+VQD LK  ++
Sbjct  176   VRCCAHVLNLIVQDGLKVAEV  196


 Score = 34.7 bits (78),  Expect(3) = 5e-55, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+ +T+D WT+  +  Y+ +T HF+D  W
Sbjct  73    RICLTSDCWTACTQEGYICLTTHFVDNNW  101



>ref|XP_007022882.1| BED zinc finger,hAT family dimerization domain, putative isoform 
1 [Theobroma cacao]
 ref|XP_007022883.1| BED zinc finger,hAT family dimerization domain, putative isoform 
1 [Theobroma cacao]
 ref|XP_007022884.1| BED zinc finger,hAT family dimerization domain, putative isoform 
1 [Theobroma cacao]
 ref|XP_007022885.1| BED zinc finger,hAT family dimerization domain, putative isoform 
1 [Theobroma cacao]
 gb|EOY25504.1| BED zinc finger,hAT family dimerization domain, putative isoform 
1 [Theobroma cacao]
 gb|EOY25505.1| BED zinc finger,hAT family dimerization domain, putative isoform 
1 [Theobroma cacao]
 gb|EOY25506.1| BED zinc finger,hAT family dimerization domain, putative isoform 
1 [Theobroma cacao]
 gb|EOY25507.1| BED zinc finger,hAT family dimerization domain, putative isoform 
1 [Theobroma cacao]
Length=678

 Score =   176 bits (445),  Expect(3) = 5e-55, Method: Compositional matrix adjust.
 Identities = 117/320 (37%), Positives = 170/320 (53%), Gaps = 24/320 (8%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             +  K  L  DV T+WNST+LML+ AL ++K F   E  D++++       P+  +WE V 
Sbjct  341   LNAKGGLRQDVSTKWNSTFLMLKRALYFRKAFSHLEIRDSNYR-----YCPSEDEWERVE  395

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKLMGANMKAKF  1472
              L KLL  FY++T   S + Y TAN FF  +   +  L E M   D  +K M   M  KF
Sbjct  396   KLYKLLAVFYDVTCVFSRTKYPTANLFFPSMFIAHSTLQEHMSGQDVYMKNMSTQMLVKF  455

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
              KY  D    + ++  A ILDPR K+ ++      +YG+   +   + +   L  LY++Y
Sbjct  456   VKYWSDF---SLILAIAVILDPRYKIHFVEWSYGKLYGNDSTQ--FKNVRDWLFSLYNEY  510

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG--KKIELE  1118
             AV  SP+  P++ +      N   E   T   R       +         G   +K +LE
Sbjct  511   AVKASPT--PSSFN------NTSDEHTLTEGKRD---FFEEFDSYATVKFGAATQKSQLE  559

Query  1117  YYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDH  938
             +YLSE + E     +IL++WK N  R+P L+ +ARD+L+IPIS  ASE AFS+ G++LD 
Sbjct  560   WYLSEPMVERTKELNILQFWKENQYRYPELAAMARDVLSIPISATASEFAFSVGGKILDQ  619

Query  937   FRSSLTPKIVEALVCTQDWL  878
              RSSL P I+EA VC +DWL
Sbjct  620   HRSSLKPDILEATVCCKDWL  639


 Score = 57.4 bits (137),  Expect(3) = 5e-55, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query  2124  SCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHILNLVV  1948
             + L EWG+ + +F+VT+DN  +++  +  LK+ +    +  V  K+ H+RC A +LNL+V
Sbjct  242   ALLAEWGIESKLFSVTLDNVLASNAFVELLKKNLNVRKTFLVGGKFFHLRCFAQVLNLIV  301

Query  1947  QDSLKQCD  1924
             QDSLK+ D
Sbjct  302   QDSLKEVD  309


 Score = 32.3 bits (72),  Expect(3) = 5e-55, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+++T D W SI    Y+ + AHF+D+ W
Sbjct  187   RINLTFDLWNSITTDTYICLIAHFVDKNW  215



>ref|XP_010273438.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
 ref|XP_010273439.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
 ref|XP_010273440.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
 ref|XP_010273441.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
Length=678

 Score =   177 bits (448),  Expect(3) = 7e-55, Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 174/321 (54%), Gaps = 15/321 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I  + SLCLD P RWN+TY ML+++L Y+ VF   +  D+++        P+ ++WE V+
Sbjct  335   IYSEKSLCLDCPMRWNATYQMLEASLEYRYVFSVLQEHDSAYTM-----APSDIEWEQVS  389

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAKF  1472
              +   LK F E++   SG  + TAN +F EI D++  L E  ++ D  +  M   MK+KF
Sbjct  390   TICNFLKLFNEVSNVFSGIKHPTANLYFPEICDIHLQLIEWCKSSDIVIGSMALKMKSKF  449

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY       N  +  A ILDPR K++ +      +YG     + ++ +  ++ ELY++Y
Sbjct  450   DKY---WSTCNLALAVAVILDPRFKMKLVEYYYPQIYG-SSAPERIKVVSDSVKELYNEY  505

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGK--KIELE  1118
             A+    S + +   G    V     F  T V    +   +   K   E    +  K +L+
Sbjct  506   AIC---STLASLDQGLGWEVRNNSGFSGTSVPNVSNDRLSGFDKFLNETTNSQRSKSDLD  562

Query  1117  YYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDH  938
              YL E +      F+IL WWKV+  R+PILS +ARD+L +P++TV   S F+   RVLD 
Sbjct  563   KYLEEPVFPRNVDFNILNWWKVHMPRYPILSMMARDVLGVPMATVPLGSTFNAGDRVLDP  622

Query  937   FRSSLTPKIVEALVCTQDWLR  875
             +RSSL P  ++AL+CTQDWLR
Sbjct  623   YRSSLNPDTLQALICTQDWLR  643


 Score = 58.2 bits (139),  Expect(3) = 7e-55, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 74/127 (58%), Gaps = 2/127 (2%)
 Frame = -3

Query  2178  SFVPV-KSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSS  2005
             +FV V  SH  E ++  L +CL++W + R +F +T+D+  +ND  +  ++ ++       
Sbjct  217   NFVMVDPSHTEELLSEVLMTCLMDWDIDRKLFAMTLDDCFTNDNFVFRIRDRLTQNRLLL  276

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMEL  1825
                +    RC AHILNL+VQD+L+  + T  ++R+ VRYV+SS  +  KF +LA+     
Sbjct  277   SNGQLFDARCAAHILNLIVQDALEAINETTHKIRDSVRYVKSSQERQDKFNELAQQIEIY  336

Query  1824  SKKHPCV  1804
             S+K  C+
Sbjct  337   SEKSLCL  343


 Score = 30.4 bits (67),  Expect(3) = 7e-55, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+    W S +   Y+ +TA +IDE W
Sbjct  181   RISLIAAMWASCENGGYLCLTAQYIDETW  209



>ref|XP_010527739.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Tarenaya hassleriana]
Length=516

 Score =   163 bits (412),  Expect(3) = 8e-55, Method: Compositional matrix adjust.
 Identities = 107/322 (33%), Positives = 175/322 (54%), Gaps = 20/322 (6%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             G+E   SL LDV TRWNSTYLML+ A+ Y++ F   +  D ++K +     P+S +W   
Sbjct  156   GVESGMSLSLDVATRWNSTYLMLKIAIKYERAFSSLQLLDRNYKYN-----PSSQEWRRG  210

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE--ADGAVKLMGANMKA  1478
               + + L+ FYE+T   SGS Y T+N +F ++  + C+L E ++   D  ++ M +NMK 
Sbjct  211   QKICEFLEPFYEITNLFSGSKYPTSNLYFFQVWRIECLLKEYMKNGEDDIIQSMASNMKE  270

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYD  1298
             KF+KY    ++ +  + F  +LDPR KLE +      +      K+ +  +   L  L+D
Sbjct  271   KFDKY---WEEYSVTLAFGAVLDPRMKLELLEFAYNEV-DPTTSKEKIAHVKENLVLLFD  326

Query  1297  DYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELE  1118
              Y    + S+  ++  G+++    V        GR    L A    ++       +  LE
Sbjct  327   QYK---NRSLTASSSRGAISPSWCVAR----GRGRSLTALNAFKAYEKRTAAQEGRSALE  379

Query  1117  YYLSEAITE--DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVL  944
              YL +   E  +    D+L++W+ +  R+  L+++A DIL+IPI+TVASES+FSI   +L
Sbjct  380   MYLDDKRLEMNEFDDIDVLQFWESHKQRYGPLAQMACDILSIPITTVASESSFSIGAHLL  439

Query  943   DHFRSSLTPKIVEALVCTQDWL  878
             + +RS L    VEAL+CT++WL
Sbjct  440   NKYRSRLRSSNVEALICTRNWL  461


 Score = 67.4 bits (163),  Expect(3) = 8e-55, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (61%), Gaps = 1/107 (1%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHM  1981
             H G  +A  +  CL +WG+ + +F++T+DNAS+ND     LK ++          K+ H+
Sbjct  47    HSGNQLAKKVLDCLKDWGIEKKIFSLTLDNASANDTMQKILKDQLCLQQGLLCDGKFFHV  106

Query  1980  RCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             RC AHILNL+VQ+ LK  D  + ++RE V+YV+ S  ++K F +  E
Sbjct  107   RCCAHILNLIVQEGLKLVDSALHKIRESVKYVKWSEGRMKMFEECCE  153


 Score = 34.7 bits (78),  Expect(3) = 8e-55, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             ++ +TTD W SI    Y+ +TAH++D+ W
Sbjct  3     KICLTTDVWRSIAIEGYICITAHYVDDRW  31



>ref|XP_010229759.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
Length=550

 Score =   173 bits (439),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/320 (35%), Positives = 157/320 (49%), Gaps = 17/320 (5%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
              IE    +CLD  TRWNSTY ML  AL Y++VF      + SF      + P+  DW   
Sbjct  210   NIEYAIRICLDCKTRWNSTYSMLCRALQYKEVFARLAIREKSF------ACPSEDDWLFA  263

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA-VKLMGANMKAK  1475
               +   LK FY++T  +SG+ YVTAN FF +I  +   + +   +D   ++ M  +M+ K
Sbjct  264   KEVCDRLKVFYDITELLSGTKYVTANLFFPKICGIRLAIRKWHASDNPLIRAMSESMRLK  323

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             FEKY  D+   + ++  A +LDPR KL  +      +Y    G D     +A +  L  D
Sbjct  324   FEKYWTDV---HGLMAIATVLDPRYKLHILKA----LYRSLYGYDTASMEVAKVRRLMLD  376

Query  1294  YAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEY  1115
               + Y      + G G+    N         V     +    +  Q        + EL+ 
Sbjct  377   LLIEYQRG---SEGGGTTNLGNTAAAHSVADVDEVYSIFDEYMSSQPAASSSQVRTELDL  433

Query  1114  YLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHF  935
             YL EA        DI+ WWK+   ++P L  IA DIL+IP+++VASESAFS SGR+L   
Sbjct  434   YLEEAPLPRTQDLDIISWWKIGGIKYPTLQLIAHDILSIPVTSVASESAFSASGRLLSPH  493

Query  934   RSSLTPKIVEALVCTQDWLR  875
             RS L P I EAL+C Q W R
Sbjct  494   RSRLAPNIAEALMCMQAWSR  513


 Score = 70.1 bits (170),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 72/123 (59%), Gaps = 8/123 (7%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +VP   H  E I  AL +CL+EW L R + TVT+DN +SND  +  L  K L   S  ++
Sbjct  97    YVPC-PHIAEVICEALHTCLVEWHLERKISTVTLDNCTSNDKTMEILPDK-LDCNSLMLQ  154

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA-----EYS  1834
                LHMRC AHILNL+ +D L   +  ++RVR+ + +  ++P + +KF  +A     EY+
Sbjct  155   GSLLHMRCAAHILNLIGKDGLSVMEDGIERVRDSIAFWSATPKRHEKFEKMAHLMNIEYA  214

Query  1833  MEL  1825
             + +
Sbjct  215   IRI  217



>emb|CAN68697.1| hypothetical protein VITISV_042570 [Vitis vinifera]
Length=1068

 Score =   172 bits (435),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/312 (35%), Positives = 161/312 (52%), Gaps = 15/312 (5%)
 Frame = -2

Query  1810  LCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLVKLL  1631
             LCLD  TRWNSTYLML  A+ Y+ VF   +      +  L  ++P+  +W     + + L
Sbjct  395   LCLDCKTRWNSTYLMLSIAITYKDVFPRLKQ-----REKLYTTVPSEEEWNLAREICERL  449

Query  1630  KCFYEMTIRISGSLYVTANTFFSEISDLY-CILNEMVEADGAVKLMGANMKAKFEKY*GD  1454
             K FY +T   SG  Y TANTFF ++ ++   + + ++ ++  V  M ++M  KF+KY   
Sbjct  450   KLFYNITKLFSGXNYPTANTFFIKVCEIKEALYDWLICSNEVVSTMASSMLEKFDKY---  506

Query  1453  IDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSP  1274
                 + ++  A +LDPR K++ +      MYG +   + + K+     +L  +Y      
Sbjct  507   WSGCHIVMAIAVVLDPRYKMKILEFYFPIMYGSEASSE-IGKIRQLCYDLLSEY--QSKS  563

Query  1273  SVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSEAIT  1094
              +   T S   +SV+ + E  +        L K  +        G  K EL+YYL E + 
Sbjct  564   KMGQQTSSHGASSVSNLFELTYD---EQDPLSKFDLFVHSTSEEGHAKSELDYYLEETVL  620

Query  1093  EDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPK  914
                  FD+L WWK N  ++P L  I RDI AIP+STVASESAFS  GR++   RS L P 
Sbjct  621   PRISDFDVLSWWKTNGIKYPTLQMIVRDIYAIPVSTVASESAFSTGGRMVSKHRSRLHPN  680

Query  913   IVEALVCTQDWL  878
              +EAL+C Q WL
Sbjct  681   TLEALMCAQSWL  692


 Score = 63.9 bits (154),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +VP   H  E +++ L   L++W + R + T+TVDN SSND  +  L  K+ S GS  + 
Sbjct  274   YVP-PPHTKEVLSDVLLDFLLDWNMDRKLSTITVDNCSSNDGMIDILSEKLSSSGSLLLN  332

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              K  HMRC AH+LNL+V++ L    + ++++RE V Y  ++PS+++KF D A
Sbjct  333   GKIFHMRCAAHVLNLIVKEGLDVIRVEIEKIRESVAYWSATPSRVEKFEDAA  384


 Score = 28.5 bits (62),  Expect(3) = 1e-54, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 16/29 (55%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R +I  D     ++  YM +T H+IDE W
Sbjct  235   RNTIKDDIMKIYEKKGYMAITVHYIDESW  263



>emb|CDY59949.1| BnaA03g58810D [Brassica napus]
 emb|CDY50781.1| BnaA09g54100D [Brassica napus]
Length=747

 Score =   155 bits (391),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 178/350 (51%), Gaps = 35/350 (10%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSI--------PTSLD  1664
             + SL LD  TRWNST+LML  A+ ++  FD     D  +     + +        P   D
Sbjct  365   RGSLPLDCKTRWNSTFLMLNRAMDFKMAFDKMMAEDKPYNDYFQERVDGKKRHGPPAKDD  424

Query  1663  WESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV--EADGAVKLMGA  1490
             WE ++  +  L  FY+ T+ +S +    +   ++EI  +   L  M     D  +K    
Sbjct  425   WEVIDRFINFLVIFYQSTLVLSATNSSCSYKCYNEIVSIQSALIAMTCQGHDEELKKKAT  484

Query  1489  NMKAKFEKY*---GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK--KGKDYLEKL  1325
              M  K  KY    G+  +MN M+  A++ DPR+K+++       +YG    K K   + +
Sbjct  485   AMMTKLGKYWDPFGEGTEMNRMVIVASVFDPRNKMKFAQLCFDQLYGKDSFKAKQMHDSI  544

Query  1324  LAALNELYDDYAVSYSPSVVPATGSGSVASVNLVV--EFVFTPVGRPQHLLK----AQIK  1163
             ++ L +L+D Y    + S+  +  + S  S +  V          +P+H  +    A++ 
Sbjct  545   MSILKKLFDQYNTRLTSSLNRSATASSSTSQSHEVGSSSSSQSQPQPRHSCRMDFSARLC  604

Query  1162  KQRMELLGGKKI----------ELEYYLSEAITEDE----GSFDILRWWKVNSARFPILS  1025
              Q+M+ +  + +          ELE YL+E +   +      +D+L WWKVN+ ++P+LS
Sbjct  605   FQKMDAVYKEMVQETGFQESATELELYLAENVESPKVFSGTEYDVLSWWKVNAQKYPVLS  664

Query  1024  KIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             ++A+D+LA+ IS+VASESAFS SGR+LD  +S LT   +E L+CT+ WL+
Sbjct  665   QVAKDVLAMQISSVASESAFSTSGRILDSTQSCLTHYTIEVLMCTEQWLK  714


 Score = 74.7 bits (182),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 67/111 (60%), Gaps = 3/111 (3%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSW-GSSSV-  2002
             F  V  HKG  IA  L+ CL EW ++ VF +TVDNA++N  A+   K   +   G  SV 
Sbjct  245   FKNVSDHKGVTIAAVLKECLEEWDIKRVFCITVDNATANSNAMEIFKADFIEVNGEESVV  304

Query  2001  -KSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
                 YLH+RC  HI+NL+V++ L++ D +V  +R  +++VR S  +LK F+
Sbjct  305   LNGDYLHVRCATHIINLIVRNGLQEVDKSVAAIRNGIQFVRPSTPRLKSFQ  355


 Score = 34.7 bits (78),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (68%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQ-RINYMVVTAHFIDEEW  2196
             QR+S+T D W +     +YMV+TAHF+D  W
Sbjct  206   QRLSLTADIWVAPNTGASYMVITAHFVDTNW  236



>ref|XP_010468785.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
Length=892

 Score =   169 bits (427),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 183/350 (52%), Gaps = 28/350 (8%)
 Frame = -2

Query  1843  RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD---NSFKSDLGDSI--  1679
             +V  G   + SL +D+ TRWNSTYLML  A+ ++  F   E  D   N +  +L D +  
Sbjct  400   KVVSGKMTRGSLPMDMKTRWNSTYLMLTRAMKFRLAFQKMEDEDKLYNDYFLELVDGVKR  459

Query  1678  ---PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DG  1511
                P+  DW ++  LVK L  FY  T+ +S S    +   + EI  +   L  +  + D 
Sbjct  460   KGPPSYTDWRAIERLVKFLGLFYTATLVVSASTKTCSYKCYGEIVTIEKNLTTLSNSYDS  519

Query  1510  AVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYG--DKKGKDY  1337
              +  M   M+ KF KY   I  +N M+  A++ DPR K+++       +YG   ++ K  
Sbjct  520   ELSKMAIEMREKFTKYWEGIKNINKMLIVASVFDPRQKMQFAKMCFDKLYGKDSQEAKGM  579

Query  1336  LEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVG-----------RP  1190
                +L  + +++ +Y+V+Y  S   ++ S   +S      F+F  V            R 
Sbjct  580   STSVLDVMKDMFKEYSVNYKGSSTQSSQSIPSSSGATQDRFIFESVSSDFAEEISEFERM  639

Query  1189  QHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEG----SFDILRWWKVNSARFPILSK  1022
              +     +K+  ++     K EL+ YL +AI   +      +D+L WW++NS +FP+LS+
Sbjct  640   DNAYTEMVKENGLD--DETKDELDIYLKDAIETPKTLPGIEWDVLSWWRLNSQKFPVLSE  697

Query  1021  IARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRR  872
             IA+D+ A+ +S+VASESAFS SGR+++  RS LT  +VE L+CT+ W+++
Sbjct  698   IAKDVFAMQVSSVASESAFSTSGRIIEPHRSCLTHYMVEVLMCTEQWIKQ  747


 Score = 74.3 bits (181),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = -3

Query  2184  KKSFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVAL-GFLKR-KVLSWGS  2011
             + S++ +  HK   I+  L  CL +WG+  +FT+TVDNA++N   L  F++  K+L   S
Sbjct  286   RASYMYITDHKSNTISKVLLECLADWGIEKLFTITVDNATANSNGLKNFVEEFKLLRHDS  345

Query  2010  SSVKSKYLHMRCIAHILNLVVQDSLKQ  1930
               +   YLHMRC AHI+NL+V+D L +
Sbjct  346   LVLDGTYLHMRCCAHIINLIVRDGLSE  372



>ref|XP_007213552.1| hypothetical protein PRUPE_ppa018143mg [Prunus persica]
 gb|EMJ14751.1| hypothetical protein PRUPE_ppa018143mg [Prunus persica]
Length=536

 Score =   115 bits (288),  Expect(3) = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/339 (29%), Positives = 150/339 (44%), Gaps = 74/339 (22%)
 Frame = -2

Query  1804  LDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSF----------------KSDLGDSI--  1679
             LDV TRWN TY M   AL  + VF      +  F                K +L   +  
Sbjct  213   LDVATRWNITYKMFDGALKCENVFARMVDENAPFVAYFNVLEKDGEKKKKKKNLVKRVGP  272

Query  1678  PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAVKL  1499
             PT   WE+    V  LK FYE T+++S +   T+N  F+E+  L   +   ++ +G   L
Sbjct  273   PTKSIWENAQAFVHFLKKFYETTLKLSATKTCTSNVMFTELVGLQVEIQRKIKDEGDETL  332

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGK--DYLEKL  1325
                               +N ++F  N+LDPR KL  +   + H  G +  K     + +
Sbjct  333   QKG---------------VNKIVFIGNVLDPRWKLALLKI-IFHNLGAESSKVETIRDDV  376

Query  1324  LAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMEL  1145
              + L  LY++Y            G G++ S+  + E     +        A  ++   E+
Sbjct  377   KSDLLTLYNEYK-----------GVGNLDSLQTLDEGDEEGLEDELDDDDAHSQR---EM  422

Query  1144  LGGKKIELEYYLSEAITE---------DEGSFDILRWWKVNSARFPILSKIARDILAIPI  992
             L  +K E +  +S  + +            +F++L WWK N +R+PILS           
Sbjct  423   LLQRKEEQQMEISNEVDKCFADPFENPRNKNFNLLDWWKGNQSRYPILS-----------  471

Query  991   STVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
                 +E+AFS+  R++D FRSSLTPK+V+ALVCT DWLR
Sbjct  472   ----NENAFSLGKRIVDPFRSSLTPKMVDALVCTHDWLR  506


 Score = 94.4 bits (233),  Expect(3) = 3e-54, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 73/112 (65%), Gaps = 12/112 (11%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +FV + SHKG+ I   L++CL  W ++ VF++TV+NAS+ND A+ ++ ++  S  +  + 
Sbjct  101   NFVKITSHKGDDIGRCLDACLNSWEIKKVFSITVNNASANDGAVEYMAKRFKSLNTLMLD  160

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              KYLHMRC+ HILNLVV+D    C          V+Y+ SSPS+L KFRD A
Sbjct  161   GKYLHMRCVCHILNLVVKDG--SC----------VKYIHSSPSRLDKFRDFA  200


 Score = 53.5 bits (127),  Expect(3) = 3e-54, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QRVS+TT +WTSIQ INYMV+TAHF+D EW
Sbjct  64    QRVSVTTVTWTSIQNINYMVITAHFMDHEW  93



>ref|XP_008675089.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008675096.1| PREDICTED: transposon protein isoform X1 [Zea mays]
Length=768

 Score =   179 bits (453),  Expect(3) = 5e-54, Method: Compositional matrix adjust.
 Identities = 115/325 (35%), Positives = 174/325 (54%), Gaps = 21/325 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E  D+++        P++ DW+ V 
Sbjct  439   IPSTKTLCLDVTTQWNTTYLMLLAALDYKQAFSTLETCDDNYNES-----PSAEDWKKVE  493

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAV-KLMGANMKAKF  1472
                  LK  Y+    +  S   TAN FF E   +   L    E +  +   +  +M  +F
Sbjct  494   ATCNYLKLLYDSAHSVMASANPTANIFFHEAWKIQLELANGTEHENPIFSSIAKDMHERF  553

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR K++ +      +YG +  K Y++ +  +L+ELY +Y
Sbjct  554   DKYWKDC---SLVLAIAVVMDPRFKMKLVEFSYSKIYGAEAMK-YVKVVNDSLHELYKEY  609

Query  1291  AVS---YSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
                    +P+ V A    + ASVN        P      LL   +    ++     K +L
Sbjct  610   VAQPLPLTPAYVEANNVAANASVNQ-----GNPSSTGDGLLDFDMYLSEIQSTQPAKCDL  664

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---R  950
             E YL E++T     FDIL WWK+N+ +FP LSK+ARDILAIP+S V+S S+   +G   R
Sbjct  665   EQYLEESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAIPMSMVSSGSSIFSAGTGNR  724

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR  875
             +LD +RSSL P+ VEALVC +DWL+
Sbjct  725   MLDDYRSSLRPETVEALVCAKDWLQ  749


 Score = 52.8 bits (125),  Expect(3) = 5e-54, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSS  2008
             +F+ V S H    ++ A+ S L+EW +++ +FT+T+DN  SS+D+    L+  + +  + 
Sbjct  320   NFMMVSSPHSENALSEAISSSLLEWNMKDRLFTITLDNDCSSHDIYSANLRDHLSNKNNL  379

Query  2007  SVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              +K +   +RC AHILN+V QD +      +  +RE ++++++SP++ +KF ++A
Sbjct  380   MLKGQLFVVRCYAHILNVVAQDVIASIHGVIYNIRESIKFIKASPNREEKFAEIA  434


 Score = 30.4 bits (67),  Expect(3) = 5e-54, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ +   FID +W
Sbjct  284   RISLTIGLWTTSQTLGYVSLAGQFIDSDW  312



>ref|XP_010513175.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
Length=997

 Score =   137 bits (344),  Expect(3) = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 151/299 (51%), Gaps = 32/299 (11%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFD-----DYEYSDNSFKSDLGDSI-----PTS  1670
             + SL LDV TRWNSTYLML +A+  +  F+     D  Y D   + D  +       PTS
Sbjct  349   RGSLPLDVVTRWNSTYLMLTAAIKLRVAFEKMASEDKLYCDYFEEVDEKEKAKRIGPPTS  408

Query  1669  LDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMG  1493
              DWE  + LVK LK FY+ T+  S S  VT+   +SEI D+   L     + D  ++  G
Sbjct  409   ADWEEASRLVKFLKVFYKATLTFSASKTVTSTLCYSEIVDIERNLTAKSSSPDLEIRKQG  468

Query  1492  ANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK--KGKDYLEKLLA  1319
               M+ KFEKY   +  MN ++  A+  DPR+K+E+       +YG    + K     + +
Sbjct  469   YVMRHKFEKYWDGLHNMNPLVIIASAFDPRNKMEFAGLCFEQLYGKDTVESKQLESSVSS  528

Query  1318  ALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG  1139
             A+ +LY+DY++  S  VV A       +V   +             L   +  Q   L+G
Sbjct  529   AMKQLYEDYSLRLSEPVVDADPPDFEPTVMCDIS------DDDDCELMESLYNQ---LVG  579

Query  1138  GKKIE-----LEYYLSEAI-TEDEGS----FDILRWWKVNSARFPILSKIARDILAIPI  992
              KK E     ++ YL+E      E S    FD+L WW+ NS++FPILS++ARD+LAI +
Sbjct  580   CKKKEPGCNDIQAYLTEKTEVRVENSLGLPFDVLSWWRCNSSKFPILSELARDVLAIQV  638


 Score = 82.4 bits (202),  Expect(3) = 6e-54, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 70/110 (64%), Gaps = 2/110 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALG-FLKRKVLSWGSSSV  2002
             SF  V  HKG+ I   L  C+ +WG+  +FT+TVDNA +ND AL  F     L  G + V
Sbjct  229   SFKVVTDHKGDTIGGQLMDCIDDWGIEKIFTITVDNAKNNDKALEIFTDALRLRGGEALV  288

Query  2001  K-SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKF  1855
             +   +LHMRC AHILNL+V D LK+ + ++  +R  V+YVRSS S+L+ F
Sbjct  289   RGGDFLHMRCCAHILNLIVGDGLKKANSSIVAIRNAVKYVRSSFSRLRSF  338


 Score = 42.7 bits (99),  Expect(3) = 6e-54, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
             QRVS+TTD WTS     NYMV+TAH+I+ +W
Sbjct  191   QRVSLTTDIWTSPTTSTNYMVITAHWINAQW  221


 Score =   154 bits (388),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 112/311 (36%), Positives = 163/311 (52%), Gaps = 32/311 (10%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFD-----DYEYSDNSFKSDLGDSI-----PTS  1670
             + SL LDV TRWNSTYLML +A+  +  F+     D  Y D   + D  +       PTS
Sbjct  690   RGSLPLDVVTRWNSTYLMLTAAIKLRVAFEKMASEDKLYCDYFEEVDEKEKAKRIGPPTS  749

Query  1669  LDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMG  1493
              DWE  + LVK LK FY+ T+  S S  VT+   +SEI D+   L     + D  ++  G
Sbjct  750   ADWEEASRLVKFLKVFYKATLTFSASKTVTSTLCYSEIVDIERNLTAKSSSPDLEIRKQG  809

Query  1492  ANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK--KGKDYLEKLLA  1319
               M+ KFEKY   +  MN ++  A+  DPR+K+E+       +YG    + K     + +
Sbjct  810   YVMRHKFEKYWDGLHNMNPLVIIASAFDPRNKMEFAGLCFEQLYGKDTVESKQLESSVSS  869

Query  1318  ALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG  1139
             A+ +LY+DY++  S  VV A       +V   +             L   +  Q   L+G
Sbjct  870   AMKQLYEDYSLRLSEPVVDADPPDFEPTVMCDIS------DDDDCELMESLYNQ---LVG  920

Query  1138  GKKIE-----LEYYLSEA----ITEDEG-SFDILRWWKVNSARFPILSKIARDILAIPIS  989
              KK E     L+ YL+E     +  + G  FD+L WW+ NS++FPILS++ARD+LAI +S
Sbjct  921   CKKSEPGCNDLQAYLTEKTEVRVENNLGLPFDVLSWWRCNSSKFPILSELARDVLAIQVS  980

Query  988   TVASESAFSIS  956
             +VASESAFS +
Sbjct  981   SVASESAFSTT  991


 Score = 27.7 bits (60),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  1971  AHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKF  1855
             AHILNL+V D LK+ + ++  +R  V+YVRSS S+L+ F
Sbjct  641   AHILNLIVGDGLKKANSSIVAIRNAVKYVRSSFSRLRSF  679



>ref|NP_001147988.1| transposon protein [Zea mays]
 gb|ACG29330.1| transposon protein [Zea mays]
Length=768

 Score =   179 bits (453),  Expect(3) = 8e-54, Method: Compositional matrix adjust.
 Identities = 115/325 (35%), Positives = 174/325 (54%), Gaps = 21/325 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E  D+++        P++ DW+ V 
Sbjct  439   IPSTKTLCLDVTTQWNTTYLMLLAALDYKQAFSTLEICDDNYNES-----PSAEDWKKVE  493

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAV-KLMGANMKAKF  1472
                  LK  Y+    +  S   TAN FF E   +   L    E +  +   +  +M  +F
Sbjct  494   ATCNYLKLLYDSAHSVMASANPTANIFFHEAWKIQLELANGTEHENPIFSSIAKDMHERF  553

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR K++ +      +YG +  K Y++ +  +L+ELY +Y
Sbjct  554   DKYWKDC---SLVLAIAVVMDPRFKMKLVEFSYSKIYGAEAMK-YVKVVNDSLHELYKEY  609

Query  1291  AVS---YSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
                    +P+ V A    + ASVN        P      LL   +    ++     K +L
Sbjct  610   VAQPLPLTPAYVEANNVAANASVNQ-----GNPSSTGDGLLDFDMYLSEIQSTQPAKCDL  664

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---R  950
             E YL E++T     FDIL WWK+N+ +FP LSK+ARDILAIP+S V+S S+   +G   R
Sbjct  665   EQYLEESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAIPMSMVSSGSSIFSAGTGNR  724

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR  875
             +LD +RSSL P+ VEALVC +DWL+
Sbjct  725   MLDDYRSSLRPETVEALVCAKDWLQ  749


 Score = 52.8 bits (125),  Expect(3) = 8e-54, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSS  2008
             +F+ V S H    ++ A+ S L+EW +++ +FT+T+DN  SS+D+    L+  + +  + 
Sbjct  320   NFMMVSSPHSENALSEAISSSLLEWNMKDRLFTITLDNDCSSHDIYSANLRDHLSNKNNL  379

Query  2007  SVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              +K +   +RC AHILN+V QD +      +  +RE ++++++SP++ +KF ++A
Sbjct  380   MLKGQLFVVRCYAHILNVVAQDVIASIHGVIYNIRESIKFIKASPNREEKFAEIA  434


 Score = 30.0 bits (66),  Expect(3) = 8e-54, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ +   FID  W
Sbjct  284   RISLTIGLWTTSQTLGYVSLAGQFIDSNW  312



>ref|XP_009781000.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=307

 Score =   198 bits (504),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 127/310 (41%), Positives = 176/310 (57%), Gaps = 17/310 (5%)
 Frame = -2

Query  1768  MLQSALIYQKVFDDYEYSDNSFKSDL-----GDSIPTSL----DWESVNNLVKLLKCFYE  1616
             ML   + Y++   +Y   D      L      D  P  L    D ++V  + + L+ FY 
Sbjct  1     MLNRVIEYERAIKEYSDRDTGLSRYLMFDAISDGKPVGLLTRTDLDNVKRIAQFLEIFYN  60

Query  1615  MTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAKFEKY*GDIDKMN  1439
             +T+++SG LYVT+N+ F EI  +   LN ++   D  +  M ++M  K EKY G+  KMN
Sbjct  61    LTLKVSGLLYVTSNSHFLEIGQVVVYLNRLITTEDVLLSEMASSMWKKIEKYWGEPTKMN  120

Query  1438  YMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSPSVVPA  1259
              MIF A +LDPR K   +   L  M+GD+ G    +++   ++ L+++Y    S SV   
Sbjct  121   KMIFIACVLDPRYKFTIVSFVLKKMFGDE-GTIIEKEVHTYMSSLFNEYV---SKSVSKD  176

Query  1258  TGSGSVASVNLVVEFVFTPVGRPQ-HLLKAQIKKQRMELLG-GKKIELEYYLSEAITEDE  1085
             T  G V++      F       P    L  +I+K +    G   KIELE YL+E    + 
Sbjct  177   T-CGKVSTSLPSSSFSTMETSTPGLGELLDEIRKHKAASGGVDSKIELEKYLAEDPENER  235

Query  1084  GSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVE  905
               FDIL WWKVNS RFPIL+K++RD+LAIPIS+VASESAFS  GR+LD FRSSLTPK+V+
Sbjct  236   PDFDILAWWKVNSPRFPILAKMSRDVLAIPISSVASESAFSTVGRILDQFRSSLTPKLVK  295

Query  904   ALVCTQDWLR  875
              LVC QDWLR
Sbjct  296   TLVCLQDWLR  305



>gb|ACN26356.1| unknown [Zea mays]
Length=510

 Score =   178 bits (451),  Expect(3) = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/325 (35%), Positives = 174/325 (54%), Gaps = 21/325 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E  D+++        P++ DW+ V 
Sbjct  181   IPSTKTLCLDVTTQWNTTYLMLLAALDYKQAFSTLETCDDNYNES-----PSAEDWKKVE  235

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAV-KLMGANMKAKF  1472
                  LK  Y+    +  S   TAN FF E   +   L    E +  +   +  +M  +F
Sbjct  236   ATCNYLKLLYDSAHSVMASANPTANIFFHEAWKIQLELANGTEHENPIFSSIAKDMHERF  295

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR K++ +      +YG +  K Y++ +  +L+ELY +Y
Sbjct  296   DKYWKDC---SLVLAIAVVMDPRFKMKLVEFSYSKIYGAEAMK-YVKVVNDSLHELYKEY  351

Query  1291  AVS---YSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
                    +P+ V A    + ASVN        P      LL   +    ++     K +L
Sbjct  352   VAQPLPLTPAYVEANNVAANASVN-----QGNPSSTGDGLLDFDMYLSEIQSTQPAKCDL  406

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---R  950
             E YL E++T     FDIL WWK+N+ +FP LSK+ARDILAIP+S V+S S+   +G   R
Sbjct  407   EQYLEESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAIPMSMVSSGSSIFSAGTGNR  466

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR  875
             +LD +RSSL P+ VEALVC +DWL+
Sbjct  467   MLDDYRSSLRPETVEALVCAKDWLQ  491


 Score = 52.8 bits (125),  Expect(3) = 1e-53, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSS  2008
             +F+ V S H    ++ A+ S L+EW +++ +FT+T+DN  SS+D+    L+  + +  + 
Sbjct  62    NFMMVSSPHSENALSEAISSSLLEWNMKDRLFTITLDNDCSSHDIYSANLRDHLSNKNNL  121

Query  2007  SVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              +K +   +RC AHILN+V QD +      +  +RE ++++++SP++ +KF ++A
Sbjct  122   MLKGQLFVVRCYAHILNVVAQDVIASIHGVIYNIRESIKFIKASPNREEKFAEIA  176


 Score = 30.4 bits (67),  Expect(3) = 1e-53, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ +   FID +W
Sbjct  26    RISLTIGLWTTSQTLGYVSLAGQFIDSDW  54



>ref|XP_007213601.1| hypothetical protein PRUPE_ppa002416mg [Prunus persica]
 gb|EMJ14800.1| hypothetical protein PRUPE_ppa002416mg [Prunus persica]
Length=675

 Score =   185 bits (469),  Expect(3) = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/329 (36%), Positives = 178/329 (54%), Gaps = 36/329 (11%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI  +  L LD P RWNSTY+ML++AL Y+  F   +  D S+ S L D+     +WE  
Sbjct  350   GINSERRLILDFPVRWNSTYIMLETALEYRGAFSLLQEHDPSYASSLTDT-----EWEWT  404

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
             + +   LK   E+T   SG+   TA+ +F EI  ++  L E  ++ D  +  M   MKAK
Sbjct  405   SFVTGYLKLLVEITNVFSGNKSPTASIYFPEICHVHIQLIEWCKSPDDFLSCMALKMKAK  464

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY     K +  +  A ILDPR K++ +      +YG     D ++++   + EL+D 
Sbjct  465   FDKY---WSKCSLALAVAAILDPRFKMKLVEYYYSQIYG-STALDRIKEVSDGIKELFDA  520

Query  1294  YAVSYS---------PSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELL  1142
             Y++  +          S +P+T S +   +    +F++    + Q+++            
Sbjct  521   YSICSTMVDQGSALPGSSLPSTSSDTRDRLKGFDKFLYE-TSQSQNVIS-----------  568

Query  1141  GGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
                  +L+ YL E +      F+IL WWKV++ R+PILS +ARD+L  P+STVA ESAFS
Sbjct  569   -----DLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDVLGTPMSTVAPESAFS  623

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             I GRVLD  RSSL P I +ALVCTQDWL+
Sbjct  624   IGGRVLDQCRSSLNPDIRQALVCTQDWLQ  652


 Score = 39.3 bits (90),  Expect(3) = 1e-53, Method: Compositional matrix adjust.
 Identities = 19/77 (25%), Positives = 43/77 (56%), Gaps = 1/77 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             +H  + ++  +  CL++W + + +F  T+D+ S++D  +  +K ++      +   +   
Sbjct  240   THTEDSLSEVISKCLMDWDIHSKLFAFTLDDCSTDDDIVLRIKDRISQSRPLAGHGQLFD  299

Query  1983  MRCIAHILNLVVQDSLK  1933
             +R  AH+LN +VQD L+
Sbjct  300   IRSAAHLLNSIVQDVLE  316


 Score = 37.0 bits (84),  Expect(3) = 1e-53, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R++++ + W+S + + Y+ +TAH+IDE+W
Sbjct  197   RINLSVEMWSSPENVEYLCLTAHYIDEDW  225



>emb|CAE01302.2| OSJNBa0020P07.19 [Oryza sativa Japonica Group]
Length=741

 Score =   169 bits (427),  Expect(3) = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/338 (33%), Positives = 166/338 (49%), Gaps = 38/338 (11%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
              ++    L +D PTRWNST+LML++A+ Y+  FD                 PT +DW   
Sbjct  380   SLDNTKGLSMDTPTRWNSTFLMLKNAIYYRNAFDRLFLRHGR---KYAKCAPTKVDWSMA  436

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAVKLMGANMKAKF  1472
               L K LK F+E T   SG+ Y TA +FF                D  +K M   M+ K+
Sbjct  437   IALCKCLKPFHEATELFSGTTYPTAKSFF--------------RTDRTIKTMANAMQTKY  482

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY    +K N  +  A  LDPR K   +    + +YG +  + + ++    + +L+D Y
Sbjct  483   DKY---WEKSNMALAVACFLDPRYKTSSIEYYGMKIYGLEAAEKF-DEFNGVIKQLFDVY  538

Query  1291  AVSYSPSVVPATGSGSVASVNL-------VVEF--VF----TPVGRPQHLLKAQIKKQRM  1151
             A S   +         V  + +         EF  +F    +     QH  +  +  +R 
Sbjct  539   ATSACATSKKKGAEMHVHQLQIQSDPVHNTDEFDDIFNENDSSHDHEQHFQRFLL--ERS  596

Query  1150  ELLGGKKIELEYYLSEAIT--EDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVAS  977
             + +   K EL+ Y+ + +     + +FDIL WWK+  A FPIL K+ARD L I +STVAS
Sbjct  597   QPICSDKTELQIYMEQPLLLWTSKDTFDILSWWKLKQAEFPILCKLARDFLCIQVSTVAS  656

Query  976   ESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNT  863
             ESAFS  G V+D FR+ L P+ ++ALVCT+DW++  N 
Sbjct  657   ESAFSAGGHVVDPFRTRLDPEAMQALVCTKDWIKAANN  694


 Score = 55.1 bits (131),  Expect(3) = 2e-53, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 2/115 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHM  1981
             H G  +       +++W L R +  +T+DNASSNDV +  +  K+           + H+
Sbjct  271   HSGSNMCKEFYDSIVDWNLDRRLVGLTLDNASSNDVCVKGVILKLRKISPLICDGIFFHV  330

Query  1980  RCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA-EYSMELSK  1819
             RC  HILNLV QD LKQ    V +++  +  ++ SP + + F+  A E S++ +K
Sbjct  331   RCFNHILNLVAQDGLKQITGAVLKIKNTISILKHSPLQFEAFQKCALEVSLDNTK  385


 Score = 36.2 bits (82),  Expect(3) = 2e-53, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R S T D WTS Q  +YM +T H+ID+ W
Sbjct  227   RFSTTMDMWTSNQNKSYMCITVHWIDDTW  255



>ref|NP_001057110.1| Os06g0209900 [Oryza sativa Japonica Group]
 dbj|BAF19024.1| Os06g0209900 [Oryza sativa Japonica Group]
Length=883

 Score =   175 bits (443),  Expect(3) = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/329 (36%), Positives = 171/329 (52%), Gaps = 28/329 (9%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             +   + L LDVPTRWNSTY ML+ A+ Y+  F+   + D         S   + +W    
Sbjct  530   LNNNSGLPLDVPTRWNSTYDMLKQAIYYKGAFERLLFLDEDRYQRCASS---AEEWGMAE  586

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKLMGANMKAKF  1472
             +L   L+ F + T+  SG LY TAN F+ +  ++   L E    AD ++  M   M+ K+
Sbjct  587   SLCNCLEKFNDATLLFSGCLYPTANLFWWKFCEIKLALREWCASADVSIASMAVAMQLKY  646

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY    DK N  +  A  LDPR K + M   L  +Y DK  +++ +++LAA++  +  Y
Sbjct  647   DKY---WDKSNLALAVACFLDPRYKQKLMIFFLQKIYPDKYEEEF-KRVLAAIDNFFRAY  702

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK----IE  1124
                 + S  P     S  S          P G    L   +I+K   +     K     E
Sbjct  703   KSCVARSSKPTAAGSSENS---------QPHGNTS-LGHNEIEKFLYDDAAANKEDDINE  752

Query  1123  LEYYLSEAI------TEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
             L+ Y+ E        T +   FDIL WWK N   FPILS +ARD++A+ ISTVASESAFS
Sbjct  753   LDVYMKEKPIRWVDPTGEGVEFDILAWWKNNQMTFPILSTLARDVMAVQISTVASESAFS  812

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
               GRV+  FRSSL P+++EALVCT+DW+R
Sbjct  813   AGGRVVGPFRSSLHPEMIEALVCTKDWIR  841


 Score = 45.1 bits (105),  Expect(3) = 2e-53, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 7/82 (9%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSND-----VALGFLKRKVLSWGSSSV-K  1999
             H G  +ANA    ++   + + +F +T+DNASSND     V +   K   +S     +  
Sbjct  414   HTGTRLANAFVKGVMSMNIEKKLFALTLDNASSNDKCAREVVIELNKLFNISKVPPLMCD  473

Query  1998  SKYLHMRCIAHILNLVVQDSLK  1933
               + H+RC+ HILNLV QD LK
Sbjct  474   GAFFHVRCLCHILNLVAQDGLK  495


 Score = 40.4 bits (93),  Expect(3) = 2e-53, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S T D WTS Q   YM +TAH+IDE W
Sbjct  370   RISTTMDMWTSNQNKAYMCITAHWIDENW  398



>gb|KDP34464.1| hypothetical protein JCGZ_11935 [Jatropha curcas]
Length=672

 Score =   182 bits (462),  Expect(3) = 3e-53, Method: Compositional matrix adjust.
 Identities = 117/332 (35%), Positives = 176/332 (53%), Gaps = 42/332 (13%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI  + +L LD P RWNSTYLML++AL Y+  F   +  D ++ S L D+     +WE  
Sbjct  351   GISSQKNLVLDSPIRWNSTYLMLETALEYKNAFSLLQEHDPAYASALTDT-----EWEWT  405

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
             +++   LK F E+T  +SG+   TAN +F EI D++  L E  ++ D  +  + + MKAK
Sbjct  406   SSVTSYLKLFVEITCVLSGNKCPTANIYFPEICDVHIQLIEWCKSPDNFLSSIASKMKAK  465

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY    +K +  +  A ILDPR K++ +      +YG     D ++++   + EL++ 
Sbjct  466   FDKY---WNKCSLALAVAAILDPRFKMKLVEYYYSQIYG-STALDRIKEVSDGIKELFNA  521

Query  1294  YAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI----  1127
             Y++    S +   GS                   P + L +     R  L G  K     
Sbjct  522   YSIC---STLVDQGS-----------------ALPGNSLPSTSSDSRDRLKGFDKFLHEN  561

Query  1126  --------ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASES  971
                     +L+ YL E +      F+IL WWKV++ R+PILS +ARD+L  P+ST++ ES
Sbjct  562   SQSQSVASDLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDVLGTPMSTISPES  621

Query  970   AFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             AFS  GRVLD  RSSL P   +AL+C +DWLR
Sbjct  622   AFSTGGRVLDSHRSSLNPDTRQALICARDWLR  653


 Score = 41.2 bits (95),  Expect(3) = 3e-53, Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLR-NVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             SH  + ++  +  CL+EW +   +F +T D+ S++D  +  +K ++          +   
Sbjct  241   SHTEDMLSEVIIKCLMEWDIECKLFAMTFDDCSTDDDIVLRIKDRISQNRPLLSNGQLFD  300

Query  1983  MRCIAHILNLVVQDSLK  1933
             +R  AH+LNL+VQD ++
Sbjct  301   VRSSAHVLNLIVQDVME  317


 Score = 36.2 bits (82),  Expect(3) = 3e-53, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R++++ + W+S + I Y+ + AH+IDE+W
Sbjct  198   RINLSIEMWSSAENIEYLCLAAHYIDEDW  226



>ref|WP_001246769.1| hypothetical protein [Vibrio cholerae]
 gb|EAX60388.1| fatty oxidation complex alpha subunit [Vibrio cholerae V52]
Length=275

 Score =   195 bits (496),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 162/262 (62%), Gaps = 6/262 (2%)
 Frame = -2

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA-VKLMGANMKA  1478
             + N+ K L+ FYE+T+++SGS YVT N  F +I +L   L   + +D   +  M + MK 
Sbjct  1     MRNVTKFLEKFYELTLKVSGSRYVTCNVHFEDICELDAYLKACMASDEVDLSKMASGMKE  60

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYD  1298
             KF+KY G  +KMN M+F A++LDPR+K  Y+   L  + G++KGK    ++ A L +L+ 
Sbjct  61    KFKKYWGTPEKMNKMLFIASVLDPRNKFVYVNFALEELLGEEKGKIVNNEVEAYLKKLFA  120

Query  1297  DYAVSYSPSV--VPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIE  1124
              Y   Y+      P++   S +S   + + V T   R +  +K Q K+    L  G K E
Sbjct  121   IYVSKYAKGSKNQPSSSDLSDSSTCGLSQNVKTNSLRTKFYMKKQ-KEDSGSL--GVKSE  177

Query  1123  LEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVL  944
             L+ YL E    +   FDIL WWKVNS RFP+LS++ARD+LAIP+S+VASE AFS  GR+L
Sbjct  178   LDRYLLEDQEPESEDFDILIWWKVNSPRFPVLSQLARDVLAIPMSSVASECAFSTGGRIL  237

Query  943   DHFRSSLTPKIVEALVCTQDWL  878
             D FRSSLTPK V+ L+C QDWL
Sbjct  238   DPFRSSLTPKCVQCLICVQDWL  259



>ref|XP_009145546.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brassica rapa]
Length=876

 Score =   173 bits (438),  Expect(3) = 5e-53, Method: Compositional matrix adjust.
 Identities = 115/341 (34%), Positives = 178/341 (52%), Gaps = 25/341 (7%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFK------SDLG---DSIPTSL  1667
             + SL LDV TRWNSTYLML +AL ++  FD  E  D  +       +D G   +  P   
Sbjct  343   RGSLPLDVTTRWNSTYLMLNTALKFRVAFDKMEAEDKLYNDHFLELTDKGKKREGPPRYH  402

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGA  1490
             DW S+  L + L  FY  T+ +S S  + A   + EI  +   L  + E+ D  +K    
Sbjct  403   DWRSIERLCRFLVIFYNSTLVVSASTSLNAYRCYEEIVTIATNLMALSESMDHELKDKAV  462

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK--KGKDYLEKLLAA  1316
              M  KF+KY   +  +N M+  A + DP  K+         +YG+   +GK+  E +++ 
Sbjct  463   EMFKKFDKYWDGLKNINKMLIVATVFDPTKKMVLATMCFDELYGEDSLEGKEMYESVMSV  522

Query  1315  LNELYDDYAVSY----SPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRME  1148
             L  L+ +Y+  +    S     AT S + AS +     + TP      +   +I ++   
Sbjct  523   LRSLFKEYSERHMRSSSGQTDQATTSNTQASQSSRELSMITPDLVDDGIGYKRIDRRYKS  582

Query  1147  LLGG-----KKIELEYYLSEAITEDE----GSFDILRWWKVNSARFPILSKIARDILAIP  995
             +L       K+ EL+ YL E +   E      +D+L +W+ N  +FPILS+IA+D+LA+ 
Sbjct  583   MLKEIGVKEKRDELDVYLKEGVENPELIVGVEYDVLSFWRRNCTKFPILSQIAKDVLAMQ  642

Query  994   ISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRR  872
             +S+VASESAFS  GR++D FRS LT  +VE L+CT+ WL++
Sbjct  643   VSSVASESAFSTGGRIIDPFRSCLTHFMVEVLMCTEQWLKQ  683


 Score = 64.7 bits (156),  Expect(3) = 5e-53, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--V  2002
             F  V  HKG+ I+  L   L +WG+  +F  TVDNA++N  AL   + +  S    +  +
Sbjct  224   FKHVIDHKGQTISRVLLEVLADWGINKLFCATVDNATANSSALRRFQAEFSSQSPDALVL  283

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCD  1924
               +++H+RC AHI+NL+V+D +   D
Sbjct  284   DGEFMHLRCSAHIINLIVKDGMADAD  309


 Score = 21.6 bits (44),  Expect(3) = 5e-53, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTS  2250
             QRVSITTD W +
Sbjct  195   QRVSITTDIWVA  206



>ref|XP_009376729.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Pyrus x bretschneideri]
Length=677

 Score =   184 bits (466),  Expect(3) = 5e-53, Method: Compositional matrix adjust.
 Identities = 119/329 (36%), Positives = 176/329 (53%), Gaps = 36/329 (11%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             G+  +  L LD P RWNSTY ML++AL Y+  F   +  D S+ S L D+     +WE +
Sbjct  349   GLNSQRRLILDFPARWNSTYHMLETALEYRGAFSLLQEHDPSYTSALTDT-----EWERM  403

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
              ++   LK   E+    S +   TA+ +F EI D++  L E  ++ D  +  M   MKAK
Sbjct  404   GSVTVYLKLLVEIVNVFSSNKCPTASIYFPEICDVHIQLIEWCKSPDEFLSSMALKMKAK  463

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY     K +  +  A ILDPR K++ +      +YG     D ++++   L EL+D 
Sbjct  464   FDKY---WSKCSLALAVAAILDPRFKMKLVEYYYSQIYG-STALDRIKEVSDGLKELFDA  519

Query  1294  YAVSYS---------PSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELL  1142
             Y++  +          S +P+T + S   +    +F++    + Q+++            
Sbjct  520   YSICSTMVDQGSALPGSSLPSTSTDSRDRLKGFDKFLYE-TSQSQNMIS-----------  567

Query  1141  GGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
                  +L+ YL E +      F+IL WWKV++ R+PILS +ARD+L  P+STVA ESAF 
Sbjct  568   -----DLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDVLGTPMSTVAPESAFD  622

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             I GRVLD  RSSL P I EALVCTQDWLR
Sbjct  623   IGGRVLDECRSSLNPDIREALVCTQDWLR  651


 Score = 38.1 bits (87),  Expect(3) = 5e-53, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 46/84 (55%), Gaps = 2/84 (2%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSS  2005
             +FV + S H  + ++  +  CL++W + + +F +T D+ S +D  +  +K ++       
Sbjct  232   NFVTLDSTHTEDLLSEVVIKCLMDWDIDSKLFALTFDDCSVDDDIVVRIKDRISQNRPLL  291

Query  2004  VKSKYLHMRCIAHILNLVVQDSLK  1933
             V  +   +R  AH+LN +VQD L+
Sbjct  292   VHGQLFDIRSAAHLLNSIVQDVLE  315


 Score = 37.0 bits (84),  Expect(3) = 5e-53, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R++++ + W+S + + Y+ +TAH+IDE+W
Sbjct  196   RINLSVEMWSSPENVEYLCLTAHYIDEDW  224



>gb|ABF94985.1| hAT family dimerisation domain containing protein [Oryza sativa 
Japonica Group]
Length=883

 Score =   173 bits (439),  Expect(3) = 8e-53, Method: Compositional matrix adjust.
 Identities = 119/329 (36%), Positives = 171/329 (52%), Gaps = 28/329 (9%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             +   + L LDVPTRWNS Y ML+ A+ Y+  F+   + D         S   + +W    
Sbjct  530   LNNNSRLPLDVPTRWNSIYDMLKQAIYYRGAFERLLFLDEDRYQKCASS---AEEWGMAE  586

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKLMGANMKAKF  1472
             +L   L+ F + T+  SG LY TAN F+ +  ++   L E    AD ++  M   M+ K+
Sbjct  587   SLCNCLEKFNDATLLFSGCLYPTANLFWWKFCEIKLALREWCASADVSIASMAVAMQLKY  646

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY    DK N  +  A  LDPR K + M   L  +Y DK  +++ +++LAA+++ +  Y
Sbjct  647   DKY---WDKSNLALAVACFLDPRYKQKLMIFFLQKIYPDKYEEEF-KRVLAAIDKFFRAY  702

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK----IE  1124
                 + S  P     S  S          P G    L   +I+K   +     K     E
Sbjct  703   KSCVARSSKPTAAGSSENS---------QPHGNTS-LGHNEIEKFLYDDAAANKEDDINE  752

Query  1123  LEYYLSEAI------TEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
             L+ Y+ E        T +   FDIL WWK N   FPILS +ARD++A+ ISTVASESAFS
Sbjct  753   LDVYMKEKPIRWVDPTGEGVEFDILAWWKNNQMTFPILSTLARDVMAVQISTVASESAFS  812

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
               GRV+  FRSSL P+++EALVCT+DW+R
Sbjct  813   AGGRVVGPFRSSLHPEMIEALVCTKDWIR  841


 Score = 44.7 bits (104),  Expect(3) = 8e-53, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 15/86 (17%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLS-----WGSSSVKS  1996
             H G  +ANA    ++   + + +F +T+DNASSND       R+V+      +  S V  
Sbjct  414   HTGTRLANAFVKGVMSMNIEKKLFALTLDNASSNDKCA----REVVIELNNLFNISKVPP  469

Query  1995  -----KYLHMRCIAHILNLVVQDSLK  1933
                   + H+RC+ HILNLV QD LK
Sbjct  470   LMCDGAFFHVRCLCHILNLVAQDGLK  495


 Score = 40.4 bits (93),  Expect(3) = 8e-53, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S T D WTS Q   YM +TAH+IDE W
Sbjct  370   RISTTMDMWTSNQNKAYMCITAHWIDENW  398



>ref|XP_006289367.1| hypothetical protein CARUB_v10002853mg [Capsella rubella]
 gb|EOA22265.1| hypothetical protein CARUB_v10002853mg [Capsella rubella]
Length=528

 Score =   143 bits (361),  Expect(3) = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/341 (31%), Positives = 169/341 (50%), Gaps = 27/341 (8%)
 Frame = -2

Query  1816  TSLC--LDVPTRWNSTYLMLQSALIYQKVFDDYEYSD---NSFKSDLGDSI-----PTSL  1667
             TS C   ++   W+STYLML  A+ ++  F   E  D   N +  +L +       PT  
Sbjct  159   TSRCDTFELKVVWSSTYLMLTRAMKFKLAFQKMEDEDKLYNDYFMELKNGAKQKGPPTYS  218

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGA  1490
             +W ++   VK L  FY  T+ +S S    +   + EI  +   L  M  + D  +  M  
Sbjct  219   NWRAIERFVKFLGLFYTATLVVSASTKGCSYKCYGEIVTIEKNLTNMSTSYDKELSKMHV  278

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYG--DKKGKDYLEKLLAA  1316
              M+ KF KY   I  +N M+  A++ DPR K+++       +YG   K  KD    +L  
Sbjct  279   EMREKFSKYWEGIKNINKMLIVASVFDPRQKMQFATMCFEKLYGKDSKDAKDMCTSVLNL  338

Query  1315  LNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGR-------PQHLLKAQIKKQ  1157
             + ++  +Y   Y+      +   + +S     +F+F  +         P+          
Sbjct  339   MKDMLVEYTY-YNKGSSTQSSQSNPSSSTAQDQFIFDSLSSDIAEDVVPEFERMDDAYSD  397

Query  1156  RMELLGGKKI--ELEYYL---SEAITEDEGS-FDILRWWKVNSARFPILSKIARDILAIP  995
              +   GG ++  EL+ YL   +E      GS +D+L WW++NS +FPILSKIA+D LA+ 
Sbjct  398   LVSSKGGGEMKDELDIYLKYETETPKTLPGSEWDVLSWWRLNSQKFPILSKIAKDFLAMQ  457

Query  994   ISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRR  872
             +S+VASE AF+ SGR+L  +RS L+  IVE L+CT+ W+++
Sbjct  458   VSSVASEEAFNNSGRILSAYRSCLSHYIVEVLICTKQWIKQ  498


 Score = 75.1 bits (183),  Expect(3) = 1e-52, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVAL-GFLKR-KVLSWGSSSV  2002
             F  +  HK   I+  L  CL EWG+  +FT+TVDNA++N + L  F+   K+L   S  +
Sbjct  57    FKHITDHKSNMISKVLLDCLAEWGIEKLFTITVDNATANSIGLKKFIDEFKLLRHDSLVL  116

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQ  1930
                Y+HMRC AHI+NL+VQD L +
Sbjct  117   GGYYMHMRCCAHIINLIVQDGLTK  140


 Score = 38.9 bits (89),  Expect(3) = 1e-52, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
              RVS+TTD WT+ + + +YMV+T HF+D +W
Sbjct  18    HRVSLTTDIWTANVTKASYMVITVHFVDADW  48



>ref|XP_009793080.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
3-like [Nicotiana sylvestris]
Length=625

 Score =   150 bits (379),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/323 (33%), Positives = 152/323 (47%), Gaps = 64/323 (20%)
 Frame = -2

Query  1810  LCLDVPTRWNSTYLMLQSALIYQKVF-----DDYEYSDNSFKSDLGDSIPTSLDWESVNN  1646
             L LDV TRWNSTYLML + + ++KVF     DD++Y +   +       P+S DW++V  
Sbjct  319   LNLDVETRWNSTYLMLDTVVKFEKVFSRMYIDDHKYFNYCLELSGTAGHPSSEDWQNV--  376

Query  1645  LVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAVKLMGANMKAKFEK  1466
                  K F                                +  D  +  M   MK KF+K
Sbjct  377   -----KAF--------------------------------LNVDSILTNMAKKMKLKFDK  399

Query  1465  Y*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAV  1286
             Y  D + MN ++F   +LDPR K++Y+       Y   +GK    K++  L+ LY  Y  
Sbjct  400   YWADFENMNMLLFVVVVLDPRYKIKYVKFLFSKFYSSLEGKGKSTKMMDTLSRLYSHYKD  459

Query  1285  SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG------GKKIE  1124
             S S            ++ N+  +   T V +   +    + + + E         G   E
Sbjct  460   SIS----------GASNENIRDQ---TSVSQTDTMHNCDVWQSQWEKFLEDENNIGNTSE  506

Query  1123  LEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVL  944
             LE YL + + E     + L  WK +S R+P++S I RD+L IP STVAS+SAFS  G +L
Sbjct  507   LEKYLMDDV-EKNKDLNDLAGWKASSERYPVISMITRDVLVIPTSTVASKSAFSSGGWIL  565

Query  943   DHFRSSLTPKIVEALVCTQDWLR  875
             D +RSSL+ KI EALVC Q WLR
Sbjct  566   DCYRSSLSTKIAEALVCCQQWLR  588


 Score = 86.7 bits (213),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLS-WGSSSVKSKYLHM  1981
             HKGE IA  +E+CL++WG+   FT+T+DNA++ND A+ +LK ++   W    +++++LH+
Sbjct  203   HKGETIAKGIEACLLDWGIEKPFTLTLDNATANDAAIKYLKGRINDYWKGVILENEFLHV  262

Query  1980  RCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             RC AHILNL+V++ L +   ++ RVR  V+YV+SSP++   F+   E
Sbjct  263   RCNAHILNLIVKERLSEQHESISRVRMAVKYVKSSPARSASFKSHVE  309



>ref|XP_009598305.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=370

 Score =   149 bits (375),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 143/259 (55%), Gaps = 11/259 (4%)
 Frame = -2

Query  1810  LCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFK--------SDLGDSIP-TSLDWE  1658
             LCLDVPTRWNS YLML +A  ++K FD +   D+ F          D   + P  S DW 
Sbjct  111   LCLDVPTRWNSIYLMLDTAQNFEKAFDKFHLFDDGFSPYLCSHLCEDGSSTSPLESDDWV  170

Query  1657  SVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKLMGANMK  1481
             ++ N++K L  F+++T ++S   YVT N  F ++S+LYC L   ++  D  ++ +  +M+
Sbjct  171   NLRNVIKFLVRFHDLTKKVSDPRYVTCNARFEDVSELYCHLKMCLICEDEHLRKLVEHME  230

Query  1480  AKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELY  1301
              KF+ Y G+  KMN +IF A++LDPR+K EY+   L  ++G+KKGK    +  A +N ++
Sbjct  231   EKFKNYWGEPAKMNKIIFIASVLDPRNKFEYVSLPLDKLFGEKKGKKINGEAYAYMNSVF  290

Query  1300  DDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG-KKIE  1124
             ++Y   YS    P + S S +  N       + +      ++  +KKQ+ +  GG  K E
Sbjct  291   EEYLKKYSTGACPQSPSRSTSFDNTSNTSNGSIITASLIRMEFHLKKQKKDNGGGVAKSE  350

Query  1123  LEYYLSEAITEDEGSFDIL  1067
             L+ Y+SE        FDIL
Sbjct  351   LDKYISEEQEPFSEEFDIL  369


 Score = 87.8 bits (216),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  2142  IANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHI  1963
             +A ++ +CL+EW L  VFTVTV NA SNDV +  L +K+  W ++ + SK++H+RC+AH+
Sbjct  1     MAKSICNCLLEWKLDKVFTVTVGNALSNDVTVKELPKKLNIWKTNMMNSKHIHVRCMAHM  60

Query  1962  LNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
             LNL+VQD LK+ D +V RVR  V+YVRSSP++  KF+
Sbjct  61    LNLIVQDGLKEIDASVTRVRNTVKYVRSSPTRTLKFK  97



>sp|P08770.2|TRA1_MAIZE RecName: Full=Putative AC transposase; AltName: Full=ORFA [Zea 
mays]
 emb|CAA29005.1| ORFa [Zea mays]
 gb|ABB59981.1| Ac transposase [Immobile Ac/T-DNA vector pKU352NA]
 gb|ABB59986.1| Ac transposase [Immobile Ac/T-DNA vector pNU400]
Length=807

 Score =   168 bits (426),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/327 (37%), Positives = 178/327 (54%), Gaps = 35/327 (11%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSI-PTSLDWESV  1652
             +++   +  DV TRWNSTYLML+ AL Y+      + SD        D+I P + +W+  
Sbjct  450   LDKSKGISYDVSTRWNSTYLMLRDALYYKPALIRLKTSD----PRRYDAICPKAEEWKMA  505

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTF---FSEISDL---YCILNEMVEADGAVKLMGA  1490
               L K LK F+++T  +SG+ Y TAN F   F EI DL   +C+  + V     ++ M  
Sbjct  506   LTLFKCLKKFFDLTELLSGTQYSTANLFYKGFCEIKDLIDQWCVHEKFV-----IRRMAV  560

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
              M  KFEKY       N  +  A  LDPR K   +   +   +GD   K +++  +  + 
Sbjct  561   AMSEKFEKY---WKVSNIALAVACFLDPRYKKILIEFYMKKFHGDSY-KVHVDDFVRVIR  616

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVN-LVVEFVFTPVGRPQHLLKA--QIKKQRMELLG  1139
             +LY  Y+ S SPS  P T + +  S++  ++E          H LK   Q++        
Sbjct  617   KLYQFYS-SCSPSA-PKTKTTTNDSMDDTLMENEDDEFQNYLHELKDYDQVESN------  668

Query  1138  GKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSI  959
                 EL+ Y+SE + +  G FDIL WW+   A +PIL++IARD+LAI +STVASESAFS 
Sbjct  669   ----ELDKYMSEPLLKHSGQFDILSWWRGRVAEYPILTQIARDVLAIQVSTVASESAFSA  724

Query  958   SGRVLDHFRSSLTPKIVEALVCTQDWL  878
              GRV+D +R+ L  +IVEAL+CT+DW+
Sbjct  725   GGRVVDPYRNRLGSEIVEALICTKDWV  751


 Score = 50.1 bits (118),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV-KSKYLH  1984
             H G+ ++    + +++W + + +F +++DNAS+N+VA+  +   +    S+ V    + H
Sbjct  339   HTGQRLSQTFTAIMVKWNIEKKLFALSLDNASANEVAVHDIIEDLQDTDSNLVCDGAFFH  398

Query  1983  MRCIAHILNLVVQDSL  1936
             +RC  HILNLV +D L
Sbjct  399   VRCACHILNLVAKDGL  414


 Score = 38.5 bits (88),  Expect(3) = 2e-52, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R S T D WTS Q  +YM VT H+ID++W
Sbjct  295   RFSTTMDMWTSCQNKSYMCVTIHWIDDDW  323



>ref|XP_009103069.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brassica rapa]
Length=477

 Score =   146 bits (369),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 122/332 (37%), Positives = 173/332 (52%), Gaps = 50/332 (15%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI +K SL LDV TRWNSTY+ML  AL Y++ F +    + S+K     S+PT  +W   
Sbjct  164   GIVKKGSLVLDVTTRWNSTYMMLSRALHYKEAFKNLAEIEASYK-----SLPTESEWLRA  218

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL--NEMVEADGAVKLMGANMKA  1478
               +  LL+ F EMT  ISGS Y TAN +F E+  +   L  NE  E D  +  M A+M+ 
Sbjct  219   GLIYNLLQPFDEMTGLISGSSYPTANLYFMEVWKIQNWLGSNEFRE-DTVISDMVASMRL  277

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDK---LEYM-----PTQLVHMYGDKKGKDYLEKLL  1322
             KF KY    ++ + ++  A +LDPR K   LEY      PT        K   DY+ K +
Sbjct  278   KFVKY---WEEYSDILAIAAVLDPRLKFKVLEYCYHSSDPTTC------KSRMDYIRKRM  328

Query  1321  AALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVF-TPVGRPQHLLKAQIKKQRMEL  1145
                 +LY DY             + S  S   V  + F +  G        Q        
Sbjct  329   L---KLYGDY-----------KKNTSAHSSQEVEAYAFPSGYGGFYEFFSQQA-------  367

Query  1144  LGGKKIELEYYLSEAITE--DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASES  971
              G +K  L+ YLSE + +       D++++W+ N+ RF  LS++A D+L IPI+TV+SES
Sbjct  368   -GTRKCALDLYLSEPVLDMVANQKLDVIKYWRDNANRFKELSRMACDVLCIPITTVSSES  426

Query  970   AFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             +FS+  RVL  +RS L P  V+AL+CT++WLR
Sbjct  427   SFSVGSRVLSKYRSRLLPSNVQALICTRNWLR  458


 Score = 74.7 bits (182),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 5/82 (6%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             +F P   H G  IA  L   + EWGL + VFTVTVDNASSND   GFLKR++        
Sbjct  52    AFPP--PHSGPAIAMKLMELIKEWGLQKKVFTVTVDNASSNDNMQGFLKRQLRK--DLVC  107

Query  2001  KSKYLHMRCIAHILNLVVQDSL  1936
               ++ H+RC AHILNL+VQD L
Sbjct  108   GGEFFHIRCAAHILNLIVQDGL  129


 Score = 35.8 bits (81),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+ +TTD W +I    Y+ +TAH++D EW
Sbjct  13    RICLTTDLWRAITIEGYLCLTAHYVDTEW  41



>prf||2021344A activator-like transposable element
Length=804

 Score =   167 bits (424),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 170/326 (52%), Gaps = 18/326 (6%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             G++    L LDV TRWNSTYLML+ AL Y+  F   + SD      +    P+  +W   
Sbjct  446   GLDTSKGLSLDVATRWNSTYLMLRDALYYKAAFMRLKSSDRRMYEKI---TPSPSEWAMA  502

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKLMGANMKAK  1475
                 + LK FY++T   SG+LY TAN F+    ++  +L++  +  D  +  M  +M  K
Sbjct  503   FKQFQCLKKFYDLTELFSGTLYPTANFFYRGFCEIKILLDDWCLSKDAIISGMATSMNKK  562

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             FEKY     K +  +  A  LDPR K   +   +   +G    + +++ L+  + +LY  
Sbjct  563   FEKY---WKKSSTTLSVACFLDPRYKKRLIEFYMRKFHGSA-SQVHVDALVDFIKKLYS-  617

Query  1294  YAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEY  1115
             Y  +   S  P + +     ++     V +      +L ++          G    EL+ 
Sbjct  618   YVSAEPSSSKPKSKADEHRDLDTADLLVDSDDELENYLYESSGPD------GDDMNELDK  671

Query  1114  YLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHF  935
             Y+++      G FDIL WWK  S  +PIL+KIARD+LA+ +STVASESAFS  GRV+D F
Sbjct  672   YMADPPLRFSGQFDILAWWKNQSDEYPILAKIARDLLAVQVSTVASESAFSAGGRVVDPF  731

Query  934   RSSLTPKIVEALVCTQDWL---RRPN  866
             RS L P++V+AL+C +DW+   RR N
Sbjct  732   RSRLDPEMVQALICMKDWVAAGRRGN  757


 Score = 52.4 bits (124),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSS  2005
             +FV VK  H G  ++       ++W + + +F++T+DNAS+N+VA+  +   +LS  SS+
Sbjct  327   NFVHVKGRHTGIKLSETFTKLRVKWYIDKKLFSLTLDNASANEVAVKDIIADLLSSTSSA  386

Query  2004  V--KSKYLHMRCIAHILNLVVQDSL  1936
             +     + H+RC  HILNLV +D L
Sbjct  387   LACDGAFFHVRCACHILNLVARDGL  411


 Score = 36.6 bits (83),  Expect(3) = 2e-52, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R S T D WTS Q  +YM VT H+ID+ W
Sbjct  291   RFSATMDMWTSNQNKSYMCVTLHWIDDNW  319



>ref|XP_010253168.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Nelumbo nucifera]
 ref|XP_010253169.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Nelumbo nucifera]
Length=684

 Score =   163 bits (413),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/328 (34%), Positives = 174/328 (53%), Gaps = 29/328 (9%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             ++ K  + +D  T+WNSTY ML+SAL  ++ F     +D+ +K       P++ +WE   
Sbjct  345   LQHKKEVVVDCSTQWNSTYDMLESALELREAFFQLAETDHDYKY-----CPSNEEWEMGK  399

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEAD-GAVKLMGANMKAKF  1472
              +   LK FY  T   S   + TA+  FS+I  +   L+    ++   V+ M   MK KF
Sbjct  400   VIRDCLKVFYICTKNFSSINFPTASILFSDICTIKLRLHMWQNSEYQYVRSMAYKMKQKF  459

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY    D+   ++  A +LDPR K+E +      +YG+   + ++ ++  ALN+LY +Y
Sbjct  460   DKY---WDECCLVLAIAVVLDPRFKMEVVTYYYNLIYGENAER-HIMRVRLALNDLYLEY  515

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGR---PQHLL----KAQIKKQRMELLGGK  1133
                    V    G  S+   +        P  R   P   L    K  ++++     G +
Sbjct  516   -------VGNDVGKKSLEDSSSAF-----PSQRDHDPDDFLSGFDKWLVQERSNYCFGSR  563

Query  1132  KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
             K EL+ YL E +   +  FDILR+W+V+  +FP LS++ARDILAIPI TV SE+ FS   
Sbjct  564   KSELDLYLEERLFPRDEDFDILRFWQVDCPKFPKLSRLARDILAIPILTVTSEATFSTKS  623

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLRRP  869
             R++D + +SL P+IVEALVC +DWL  P
Sbjct  624   RIVDQYHTSLLPEIVEALVCGKDWLEAP  651


 Score = 54.3 bits (129),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHM  1981
             H G  +   +   L+ W L + + ++TV NAS+ND+ +  L+ K+ S     +  +  H+
Sbjct  235   HDGNTLYKIVMERLLSWNLDKKICSITVTNASNNDIMVRELRNKLCSQSLLPLDGEVFHV  294

Query  1980  RCIAHILNLVVQDSLKQ  1930
             RCIAH LNL VQD L +
Sbjct  295   RCIAHTLNLTVQDGLHE  311


 Score = 38.9 bits (89),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+  D WTS Q + Y  +TAHFID+ W
Sbjct  191   RISLNIDMWTSDQNLGYYCLTAHFIDDGW  219



>ref|NP_001051173.1| Os03g0733400 [Oryza sativa Japonica Group]
 sp|Q6AVI0.1|RSLE2_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
2; AltName: Full=Transposase-like protein RICESLEEPER 
2 [Oryza sativa Japonica Group]
 gb|AAT77879.1| putative hAT family dimerisation domain containing protein [Oryza 
sativa Japonica Group]
 gb|AAT78789.1| putative transposases [Oryza sativa Japonica Group]
 gb|ABF98716.1| hAT family dimerisation domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13087.1| Os03g0733400 [Oryza sativa Japonica Group]
 gb|EAZ28483.1| hypothetical protein OsJ_12466 [Oryza sativa Japonica Group]
 dbj|BAH00332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=722

 Score =   176 bits (446),  Expect(3) = 3e-52, Method: Compositional matrix adjust.
 Identities = 120/333 (36%), Positives = 178/333 (53%), Gaps = 23/333 (7%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E SD+++     +  P++ DW+ V 
Sbjct  390   IPSTKTLCLDVTTQWNTTYLMLLAALDYKQAFSTLETSDDNY-----NEAPSAEDWKKVE  444

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
                  LK  Y+    I  +   T+N FF E   L   L N     D     +  +M  +F
Sbjct  445   AACNYLKLLYDSAHSIMAAANPTSNLFFHEAWKLQLELSNATGHEDPVFSSIAKDMHERF  504

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    N ++  A ++DPR K++ +      +YG +  K Y++ +  A++ELY +Y
Sbjct  505   DKYWKDC---NLVLAIAVVMDPRFKMKLVEFSYSKIYGVEAAK-YVKVVDDAVHELYKEY  560

Query  1291  AVSYSPSVVPA-----TGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI  1127
                  P + PA      G+ + AS N       T       L+   +    +      K 
Sbjct  561   VAQPLP-LTPAYVEQGDGNNAPASENGTQA---TAPSTGDGLVDFDMYLSEIATSQPTKS  616

Query  1126  ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG--  953
             ELE YL E++T     FDIL WWK+N+ +FP LS++ARDILAIP+S V+S ++   +G  
Sbjct  617   ELEQYLDESLTPRIQEFDILNWWKLNTLKFPTLSRMARDILAIPMSMVSSGNSIFSAGTG  676

Query  952   -RVLDHFRSSLTPKIVEALVCTQDWLRR-PNTP  860
              R+LD +RSSL P+IVEALVC +DWL+  P TP
Sbjct  677   TRMLDDYRSSLRPEIVEALVCAKDWLQYLPATP  709


 Score = 48.5 bits (114),  Expect(3) = 3e-52, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             H    ++ A+ + L +W +++ +FT+T+DN  SS+D+    L+  + +  +  +K +   
Sbjct  279   HSENALSEAISTSLSDWNMKDKLFTITLDNDCSSHDIYSANLRDYLSNKNNLMLKGQLFV  338

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             +RC AHILN V QD +      +  +RE ++++++SPS+ +KF ++A
Sbjct  339   VRCYAHILNAVAQDVIASIHGVIYNIRESIKFIKASPSREEKFAEIA  385


 Score = 32.0 bits (71),  Expect(3) = 3e-52, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ +   FID EW
Sbjct  235   RISLTIGLWTTSQTLGYVSLAGQFIDSEW  263



>ref|XP_010253170.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Nelumbo nucifera]
Length=671

 Score =   163 bits (413),  Expect(3) = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/328 (34%), Positives = 174/328 (53%), Gaps = 29/328 (9%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             ++ K  + +D  T+WNSTY ML+SAL  ++ F     +D+ +K       P++ +WE   
Sbjct  332   LQHKKEVVVDCSTQWNSTYDMLESALELREAFFQLAETDHDYKY-----CPSNEEWEMGK  386

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEAD-GAVKLMGANMKAKF  1472
              +   LK FY  T   S   + TA+  FS+I  +   L+    ++   V+ M   MK KF
Sbjct  387   VIRDCLKVFYICTKNFSSINFPTASILFSDICTIKLRLHMWQNSEYQYVRSMAYKMKQKF  446

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY    D+   ++  A +LDPR K+E +      +YG+   + ++ ++  ALN+LY +Y
Sbjct  447   DKY---WDECCLVLAIAVVLDPRFKMEVVTYYYNLIYGENAER-HIMRVRLALNDLYLEY  502

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGR---PQHLL----KAQIKKQRMELLGGK  1133
                    V    G  S+   +        P  R   P   L    K  ++++     G +
Sbjct  503   -------VGNDVGKKSLEDSSSAF-----PSQRDHDPDDFLSGFDKWLVQERSNYCFGSR  550

Query  1132  KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
             K EL+ YL E +   +  FDILR+W+V+  +FP LS++ARDILAIPI TV SE+ FS   
Sbjct  551   KSELDLYLEERLFPRDEDFDILRFWQVDCPKFPKLSRLARDILAIPILTVTSEATFSTKS  610

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLRRP  869
             R++D + +SL P+IVEALVC +DWL  P
Sbjct  611   RIVDQYHTSLLPEIVEALVCGKDWLEAP  638


 Score = 53.9 bits (128),  Expect(3) = 3e-52, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = -3

Query  2178  SFVPVK-SHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSS  2005
             +F  V+  H G  +   +   L+ W L + + ++TV NAS+ND+ +  L+ K+ S     
Sbjct  214   AFTAVECPHDGNTLYKIVMERLLSWNLDKKICSITVTNASNNDIMVRELRNKLCSQSLLP  273

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQ  1930
             +  +  H+RCIAH LNL VQD L +
Sbjct  274   LDGEVFHVRCIAHTLNLTVQDGLHE  298


 Score = 38.9 bits (89),  Expect(3) = 3e-52, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+  D WTS Q + Y  +TAHFID+ W
Sbjct  178   RISLNIDMWTSDQNLGYYCLTAHFIDDGW  206



>gb|EEE64835.1| hypothetical protein OsJ_19692 [Oryza sativa Japonica Group]
Length=722

 Score =   176 bits (446),  Expect(3) = 3e-52, Method: Compositional matrix adjust.
 Identities = 120/333 (36%), Positives = 177/333 (53%), Gaps = 23/333 (7%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E SD+++     +  P++ DW+ V 
Sbjct  390   IPSTKTLCLDVTTQWNTTYLMLLAALDYKQAFSTLETSDDNY-----NEAPSAEDWKKVE  444

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
                  LK  Y+    I  +   T+N FF E   L   L N     D     +  +M  +F
Sbjct  445   AACNYLKLLYDSAHSIMAAANPTSNLFFHEAWKLQLELSNATGHEDPVFSSIAKDMHERF  504

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    N ++  A ++DPR K++ +      +YG +  K Y++ +  A++ELY +Y
Sbjct  505   DKYWKDC---NLVLAIAVVMDPRFKMKLVEFSYSKIYGVEAAK-YVKVVDDAVHELYKEY  560

Query  1291  AVSYSPSVVPA-----TGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI  1127
                  P + PA      G+ + AS N       T       L+   +    +      K 
Sbjct  561   VAQPLP-LTPAYVEQGEGNNAPASENSTQT---TAPSTGDGLVDFDMYLSEIATSQPTKS  616

Query  1126  ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG--  953
             ELE YL E++T     FDIL WWK+N+ +FP LSK+ARDILAIP+S V+S ++   +G  
Sbjct  617   ELEQYLDESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAIPMSMVSSGNSIFSAGTG  676

Query  952   -RVLDHFRSSLTPKIVEALVCTQDWLR-RPNTP  860
              R+LD +RSSL P+IVEAL C +DWL+  P TP
Sbjct  677   TRMLDDYRSSLRPEIVEALFCAKDWLQYSPATP  709


 Score = 47.4 bits (111),  Expect(3) = 3e-52, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             H    ++ A+ + L +W +++ +FT+T+DN  SS+D+    L+  + +  +  +K +   
Sbjct  279   HSENALSEAISASLSDWNMKDKLFTITLDNDCSSHDIYSANLRDYLSNKNNLMLKGQLFV  338

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             +RC AHILN V QD +      +  +RE ++++++SP++ +KF ++A
Sbjct  339   VRCYAHILNAVAQDVIASIHGVIYNIRESIKFIKASPTREEKFAEIA  385


 Score = 33.1 bits (74),  Expect(3) = 3e-52, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ ++  FID EW
Sbjct  235   RISLTIGLWTTSQTLGYVSLSGQFIDSEW  263



>emb|CDY08266.1| BnaA05g13530D [Brassica napus]
Length=799

 Score =   154 bits (390),  Expect(3) = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/322 (34%), Positives = 170/322 (53%), Gaps = 17/322 (5%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI     L LDVPTRWNSTY ML  AL ++  F   +  D S+KS     +P+  +W+  
Sbjct  461   GIRSGAGLSLDVPTRWNSTYDMLARALKFRDAFTSLKECDRSYKS-----LPSEDEWDRG  515

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAV-KLMGANMKAK  1475
               + + LK F  +T   SG  Y TAN +F ++  +  +L +    D  V K M   M+ K
Sbjct  516   QKICEFLKPFSTITTFFSGVRYPTANAYFLQVWKIERLLMKYASCDDPVMKEMAKKMRVK  575

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F KY    D+ + ++    +LDPR KL+ + T    +   +  +  +E +   L +LY++
Sbjct  576   FSKY---WDEYSLVLAMGAVLDPRLKLQILRTAYDKV-DPRNAEKKVEIVKKNLKKLYEE  631

Query  1294  YAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEY  1115
             Y   +  S   +T S +     L+ E   +P+    +    ++++     L  KK  LE 
Sbjct  632   YGAKFQSSS--STSSATPTPYELLTE---SPLEDDLNYDLFELERSIQPGLDNKKTNLEM  686

Query  1114  YLSEAITEDEGSFDI--LRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLD  941
             YL +   +     DI  L +WK    R+  L+ +A D+L+IPI+TVASESAFS+ GRV+ 
Sbjct  687   YLEDPRLDTRSFTDIEVLGYWKDQGQRYGDLASLACDLLSIPITTVASESAFSVGGRVIS  746

Query  940   HFRSSLTPKIVEALVCTQDWLR  875
              +R+ L PK V+AL+CT++WLR
Sbjct  747   PYRNRLLPKNVQALLCTRNWLR  768


 Score = 69.7 bits (169),  Expect(3) = 3e-52, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 3/79 (4%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV--KSKY  1990
              H GE +AN L SCL EWGL + VF++T+DNA+ ND     LK ++     + +    K+
Sbjct  349   PHTGEEVANKLISCLKEWGLEKKVFSMTLDNATYNDSMQKILKHRLQMASGNGLLCDGKF  408

Query  1989  LHMRCIAHILNLVVQDSLK  1933
              H+RC AHILNL+V++ L+
Sbjct  409   FHVRCCAHILNLIVKEGLE  427


 Score = 32.0 bits (71),  Expect(3) = 3e-52, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 1/30 (3%)
 Frame = -1

Query  2282  RVSITTDSWT-SIQRINYMVVTAHFIDEEW  2196
             RVS T+D WT S     Y+ +TAH++DE +
Sbjct  305   RVSFTSDMWTASTTMTGYICLTAHYVDESF  334



>ref|XP_010480984.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
Length=447

 Score =   193 bits (490),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 132/362 (36%), Positives = 196/362 (54%), Gaps = 50/362 (14%)
 Frame = -2

Query  1843  RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQ----------KVFDDY--EYSDNSFK  1700
             RV  G   + SLCLDV TRWNSTYLML +A+ ++          K++++Y  E  +N+ +
Sbjct  61    RVETGNVGRGSLCLDVATRWNSTYLMLTAAIKFRVAFEKMLAEDKLYNEYFMETEENA-E  119

Query  1699  SDLGDS------IPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDL-YC  1541
              D G++       PT  DWE V  LVK LK F+  T+  S +  VT+   ++E+  +   
Sbjct  120   GDTGENGRKRVGPPTFADWEQVQRLVKFLKIFFNCTLTFSATKTVTSPVCYNELVIIERN  179

Query  1540  ILNEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMY  1361
             ++N  +  D  +K     M+AKFEKY   ++ MN ++  A + DPR+K+++       +Y
Sbjct  180   LINLSINGDLLLKTEAMIMRAKFEKYWDGLNNMNPLVIIAFVFDPRNKMQFAGLCFDKLY  239

Query  1360  GDKKGKDYLEK------LLAALNELYDDYAVSYSPSVV-PATGSGSVASVNLVVEFVFT-  1205
             G    KD +E       + + + ELY +Y V  S S    +T  G+V    +    +F  
Sbjct  240   G----KDSMESTHLRSSIKSVMKELYGEYVVKLSGSEPGNSTYGGTVTEPVVTTNDLFDL  295

Query  1204  ----PVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSE--------AITEDEGSFDILRW  1061
                    R   L    + +   E       EL+ YL E        A+  D   FDIL W
Sbjct  296   SDDDGYERTDTLYSEMVAETSNEECSS---ELDIYLLEKPVIRTPAALGMD---FDILSW  349

Query  1060  WKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDW  881
             W+ NS++FP+LS++ARD+LAI +S+VASESAFS SGR+LD +RSS++P +VE LVCTQ W
Sbjct  350   WRRNSSKFPVLSEVARDVLAIQVSSVASESAFSTSGRILDPYRSSMSPHMVETLVCTQQW  409

Query  880   LR  875
             LR
Sbjct  410   LR  411


 Score = 42.4 bits (98),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -3

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKF  1855
             +  +Y+HMRC AHILNL+V+D L +   ++  +R  ++YVRSS  +LK F
Sbjct  9     LNGEYIHMRCCAHILNLIVRDGLAKAKTSIVAIRNAIKYVRSSGDRLKSF  58



>gb|EEC79762.1| hypothetical protein OsI_21153 [Oryza sativa Indica Group]
Length=722

 Score =   176 bits (445),  Expect(3) = 4e-52, Method: Compositional matrix adjust.
 Identities = 120/333 (36%), Positives = 177/333 (53%), Gaps = 23/333 (7%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E SD+++     +  P++ DW+ V 
Sbjct  390   IPSTKTLCLDVTTQWNTTYLMLLAALDYKQAFSTLETSDDNY-----NEAPSAEDWKKVE  444

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
                  LK  Y+    I  +   T+N FF E   L   L N     D     +  +M  +F
Sbjct  445   AACNYLKLLYDSAHSIMAAANPTSNLFFHEAWKLQLELSNATGHEDPVFSSIAKDMHERF  504

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    N ++  A ++DPR K++ +      +YG +  K Y++ +  A++ELY +Y
Sbjct  505   DKYWKDC---NLVLAIAVVMDPRFKMKLVEFSYSKIYGVEAAK-YVKVVDDAVHELYKEY  560

Query  1291  AVSYSPSVVPA-----TGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI  1127
                  P + PA      G+ + AS N       T       L+   +    +      K 
Sbjct  561   VAQPLP-LTPAYVEQGEGNNAPASENSTQT---TAPSTGDGLVDFDMYLSEIATSQPTKS  616

Query  1126  ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG--  953
             ELE YL E++T     FDIL WWK+N+ +FP LSK+ARDILAIP+S V+S ++   +G  
Sbjct  617   ELEQYLDESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAIPMSMVSSGNSIFSAGTG  676

Query  952   -RVLDHFRSSLTPKIVEALVCTQDWLR-RPNTP  860
              R+LD +RSSL P+IVEAL C +DWL+  P TP
Sbjct  677   TRMLDDYRSSLRPEIVEALFCAKDWLQYSPATP  709


 Score = 47.4 bits (111),  Expect(3) = 4e-52, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             H    ++ A+ + L +W +++ +FT+T+DN  SS+D+    L+  + +  +  +K +   
Sbjct  279   HSENALSEAISASLSDWNMKDKLFTITLDNDCSSHDIYSANLRDYLSNKNNLMLKGQLFV  338

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             +RC AHILN V QD +      +  +RE ++++++SP++ +KF ++A
Sbjct  339   VRCYAHILNAVAQDVIASIHGVIYNIRESIKFIKASPTREEKFAEIA  385


 Score = 32.3 bits (72),  Expect(3) = 4e-52, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ +   FID EW
Sbjct  235   RISLTIGLWTTSQTLGYVSLAGQFIDSEW  263



>emb|CAN60218.1| hypothetical protein VITISV_006612 [Vitis vinifera]
Length=667

 Score =   171 bits (434),  Expect(3) = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/329 (33%), Positives = 169/329 (51%), Gaps = 36/329 (11%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI  + +L LD PT+WNSTYLML + L Y+  F   +  D  +   L D+     +WE  
Sbjct  348   GINSQQNLFLDCPTQWNSTYLMLDTVLEYKGAFSLLQEHDPGYTVALSDT-----EWEWA  402

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
             +++   +K   E+   +S +   TAN +F EI D++  L E  ++ D  +  +   MKAK
Sbjct  403   SSITSYMKLLLEIIAVLSSNKCPTANIYFPEICDIHIQLIEWCKSPDDFISSLALKMKAK  462

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY     K +  +  A ILDPR K++ +      +YG+    D ++ +   + EL++ 
Sbjct  463   FDKY---WSKCSLALAVAVILDPRFKMKLVEYYYPQIYGNDAA-DRIKDVSDGIKELFNV  518

Query  1294  YA---------VSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELL  1142
             Y          V+   S +P+T + S   +    +F+     + Q+++            
Sbjct  519   YCSTSASLHQGVALPGSSLPSTSNDSRDRLKGFDKFIHE-TSQNQNIVS-----------  566

Query  1141  GGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
                  +L+ YL E +      F IL WWKV   R+PILS + RD+L IP+STVA E  FS
Sbjct  567   -----DLDKYLEEPVFPRNCDFHILNWWKVQKPRYPILSMMVRDVLGIPMSTVAPEVVFS  621

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
                RVLDH+RSSL P   +AL+CTQDWL+
Sbjct  622   TGARVLDHYRSSLNPDTRQALICTQDWLQ  650


 Score = 45.4 bits (106),  Expect(3) = 5e-52, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 67/114 (59%), Gaps = 13/114 (11%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTV-DNASSNDVALGFLK-----RKVLSWGSSSV  2002
             SH  + ++  +  CL+EW +   +F++T  D A+++DVAL   +     R +L  G    
Sbjct  238   SHTEDMLSEFIIKCLMEWEVGHKLFSMTFHDCATNDDVALRVKEHFSQDRPLLGSG----  293

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
               + L +RC+ H+LNL+VQD ++       ++RE VRYV++S + L KF ++A+
Sbjct  294   --QLLDVRCVGHVLNLIVQDCIEALREVTHKIRESVRYVKTSQATLGKFNEIAQ  345


 Score = 38.9 bits (89),  Expect(3) = 5e-52, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+++  D WTS ++  Y+ +TAH+IDE+W
Sbjct  195   RINLAVDMWTSPEQAEYLCLTAHYIDEDW  223



>gb|AEF33496.1| putative transposase [Saccharum hybrid cultivar R570]
Length=607

 Score =   160 bits (406),  Expect(3) = 5e-52, Method: Compositional matrix adjust.
 Identities = 106/325 (33%), Positives = 171/325 (53%), Gaps = 33/325 (10%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI  ++   +DV  RWNST  M++SA+ +++ F + +  D+++        P+S DWE  
Sbjct  309   GIRCRSVPKIDVENRWNSTCDMIESAMPFKEAFLELKVKDSNYSY-----CPSSQDWERA  363

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKLMGANMKAK  1475
             N + KLLK F +    +SG+ Y T+N +F EI  +  +L E     +  +  M + M+AK
Sbjct  364   NAVCKLLKVFKKAMEVVSGTSYPTSNLYFHEIWSIKQVLEEEAFSPNETIVTMVSEMQAK  423

Query  1474  FEKY*GDIDKMNYMI-FFAN----ILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
             F+KY        +MI +  N    ILDPR K  ++  +L   +G+     +L+K+  A+ 
Sbjct  424   FDKY--------WMISYLTNCVPVILDPRFKFGFIEFRLKQAFGEYGSVQHLDKVDQAIR  475

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK  1130
              L++ Y+     S    T    +           TP G+      +   +        + 
Sbjct  476   RLFNAYSTHMGGSSQVETHGDDM-----------TPAGKGHSW--SDWSEHTSAKRNKEN  522

Query  1129  IELEYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
              E + YL + +   D+ SFDIL WWK++++++P L+ IARDILA+  STV SESAFS SG
Sbjct  523   SEYDRYLRDDLFPCDDESFDILDWWKMHTSKYPTLAAIARDILAVTASTVPSESAFSTSG  582

Query  952   RVLDHFRSSLTPKIVEALVCTQDWL  878
             R+++  ++ L    VEAL+C QDWL
Sbjct  583   RIINDHKTRLAGSTVEALLCFQDWL  607


 Score = 53.1 bits (126),  Expect(3) = 5e-52, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -3

Query  2094  VFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHILNLVVQDSLKQCDITv  1915
             +F++T+DNA++N+  +  LK  +L            H+RC AH++NL+V+D L+  D  +
Sbjct  222   LFSITLDNAATNNTMMDILKANLLKMDMLHCDGDLFHIRCAAHVINLIVKDGLQAIDGVI  281

Query  1914  krvrevvryvRSSPSKLKKFRDL  1846
               +RE V+YVR+S S+ +KF D+
Sbjct  282   NNIRESVKYVRASQSRKEKFEDI  304


 Score = 42.0 bits (97),  Expect(3) = 5e-52, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R S+T D WTS Q I YM VT H+ID++W
Sbjct  156   RFSLTADLWTSNQNIGYMCVTCHYIDDDW  184



>ref|XP_006383274.1| hypothetical protein POPTR_0005s13270g [Populus trichocarpa]
 gb|ERP61071.1| hypothetical protein POPTR_0005s13270g [Populus trichocarpa]
Length=347

 Score =   195 bits (495),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 115/282 (41%), Positives = 170/282 (60%), Gaps = 11/282 (4%)
 Frame = -2

Query  1678  PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVK  1502
             P   DWE   + VK LK FY +T++ SGSLYVT+N+FF E+  ++  ++++  + D  V 
Sbjct  28    PALEDWEKTRSFVKFLKLFYTVTLKFSGSLYVTSNSFFHELISMHTSISQLCRSEDVYVS  87

Query  1501  LMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLL  1322
              M  NM AK++KY GD D  N++++ A +LDPR KL+Y+      +Y  ++ +++  K+ 
Sbjct  88    NMAKNMMAKYKKYWGDQDTQNFLLYVAVVLDPRFKLKYVRFCFGRLYDVEEAENFTIKVK  147

Query  1321  AALNELYDDYA-VSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMEL  1145
               L  L++ Y  V  +  VVP+ G+    S+N  V    T V        A   K+ +E 
Sbjct  148   NTLLRLFEHYMNVDENVDVVPSVGT----SINENVNVDLTAVNDDMVDDLASEFKKHLEE  203

Query  1144  LGG--KKIELEYYLSEAITEDEGSF--DILRWWKVNSARFPILSKIARDILAIPISTVAS  977
              G   KK E+E YLS+   ED   F  DIL WW+ N+ ++ ILSK+A+ +LAIP+STV S
Sbjct  204   EGCVQKKNEVERYLSDD-CEDPNDFKLDILGWWRCNATKYKILSKVAQHVLAIPVSTVVS  262

Query  976   ESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             E+AFS  GR+LD FRSSL+P  ++ALVC Q+WL     PI+I
Sbjct  263   EAAFSTGGRILDPFRSSLSPSTMQALVCCQNWLSLAPIPINI  304



>ref|XP_007020914.1| BED zinc finger,hAT family dimerization domain, putative [Theobroma 
cacao]
 gb|EOY12439.1| BED zinc finger,hAT family dimerization domain, putative [Theobroma 
cacao]
Length=631

 Score =   201 bits (512),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 176/301 (58%), Gaps = 7/301 (2%)
 Frame = -2

Query  1747  YQKVFDDYEYSDNSFKSDL--GDSIPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTAN  1574
             +++ F+ +E  D  +K +L  GD +P S DW +V  LV  L+ FYE+T +++GSL VT+N
Sbjct  283   FERAFERFEDEDPFYKDELLLGDGVPDSHDWVNVRRLVLFLQPFYELTFKVAGSLCVTSN  342

Query  1573  TFFSEISDLYCILNE-MVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDK  1397
              F  EI ++Y +L +    +D     M   MK K++KY G+I KMN +++ A +LDPR+K
Sbjct  343   IFLGEICEVYRLLQDWQSSSDAEFSTMAKRMKEKYDKYWGNIGKMNVLLYVAVVLDPRNK  402

Query  1396  LEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVE  1217
             L+++      MY +++ +   +++   + EL++DY      S        S  S      
Sbjct  403   LDFVEFCFKVMYAEEEAEVMTKEVKEVVFELFNDYKRMMELSQSKQVSDRSQMSQKTQAT  462

Query  1216  FVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEG----SFDILRWWKVN  1049
                  + + +  L +  KK R      +K EL+ YLS+ + +D+      F+IL WWK N
Sbjct  463   GDTNLLQKKKRGLSSDFKKYRESRCTEQKTELDKYLSQELVDDDDDDDDEFNILDWWKSN  522

Query  1048  SARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRP  869
             S +FP+LS +ARD+LAIPIST  S+SAF+     LD +R SLTPK+V++LVC +DWLR P
Sbjct  523   SRKFPVLSHLARDVLAIPISTATSKSAFNTGRCELDAYRGSLTPKVVQSLVCARDWLRGP  582

Query  868   N  866
             +
Sbjct  583   S  583


 Score = 75.5 bits (184),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V S +G+    A+  CL +WG+  VFT+TVDNAS+ND A+ FLK +   +G   ++
Sbjct  204   NFFRVSSCRGDANGKAILMCLRDWGIDKVFTITVDNASTNDDAISFLKNRFNLFGMGILR  263

Query  1998  SKYLHMRCIAHILNLVVQD  1942
              KY+H++CI+ I+NL++++
Sbjct  264   GKYVHLKCISDIINLILKN  282


 Score = 43.1 bits (100),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
              RVS T ++WTS+Q+ +YM +TAHFID +W
Sbjct  167   HRVSFTVETWTSLQQEDYMSLTAHFIDNDW  196



>ref|XP_010644074.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Vitis vinifera]
 ref|XP_010644075.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Vitis vinifera]
 ref|XP_010644076.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Vitis vinifera]
 emb|CBI20108.3| unnamed protein product [Vitis vinifera]
Length=677

 Score =   170 bits (431),  Expect(3) = 6e-52, Method: Compositional matrix adjust.
 Identities = 110/329 (33%), Positives = 167/329 (51%), Gaps = 36/329 (11%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI  + +L LD PT+WNSTYLML   L Y+  F   +  D  +   L D+     +WE  
Sbjct  348   GINSQQNLFLDCPTQWNSTYLMLDRVLEYKGAFSLLQEHDPGYTVALSDT-----EWEWA  402

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
             +++   +K   E+   +S +   TAN +F EI D++  L E  ++ D  +  +   MKAK
Sbjct  403   SSITSYMKLLLEIIAVLSSNKCPTANIYFPEICDIHIQLIEWCKSPDDFISSLALKMKAK  462

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY     K +  +  A ILDPR K++ +      +YG     D ++ +   + EL++ 
Sbjct  463   FDKY---WSKCSLALAVAVILDPRFKMKLVEYYYPQIYG-TDAADRIKDVSDGIKELFNV  518

Query  1294  YA---------VSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELL  1142
             Y          V+   S +P+T + S   +    +F+     + Q+++            
Sbjct  519   YCSTSASLHQGVALPGSSLPSTSNDSRDRLKGFDKFIHE-TSQNQNIVS-----------  566

Query  1141  GGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
                  +L+ YL E +      F IL WWKV   R+PILS + RD+L IP+STVA E  FS
Sbjct  567   -----DLDKYLEEPVFPRNCDFHILNWWKVQKPRYPILSMMVRDVLGIPMSTVAPEVVFS  621

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
                RVLDH+RSSL P   +AL+CTQDWL+
Sbjct  622   TGARVLDHYRSSLNPDTRQALICTQDWLQ  650


 Score = 46.2 bits (108),  Expect(3) = 6e-52, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 67/114 (59%), Gaps = 13/114 (11%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTV-DNASSNDVALGFLK-----RKVLSWGSSSV  2002
             SH  + ++  +  CL+EW +   +F++T  D A+++DVAL   +     R +L  G    
Sbjct  238   SHTEDMLSEVIIKCLMEWEVGHKLFSMTFHDCATNDDVALRVKEHFSQDRPLLGSG----  293

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
               + L +RC+ H+LNL+VQD ++       ++RE VRYV++S + L KF ++A+
Sbjct  294   --QLLDVRCVGHVLNLIVQDCIEALREVTHKIRESVRYVKTSQATLGKFNEIAQ  345


 Score = 38.9 bits (89),  Expect(3) = 6e-52, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+++  D WTS ++  Y+ +TAH+IDE+W
Sbjct  195   RINLAVDMWTSPEQAEYLCLTAHYIDEDW  223



>gb|AAC61291.1| Ac-like transposase [Arabidopsis thaliana]
Length=730

 Score =   139 bits (349),  Expect(3) = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/316 (33%), Positives = 166/316 (53%), Gaps = 31/316 (10%)
 Frame = -2

Query  1741  KVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFS  1562
             K+++DY       +  +G   P S DW++   L+++L  FY+ T+ +SGS YVT++  ++
Sbjct  382   KLYNDYYLEKVDGEKKIGP--PMSSDWDAAERLIQILAIFYKSTLVLSGSTYVTSHKMYN  439

Query  1561  EISDL---YCILNEMVEADGAVKLMGANMKAKFEKY*---GDIDKMNYMIFFANILDPRD  1400
             EI ++      LN     D  +K     M  K +KY    G+  +MN ++  A + DPR 
Sbjct  440   EIINMARNLTTLNTDTFFDEQLKKKAIAMLGKLKKYWDPFGEGVEMNRLVMVATVFDPRK  499

Query  1399  KLEYMPTQLVHMYGDKKGKDYL--EKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNL  1226
             K++++      MYG    +  L  + ++  L +LYD+Y  S +  +    GS S+ S   
Sbjct  500   KMKFVELCFGKMYGLGSVEVVLLSDSVIQILKDLYDEY--SRANLLRINGGSDSMPSSQS  557

Query  1225  VVEFVFTPV-----GRPQHLLKAQIKKQRMELLGGKKI----------ELEYYLSEAITE  1091
                +  +          + + K  I+ + ME L  + +          EL+ YL+EA+  
Sbjct  558   QGSWSQSQEQDRSGAYERTINKTGIQLEDMENLFDEIVKETCIHKSSNELDLYLNEAVET  617

Query  1090  DEGSF----DILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSL  923
                      D+L WWK+NS +F +LS IA+DI A+ +S+VASESAFS SGRVLD FRS L
Sbjct  618   PHLLMGIESDVLDWWKLNSGKFLVLSLIAKDIFAMQVSSVASESAFSTSGRVLDPFRSCL  677

Query  922   TPKIVEALVCTQDWLR  875
             T  ++E L+CT+ WL+
Sbjct  678   THYMIEVLMCTEQWLK  693


 Score = 79.0 bits (193),  Expect(3) = 1e-51, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 68/110 (62%), Gaps = 2/110 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV-  2002
              F  V  H    I   L  CL EW +R +F +TVDNA++N+ AL   K+ +   G  ++ 
Sbjct  246   GFKHVTDHNCGTICKVLLECLAEWDIRRIFCITVDNATANNTALTKFKKTMKLIGDDALV  305

Query  2001  -KSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKF  1855
              K +Y+HMRC AHILNLVV++ L + D +V  +R  +++VRSS ++LK F
Sbjct  306   LKGEYMHMRCDAHILNLVVKEGLTEVDASVTSIRNGIQFVRSSTNRLKSF  355


 Score = 36.6 bits (83),  Expect(3) = 1e-51, Method: Composition-based stats.
 Identities = 16/31 (52%), Positives = 23/31 (74%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQR-INYMVVTAHFIDEEW  2196
             +R+S+TTD W S     +YMV+TAHF+D +W
Sbjct  208   ERMSLTTDIWVSNNTGESYMVITAHFVDVDW  238



>gb|KHN37124.1| Putative AC transposase, partial [Glycine soja]
Length=540

 Score =   157 bits (398),  Expect(3) = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 175/338 (52%), Gaps = 51/338 (15%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI  K  L LDV TRWNST+LML+SAL+Y+  F    + D S+      S PT+ +WE  
Sbjct  231   GIHTKMGLRLDVITRWNSTFLMLESALVYRHAFCSLVFDDRSY-----SSCPTNEEWERG  285

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAK  1475
               +   L+ F+++T  ISGS Y  +N +F ++  + C+L   +   D  ++ M  +MK K
Sbjct  286   QKMCDFLRPFFQITELISGSSYPMSNLYFMQVWKIECLLLQNLSNEDELIRTMTIHMKTK  345

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKD------YLEKLLAAL  1313
             F+KY  D   +   + F  ILDP  ++     +L+     K G D       L+ +   L
Sbjct  346   FDKYWRDYSNV---LSFRCILDPHCRI-----KLLKYCYSKLGLDPISCQAKLKVMEHKL  397

Query  1312  NELYDDYAVSYSPSV--------------VPATGSGSVASVNLVVEFVFTPVGRPQHLLK  1175
               LY++Y   YS                 +  T + S+A V+++ EF+            
Sbjct  398   YTLYNEYVQMYSKETRSNAGLSQGLSQETMVITSTISIAQVDVMDEFI------------  445

Query  1174  AQIKKQRMELLGGKKIELEYYLSEAITEDE--GSFDILRWWKVNSARFPILSKIARDILA  1001
              Q + Q M  +G  K +L+ YL EA   ++   + D+L++WK N A+FP LS +A DIL+
Sbjct  446   -QFEDQDMSQVG--KSQLDTYLEEANLSNKYHPNLDVLQYWKDNQAQFPDLSLLACDILS  502

Query  1000  IPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQ  887
             I I+ VA ESAFSI  RVL+ +R+ L    V+ L+CT+
Sbjct  503   IQITMVAFESAFSIGSRVLNKYRTRLLVDNVQVLICTK  540


 Score = 61.2 bits (147),  Expect(3) = 1e-51, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 51/83 (61%), Gaps = 4/83 (5%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             F P   + G  +A  +   L EWG+ + +F++T+DNASSND    +LK  +L   +  V 
Sbjct  116   FPP--PYSGREMAKVIYDFLEEWGIEQKIFSLTLDNASSNDKMQDYLKEILLLHTNGLVS  173

Query  1998  S-KYLHMRCIAHILNLVVQDSLK  1933
               ++ H+RC AHILNL+VQ+ LK
Sbjct  174   GGEFFHIRCCAHILNLIVQEGLK  196


 Score = 35.0 bits (79),  Expect(3) = 1e-51, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T+D WTS     Y+ +TAH++D  W
Sbjct  76    RISLTSDVWTSCTSEGYISLTAHYVDANW  104



>ref|XP_010527601.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Tarenaya hassleriana]
Length=581

 Score =   153 bits (387),  Expect(3) = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/321 (33%), Positives = 163/321 (51%), Gaps = 62/321 (19%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             G+E  T L LD+PTRWNSTY ML+ A+ Y++ F   +  D S+K +     P+S +W+  
Sbjct  288   GVETGTGLHLDIPTRWNSTYTMLKVAIKYERAFSSLQLLDRSYKYN-----PSSQEWQRG  342

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE--ADGAVKLMGANMKA  1478
               +   L+ FYE+T    GS Y T+N +F ++  + C+L + +    D  ++ M  NMK 
Sbjct  343   EKICDFLEPFYEITNLFFGSKYPTSNLYFFQVWRIECLLKDYMTNGEDEMIESMANNMKE  402

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYD  1298
             KF+KY    ++ N     A +LDPR KLE +                      A NE   
Sbjct  403   KFDKY---WEEYNITFALAAVLDPRMKLELLE--------------------FAYNE---  436

Query  1297  DYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMEL-LGGKKIEL  1121
                       V  T S         ++ VF    R      AQ ++  +E+ L  K++E+
Sbjct  437   ----------VDPTNSKE------KIDIVFKAYERRT---AAQEERSALEIYLDDKRLEM  477

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLD  941
               +            D+L++WK +  R+  L+++A DIL+IPI+TVASES+FSI  R+L+
Sbjct  478   NEF---------DDIDVLQFWKNHKQRYGNLTQMACDILSIPITTVASESSFSIGSRLLN  528

Query  940   HFRSSLTPKIVEALVCTQDWL  878
              +RS L    VEAL+CT++WL
Sbjct  529   KYRSRLCSSNVEALICTRNWL  549


 Score = 68.6 bits (166),  Expect(3) = 2e-51, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 66/108 (61%), Gaps = 1/108 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
              H G  +A  +  CL +WG+ + +F++T+DNAS+ND     LK ++          K+ H
Sbjct  178   PHSGNELAKKVLDCLKDWGIEKKIFSLTLDNASANDTMQSILKDQLCLQYGLLCDGKFFH  237

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +RC AHILNL+VQ+ LK  D  + ++RE V+YV+ S  ++K F++  E
Sbjct  238   VRCYAHILNLIVQEGLKVVDSALYKIRESVKYVKWSEGRMKMFKEYCE  285


 Score = 32.0 bits (71),  Expect(3) = 2e-51, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+ +T D W SI    Y+ +T H++D  W
Sbjct  135   RICLTADVWRSIAIEGYICITGHYVDNSW  163



>ref|XP_008643805.1| PREDICTED: transposon protein isoform X1 [Zea mays]
Length=764

 Score =   168 bits (426),  Expect(3) = 4e-51, Method: Compositional matrix adjust.
 Identities = 114/322 (35%), Positives = 170/322 (53%), Gaps = 15/322 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E  D+++        P++ DW+ V 
Sbjct  435   IPSTKTLCLDVTTQWNTTYLMLLAALDYKQAFATLETCDDNYNES-----PSAEDWKKVE  489

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAV-KLMGANMKAKF  1472
                  LK  Y+    +  S   TAN FF E   +   L    E        +  +M  +F
Sbjct  490   ASCNYLKLLYDSAHSVMASANPTANIFFHEAWKIQLELANGTEHGSPFFSCIAKDMHERF  549

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR K++ +      +YG +  K Y++ +  +L+ELY +Y
Sbjct  550   DKYWKDC---SLVLAIAVVMDPRFKMKLVEFSYSKIYGAEAAK-YVKVVNDSLHELYKEY  605

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYY  1112
                  P + PA    +  + N  V     P      LL   +    ++     K ELE Y
Sbjct  606   VAQTLP-LAPAYVEANNVAANTNVN-QGNPPPTSDGLLDFDMYLSEIQSSQPAKCELEQY  663

Query  1111  LSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---RVLD  941
             L E++T     FDIL WWK+N+ +FP LSK+ARDILAIP+S V+S S+   +G   R+LD
Sbjct  664   LEESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAIPMSMVSSGSSIFSAGTGNRMLD  723

Query  940   HFRSSLTPKIVEALVCTQDWLR  875
              +RSSL P+ VEALVC +DWL+
Sbjct  724   DYRSSLRPETVEALVCAKDWLQ  745


 Score = 52.8 bits (125),  Expect(3) = 4e-51, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 71/115 (62%), Gaps = 3/115 (3%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSS  2008
             +F+ V S H    ++ A+ S L EW +++ +FT+T+DN  SS+D+    L+  + +  + 
Sbjct  316   NFMMVSSPHSENALSEAISSSLSEWNMKDKLFTITLDNDCSSHDIYSANLRDHLSNKNNV  375

Query  2007  SVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              +K +   +RC AHILN+V QD +      +  +RE ++++++SPS+ +KF ++A
Sbjct  376   MLKGQLFVVRCYAHILNVVAQDVIASIHGVIYSIRESIKFIKASPSREEKFAEIA  430


 Score = 31.6 bits (70),  Expect(3) = 4e-51, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ +   FID +W
Sbjct  280   RISLTIGLWTTSQTLGYVSLAGQFIDSDW  308



>ref|NP_001151544.1| transposon protein [Zea mays]
 gb|ACG43259.1| transposon protein [Zea mays]
Length=764

 Score =   168 bits (426),  Expect(3) = 4e-51, Method: Compositional matrix adjust.
 Identities = 114/322 (35%), Positives = 170/322 (53%), Gaps = 15/322 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E  D+++        P++ DW+ V 
Sbjct  435   IPSTKTLCLDVTTQWNTTYLMLLAALDYKQAFATLETCDDNYNES-----PSAEDWKKVE  489

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAV-KLMGANMKAKF  1472
                  LK  Y+    +  S   TAN FF E   +   L    E        +  +M  +F
Sbjct  490   ASCNYLKLLYDSAHSVMASANPTANIFFHEAWKIQLELANGTEHGSPFFSCIAKDMHERF  549

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR K++ +      +YG +  K Y++ +  +L+ELY +Y
Sbjct  550   DKYWKDC---SLVLAIAVVMDPRFKMKLVEFSYSKIYGAEAAK-YVKVVNDSLHELYKEY  605

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYY  1112
                  P + PA    +  + N  V     P      LL   +    ++     K ELE Y
Sbjct  606   VAQTLP-LAPAYVEANNVAANTNVN-QGNPPPTSDGLLDFDMYLSEIQSSQPAKCELEQY  663

Query  1111  LSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---RVLD  941
             L E++T     FDIL WWK+N+ +FP LSK+ARDILAIP+S V+S S+   +G   R+LD
Sbjct  664   LEESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAIPMSMVSSGSSIFSAGTGNRMLD  723

Query  940   HFRSSLTPKIVEALVCTQDWLR  875
              +RSSL P+ VEALVC +DWL+
Sbjct  724   DYRSSLRPETVEALVCAKDWLQ  745


 Score = 52.8 bits (125),  Expect(3) = 4e-51, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 71/115 (62%), Gaps = 3/115 (3%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSS  2008
             +F+ V S H    ++ A+ S L EW +++ +FT+T+DN  SS+D+    L+  + +  + 
Sbjct  316   NFMMVSSPHSENALSEAISSSLSEWNMKDKLFTITLDNDCSSHDIYSANLRDHLSNKNNV  375

Query  2007  SVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              +K +   +RC AHILN+V QD +      +  +RE ++++++SPS+ +KF ++A
Sbjct  376   MLKGQLFVVRCYAHILNVVAQDVIASIHGVIYSIRESIKFIKASPSREEKFAEIA  430


 Score = 31.6 bits (70),  Expect(3) = 4e-51, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ +   FID +W
Sbjct  280   RISLTIGLWTTSQTLGYVSLAGQFIDSDW  308



>ref|XP_006290045.1| hypothetical protein CARUB_v10003680mg, partial [Capsella rubella]
 gb|EOA22943.1| hypothetical protein CARUB_v10003680mg, partial [Capsella rubella]
Length=669

 Score =   133 bits (335),  Expect(3) = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/345 (30%), Positives = 166/345 (48%), Gaps = 36/345 (10%)
 Frame = -2

Query  1843  RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSI-----  1679
             RV  G  ++ SL LDV T WNSTYLML+ AL ++  F+  +  D  +     + +     
Sbjct  339   RVETGKVKRGSLPLDVKTLWNSTYLMLEQALKFRVAFEKLQAEDKPYNDYFLERVDGHKR  398

Query  1678  ---PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILN--EMVEAD  1514
                P   D + V+  V++L  FY  T+ +S S  V ++  ++EI  +   L        D
Sbjct  399   FGPPMKDDLDEVSAFVQVLGIFYNSTLVLSASNSVASHKIYNEIVSITRNLTIYSTTGDD  458

Query  1513  GAVKLMGANMKAKFEKY*---GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGK  1343
               +    + +  K EKY    GD  +MN ++  A++ DPR K++++     H+YG  KG 
Sbjct  459   EELHKRSSAILTKLEKYWDVFGDKVEMNRLVIVASVFDPRKKMKFVEVCFDHLYG--KGS  516

Query  1342  DYLEKLLAALNE----LYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLK  1175
                  L  ++N     LYD+Y  +   +   ++     +      +F      R  H+  
Sbjct  517   VESSHLSDSINNILKNLYDEYTRASLLNTSGSSSQSQSSWSQAQDQFETDISQRTHHIGL  576

Query  1174  AQIKKQRMELLGGKKI-----ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARD  1010
               +     +++    I     ELE YL E +              VNS ++PILS IA+D
Sbjct  577   PDMDSIFQDIVKEAGIRKSSNELEMYLKEDVES------------VNSGKYPILSMIAKD  624

Query  1009  ILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             ILA+ +S+VA E+AFS S R+LD  RS LT  ++E L+CT+ WL+
Sbjct  625   ILAMQVSSVALEAAFSTSNRLLDSSRSCLTHYMIEVLMCTKQWLK  669


 Score = 89.4 bits (220),  Expect(3) = 4e-51, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS---  2005
             F  V  +KGE I N L  CL EWG++ VF +TVD A++N +A+   K++++    +    
Sbjct  227   FKNVSDYKGETICNCLLECLAEWGIKKVFCITVDKATANSLAMNMFKKEMMQQNGNDALV  286

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKF  1855
             +K +YLH+RC AHILNLV+++ L+  D +V  VR  ++Y RS+P++LK F
Sbjct  287   LKGEYLHLRCAAHILNLVLKEGLQDIDRSVAAVRNGIQYARSTPNRLKAF  336


 Score = 30.0 bits (66),  Expect(3) = 4e-51, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -1

Query  2243  RINYMVVTAHFIDEEW  2196
             R +YMV+TAHF+D+ W
Sbjct  203   RASYMVITAHFVDDMW  218



>emb|CDX88018.1| BnaA06g26090D [Brassica napus]
Length=642

 Score =   151 bits (382),  Expect(3) = 4e-51, Method: Compositional matrix adjust.
 Identities = 118/343 (34%), Positives = 178/343 (52%), Gaps = 42/343 (12%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI +K SL LDV TRWNSTY+ML  AL Y++ F +    + S+KS     +PT  +W   
Sbjct  303   GIVKKGSLVLDVTTRWNSTYMMLSRALHYKEAFKNLAEIEASYKS-----LPTESEWLRA  357

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL--NEMVEADGAVKLMGANMKA  1478
               +  LL+ F EMT  ISGS Y TAN +F E+  +   L  NE  E D  +  M A+M+ 
Sbjct  358   GLICNLLQPFEEMTRLISGSSYPTANLYFMEVWKIQNWLSSNEFHE-DTVIADMVASMRM  416

Query  1477  KFEKY*GDIDKMNYMIFFANILDPR-------------------DKLEYMPTQLVHMYGD  1355
             KF KY    ++ + ++  A +LDPR                    +++Y+  +++ +YGD
Sbjct  417   KFVKY---WEEYSDILAIAAVLDPRLKFKVLEYCYHSSDPATCKSRMDYIRKRMLKLYGD  473

Query  1354  -KKGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLL  1178
              KK            N L   Y VSY   +     S   +S+N+    +F   G  +   
Sbjct  474   YKKNTSAHSSQEVEANALPSGYGVSYLNYLNYLPESDVYSSLNIRFNNLFFLQGFYEFFS  533

Query  1177  KAQIKKQRMELLGGKKIELEYYLSEAITE--DEGSFDILRWWKVNSARFPILSKIARDIL  1004
             +           G +K  L+ YLSE + +       D++++W+ N+ RF  LS++A D+L
Sbjct  534   QQA---------GTRKSALDLYLSEPVLDMVANQKLDVIKYWRDNANRFKELSRMACDVL  584

Query  1003  AIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
              IPI+TV+SES+FS+  RVL  +RS L P  V+AL+C ++WLR
Sbjct  585   CIPITTVSSESSFSVGSRVLSKYRSRLLPSNVQALICARNWLR  627


 Score = 74.3 bits (181),  Expect(3) = 4e-51, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 5/82 (6%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             +F P   H G  IA  L   + EWGL + VFTVTVDNASSND   GFLKR++        
Sbjct  191   AFPP--PHSGPAIAMKLMELIKEWGLQKKVFTVTVDNASSNDNMQGFLKRQLRK--DLVC  246

Query  2001  KSKYLHMRCIAHILNLVVQDSL  1936
               ++ H+RC AHILNL+VQD L
Sbjct  247   GGEFFHIRCAAHILNLIVQDGL  268


 Score = 26.6 bits (57),  Expect(3) = 4e-51, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 17/29 (59%), Gaps = 6/29 (21%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+ +TTD W +I       + AH++D EW
Sbjct  158   RICLTTDLWRAI------TIEAHYVDTEW  180



>ref|XP_009596976.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like, partial [Nicotiana tomentosiformis]
Length=394

 Score =   193 bits (491),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 118/324 (36%), Positives = 175/324 (54%), Gaps = 36/324 (11%)
 Frame = -2

Query  1789  RWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPT---------SLDWESVNNLVK  1637
             RWNSTY ML  A  ++K FD +   D+ F + L   +           S DW +V N++ 
Sbjct  84    RWNSTYFMLDMAQNFEKAFDKFYLFDDGFFAYLCSHLCEDGSSASPLESDDWVNVRNVIA  143

Query  1636  LLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKLMGANMKAKFEKY*  1460
              L  F+E+T ++SGS YVT N+ F ++S+LYC L   ++  D  ++ M   M+ KF+KY 
Sbjct  144   FLARFHELTKKVSGSRYVTCNSHFEDVSELYCHLKMCLISEDEHLRKMAEQMQEKFKKYW  203

Query  1459  GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSY  1280
             G+ +KMN +IF A++LDPR+K EY+   L  ++G++KGK    ++ A +N L+++Y   Y
Sbjct  204   GEPEKMNKIIFIASVLDPRNKFEYVSLALEELFGEEKGKKINAEVYAYMNSLFEEYLKKY  263

Query  1279  SPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG-GKKIELEYYLSE  1103
             S    P + S S +S N       + +       K  +KKQ+ +    G K EL+ Y+SE
Sbjct  264   STGSCPQSPSSSTSSNNTSNTSSGSVLTASLIRTKLHLKKQKEDNGSRGAKSELDKYISE  323

Query  1102  AITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSL  923
                     F+IL WWK ++ RFPILS++ARD+                         SSL
Sbjct  324   EQEHFSEEFNILSWWKTHAPRFPILSELARDV-------------------------SSL  358

Query  922   TPKIVEALVCTQDWLRRPNTPISI  851
             TPK V+ALV  QDWLR    PIS+
Sbjct  359   TPKCVQALVYVQDWLREEKNPISV  382


 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -3

Query  2133  ALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHILNL  1954
             A+ +CL+EW L  VFT+TVDNAS NDV +  L +K+  W ++ +  K+LH+RC+AHILNL
Sbjct  4     AISNCLLEWKLDKVFTITVDNASLNDVTVKELSKKLDMWKTNMMSGKHLHVRCMAHILNL  63

Query  1953  VVQDSLKQCDIT  1918
             +VQD LK+ D +
Sbjct  64    IVQDGLKEIDAS  75



>ref|XP_002463929.1| hypothetical protein SORBIDRAFT_01g009090 [Sorghum bicolor]
 gb|EER90927.1| hypothetical protein SORBIDRAFT_01g009090 [Sorghum bicolor]
Length=770

 Score =   166 bits (421),  Expect(3) = 6e-51, Method: Compositional matrix adjust.
 Identities = 112/322 (35%), Positives = 167/322 (52%), Gaps = 15/322 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E  D+++        P++ DW+ V 
Sbjct  441   IPSAKTLCLDVTTQWNTTYLMLLAALDYKQAFATLETCDDNYNES-----PSAEDWKRVE  495

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAV-KLMGANMKAKF  1472
                  LK  Y+    +  S   TAN FF E   +   L    E        +  +M  +F
Sbjct  496   ASCNYLKLLYDSAHSVMASANPTANIFFHEAWKIQLELANGTEHGSPFFSSVAKDMHERF  555

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR K++ +      +YG +  K Y++ +  +L+ELY +Y
Sbjct  556   DKYWKDC---SLVLAIAVVMDPRFKMKLVEFSYSKIYGAEATK-YVKVVNDSLHELYKEY  611

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYY  1112
                  P + PA    +             P      LL   +    ++     K ELE Y
Sbjct  612   VAQPLP-LTPAYVE-ANNVAANTNVNQGNPPSTSDGLLDFDMYLSEIQSSQPAKCELEQY  669

Query  1111  LSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---RVLD  941
             L E++T     FDIL WWK+N+ +FP LSK+ARDILAIP+S V+S S+   +G   R+LD
Sbjct  670   LEESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAIPMSMVSSGSSIFSAGTGNRMLD  729

Query  940   HFRSSLTPKIVEALVCTQDWLR  875
              +RSSL P+ VEALVC +DWL+
Sbjct  730   DYRSSLRPETVEALVCAKDWLQ  751


 Score = 53.9 bits (128),  Expect(3) = 6e-51, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSS  2008
             +F+ V S H    ++ A+ S L+EW +++ +FT+T+DN  SS+D+    L+  + +  + 
Sbjct  322   NFMMVSSPHSENALSEAISSSLLEWNMKDKLFTITLDNDCSSHDIYSANLRDHLSNKNNL  381

Query  2007  SVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              +K +   +RC AHILN+V QD +      +  +RE ++++++SPS+ +KF ++A
Sbjct  382   MLKGQLFVVRCYAHILNVVAQDVIASIHGVIYNIRESIKFIKASPSREEKFAEIA  436


 Score = 31.6 bits (70),  Expect(3) = 6e-51, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ +   FID +W
Sbjct  286   RISLTIGLWTTSQTLGYVSLAGQFIDSDW  314



>ref|NP_001174288.1| Os05g0239150 [Oryza sativa Japonica Group]
 sp|B9FJG3.1|RSLE1_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
1; AltName: Full=Transposase-like protein RICESLEEPER 
1 [Oryza sativa Japonica Group]
 gb|EEE62941.1| hypothetical protein OsJ_17746 [Oryza sativa Japonica Group]
 dbj|BAH93016.1| Os05g0239150 [Oryza sativa Japonica Group]
Length=722

 Score =   174 bits (442),  Expect(3) = 9e-51, Method: Compositional matrix adjust.
 Identities = 115/331 (35%), Positives = 176/331 (53%), Gaps = 19/331 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E SD+++     +  P++ DW+ V 
Sbjct  390   IPSTKTLCLDVTTQWNTTYLMLLAALDYKQAFSTLETSDDNY-----NEAPSAEDWKKVE  444

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
                  LK  Y+    I  +   T+N FF E   L   L N     D     +  +M  +F
Sbjct  445   AACNYLKLLYDSAHSIMAAANPTSNLFFHEAWKLQLELSNATGREDPVFSSIAKDMHERF  504

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    N ++  A ++DPR K++ +      +YG +  K Y++ +  A++ELY++Y
Sbjct  505   DKYWKDC---NLVLAIAVVMDPRFKMKLVEFSYSKIYGVEAAK-YVKVVDDAVHELYNEY  560

Query  1291  AVS---YSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
                    +P+ V   G  +  +     +      G    L+   +    +      K EL
Sbjct  561   VAQPLPLTPAYVEQGGGNNAPASENSTQATAPSTG--DGLVDFDMYLSEIATSQPTKSEL  618

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---R  950
             E YL E++T     FDIL WWK+N+ ++P LSK+ARDILAIP+S V+S ++   +G   R
Sbjct  619   EQYLDESLTPRIQEFDILNWWKLNTLKYPTLSKMARDILAIPMSMVSSGNSIFSAGTGTR  678

Query  949   VLDHFRSSLTPKIVEALVCTQDWLRR-PNTP  860
             +LD +RSS  P+IVEALVC +DWL+  P TP
Sbjct  679   MLDDYRSSSRPEIVEALVCAKDWLQYLPATP  709


 Score = 45.8 bits (107),  Expect(3) = 9e-51, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             H    ++ A+ + L +W +++ +FT+T+DN  SS+D+    L+  + +  +  +K +   
Sbjct  279   HSENALSEAISTSLSDWNMKDKLFTITLDNDCSSHDIYSANLRDYLSNKNNLMLKGQLFV  338

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             +RC AHILN V QD +      +  +RE ++++++SPS  +KF ++A
Sbjct  339   VRCYAHILNAVAQDVIASIHGVIYNIRESIKFIKASPSCEEKFAEIA  385


 Score = 30.8 bits (68),  Expect(3) = 9e-51, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+    WT+ Q + Y+ +   FID EW
Sbjct  235   RISLAIGLWTTSQTLGYVSLAGQFIDSEW  263



>gb|AAD24567.1|AF120335_1 putative transposase [Arabidopsis thaliana]
Length=577

 Score =   154 bits (390),  Expect(3) = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 170/326 (52%), Gaps = 36/326 (11%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI+ + +L LDV TRWNSTY ML  A+ ++ V       D  +KS      P++++WE  
Sbjct  245   GIQTEANLVLDVSTRWNSTYHMLSRAIQFKDVLRSLAEVDRGYKS-----FPSAVEWERA  299

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
               +  LLK F E+T  ISGS Y TAN +F ++  + C L +  ++ D  ++ M  +M  K
Sbjct  300   ELICDLLKPFAEITKLISGSSYPTANVYFMQVWAIKCWLGDHDDSHDRVIREMVEDMTEK  359

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDK---LEYMPTQLVHMYGDKKGKDYLEKLLAALNEL  1304
             ++KY  D   +  M   A +LDPR K   LEY      ++      K+ L  +   + +L
Sbjct  360   YDKYWEDFSDILAM---AAVLDPRLKFSALEY----CYNILNPLTSKENLTHVRDKMVQL  412

Query  1303  YDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIE  1124
             +  Y  + + +V  +T   S   +    +  ++   +                 G  K  
Sbjct  413   FGAYKRT-TCNVAASTSQSSRKDIPFGYDGFYSYFSQRN---------------GTGKSP  456

Query  1123  LEYYLSEAITEDEGSF---DILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
             L+ YL E +  D  SF   D++ +WK N +RF  LS +A DIL+IPI+TVASESAFSI  
Sbjct  457   LDMYLEEPVL-DMVSFRDMDVIAYWKNNVSRFKELSSMACDILSIPITTVASESAFSIGS  515

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLR  875
             RVL+ +RS L P  V+AL+CT++W R
Sbjct  516   RVLNKYRSCLLPTNVQALLCTRNWFR  541


 Score = 67.4 bits (163),  Expect(3) = 1e-50, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 50/83 (60%), Gaps = 5/83 (6%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             +F P   H G  IA  L   L +WG+ + VFT+TVDNAS+ND     LKRK+        
Sbjct  133   AFPP--PHSGVAIAMKLSELLKDWGIEKKVFTLTVDNASANDTMQSILKRKLQK--DLVC  188

Query  2001  KSKYLHMRCIAHILNLVVQDSLK  1933
               ++ H+RC AHILNL+VQD L+
Sbjct  189   SGEFFHVRCSAHILNLIVQDGLE  211


 Score = 29.3 bits (64),  Expect(3) = 1e-50, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFID  2205
             R+ +TTD W ++   +Y+ +TAH++D
Sbjct  94    RICLTTDLWRALTVESYICLTAHYVD  119



>ref|XP_010484797.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
Length=731

 Score =   150 bits (380),  Expect(3) = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/358 (30%), Positives = 180/358 (50%), Gaps = 49/358 (14%)
 Frame = -2

Query  1843  RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSI-----  1679
             +V  G   + SL L+  TRWNSTYLML  AL ++  FD  E  D  +     +++     
Sbjct  352   KVESGKMTRGSLSLNCKTRWNSTYLMLTRALKFRLAFDRMEAEDKLYNDYFCETVEGKKR  411

Query  1678  ---PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEM-VEADG  1511
                P   +W+ +  LV+ L  FY  T+ +S S  V++   ++EI  +   L+ +   +D 
Sbjct  412   IGPPCKDNWDEIERLVRFLVIFYNSTLVVSASSTVSSYKCYNEIVTIERNLSALSTNSDL  471

Query  1510  AVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLE  1331
              + L    M+ KF KY     K+  M+  A + DPR+K+++       +YG    +   +
Sbjct  472   KLSLKAEAMRDKFNKYWDGSKKLKKMLIIAIVFDPRNKMKFASLCFDILYGKDNAES--K  529

Query  1330  KLLAALNELYDDYAVSYSPSVV-----------PATGSGSVASVNLVVEFVFTPVGRPQH  1184
             ++   +NE+  +    Y+ + V             +G  S   +N  ++F          
Sbjct  530   EITKVVNEVLVNLFNEYNATTVGSSFQSQTASSSQSGHESQGDLNQKMDF----------  579

Query  1183  LLKAQIKKQRMELLGGKKI----------ELEYYLSEAITEDEGS-----FDILRWWKVN  1049
                + I+ QR++ +  + +          ELE YL E +   + +     FD+L WW++N
Sbjct  580   --DSDIEYQRVDTMYNELVNEIGFQDASSELELYLKEKVETPKANQLGIKFDVLGWWRIN  637

Query  1048  SARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             S ++PIL+ IA+D+LA+ +S+VASESAFS S R+LD FRS LT  ++E L+C++ WL+
Sbjct  638   SPKYPILASIAKDVLAMQVSSVASESAFSNSNRILDPFRSCLTHYMIEVLMCSEQWLK  695


 Score = 68.9 bits (167),  Expect(3) = 1e-50, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV--  2002
             F  V  H    I++ L  CL EWG++ +FT+TVDNA++N  A+   K      G+ ++  
Sbjct  241   FKHVADHTRSTISSVLLKCLAEWGIKKIFTITVDNATANSNAMKKFKEAFSLVGNDAMVF  300

Query  2001  KSKYLHMRCIAHILNLVVQDSL  1936
               K+LH+RC AHI+NL+ +D L
Sbjct  301   GGKFLHLRCCAHIINLIAKDGL  322


 Score = 31.2 bits (69),  Expect(3) = 1e-50, Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
             QR S+TTD W +     +YMV+T  FID  W
Sbjct  202   QRFSLTTDIWVAPTTGTSYMVITTLFIDASW  232



>emb|CAN79118.1| hypothetical protein VITISV_005773 [Vitis vinifera]
Length=1368

 Score =   134 bits (337),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/315 (31%), Positives = 150/315 (48%), Gaps = 42/315 (13%)
 Frame = -2

Query  1810  LCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLVKLL  1631
             L LD  TRWNSTYLML  A+ Y+ VF   +  +  +       +P+  +W     +   L
Sbjct  345   LSLDCKTRWNSTYLMLSIAITYKDVFPCLKQREKYYMV-----VPSKEEWNMAKEICGRL  399

Query  1630  KCFYEMTIRISGSLYVTANTFFSEISDLY-CILNEMVEADGAVKLMGANMKAKFEKY*GD  1454
             K FY +T   SG  Y TANTFF ++ ++   + + ++ ++  VK M ++M  KF+KY   
Sbjct  400   KLFYNITELFSGRNYPTANTFFIKVCEIKEALYDWLICSNDVVKTMASSMLQKFDKY---  456

Query  1453  IDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSP  1274
                 + ++  A I DPR K++ +      MYG +   + +EK+     EL  +Y      
Sbjct  457   WSGCHIVMAIAAIFDPRYKIKILEFYFPLMYGSEASNE-IEKICGMCYELLSEY--QSKS  513

Query  1273  SVVPATGSGSVASVNLVVEFVFT---PVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSE  1103
             ++   T S   +S + ++E  +    P+ +    + + I +         K EL YYL E
Sbjct  514   NLGQKTSSYGTSSDSTLLELNYDEQDPLSKFDLFVHSTIGESHT------KSELYYYLEE  567

Query  1102  AITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSL  923
             +I     +F++L WWK N                     VASESAFS  GRV+   RS L
Sbjct  568   SILPRNSNFNVLSWWKTN---------------------VASESAFSTGGRVVSKHRSRL  606

Query  922   TPKIVEALVCTQDWL  878
              P  +EAL+C Q WL
Sbjct  607   HPDTLEALMCAQSWL  621


 Score = 71.2 bits (173),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 68/112 (61%), Gaps = 2/112 (2%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +VP   H  E ++N L   L++W + R V T+TVDN SSND  +  L  K+    S  + 
Sbjct  224   YVP-PPHTKEVLSNVLMDFLLDWNMDRKVSTITVDNCSSNDRMINILVEKLSLSNSLLLN  282

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              K  HMRC  H+LNL+V++ L   ++ ++++RE V Y  ++PS+++KF D A
Sbjct  283   GKIFHMRCATHVLNLIVKEGLDVIEVEIEKIRESVAYWSATPSRMEKFEDAA  334


 Score = 45.1 bits (105),  Expect(3) = 2e-50, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R++ITTD WTS Q+  YM +T H+IDE W
Sbjct  185   RIAITTDMWTSNQKKGYMAITVHYIDESW  213



>ref|XP_009610145.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=405

 Score =   138 bits (348),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 111/195 (57%), Gaps = 10/195 (5%)
 Frame = -2

Query  1819  KTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDS-----IPT----SL  1667
             K +LCLDVPTRWNSTYLML+ A+ ++  F  Y  S+   +  L  S     IPT    S 
Sbjct  184   KKTLCLDVPTRWNSTYLMLRRAVEFESAFSHYASSEIGLRHYLEHSYIEVGIPTGELLSS  243

Query  1666  DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EADGAVKLMGA  1490
             DWE+V  + K L+ FY +T++ISGS YVT+N  F EI  +   L +++   D  +  M  
Sbjct  244   DWENVKRITKFLEIFYLLTLKISGSRYVTSNIHFLEICAVGVYLKQLIANEDTVLSEMAK  303

Query  1489  NMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALN  1310
              MK KF+KY GD  KMN +IF + ILDPR KLE +   LV ++G   G     ++   + 
Sbjct  304   KMKEKFDKYWGDPGKMNNIIFISCILDPRYKLESVSYALVKIFGQDPGATIQAEVKKYMT  363

Query  1309  ELYDDYAVSYSPSVV  1265
              L+ +Y  S S  VV
Sbjct  364   SLFSEYVKSGSKGVV  378


 Score = 91.3 bits (225),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = -3

Query  2121  CLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHILNLVVQD  1942
             CL EWG+  +FTVTVDNASSNDV +  L +++   G++ +   +LH+RC+AHI+NLVVQD
Sbjct  84    CLREWGINKIFTVTVDNASSNDVTVKELSKQLTKMGTNLMNGNHLHVRCMAHIMNLVVQD  143

Query  1941  SLKQCDITvkrvrevvryvRSSPSKLKKFRD  1849
              LK+  ++++RVR  VRYVR SP++LK+F++
Sbjct  144   GLKESSVSIERVRHEVRYVRQSPARLKRFQE  174



>ref|XP_010489640.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Camelina sativa]
Length=774

 Score =   149 bits (375),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/322 (33%), Positives = 168/322 (52%), Gaps = 19/322 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I+    L  DVPTRWNSTY ML  AL +++ F   ++ DN++K+     +P+  +W    
Sbjct  434   IKSGAGLSQDVPTRWNSTYEMLVRALKFKEAFVSLKWFDNNYKT-----LPSDDEWNRGE  488

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA-VKLMGANMKAKF  1472
              + +LLK F ++T   SGS Y T+N +F+++  +  +L +    D   V  +  +M+  F
Sbjct  489   KICELLKPFSDITTHFSGSKYPTSNVYFTQVWRIELLLRKFASCDDEDVAKLAQDMQIMF  548

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
              KY  D    + ++    +LDPR KL+ +      +         ++KL   L  LY+DY
Sbjct  549   TKYWED---YSLILAMGAVLDPRMKLQMLEVAYERV-DPTTSASKIKKLKDNLEMLYEDY  604

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVF-TPVGRPQHLLKAQIKKQRMELLGGKKIELEY  1115
                        T S S++      ++V  +P+         +++K     +G  K  L+ 
Sbjct  605   KAK------SRTCSSSISVTPNPHDWVNESPLDDDYDNDLFELEKSIGVGVGKTKTHLDI  658

Query  1114  YLSEAITEDEG--SFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLD  941
             YL E   E +     D+L +WK N  R   L+ +A +IL+IPI+TVASESAFSI  RV+ 
Sbjct  659   YLEEPRLERKSFPKLDVLSFWKDNQHRLGELASLACEILSIPITTVASESAFSIGSRVIT  718

Query  940   HFRSSLTPKIVEALVCTQDWLR  875
              +R+ L PK V+AL+CT++WLR
Sbjct  719   PYRNRLLPKNVQALLCTRNWLR  740


 Score = 69.3 bits (168),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSS  2005
              F  +KS H GE I+N +  CL EWGL + VF++T+DNA++N+  L  LK ++     S 
Sbjct  314   QFCELKSPHTGEEISNKILECLKEWGLEKKVFSITLDNATNNNSMLNILKGQLQMISGSG  373

Query  2004  V--KSKYLHMRCIAHILNLVVQDSL  1936
             +    K++H+RC AHILNL+V+  L
Sbjct  374   LLCDGKFMHVRCCAHILNLIVKKGL  398


 Score = 32.3 bits (72),  Expect(3) = 2e-50, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 21/30 (70%), Gaps = 1/30 (3%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRI-NYMVVTAHFIDEEW  2196
             RV  T+D WT+   + +Y+ +TAH+IDE W
Sbjct  277   RVCFTSDLWTARGTVMSYICLTAHYIDENW  306



>ref|XP_008643588.1| PREDICTED: LOC100281046 isoform X1 [Zea mays]
 ref|XP_008643589.1| PREDICTED: LOC100281046 isoform X1 [Zea mays]
 ref|XP_008643590.1| PREDICTED: LOC100281046 isoform X1 [Zea mays]
Length=719

 Score =   177 bits (449),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/325 (36%), Positives = 171/325 (53%), Gaps = 18/325 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E  D+++     +  P++ DW+ V 
Sbjct  387   IPSTKTLCLDVTTQWNTTYLMLLAALDYKQTFTTLETCDDNY-----NEAPSAEDWKKVE  441

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
                  LK  Y+    I  +   TAN FF E   L   L N     D     +  +M  +F
Sbjct  442   AACNYLKLLYDSAHSIMAAANPTANIFFHEAWKLQLELANGTGHEDPTFSSIAKDMHERF  501

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR K++ +      +YG    K Y++ +  A++ELY +Y
Sbjct  502   DKYWKDC---SLVLAIAVVMDPRFKMKLVEFSYSKIYGAGAAK-YVKVVDDAVHELYKEY  557

Query  1291  AVSYSPSVVPA---TGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
                  P + PA    G G+    N        P      LL   +    ++     K EL
Sbjct  558   VAQPLP-LTPAYVDQGEGNNGPAN-ANSSQGAPASTGDGLLDFDMYLSEIQSSQPSKSEL  615

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---R  950
             E YL E++T     FDIL WWK+N+ +FP LSK+ARDILAIP+S V+S S+   +G    
Sbjct  616   EQYLDESLTPRIQEFDILNWWKLNTVKFPTLSKMARDILAIPVSMVSSGSSIFCAGTGSH  675

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR  875
             +LD +RSSL P+IVEALVC +DWL+
Sbjct  676   MLDDYRSSLRPEIVEALVCAKDWLQ  700


 Score = 40.4 bits (93),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 67/115 (58%), Gaps = 3/115 (3%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGLRN-VFTVTVDNA-SSNDVALGFLKRKVLSWGSS  2008
             +F+ V S H    ++ A+   L +W +++ +FT+T+DN  SS+D+    L+  + +  + 
Sbjct  268   NFMMVSSPHSENALSEAISMSLSDWNMKDRLFTITLDNECSSHDIYSANLRDHLSNKNNL  327

Query  2007  SVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              +K +   +RC AHILN V  D +      V  +RE ++++++S ++ +KF ++A
Sbjct  328   MLKGQLFVVRCYAHILNAVALDVIASIHGVVYSIRESIKFIKASSAREEKFAEIA  382


 Score = 32.7 bits (73),  Expect(3) = 2e-50, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ +   FID EW
Sbjct  232   RISLTIGLWTTSQTLGYVSLAGQFIDSEW  260



>ref|NP_001136571.1| uncharacterized protein LOC100216693 [Zea mays]
 gb|ACF82192.1| unknown [Zea mays]
Length=503

 Score =   174 bits (442),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 115/325 (35%), Positives = 172/325 (53%), Gaps = 17/325 (5%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E  D+S+     +  P+S DW  V 
Sbjct  181   IPSTRTLCLDVTTQWNTTYLMLLAALDYKQAFTALETCDDSY-----NEAPSSEDWRKVE  235

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
                  LK  Y+    I  +   TAN FF E   L   L N     D   + +  +M  +F
Sbjct  236   AACNYLKLLYDSAHSIMAAANPTANIFFHEAWKLQLELANGTGHEDPTFRSIAKDMHERF  295

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR K++ +      +YG +  K +++ +  A++ELY++Y
Sbjct  296   DKYWKDC---SLVLAVAVVMDPRFKMKLVEFSYTKIYGAEAAK-HVKVVNDAVHELYEEY  351

Query  1291  AVSYSPSVVPA---TGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
              V++   + PA    G G             +P      LL   +    ++     K EL
Sbjct  352   -VAHPLPLTPAYVEQGEGGNNGAANANSSQGSPASAGDGLLDFDMYLSEIQSSQPSKPEL  410

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---R  950
             E YL E++T     FDIL WWK+N  +FP LS++A DILAIP+S V+S S+   +G   R
Sbjct  411   EQYLDESLTPRTQEFDILNWWKLNRVKFPTLSRMACDILAIPMSMVSSGSSIFTAGTGSR  470

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR  875
             +LD +RSSL P+ VEALVC +DWL+
Sbjct  471   MLDDYRSSLRPETVEALVCAKDWLQ  495


 Score = 43.5 bits (101),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 68/115 (59%), Gaps = 3/115 (3%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGLRN-VFTVTVDNA-SSNDVALGFLKRKVLSWGSS  2008
             +F+ V S H    ++ A+   L +W +++ +FT+T+DN  SS+D+    L+  + +  S 
Sbjct  62    NFMMVSSPHSENALSEAISLSLSDWSMKDKLFTITLDNECSSHDIYSANLRDHLSNKNSL  121

Query  2007  SVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              +K +   +RC AHILN V QD +      V  +RE ++++++S ++ +KF ++A
Sbjct  122   MLKGQLFVVRCYAHILNAVAQDVIASVHGVVYNIRESIKFIKASSAREEKFAEIA  176


 Score = 32.0 bits (71),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ +   FID EW
Sbjct  26    RISLTIGLWTTSQTLGYVSLAGQFIDSEW  54



>ref|XP_010656943.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X2 [Vitis vinifera]
Length=687

 Score =   175 bits (443),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/331 (34%), Positives = 178/331 (54%), Gaps = 38/331 (11%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             +E +  LCLD P RWN TY ML++AL Y+  F   +  D+++        P+  +WE   
Sbjct  350   VEGQKFLCLDNPLRWNLTYFMLEAALEYKDAFSLLQEHDSAYT-----MCPSDTEWERAG  404

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGANMKAKF  1472
              +   LK F E+T   SGS Y TAN +F EI D++  L ++   +D  +  +   MK+KF
Sbjct  405   AIAGYLKLFIEVTHVFSGSKYPTANIYFPEICDIHLQLIDLCNSSDILISTLALKMKSKF  464

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             ++Y     K +  +  A ILDPR K++ +      +YG      +++ +  ++  L++++
Sbjct  465   DEY---WKKCSLALAVAAILDPRFKMKLVEYYYSKIYG-SNATVHIDDISVSIKALFNEH  520

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI-----  1127
             A+  SP          +AS++  + +    VG    L      + R  LLG  K      
Sbjct  521   AIC-SP----------LASLDQGLAW---QVGGSGRLSAGNYSRDR--LLGFDKFLHETS  564

Query  1126  -------ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESA  968
                    +L+ YL E +      F IL WWKV++ ++PILS +AR++L IP+S VA +SA
Sbjct  565   QSQSVKSDLDKYLEEPLFPRNVDFSILNWWKVHTPKYPILSMMARNVLGIPMSKVALDSA  624

Query  967   FSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             F++ GRVLDH RSSL+P  V+ALVC QDW+R
Sbjct  625   FNMEGRVLDHDRSSLSPATVQALVCAQDWMR  655


 Score = 45.4 bits (106),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 71/120 (59%), Gaps = 1/120 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             SH  + ++  + +CL++W + R +F++++D  S+ND  +  ++ ++          +   
Sbjct  239   SHTEDMLSEVIMTCLMDWDIDRKLFSMSLDCCSTNDNIMCRIRDRLSQNRFLLCDGQLFD  298

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKKHPCV  1804
             +RC A+++N++VQD+L+       ++RE +RYV+SS +  +KF ++A+ +    +K  C+
Sbjct  299   IRCAANLVNMMVQDALEALSEVTCKIRESIRYVKSSQAVQEKFNEMAQQARVEGQKFLCL  358


 Score = 30.0 bits (66),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             ++S+  D W +   + Y+ +T+ +IDE W
Sbjct  196   KISLGADMWNASGDVQYLCLTSQYIDESW  224



>ref|NP_001147437.1| LOC100281046 [Zea mays]
 gb|ACG27513.1| transposon protein [Zea mays]
Length=719

 Score =   177 bits (448),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/325 (36%), Positives = 171/325 (53%), Gaps = 18/325 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E  D+++     +  P++ DW+ V 
Sbjct  387   IPSTKTLCLDVTTQWNTTYLMLLAALDYKQTFTTLETCDDNY-----NEAPSAEDWKKVE  441

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
                  LK  Y+    I  +   TAN FF E   L   L N     D     +  +M  +F
Sbjct  442   AACNYLKLLYDSAHSIMAAANPTANIFFHEAWKLQLELANGTGHEDPTFSSIAKDMHERF  501

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR K++ +      +YG    K Y++ +  A++ELY +Y
Sbjct  502   DKYWKDC---SLVLAIAVVMDPRFKMKLVEFSYSKIYGAGAAK-YVKVVDDAVHELYKEY  557

Query  1291  AVSYSPSVVPA---TGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
                  P + PA    G G+    N        P      LL   +    ++     K EL
Sbjct  558   VAQPLP-LTPAYVDQGEGNNGPAN-ANSSQGAPASTGDGLLDFDMYLSEIQSSQPSKSEL  615

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---R  950
             E YL E++T     FDIL WWK+N+ +FP LSK+ARDILAIP+S V+S S+   +G    
Sbjct  616   EQYLDESLTPRIQEFDILNWWKLNTVKFPTLSKMARDILAIPVSMVSSGSSIFCAGTGSH  675

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR  875
             +LD +RSSL P+IVEALVC +DWL+
Sbjct  676   MLDDYRSSLRPEIVEALVCAKDWLQ  700


 Score = 40.4 bits (93),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 67/115 (58%), Gaps = 3/115 (3%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGLRN-VFTVTVDNA-SSNDVALGFLKRKVLSWGSS  2008
             +F+ V S H    ++ A+   L +W +++ +FT+T+DN  SS+D+    L+  + +  + 
Sbjct  268   NFMMVSSPHSENALSEAISMSLSDWNMKDRLFTITLDNECSSHDIYSANLRDHLSNKNNL  327

Query  2007  SVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              +K +   +RC AHILN V  D +      V  +RE ++++++S ++ +KF ++A
Sbjct  328   MLKGQLFVVRCYAHILNAVALDVIASIHGVVYSIRESIKFIKASSAREEKFAEIA  382


 Score = 32.7 bits (73),  Expect(3) = 2e-50, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ +   FID EW
Sbjct  232   RISLTIGLWTTSQTLGYVSLAGQFIDSEW  260



>ref|XP_010656941.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X1 [Vitis vinifera]
 ref|XP_010656942.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X1 [Vitis vinifera]
Length=690

 Score =   175 bits (443),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/331 (34%), Positives = 178/331 (54%), Gaps = 38/331 (11%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             +E +  LCLD P RWN TY ML++AL Y+  F   +  D+++        P+  +WE   
Sbjct  350   VEGQKFLCLDNPLRWNLTYFMLEAALEYKDAFSLLQEHDSAYT-----MCPSDTEWERAG  404

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGANMKAKF  1472
              +   LK F E+T   SGS Y TAN +F EI D++  L ++   +D  +  +   MK+KF
Sbjct  405   AIAGYLKLFIEVTHVFSGSKYPTANIYFPEICDIHLQLIDLCNSSDILISTLALKMKSKF  464

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             ++Y     K +  +  A ILDPR K++ +      +YG      +++ +  ++  L++++
Sbjct  465   DEY---WKKCSLALAVAAILDPRFKMKLVEYYYSKIYG-SNATVHIDDISVSIKALFNEH  520

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI-----  1127
             A+  SP          +AS++  + +    VG    L      + R  LLG  K      
Sbjct  521   AIC-SP----------LASLDQGLAW---QVGGSGRLSAGNYSRDR--LLGFDKFLHETS  564

Query  1126  -------ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESA  968
                    +L+ YL E +      F IL WWKV++ ++PILS +AR++L IP+S VA +SA
Sbjct  565   QSQSVKSDLDKYLEEPLFPRNVDFSILNWWKVHTPKYPILSMMARNVLGIPMSKVALDSA  624

Query  967   FSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             F++ GRVLDH RSSL+P  V+ALVC QDW+R
Sbjct  625   FNMEGRVLDHDRSSLSPATVQALVCAQDWMR  655


 Score = 45.4 bits (106),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 71/120 (59%), Gaps = 1/120 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             SH  + ++  + +CL++W + R +F++++D  S+ND  +  ++ ++          +   
Sbjct  239   SHTEDMLSEVIMTCLMDWDIDRKLFSMSLDCCSTNDNIMCRIRDRLSQNRFLLCDGQLFD  298

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKKHPCV  1804
             +RC A+++N++VQD+L+       ++RE +RYV+SS +  +KF ++A+ +    +K  C+
Sbjct  299   IRCAANLVNMMVQDALEALSEVTCKIRESIRYVKSSQAVQEKFNEMAQQARVEGQKFLCL  358


 Score = 30.0 bits (66),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             ++S+  D W +   + Y+ +T+ +IDE W
Sbjct  196   KISLGADMWNASGDVQYLCLTSQYIDESW  224



>ref|XP_010656944.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X3 [Vitis vinifera]
Length=685

 Score =   174 bits (442),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/331 (34%), Positives = 178/331 (54%), Gaps = 38/331 (11%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             +E +  LCLD P RWN TY ML++AL Y+  F   +  D+++        P+  +WE   
Sbjct  350   VEGQKFLCLDNPLRWNLTYFMLEAALEYKDAFSLLQEHDSAYT-----MCPSDTEWERAG  404

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGANMKAKF  1472
              +   LK F E+T   SGS Y TAN +F EI D++  L ++   +D  +  +   MK+KF
Sbjct  405   AIAGYLKLFIEVTHVFSGSKYPTANIYFPEICDIHLQLIDLCNSSDILISTLALKMKSKF  464

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             ++Y     K +  +  A ILDPR K++ +      +YG      +++ +  ++  L++++
Sbjct  465   DEY---WKKCSLALAVAAILDPRFKMKLVEYYYSKIYG-SNATVHIDDISVSIKALFNEH  520

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI-----  1127
             A+  SP          +AS++  + +    VG    L      + R  LLG  K      
Sbjct  521   AIC-SP----------LASLDQGLAW---QVGGSGRLSAGNYSRDR--LLGFDKFLHETS  564

Query  1126  -------ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESA  968
                    +L+ YL E +      F IL WWKV++ ++PILS +AR++L IP+S VA +SA
Sbjct  565   QSQSVKSDLDKYLEEPLFPRNVDFSILNWWKVHTPKYPILSMMARNVLGIPMSKVALDSA  624

Query  967   FSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             F++ GRVLDH RSSL+P  V+ALVC QDW+R
Sbjct  625   FNMEGRVLDHDRSSLSPATVQALVCAQDWMR  655


 Score = 45.4 bits (106),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 71/120 (59%), Gaps = 1/120 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             SH  + ++  + +CL++W + R +F++++D  S+ND  +  ++ ++          +   
Sbjct  239   SHTEDMLSEVIMTCLMDWDIDRKLFSMSLDCCSTNDNIMCRIRDRLSQNRFLLCDGQLFD  298

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKKHPCV  1804
             +RC A+++N++VQD+L+       ++RE +RYV+SS +  +KF ++A+ +    +K  C+
Sbjct  299   IRCAANLVNMMVQDALEALSEVTCKIRESIRYVKSSQAVQEKFNEMAQQARVEGQKFLCL  358


 Score = 30.0 bits (66),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             ++S+  D W +   + Y+ +T+ +IDE W
Sbjct  196   KISLGADMWNASGDVQYLCLTSQYIDESW  224



>gb|AAF79835.1|AC026875_15 T6D22.19 [Arabidopsis thaliana]
Length=745

 Score =   153 bits (386),  Expect(3) = 3e-50, Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 169/326 (52%), Gaps = 36/326 (11%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI+ + SL LDV TRWNSTY ML  A+ ++ V       D  +KS      P++++WE  
Sbjct  428   GIQTEASLVLDVSTRWNSTYHMLSRAIQFKDVLHSLAEVDRGYKS-----FPSAVEWERA  482

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
               +  LLK F E+T  ISGS Y TAN +F ++  + C L +  ++ D A++ M  +M  K
Sbjct  483   ELICDLLKPFAEITKLISGSSYPTANVYFMQVWAIKCWLGDHDDSHDRAIREMVEDMTEK  542

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDK---LEYMPTQLVHMYGDKKGKDYLEKLLAALNEL  1304
             ++KY  D   +  M   A +LDPR K   LEY      ++      K+ L  +   + +L
Sbjct  543   YDKYWEDFSDILAM---AAVLDPRLKFSALEY----CYNILNPLTSKENLTHVRDKMVQL  595

Query  1303  YDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIE  1124
             +  Y  + + +V  +T   S   +    +  ++   +                 G  K  
Sbjct  596   FGAYKRT-TCNVAASTSQSSRKDIPFGYDGFYSYFSQRN---------------GTGKSP  639

Query  1123  LEYYLSEAITEDEGSF---DILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
             L+ YL E +  D  SF   D++ +WK N +RF  LS +A DIL+I I+TVASES FSI  
Sbjct  640   LDMYLEEPVL-DMVSFRDMDVIAYWKNNVSRFKELSSMACDILSISITTVASESTFSIGS  698

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLR  875
             RVL+ +RS L P  V+AL+CT++W R
Sbjct  699   RVLNKYRSCLLPTNVQALLCTRNWFR  724


 Score = 67.8 bits (164),  Expect(3) = 3e-50, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 5/83 (6%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             +F P   H G  IA  L   L +WG+ + VFT+TVDNAS+ND     LKRK+      S 
Sbjct  316   AFPP--PHSGVAIAMKLSELLKDWGIEKKVFTLTVDNASANDTMQSILKRKLQKHLVCS-  372

Query  2001  KSKYLHMRCIAHILNLVVQDSLK  1933
               ++ H+RC AHILNL+VQD L+
Sbjct  373   -GEFFHVRCSAHILNLIVQDGLE  394


 Score = 29.3 bits (64),  Expect(3) = 3e-50, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFID  2205
             R+ +TTD W ++   +Y+ +TAH++D
Sbjct  277   RICLTTDLWRALTVESYICLTAHYVD  302



>ref|XP_006377715.1| hypothetical protein POPTR_0011s10500g [Populus trichocarpa]
 gb|ERP55512.1| hypothetical protein POPTR_0011s10500g [Populus trichocarpa]
Length=673

 Score =   175 bits (443),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 175/325 (54%), Gaps = 28/325 (9%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI  + +L LD+PTRWNSTY ML++ + Y+  F   +  D ++ S L D+     +WE  
Sbjct  352   GISSQKNLVLDLPTRWNSTYFMLETVIGYKSAFCFLQERDPAYTSALTDT-----EWEWA  406

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
             +++   LK F E+T   SG    TAN +F EI D++  L E  +  D  +  M + MKAK
Sbjct  407   SSITGYLKLFVEITNIFSGDKCPTANIYFPEICDVHIQLIEWCKNPDDFLSSMASKMKAK  466

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F++Y     K +  +  A ILDPR K++ +      +YG     D ++++   + EL++ 
Sbjct  467   FDRY---WSKCSLALAVAAILDPRFKMKLVEYYYSQIYG-STALDRIKEVSDGIKELFNA  522

Query  1294  YAVSYS----PSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI  1127
             Y++  +     S +P +   S ++               +  LK   K       G   I
Sbjct  523   YSICSTLVDQGSTLPGSSLPSTST-------------DSRDRLKGFDKFLHESSQGQSAI  569

Query  1126  -ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGR  950
              +L+ YL E +      F+IL WWKV++ R+PILS +ARDIL  P+ST+A E AF + GR
Sbjct  570   SDLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDILGTPMSTIAPELAFGVGGR  629

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR  875
             VLD +RSSL P   +AL+CT+DWL+
Sbjct  630   VLDSYRSSLNPDTRQALICTRDWLQ  654


 Score = 41.2 bits (95),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLR-NVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             SH  + ++  + +CL+EW +   +F +T D+  ++D  +  +K ++          +   
Sbjct  242   SHTEDMLSEVIINCLMEWDVECKLFAMTFDDCFADDDIVLRIKDRISQNRPLLSNGQLFD  301

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +R  AH+LNL+VQD+++      ++VR  VRYV+SS     KF ++AE
Sbjct  302   VRSAAHVLNLIVQDAMETIREVTEKVRGSVRYVKSSQVIQGKFNEIAE  349


 Score = 33.1 bits (74),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+++  + W+S +   Y+ + AH+IDE+W
Sbjct  199   RINLAVEMWSSPENAEYLCLIAHYIDEDW  227



>emb|CAH66110.1| OSIGBa0115D20.3 [Oryza sativa Indica Group]
 emb|CAH65955.1| H0716A07.13 [Oryza sativa Indica Group]
Length=653

 Score =   172 bits (436),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/334 (33%), Positives = 166/334 (50%), Gaps = 38/334 (11%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
              ++    L +D PTRWNST+LML++A+ Y+  FD                 PT +DW   
Sbjct  283   SLDNTKGLSMDTPTRWNSTFLMLKNAIYYRNAFDRLFLQHGR---KYAKCAPTKVDWSMA  339

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAVKLMGANMKAKF  1472
               L K LK F+E T   SG+ Y TA +FF                DG +K M   M+ K+
Sbjct  340   IALCKCLKPFHEATELFSGTTYPTAKSFF--------------RTDGTIKTMANAMQTKY  385

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY    +K N  +  A  LDP  K   +    + +YG +  + + ++    + +L+D Y
Sbjct  386   DKY---WEKSNMALAVACFLDPHYKTSSIEYYGMKIYGLEAAEKF-DEFNGVIKKLFDVY  441

Query  1291  AVSYSPSVVPATGSGSVASVNL-------VVEF--VF----TPVGRPQHLLKAQIKKQRM  1151
             A S   +         V  + +         EF  +F    +     QH  +  +  +R 
Sbjct  442   ATSACATSKKKGAEMHVHQLQIQSDPVHNTNEFDDIFNENDSSQDHEQHFQRFLL--ERS  499

Query  1150  ELLGGKKIELEYYLSEAIT--EDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVAS  977
             + +   K EL+ Y+ + +     + +FDIL WWK+  A FPIL K+ARD L I +STVAS
Sbjct  500   QPICSDKTELQIYMEQPLLLWTSKDTFDILSWWKLKQAEFPILCKLARDFLCIQVSTVAS  559

Query  976   ESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             ESAFS  GRV+D FR+ L P+ V+ALVCT+DW++
Sbjct  560   ESAFSAGGRVVDPFRTRLDPEAVQALVCTKDWIK  593


 Score = 55.5 bits (132),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 2/115 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHM  1981
             H G  +       +++W L R +  +T+DNASSNDV +  +  K+           + H+
Sbjct  174   HSGSNMCKEFYDSIVDWNLDRRLVGLTLDNASSNDVCVKGVILKLRKISPLICDGIFFHV  233

Query  1980  RCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA-EYSMELSK  1819
             RC  HILNLV QD LKQ    V +++  +  ++ SP + + F+  A E S++ +K
Sbjct  234   RCFNHILNLVAQDGLKQITGAVLKIKNTISILKHSPLQFEAFQKCALEVSLDNTK  288



>ref|XP_011044575.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
 ref|XP_011044576.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
Length=673

 Score =   173 bits (439),  Expect(3) = 6e-50, Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 172/321 (54%), Gaps = 20/321 (6%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI  + +L LD+PTRWNSTY ML++ + Y+  F   +  D ++ S L D+     +WE  
Sbjct  352   GISSQKNLVLDLPTRWNSTYFMLETVIGYKSAFCFLQERDPAYTSALTDT-----EWEWA  406

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGANMKAK  1475
             +++   LK F E+T   SG    TAN +F EI D++  L E  +  D  +  M + MKAK
Sbjct  407   SSITGYLKLFVEITNIFSGDKCPTANIYFPEICDVHIQLIEWCKNPDDFLSSMASKMKAK  466

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F++Y     K +  +  A ILDPR K++ +      +YG     D ++++   + EL++ 
Sbjct  467   FDRY---WSKCSLALAVAAILDPRFKMKLVEYYYSQIYG-STALDRIKEVSDGIKELFNA  522

Query  1294  YAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI-ELE  1118
             Y++  +     +T  GS                  +  LK   K       G   I +L+
Sbjct  523   YSICSTLVDQGSTLPGSSLPSTSSDS---------RDRLKGFDKFLHESSQGQSAISDLD  573

Query  1117  YYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDH  938
              YL E +      F+IL WWKV++ R+PILS +ARDIL  P+ST+A + AF + GRVLD 
Sbjct  574   KYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDILGTPMSTIAPDLAFGVGGRVLDS  633

Query  937   FRSSLTPKIVEALVCTQDWLR  875
             +RSSL P   +AL+CT+DWL+
Sbjct  634   YRSSLNPDTRQALICTRDWLQ  654


 Score = 42.0 bits (97),  Expect(3) = 6e-50, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLR-NVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             SH  + ++  + +CL+EW +   +F +T D+  ++D  +  +K ++          +   
Sbjct  242   SHTEDMLSEVIINCLMEWDVECKLFAMTFDDCFADDDIVLRIKDRISQSRPLLSNGQLFD  301

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +R  AH+LNL+VQD+++      ++VR  VRYV+SS     KF D+A+
Sbjct  302   VRSAAHVLNLIVQDAMETIREVTEKVRGSVRYVKSSQVIQGKFNDIAQ  349


 Score = 33.1 bits (74),  Expect(3) = 6e-50, Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+++  + W+S +   Y+ + AH+IDE+W
Sbjct  199   RINLAVEMWSSPENAEYLCLIAHYIDEDW  227



>ref|XP_010268748.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
Length=367

 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 159/279 (57%), Gaps = 4/279 (1%)
 Frame = -2

Query  1678  PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVK  1502
             P   DW++V   VK LK FY +T+  SGSLYVT+NTFF E+  L   L  +  + D  + 
Sbjct  55    PNYDDWDNVRCFVKFLKLFYNVTLWFSGSLYVTSNTFFHELVALQTRLVRLCRSGDSLLS  114

Query  1501  LMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLL  1322
              M   MK KF+KY  +++ +N++++ A +LDP  KL+Y+      +Y   + ++  E++ 
Sbjct  115   SMAKRMKQKFDKYWENLENLNFLLYVAIVLDPCYKLKYVKFCFGQIYDSLRAREMTERVK  174

Query  1321  AALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQ-HLLKAQIKKQ-RME  1148
               LN LY  Y      S   A G  + +S     E  F          L +Q  K    E
Sbjct  175   ETLNHLYYHYHDHKCNSNFNA-GHEASSSSKSSNEMDFDDNEDDTLKFLASQFAKHLESE  233

Query  1147  LLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESA  968
                  K E+  YL E+  +   SFDIL WWK+N  ++ ILS+IARD+LA+PISTVA ESA
Sbjct  234   ERVESKSEVVTYLLESCEKPSDSFDILIWWKMNCQKYHILSQIARDVLAMPISTVAFESA  293

Query  967   FSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             F+ SG +LD FRSSL+PK+VEAL+C QDWLR    PI I
Sbjct  294   FNKSGHLLDPFRSSLSPKMVEALICGQDWLRSKPIPIDI  332



>ref|XP_007210480.1| hypothetical protein PRUPE_ppb018633mg [Prunus persica]
 gb|EMJ11679.1| hypothetical protein PRUPE_ppb018633mg [Prunus persica]
Length=643

 Score =   177 bits (448),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/334 (33%), Positives = 180/334 (54%), Gaps = 21/334 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKS------------DLGD  1685
             +++  ++ +DVPTRWN+TY ML+ A  Y++VF+   Y    F++                
Sbjct  220   MDKMANVPMDVPTRWNATYKMLEGAFKYRQVFEKMAYYCEVFQAYFLEEEKVKKVMVKRV  279

Query  1684  SIPTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE--ADG  1511
               P   DWE     V  L   Y+ T++++ +   T+     E+  L   +   ++   + 
Sbjct  280   GPPKDDDWEKALAFVHFLNKIYDATLKLNATKTCTSPIISLELVALQVQIEAKMKDPRNP  339

Query  1510  AVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLE  1331
              ++ + + MK KF+KY G  D +N +IF  N+LDP  KL+ +     ++  D + ++ + 
Sbjct  340   TIQRVASLMKLKFDKYWGSFDVVNKLIFLGNVLDPMMKLQMLQISFGNLGADARNQNEIV  399

Query  1330  K-LLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQR  1154
             K ++  LNELY++Y   +   VV       V  ++  V  +   V     L++  ++K++
Sbjct  400   KGVVKCLNELYNEY--KWVGGVVRQI---DVDEIDDEVALIGDDVDATFQLMQQLVQKRK  454

Query  1153  MELLGGKKIELEYYLSEAITED-EGSFDILRWWKVNSARFPILSKIARDILAIPISTVAS  977
              E       E++ +L++         F++L WWK N  R+PILS++A+DI AIP STVAS
Sbjct  455   FEQSVEISNEVDKHLTDPFESPLSKQFNLLNWWKGNQTRYPILSQVAKDIFAIPSSTVAS  514

Query  976   ESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             E+AFS+  R++D FRSSL PK+VEALVCT DWLR
Sbjct  515   ENAFSLGKRIVDPFRSSLHPKMVEALVCTSDWLR  548


 Score = 49.7 bits (117),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 50/108 (46%), Gaps = 42/108 (39%)
 Frame = -3

Query  2142  IANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKR------KVLSWGSSSVKS--KYL  1987
             I   L++CL +WG+  VFT+TVDNAS+ND A+ ++ +      KVLS     +++  K++
Sbjct  142   IGKTLDACLTDWGIHKVFTITVDNASANDRAVEYMAQSLKDGLKVLSASIEGIRNCVKFI  201

Query  1986  HMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             H                                  SSP++L KFR+ A
Sbjct  202   H----------------------------------SSPARLDKFREFA  215



>ref|XP_010314161.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X1 [Solanum lycopersicum]
 ref|XP_010314162.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X1 [Solanum lycopersicum]
Length=333

 Score =   187 bits (475),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/276 (41%), Positives = 156/276 (57%), Gaps = 10/276 (4%)
 Frame = -2

Query  1672  SLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EADGAVKLM  1496
             S DWE V  + K L+ F+ +T++ISGS YVT+N +F EI  +   LN+++   D  +  M
Sbjct  40    SSDWEGVKRITKFLEIFFNLTLKISGSRYVTSNLYFLEICQVGVYLNQLISNEDQVLAKM  99

Query  1495  GANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAA  1316
               NMK KF+KY GD  KM  M+F   +LDPR K   +   L  M+G+K G      +   
Sbjct  100   AENMKEKFDKYWGDASKMFKMVFIPCVLDPRHKFSTLGFALKKMFGEK-GAAIENGVQTY  158

Query  1315  LNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG  1136
             +  L+++Y     P     +G  S   V+  +    + VG   +  + ++ K + E  G 
Sbjct  159   MEALFNEYT---HPISNDKSGQFSSTGVDTSIS---SFVGEFGNFFE-ELHKHKSEKGGA  211

Query  1135  K-KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSI  959
               K EL  YL E    ++  FD+L WW VNS  F  LS++AR +LAIP+S+VASE AFS 
Sbjct  212   SSKSELVKYLDEETEIEKSDFDVLIWWIVNSPIFSFLSEMARYVLAIPVSSVASECAFST  271

Query  958   SGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
              G +LD FRSSLTP+ V+ALVC QDWLR     ISI
Sbjct  272   EGHILDLFRSSLTPRFVQALVCLQDWLRSEPLSISI  307



>ref|XP_006370067.1| hypothetical protein POPTR_0001s39240g [Populus trichocarpa]
 gb|ERP66636.1| hypothetical protein POPTR_0001s39240g [Populus trichocarpa]
Length=673

 Score =   172 bits (435),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 172/325 (53%), Gaps = 28/325 (9%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI  + +L LD  TRWNSTY ML++ + Y+  F   +  D ++ S L D     ++WE  
Sbjct  352   GISSQRNLVLDSSTRWNSTYSMLETVIGYKSAFCFLQEHDPAYTSALSD-----IEWEWA  406

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGANMKAK  1475
              ++   LK F E+T   SG    TAN +F EI D++  L E  +  D  +  + + MKAK
Sbjct  407   KSITGYLKLFVEITNIFSGDKCPTANRYFPEICDVHIQLIEWCKNPDDFLSSIASKMKAK  466

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY     K +  +  A ILDPR K++ +      +YG     D ++++   + EL++ 
Sbjct  467   FDKY---WSKCSLALAVAAILDPRFKMKLVEYYYSQIYG-STALDRIKEVSDGIKELFNA  522

Query  1294  YAVSYS----PSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI  1127
             Y++  +     S +P +   S ++               +  LK   K       G   I
Sbjct  523   YSICSTLVDQGSALPGSSLPSTST-------------DSRDRLKGFDKFLHESSQGQSSI  569

Query  1126  -ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGR  950
              +L+ YL E +      F+IL WWKV++ R+PILS +ARDIL  P+STV+ E AF + GR
Sbjct  570   SDLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDILGTPMSTVSPELAFGVGGR  629

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR  875
             VLD +RSSL P   +AL+CT+DWLR
Sbjct  630   VLDSYRSSLNPDTRQALICTRDWLR  654


 Score = 40.8 bits (94),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLR-NVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             SH  + ++  + +CL+EW +   +F +T D+ S++D  +  +K ++          +   
Sbjct  242   SHTEDVLSEVIINCLMEWDVEYKLFAMTFDDCSADDDIVLRIKDRISQNRPLLSNGQLFD  301

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +R   H+LNL+V+D+++      ++VR  V YV+SS     KF D+A+
Sbjct  302   VRSAVHVLNLIVKDAMETLQEVTEKVRGSVSYVKSSQVIQGKFNDIAQ  349


 Score = 34.3 bits (77),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+++  + W+S +   YM + AH+IDE+W
Sbjct  199   RINLAIEMWSSPENAEYMCLIAHYIDEDW  227



>ref|XP_009613012.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=382

 Score =   139 bits (351),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/275 (34%), Positives = 138/275 (50%), Gaps = 36/275 (13%)
 Frame = -2

Query  1765  LQSALIYQKVFDDYEYSDNSFKSDLGDS-----IPT----SLDWESVNNLVKLLKCFYEM  1613
             L+ A+ ++  F  Y  S+   +  L  S     IPT    S DWE+V  + K L+  Y +
Sbjct  93    LKRAVEFESAFSHYASSEIGLRHYLEHSYIDVGIPTGELLSSDWENVKRITKFLEIVYLL  152

Query  1612  TIRISGSLYVTANTFFSEISDLYCILNEMV-EADGAVKLMGANMKAKFEKY*GDIDKMNY  1436
             T++ISGS YVT+N  F E   +   L +++   D  +  M  NMK KF+KY GD  KMN 
Sbjct  153   TLKISGSRYVTSNIHFLETCTVVVYLKQLIANEDTILSEMTKNMKEKFDKYWGDRGKMNK  212

Query  1435  MIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSPSVVPAT  1256
             +IF +  LDP  KLE +   LV M+G   G     ++   +  L+ +Y+  +        
Sbjct  213   IIFISCSLDPCYKLESVSYALVKMFGVDLGATIQAEVTKYMTSLFSEYSSKH--------  264

Query  1255  GSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG-GKKIELEYYLSEAITEDEGS  1079
                              P  R   +   + KK +    G   + EL+ Y+ E   +D   
Sbjct  265   -----------------PKYRTFRITHTRYKKYKSGSGGVDTRTELDKYVGEETEDDTKE  307

Query  1078  FDILRWWKVNSARFPILSKIARDILAIPISTVASE  974
             FD+L WWK+NSARFPIL ++A D+LA+PIS++ASE
Sbjct  308   FDVLLWWKLNSARFPILEEMAHDVLAVPISSLASE  342


 Score = 86.7 bits (213),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -3

Query  2142  IANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHI  1963
             +AN +  CL EWG+  +FTVTVDN SSNDV +  L +++   G++ +   +LH+R +AHI
Sbjct  1     MANGIGRCLHEWGINKIFTVTVDNVSSNDVTIKELSKQLTKMGTNLMNGTHLHVRFMAHI  60

Query  1962  LNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKK  1858
             +NLVVQD LK+  ++++ VR  VRYVR SP++LK+
Sbjct  61    MNLVVQDGLKESSVSIEHVRHAVRYVRQSPARLKR  95



>ref|XP_007214577.1| hypothetical protein PRUPE_ppa019953mg, partial [Prunus persica]
 gb|EMJ15776.1| hypothetical protein PRUPE_ppa019953mg, partial [Prunus persica]
Length=508

 Score =   150 bits (378),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/357 (31%), Positives = 174/357 (49%), Gaps = 68/357 (19%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSF------------------  1703
             IE +  + +DVP RWNSTYLML + L +QK FD      +S                   
Sbjct  178   IECEGLVVIDVPIRWNSTYLMLDATLKFQKTFDRMGDDLDSLYLMYFKEKEGEEEGNEGI  237

Query  1702  ------KSDLGDSI--PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFS-----  1562
                   K  +   +   ++ DW++    V  LK FY++T++I  SL+ T++T F      
Sbjct  238   EGSGNKKEKINKRVGPRSNEDWDNAMTFVMFLKTFYDVTLKILSSLHPTSHTTFHDLIAI  297

Query  1561  --EISDLY-----CILNEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPR  1403
               EI DLY       +  +   D  +  M A+M+ K++KY G++ K+N  +    ++DPR
Sbjct  298   GGEIQDLYRYDVTTPIKALTVMDTLLNDMAASMRKKYDKYFGELHKVNPFLMIGVVIDPR  357

Query  1402  DKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVNLV  1223
               L      L H++      D + + L A N                   +  V  + + 
Sbjct  358   FNLR----NLKHIFEKIFEHDTICERLVAQN-------------------TNEVKQILMN  394

Query  1222  VEFVFTPVGRPQHLLKAQIKKQRME----LLGGKKIELEYYLSEAITEDEGSFDILRWWK  1055
             +  V+ P    +  +  + KK + E    +L     E++ YL + +   +G FDI+RWW+
Sbjct  395   MYEVYKPSSHKRKNMMEKWKKIQQESDNVVLTH---EMDRYLLDPLETIDGVFDIIRWWR  451

Query  1054  VNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQD  884
             +   ++P L+ IARD+L IP STVASES FS  GRV+D F+SSL+ K+VEAL+ +Q+
Sbjct  452   IKGLKYPGLALIARDVLVIPTSTVASESCFSTGGRVIDSFQSSLSLKMVEALIYSQN  508


 Score = 53.5 bits (127),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = -3

Query  2106  GLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--VKSKYLHMRCIAHILNLVVQDSLK  1933
             G   +  +T DNAS+N  A+ ++++K+  W +S+  +   ++HMRC AHI+N +V+  LK
Sbjct  84    GHEKILIITADNASANSKAIDYVRKKINGWKNSNSVLGGVHMHMRCSAHIINWLVKKDLK  143

Query  1932  QCDITvkrvrevvryvRSSPSKL  1864
             + +  +  +   V+YVRSSPS+L
Sbjct  144   RLESYIVAICNAVKYVRSSPSRL  166


 Score = 43.1 bits (100),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  2273  ITTDSWTSIQRINYMVVTAHFIDEEW  2196
             +TTD+WTS+Q +NYMV+ AHF+D ++
Sbjct  48    LTTDTWTSVQNVNYMVLIAHFVDSDY  73



>ref|XP_009622105.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=381

 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 118/345 (34%), Positives = 169/345 (49%), Gaps = 81/345 (23%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPT--------  1673
             +E   +LCLDVPT WN TY ML +A  ++KVFD +   D+ F + L   +          
Sbjct  49    VECTKTLCLDVPTWWNFTYFMLDTAQNFEKVFDKFHLFDDGFSAYLCSHLCEDGSSAGPL  108

Query  1672  -SLDWESVNNLV--------KLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MV  1523
              S D  +V N++         +L  F+E+T ++SGS YVT N+ F ++S+LYC L   ++
Sbjct  109   KSDDLVNVRNMIAFLARFHDXVLARFHELTKKVSGSRYVTCNSHFEDVSELYCHLKMCLI  168

Query  1522  EADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGK  1343
               D  ++ M   M+ KF+                               L  + G++KGK
Sbjct  169   SEDEHLRKMAEQMQEKFKN----------------------------LALEELSGEEKGK  200

Query  1342  DYLEKLLAALNELYDDYAVSYSPSVVPAT-GSGSVASVNLVVEFVFTPVGRPQHLLKAQI  1166
                 ++ A +N L+++Y       +      +GS                          
Sbjct  201   KINVEVYAYMNSLFEEYLKKTKLHLKKQKEDNGS--------------------------  234

Query  1165  KKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPIST  986
                     GG K EL+ Y++E        FDIL WWK ++ RFPILS++ARD+LAIPIS+
Sbjct  235   --------GGAKSELDKYINEEQEPFSEEFDILSWWKTHAPRFPILSELARDVLAIPISS  286

Query  985   VASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             VAS+ AFS  GR+LD FRSSLTPK V+ LVC QDWLR    PIS+
Sbjct  287   VASKCAFSTGGRILDSFRSSLTPKCVQTLVCVQDWLREEKNPISV  331



>ref|XP_011098171.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011098172.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011098173.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011098174.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=684

 Score =   173 bits (439),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 115/332 (35%), Positives = 170/332 (51%), Gaps = 42/332 (13%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI     L LD P +WNSTYLML++A+ Y+  F   +  D S+   L +     ++WE  
Sbjct  360   GINSGRRLVLDCPMQWNSTYLMLEAAIEYKGAFCLLQEHDASYTKALSE-----MEWEWA  414

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
             +++   +K   E T  + G+ Y TAN FF EI D++  LNE  ++ D  +  +   MK K
Sbjct  415   SSVAGYIKFLLEFTNIVIGNKYPTANIFFPEICDMHIQLNEWCKSPDEFLSSVALKMKLK  474

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+ Y     K + ++  A ILDPR K++ +      +YG       ++++ A L EL+++
Sbjct  475   FDVY---WSKCSMVLAIAAILDPRFKMKLVEYYFQQIYGSA-APCRIKEVSAGLRELFNE  530

Query  1294  YAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI----  1127
             Y+++ S    P   SG                  P   L +     R +L G  K     
Sbjct  531   YSMASSS---PDEDSG-----------------LPGSCLPSSSNSSRDKLKGFDKFLFET  570

Query  1126  --------ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASES  971
                     +L+ YL E +      F IL WWKV++ R+PILS +ARD+L IP+ST+  E 
Sbjct  571   SQSQSMSSDLDKYLEEPVFPRNYDFSILNWWKVHTPRYPILSMMARDVLGIPVSTLGPEV  630

Query  970   AFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             AFS  GRVLD + SSL+P   EAL+C QDWLR
Sbjct  631   AFSNGGRVLDQYHSSLSPDTREALLCGQDWLR  662


 Score = 40.4 bits (93),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 64/109 (59%), Gaps = 3/109 (3%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             SH  + ++  +   L +W + R +F++T D+ S+ +V + F  +  LS     +K+  L 
Sbjct  250   SHTDDILSEVIIKSLTDWAIDRKLFSMTFDDCSAYEVMV-FRIKDWLSQNRPLLKNGDLF  308

Query  1983  -MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
              +RC+ H+L  +VQ+ ++ C     ++RE VR+V+SS + L KF ++A+
Sbjct  309   DVRCVTHLLKSIVQEVMESCRDVTHKIRESVRHVKSSQTVLGKFNEIAQ  357


 Score = 32.3 bits (72),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+++  D W S +   Y+ +TA++IDE+W
Sbjct  207   RINLAVDMWGSPESSEYICLTANYIDEDW  235



>ref|XP_010534728.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Tarenaya hassleriana]
Length=328

 Score =   125 bits (314),  Expect(3) = 5e-49, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 112/184 (61%), Gaps = 6/184 (3%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL---GDSIPTSLDWE  1658
             +  K  +CLDV TRWNSTYLML+SA+  +  FD     D+ + +DL   G   PT++DW+
Sbjct  136   LSTKCGVCLDVETRWNSTYLMLESAIKLRSGFDMLASMDDKYVADLRKNGFGPPTAIDWD  195

Query  1657  SVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAVKL-MGANMK  1481
              V +L+ +L+CFYE T+++SG+ YVT N +  EI  +   + ++++ D   K  M   MK
Sbjct  196   YVESLLPILECFYEATLKVSGTRYVTGNEYMKEIFAVGWKIQQVMDCDDPFKRSMAERMK  255

Query  1480  AKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK-KGKDYLEKLLAALNEL  1304
              KF+KY    D +N +IF A ++DPR KL Y+   +  +Y D+ K  + + K+ +AL  L
Sbjct  256   KKFDKYWLS-DDINVIIFIATVVDPRFKLTYVNFMIKEIYNDEDKASEMIGKVKSALENL  314

Query  1303  YDDY  1292
             ++ Y
Sbjct  315   FEYY  318


 Score = 99.4 bits (246),  Expect(3) = 5e-49, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ +H GE I   +E CL++WG+  V TVTVDNASSNDV + +L+R+    GSS + 
Sbjct  20    NFCPIPNHAGETIGKFVEHCLVQWGIERVLTVTVDNASSNDVGIKYLQRQFKKSGSSILD  79

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRD  1849
               +LHMRC AHIL L+V+D L +   ++ R+R  VRYVRSS S+  KF++
Sbjct  80    GDFLHMRCGAHILGLIVRDGLSEIHESIFRIRGAVRYVRSSTSRADKFKE  129


 Score = 21.2 bits (43),  Expect(3) = 5e-49, Method: Compositional matrix adjust.
 Identities = 7/12 (58%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -1

Query  2231  MVVTAHFIDEEW  2196
             M +TAH+ID +W
Sbjct  1     MSLTAHYIDVDW  12



>ref|XP_011045538.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
 ref|XP_011045539.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
 ref|XP_011045541.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
Length=673

 Score =   169 bits (429),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 171/325 (53%), Gaps = 28/325 (9%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI  + +L LD  TRWNSTY ML++ + Y+      +  D ++ S L D     ++WE  
Sbjct  352   GISSQRNLILDSSTRWNSTYFMLETVIGYKSASCFLQEHDPAYTSALSD-----IEWEWA  406

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
              ++   LK F E+T   SG    TAN +F EI D++  L E  +  D  +  M + MKAK
Sbjct  407   RSITGYLKLFVEITNIFSGDKCPTANRYFPEICDVHIQLIEWCKNPDDFLSSMASKMKAK  466

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY     K +  +  A ILDPR K++ +      +YG     D ++++   + EL++ 
Sbjct  467   FDKY---WSKCSLALAVAAILDPRFKMKLVEYYYSQIYG-STALDRIKEVSDGIKELFNA  522

Query  1294  YAVSYS----PSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI  1127
             Y++  +     S +P +   S ++               +  LK   K       G   I
Sbjct  523   YSICSTLVDEGSALPGSSLPSTST-------------DSRDRLKGFDKFLHESSQGQSAI  569

Query  1126  -ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGR  950
              +L+ YL E +      F+IL WWKV++ R+PILS +ARDIL  P+STV+ E AF + GR
Sbjct  570   SDLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDILGTPVSTVSPELAFGVGGR  629

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR  875
             VLD +RSSL P   +AL+CT+DWLR
Sbjct  630   VLDSYRSSLNPDTRQALICTRDWLR  654


 Score = 40.0 bits (92),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 62/114 (54%), Gaps = 13/114 (11%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLR-NVFTVTVDNASSNDVALGFLK------RKVLSWGSSSV  2002
             SH  + ++  + +CL+EW +   +F +T D+ S++D  +  +K      R +LS G    
Sbjct  242   SHTEDVLSEVIINCLMEWDVEYKLFAMTFDDCSADDDIVLRIKDRTSQNRPLLSNG----  297

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
               +   +R   H+LNL+V+D+++      ++VR  V YV+SS     KF D+A+
Sbjct  298   --QLFDVRSAVHVLNLIVKDAMETLQEVTEKVRGSVSYVKSSQVIQGKFNDIAQ  349


 Score = 35.4 bits (80),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+++  + W+S + + YM + AH+IDE+W
Sbjct  199   RINLAIEMWSSPENVQYMCLIAHYIDEDW  227



>ref|XP_009777794.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like, 
partial [Nicotiana sylvestris]
Length=293

 Score =   184 bits (466),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 110/275 (40%), Positives = 148/275 (54%), Gaps = 60/275 (22%)
 Frame = -2

Query  1672  SLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKLM  1496
             S DW +V N+++ L  F+E+T ++SGS YVT N+ F ++S+LYC L   +V  D  ++ M
Sbjct  9     SDDWVNVGNVIEFLARFHEITKKVSGSRYVTCNSHFEDVSELYCHLKMCLVSEDEHLRKM  68

Query  1495  GANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAA  1316
                M+ KF+KY G+ +KMN MIF A++LDPR+K EY+                      A
Sbjct  69    AERMQEKFKKYWGEPEKMNKMIFIASVLDPRNKFEYVE--------------------GA  108

Query  1315  LNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGG  1136
             L EL+               G      +N                  A+ +K+  E  GG
Sbjct  109   LEELF---------------GEEKGKKIN------------------AEKQKEDNES-GG  134

Query  1135  KKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSIS  956
              K EL+ Y+SE        FDIL WWK ++ RF ILS+     LAIPIS+VASE  FS  
Sbjct  135   AKSELDKYISEEQEPFSEEFDILNWWKTHAPRFSILSE-----LAIPISSVASECVFSTG  189

Query  955   GRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             GR+LD FRSSLTPK V+AL+C QDWLR    PIS+
Sbjct  190   GRILDSFRSSLTPKCVQALICVQDWLREEKNPISV  224



>emb|CAB72476.1| putative protein [Arabidopsis thaliana]
Length=661

 Score =   146 bits (368),  Expect(3) = 9e-49, Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 166/348 (48%), Gaps = 45/348 (13%)
 Frame = -2

Query  1843  RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD---NSFKSDLGDSIPT  1673
             +V  G   + SL LD+ TRWNSTYLML+ A+ ++  FD  E  D   N + +++ D    
Sbjct  305   KVVSGKMTRGSLPLDIKTRWNSTYLMLKRAMEFRLAFDKMEAEDKLYNDYFNEVDDGKAR  364

Query  1672  SLDWESV---NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAVK  1502
             S   + +    + V   KC+ E+ + I  +L    N F                 D  +K
Sbjct  365   SGHLQELIGMQSRVASYKCYGEI-VTIETNLVSLGNNF-----------------DRDLK  406

Query  1501  LMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKK--GKDYLEK  1328
             +    M  KF KY      +N  +  A++ DPR K+++       +YG      K+  EK
Sbjct  407   IKAKAMLGKFVKYWDGTRNINVYLIVASVFDPRKKMQFANMCFAKLYGKDTTDAKEMAEK  466

Query  1327  LLAALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRME  1148
             +   L  L+ +Y+  +  +   +  S      ++         G P  L+   +  +RM+
Sbjct  467   VNNVLTSLFKEYSSRFQKTSSGSGPSSQSTQTSITA-----SQGEPSDLMSDSMGYERMD  521

Query  1147  L----------LGGKKIELEYYLSEAITEDEG----SFDILRWWKVNSARFPILSKIARD  1010
                        +   + EL+ YL E +   +      +++L WWK+N  RFP+LS I +D
Sbjct  522   FAYKELVDEIGVDDGRDELDVYLKEKVENPKTIIGLEWEVLSWWKLNCGRFPVLSAITKD  581

Query  1009  ILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPN  866
             +LA+ +S+VASESAFS SGRV++  RS LT  +V+ L+CT+ W++  N
Sbjct  582   VLAMQVSSVASESAFSNSGRVIEPHRSCLTHYMVKVLLCTEQWMKNVN  629


 Score = 60.5 bits (145),  Expect(3) = 9e-49, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 50/83 (60%), Gaps = 4/83 (5%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS---  2005
             F  +  HKG  IA  L  CL E G+  +FT+TVDN ++N  AL   + +  S  S+    
Sbjct  194   FKYITDHKGATIARILLECLAECGIEKIFTITVDNETTNTSALKKFQ-ETFSLRSNEAFV  252

Query  2004  VKSKYLHMRCIAHILNLVVQDSL  1936
             ++ + +H+RC AHI+NL+V++ L
Sbjct  253   LEGEGMHVRCAAHIINLIVKEGL  275


 Score = 38.1 bits (87),  Expect(3) = 9e-49, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 1/30 (3%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRI-NYMVVTAHFIDEEW  2196
             RVS+TTD WT+   + +YMV+TAHF+D  W
Sbjct  156   RVSLTTDIWTAKATVASYMVITAHFVDSAW  185



>ref|XP_007021998.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 ref|XP_007021999.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 ref|XP_007022000.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 gb|EOY13523.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 gb|EOY13524.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 gb|EOY13525.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
Length=672

 Score =   160 bits (405),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 169/320 (53%), Gaps = 22/320 (7%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLD-WES  1655
             GI  + SL LD P RWNSTY+ML++A+ Y+  F            +L   +  S D WE 
Sbjct  350   GIISQKSLVLDCPIRWNSTYVMLETAVEYRNAF--------CHLPELDPDLALSDDEWEW  401

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKA  1478
              +++   LK F E+    SG+   TAN +F EI  ++  L E  ++ D  +  + A MKA
Sbjct  402   ASSVTGYLKLFIEIINVFSGNKCPTANIYFPEICHVHIQLIEWCKSPDNFLSSLAAKMKA  461

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYD  1298
             KF+KY     K +  +  A ILDPR K++ +      +YG     + ++++   + EL++
Sbjct  462   KFDKY---WSKCSLALAVAAILDPRFKMKLVEYYYSQIYG-STALERIKEVSDGIKELFN  517

Query  1297  DYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELE  1118
              Y++  S  +   T     +  +   +      G  + L +    +  +        +LE
Sbjct  518   AYSIC-STLIDEGTALPGSSLPSSSNDSRDRLKGFDKFLHETAQSQSAIS-------DLE  569

Query  1117  YYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDH  938
              YL EA+      F+IL WW+V++ R+PILS +ARD+L  P+STVA ESAF+  GRVLD 
Sbjct  570   KYLEEAVFPRNCDFNILNWWRVHTPRYPILSMMARDVLGTPMSTVAQESAFNAGGRVLDS  629

Query  937   FRSSLTPKIVEALVCTQDWL  878
              RSSLT    +AL+CT+DWL
Sbjct  630   CRSSLTADTRQALICTRDWL  649


 Score = 47.8 bits (112),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 68/116 (59%), Gaps = 1/116 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLR-NVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             SH  + ++  +  CL++W +   +F +T D+ S+ND  +  +K ++          + L 
Sbjct  240   SHTEDLLSEVIMKCLMDWDIECKLFAMTFDDCSTNDDIVLRIKEQISENRPRLSNGQLLD  299

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKK  1816
             +R  AHILN +VQD+++   + ++++R  VRYV+SS S   KF ++A+ +  +S+K
Sbjct  300   VRSAAHILNSLVQDAVEALQVVIQKIRGSVRYVKSSQSIQGKFNEIAQQTGIISQK  355


 Score = 35.8 bits (81),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+++  + W+S +  NY+ +TAH+ID++W
Sbjct  197   RINLAVEMWSSPENSNYLCLTAHYIDDDW  225



>ref|NP_001056444.1| Os05g0583100 [Oryza sativa Japonica Group]
 dbj|BAF18358.1| Os05g0583100, partial [Oryza sativa Japonica Group]
Length=473

 Score =   176 bits (445),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 120/333 (36%), Positives = 177/333 (53%), Gaps = 23/333 (7%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +LCLDV T+WN+TYLML +AL Y++ F   E SD+++     +  P++ DW+ V 
Sbjct  141   IPSTKTLCLDVTTQWNTTYLMLLAALDYKQAFSTLETSDDNY-----NEAPSAEDWKKVE  195

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
                  LK  Y+    I  +   T+N FF E   L   L N     D     +  +M  +F
Sbjct  196   AACNYLKLLYDSAHSIMAAANPTSNLFFHEAWKLQLELSNATGHEDPVFSSIAKDMHERF  255

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    N ++  A ++DPR K++ +      +YG +  K Y++ +  A++ELY +Y
Sbjct  256   DKYWKDC---NLVLAIAVVMDPRFKMKLVEFSYSKIYGVEAAK-YVKVVDDAVHELYKEY  311

Query  1291  AVSYSPSVVPA-----TGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI  1127
                  P + PA      G+ + AS N       T       L+   +    +      K 
Sbjct  312   VAQPLP-LTPAYVEQGEGNNAPASENSTQT---TAPSTGDGLVDFDMYLSEIATSQPTKS  367

Query  1126  ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG--  953
             ELE YL E++T     FDIL WWK+N+ +FP LSK+ARDILAIP+S V+S ++   +G  
Sbjct  368   ELEQYLDESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAIPMSMVSSGNSIFSAGTG  427

Query  952   -RVLDHFRSSLTPKIVEALVCTQDWLR-RPNTP  860
              R+LD +RSSL P+IVEAL C +DWL+  P TP
Sbjct  428   TRMLDDYRSSLRPEIVEALFCAKDWLQYSPATP  460


 Score = 47.4 bits (111),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             H    ++ A+ + L +W +++ +FT+T+DN  SS+D+    L+  + +  +  +K +   
Sbjct  30    HSENALSEAISASLSDWNMKDKLFTITLDNDCSSHDIYSANLRDYLSNKNNLMLKGQLFV  89

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             +RC AHILN V QD +      +  +RE ++++++SP++ +KF ++A
Sbjct  90    VRCYAHILNAVAQDVIASIHGVIYNIRESIKFIKASPTREEKFAEIA  136



>sp|P03010.1|TRAC9_MAIZE RecName: Full=Putative AC9 transposase [Zea mays]
Length=839

 Score =   156 bits (394),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 122/349 (35%), Positives = 176/349 (50%), Gaps = 55/349 (16%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVF-------------------DDYEYSDNS  1706
             +++   +  DV TRWNSTYLML+ AL Y+                        Y++S N 
Sbjct  395   LDKSKGISYDVSTRWNSTYLMLRDALYYKPALIRLKTSDPRRYVCLNCCTCHHYKFSINQ  454

Query  1705  FKSDLGDSI----PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTF---FSEISDL  1547
                 +G       P S  W     L K LK F+++T  +SG+ Y TAN F   F EI DL
Sbjct  455   MSIIVGTMQFVLKPRSGRWHL--TLFKCLKKFFDLTELLSGTQYSTANLFYKGFCEIKDL  512

Query  1546  ---YCILNEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQ  1376
                +C   + V     ++ M   M  KFEKY       N  +  A  LDPR K   +   
Sbjct  513   IDQWCCHEKFV-----IRRMAVAMSEKFEKY---WKVSNIALAVACFLDPRYKKILIEFY  564

Query  1375  LVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSPSVVPATGSGSVASVN-LVVEFVFTPV  1199
             +   +GD   K +++  +  + +LY  Y+ S SPS  P T + +  S++  ++E      
Sbjct  565   MKKFHGDSY-KVHVDDFVRVIRKLYQFYS-SCSPSA-PKTKTTTNDSMDDTLMENEDDEF  621

Query  1198  GRPQHLLKA--QIKKQRMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILS  1025
                 H LK   Q++            EL+ Y+SE + +  G FDIL WW+   A +PIL+
Sbjct  622   QNYLHELKDYDQVESN----------ELDKYMSEPLLKHSGQFDILSWWRGRVAEYPILT  671

Query  1024  KIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWL  878
             +IARD+LAI +STVASESAFS  GRV+D +R+ L  +IVEAL+CT+DW+
Sbjct  672   QIARDVLAIQVSTVASESAFSAGGRVVDPYRNRLGSEIVEALICTKDWV  720


 Score = 49.7 bits (117),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV-KSKYLH  1984
             H G+ ++    + +++W + + +F +++DNAS+N+VA+  +   +    S+ V    + H
Sbjct  284   HTGQRLSQTFTAIMVKWNIEKKLFALSLDNASANEVAVHDIIEDLQDTDSNLVCDGAFFH  343

Query  1983  MRCIAHILNLVVQDSL  1936
             +RC  HILNLV +D L
Sbjct  344   VRCACHILNLVAKDGL  359


 Score = 38.1 bits (87),  Expect(3) = 1e-48, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R S T D WTS Q  +YM VT H+ID++W
Sbjct  240   RFSTTMDMWTSCQNKSYMCVTIHWIDDDW  268



>ref|XP_007022001.1| BED zinc finger,hAT family dimerization domain isoform 4 [Theobroma 
cacao]
 ref|XP_007022003.1| BED zinc finger,hAT family dimerization domain isoform 4 [Theobroma 
cacao]
 gb|EOY13526.1| BED zinc finger,hAT family dimerization domain isoform 4 [Theobroma 
cacao]
 gb|EOY13528.1| BED zinc finger,hAT family dimerization domain isoform 4 [Theobroma 
cacao]
Length=689

 Score =   160 bits (404),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 169/320 (53%), Gaps = 22/320 (7%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLD-WES  1655
             GI  + SL LD P RWNSTY+ML++A+ Y+  F            +L   +  S D WE 
Sbjct  350   GIISQKSLVLDCPIRWNSTYVMLETAVEYRNAF--------CHLPELDPDLALSDDEWEW  401

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKA  1478
              +++   LK F E+    SG+   TAN +F EI  ++  L E  ++ D  +  + A MKA
Sbjct  402   ASSVTGYLKLFIEIINVFSGNKCPTANIYFPEICHVHIQLIEWCKSPDNFLSSLAAKMKA  461

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYD  1298
             KF+KY     K +  +  A ILDPR K++ +      +YG     + ++++   + EL++
Sbjct  462   KFDKY---WSKCSLALAVAAILDPRFKMKLVEYYYSQIYG-STALERIKEVSDGIKELFN  517

Query  1297  DYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELE  1118
              Y++  S  +   T     +  +   +      G  + L +    +  +        +LE
Sbjct  518   AYSIC-STLIDEGTALPGSSLPSSSNDSRDRLKGFDKFLHETAQSQSAIS-------DLE  569

Query  1117  YYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDH  938
              YL EA+      F+IL WW+V++ R+PILS +ARD+L  P+STVA ESAF+  GRVLD 
Sbjct  570   KYLEEAVFPRNCDFNILNWWRVHTPRYPILSMMARDVLGTPMSTVAQESAFNAGGRVLDS  629

Query  937   FRSSLTPKIVEALVCTQDWL  878
              RSSLT    +AL+CT+DWL
Sbjct  630   CRSSLTADTRQALICTRDWL  649


 Score = 47.8 bits (112),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 68/116 (59%), Gaps = 1/116 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLR-NVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             SH  + ++  +  CL++W +   +F +T D+ S+ND  +  +K ++          + L 
Sbjct  240   SHTEDLLSEVIMKCLMDWDIECKLFAMTFDDCSTNDDIVLRIKEQISENRPRLSNGQLLD  299

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKK  1816
             +R  AHILN +VQD+++   + ++++R  VRYV+SS S   KF ++A+ +  +S+K
Sbjct  300   VRSAAHILNSLVQDAVEALQVVIQKIRGSVRYVKSSQSIQGKFNEIAQQTGIISQK  355


 Score = 35.8 bits (81),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+++  + W+S +  NY+ +TAH+ID++W
Sbjct  197   RINLAVEMWSSPENSNYLCLTAHYIDDDW  225



>ref|XP_004511203.1| PREDICTED: uncharacterized protein LOC101508098 [Cicer arietinum]
Length=640

 Score =   191 bits (486),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 127/334 (38%), Positives = 180/334 (54%), Gaps = 46/334 (14%)
 Frame = -2

Query  1825  EQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL----GDSIPTSLDWE  1658
             E K  +CLDV TRWNSTYLML SAL +QK F+  E  D  +  +L    G  +PTSLDW 
Sbjct  123   EYKGLVCLDVETRWNSTYLMLDSALKHQKAFEVLEIHDPKYSEELLKGKGKGVPTSLDWA  182

Query  1657  SVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDL-YCILNEMVEADGAVKLMGANMK  1481
                +++  LK FY+ T+RISGS YV +N +  E+  +   IL      D  +K+M   MK
Sbjct  183   KAQSIMPFLKMFYDATLRISGSSYVASNMYMLEVFGIGEKILKMCNSKDMYLKVMADRMK  242

Query  1480  AKFEKY*GDIDKMNYMIFFANILDPRDKLEY---MPTQLVHMYGDKKGKDYLEKLLAALN  1310
              K++KY G  + +N ++  +++L+PR+KL++   + TQ  + +   K KD L+     L+
Sbjct  243   TKYDKYWGKYENLNMLLLISSVLEPRNKLKFVNWLITQNFNSFDATKLKDLLK---TRLD  299

Query  1309  ELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK  1130
             EL  +Y+           G G                         Q + Q  E     K
Sbjct  300   ELILEYS---------GVGEG------------------------FQSESQSTEFDLSGK  326

Query  1129  IELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGR  950
              +L  Y    ++    S +     ++NS+RFPIL KIA+D+LAIPISTVAS S FS  GR
Sbjct  327   EDLYSYNRFLMSIGSSSTEKSDLERLNSSRFPILVKIAKDLLAIPISTVASGSTFSFGGR  386

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR--RPNTPIS  854
             V+D +RS LTP+ VEALVCT  WL+  R ++ IS
Sbjct  387   VIDEYRSCLTPQTVEALVCTASWLKGLRKSSSIS  420



>ref|XP_009762687.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=288

 Score =   129 bits (325),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 101/171 (59%), Gaps = 10/171 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDS-----IPT---  1673
             +  K +LCLDVPTRWNSTYLML+ A+ ++  F  Y  S+   +  L  S     IPT   
Sbjct  105   LNSKKTLCLDVPTRWNSTYLMLRRAIEFECAFSHYASSEIGLRHYLEHSYIDVGIPTGEL  164

Query  1672  -SLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EADGAVKL  1499
              S DW++V  + K L+ FY +T++ISGS YVT+N  F EI  +   L +++   D  +  
Sbjct  165   LSSDWDNVKRITKFLEIFYLLTLKISGSRYVTSNIHFLEICAVAVYLKQLIANEDIVLSE  224

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKG  1346
             M  NMK  F KY GD+ KMN +IF + ILDPR K+E +   LV ++G   G
Sbjct  225   MAKNMKENFNKYWGDLGKMNKIIFISCILDPRYKIESVGFALVKIFGVDPG  275


 Score = 93.2 bits (230),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = -3

Query  2142  IANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAHI  1963
             +AN +   L EWG+  +FTVTVDNASSNDV +  L +++   G++ +   +LH+RC+AHI
Sbjct  1     MANGIGRFLCEWGINKIFTVTVDNASSNDVTVKELSKQLTKMGTNLMNGTHLHVRCMAHI  60

Query  1962  LNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKKHPCV  1804
             +NLVVQD LK+  ++++RVR  VRYVR SP++LK+F++  +     SKK  C+
Sbjct  61    MNLVVQDGLKESSVSIERVRHAVRYVRQSPARLKRFQECFDAEQLNSKKTLCL  113



>ref|XP_010906914.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Elaeis guineensis]
Length=687

 Score =   163 bits (412),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 114/333 (34%), Positives = 171/333 (51%), Gaps = 24/333 (7%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +L LDV T+WN+TYLML +AL Y++ F   E  D+++     +  P++ DW+ V 
Sbjct  346   IPSTKTLSLDVTTQWNTTYLMLVAALEYKQAFTVLETCDDNY-----NEAPSTEDWKKVE  400

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
              +   LK  Y+    I  +   TAN FF E   +   L N  +  D  V      M  KF
Sbjct  401   IVCTYLKLLYDSANIIMATADPTANIFFHEAWKIQLELTNATLNEDVLVSSFAKEMHEKF  460

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR KL+ +      +YG    + Y+  +  +++ELY +Y
Sbjct  461   DKYWKDC---SLVLAIAVVMDPRFKLKLVEFSFSKIYGADAVR-YINVVNDSIHELYLEY  516

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVG----RPQHLLKAQIKKQRMELLGGK---  1133
                  P        G V + N+      + +G    RP  L+      Q  +L   +   
Sbjct  517   VAQPLPLTPAYEEQGEVTTSNINGNENGSGIGNDNNRPTTLVSNGDGLQDFDLYLSEMAV  576

Query  1132  ----KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAF  965
                 K ELE YL E++      FDIL WWK+N+ ++P LSK+ARD+LAIP+S V++ S+ 
Sbjct  577   NQPTKSELEQYLEESLVPRIQEFDILNWWKLNNLKYPTLSKLARDVLAIPMSMVSTGSSI  636

Query  964   SISG---RVLDHFRSSLTPKIVEALVCTQDWLR  875
               SG   RVLD +RSSL P+ VEAL C +DWL+
Sbjct  637   FASGTGSRVLDDYRSSLRPETVEALFCAKDWLQ  669


 Score = 46.6 bits (109),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             H    ++ A+   L +W +++ +FT+T+DN  SS+D+    L+  + +  +  +K +   
Sbjct  235   HSENALSEAIGVSLSDWNMKSKLFTITLDNNCSSHDIYSANLRDHLSNKNTLMLKGQLFV  294

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             +RC AHILN+V QD +      +  +RE V+++++SP++ +KF ++A
Sbjct  295   VRCYAHILNVVAQDVIASIHGIIYNIRESVKFIKASPAREEKFAEIA  341


 Score = 33.5 bits (75),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RVS+T   WT+ Q + Y+ +T  FID +W
Sbjct  191   RVSLTIGLWTTSQTLGYVCLTGQFIDSDW  219



>gb|AAX95747.1| hAT family dimerisation domain, putative [Oryza sativa Japonica 
Group]
 gb|AAP52630.2| hAT family dimerisation domain containing protein [Oryza sativa 
Japonica Group]
Length=989

 Score =   157 bits (397),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/329 (34%), Positives = 163/329 (50%), Gaps = 47/329 (14%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             +   + L LDVPTRWNSTY ML+ A+ Y+  F+   + D         S   + +W    
Sbjct  655   LNNNSGLPLDVPTRWNSTYDMLKQAIYYRGAFERLLFLDEDRYQRCASS---AEEWGMAE  711

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKLMGANMKAKF  1472
             +L   L+ F + T+  SG LY TAN F+ +  ++   L E    AD ++  M   M+ K+
Sbjct  712   SLCNCLEKFNDATLLFSGCLYPTANLFWWKFCEIKLALREWCASADVSIASMAVAMQLKY  771

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY    DK N                     L  +Y DK  +++ +++LAA+++ +  Y
Sbjct  772   DKY---WDKSNLA-------------------LAKIYPDKYEEEF-KRVLAAIDKFFRAY  808

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK----IE  1124
                 + S  P     S  S          P G    L   +I+K   +     K     E
Sbjct  809   KSCVARSSKPTAAGSSENS---------QPHGNTS-LGHNEIEKFLYDDAAANKEDDINE  858

Query  1123  LEYYLSEAI------TEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
             L+ Y+ E        T +   FDIL WWK N   FPILS +ARD++A+ ISTVASESAFS
Sbjct  859   LDVYMKEKPIRWVDPTGEGVEFDILAWWKNNQMTFPILSTLARDVMAVQISTVASESAFS  918

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
               GRV+  FRSSL P+++EALVCT+DW+R
Sbjct  919   AGGRVVGPFRSSLHPEMIEALVCTKDWIR  947


 Score = 45.1 bits (105),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 7/82 (9%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSND-----VALGFLKRKVLSWGSSSV-K  1999
             H G  +ANA    ++   + + +F +T+DNASSND     V +   K   +S     +  
Sbjct  539   HTGTRLANAFVKGVMSMNIEKKLFALTLDNASSNDKCAREVVIELNKLFNISKVPPLMCD  598

Query  1998  SKYLHMRCIAHILNLVVQDSLK  1933
               + H+RC+ HILNLV QD LK
Sbjct  599   GAFFHVRCLCHILNLVAQDGLK  620


 Score = 40.8 bits (94),  Expect(3) = 3e-48, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S T D WTS Q   YM +TAH+IDE W
Sbjct  495   RISTTMDMWTSNQNKAYMCITAHWIDENW  523



>ref|NP_001176059.1| Os10g0197200 [Oryza sativa Japonica Group]
 dbj|BAH94787.1| Os10g0197200 [Oryza sativa Japonica Group]
Length=946

 Score =   157 bits (396),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 113/329 (34%), Positives = 163/329 (50%), Gaps = 47/329 (14%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             +   + L LDVPTRWNSTY ML+ A+ Y+  F+   + D         S   + +W    
Sbjct  612   LNNNSGLPLDVPTRWNSTYDMLKQAIYYRGAFERLLFLDEDRYQRCASS---AEEWGMAE  668

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNE-MVEADGAVKLMGANMKAKF  1472
             +L   L+ F + T+  SG LY TAN F+ +  ++   L E    AD ++  M   M+ K+
Sbjct  669   SLCNCLEKFNDATLLFSGCLYPTANLFWWKFCEIKLALREWCASADVSIASMAVAMQLKY  728

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY    DK N                     L  +Y DK  +++ +++LAA+++ +  Y
Sbjct  729   DKY---WDKSNLA-------------------LAKIYPDKYEEEF-KRVLAAIDKFFRAY  765

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK----IE  1124
                 + S  P     S  S          P G    L   +I+K   +     K     E
Sbjct  766   KSCVARSSKPTAAGSSENS---------QPHGNTS-LGHNEIEKFLYDDAAANKEDDINE  815

Query  1123  LEYYLSEAI------TEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
             L+ Y+ E        T +   FDIL WWK N   FPILS +ARD++A+ ISTVASESAFS
Sbjct  816   LDVYMKEKPIRWVDPTGEGVEFDILAWWKNNQMTFPILSTLARDVMAVQISTVASESAFS  875

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
               GRV+  FRSSL P+++EALVCT+DW+R
Sbjct  876   AGGRVVGPFRSSLHPEMIEALVCTKDWIR  904


 Score = 45.1 bits (105),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 7/82 (9%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSND-----VALGFLKRKVLSWGSSSV-K  1999
             H G  +ANA    ++   + + +F +T+DNASSND     V +   K   +S     +  
Sbjct  496   HTGTRLANAFVKGVMSMNIEKKLFALTLDNASSNDKCAREVVIELNKLFNISKVPPLMCD  555

Query  1998  SKYLHMRCIAHILNLVVQDSLK  1933
               + H+RC+ HILNLV QD LK
Sbjct  556   GAFFHVRCLCHILNLVAQDGLK  577


 Score = 40.4 bits (93),  Expect(3) = 4e-48, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S T D WTS Q   YM +TAH+IDE W
Sbjct  452   RISTTMDMWTSNQNKAYMCITAHWIDENW  480



>ref|XP_011082213.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=236

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 139/228 (61%), Gaps = 15/228 (7%)
 Frame = -2

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYL-EKLL  1322
             M   MK KF+KY G I+KMN ++++  ILDPR KL ++      +YG     D + E++ 
Sbjct  1     MARKMKEKFDKYWGSIEKMNMVLYYGVILDPRHKLGFVEFSFDKLYGGIGQNDVMKERVR  60

Query  1321  AALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQR----  1154
               L+EL++DY + Y  ++    G+      +       +   +   +   + + +R    
Sbjct  61    DGLHELFNDYKLRYGYAL---QGTLESPGSSSSHVSSSSSSSKEMFMHDEESETRRFSLQ  117

Query  1153  ----MELLGGK---KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIP  995
                 M + GGK   K ELE YL E + E    FDIL+WWKVN+ RFPILSK+ARDILA+P
Sbjct  118   QEYMMYMTGGKDHVKSELEKYLGEDVEEYREKFDILKWWKVNTQRFPILSKMARDILAVP  177

Query  994   ISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             +STVASE+AFS  G VLD FRSSL+PKIV+A++C QDW+R+ + PISI
Sbjct  178   VSTVASEAAFSTGGHVLDAFRSSLSPKIVQAIICAQDWIRKDSKPISI  225



>ref|XP_006292237.1| hypothetical protein CARUB_v10018444mg, partial [Capsella rubella]
 gb|EOA25135.1| hypothetical protein CARUB_v10018444mg, partial [Capsella rubella]
Length=547

 Score =   146 bits (369),  Expect(3) = 5e-48, Method: Compositional matrix adjust.
 Identities = 102/325 (31%), Positives = 169/325 (52%), Gaps = 39/325 (12%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI+    L +DV TRWNSTYLML S + Y++ F   E ++ ++K       P+  +W   
Sbjct  233   GIKYTAGLKMDVSTRWNSTYLMLGSVIKYRRAFSLLERAERNYKF-----CPSDEEWNKA  287

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EADGAVKLMGANMKAK  1475
               +   L+ FY++T   SG+ Y TAN +F++I  + C+LN    + D  ++ M   M+ K
Sbjct  288   EKIYTFLEPFYDITKLFSGTSYPTANLYFAQIWKIECLLNSYSNDGDMELQNMANEMRTK  347

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY    ++ + ++    ILDPR K+E + T           K  +E +   LN L+D 
Sbjct  348   FDKY---WEEYSIILSIGAILDPRMKVEIL-TYCFDKLDPSTTKAKVEVVKQKLNLLFDQ  403

Query  1294  YAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRME--------LLG  1139
             Y  + + + V ++  G+        +F+     +     KA  K+  +E         L 
Sbjct  404   YKSTPTSTNVSSSSRGT--------DFI----AKTHSDFKAYEKRTILEEGKSKLAVYLE  451

Query  1138  GKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSI  959
               ++E+ +Y      ED    D+L WWK  + R+  L+++A D+L+IPI++VA+ES+FSI
Sbjct  452   DDRLEMTFY------ED---MDVLEWWKNQTQRYGELARMACDVLSIPITSVAAESSFSI  502

Query  958   SGRVLDHFRSSLTPKIVEALVCTQD  884
                VL+ +RS L P+ VEAL   +D
Sbjct  503   GAHVLNKYRSRLLPRHVEALKDLED  527


 Score = 62.0 bits (149),  Expect(3) = 5e-48, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
              H G  +A  + SCL +WG+ + +F++T+DNASSND     L+ ++ S        ++ H
Sbjct  123   PHSGFELAKKVLSCLEDWGIEKKIFSLTLDNASSNDNMQSILRDQLSSRHGLLCDGEFFH  182

Query  1983  MRCIAHILNLVVQDSLK  1933
             +RC AH+LNL+VQ  LK
Sbjct  183   IRCSAHVLNLIVQVGLK  199


 Score = 33.5 bits (75),  Expect(3) = 5e-48, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
              R+ +T D W SI    Y+ +TAH++D+ W
Sbjct  79    NRICLTCDVWRSISIEGYICLTAHYVDDSW  108



>ref|XP_002444199.1| hypothetical protein SORBIDRAFT_07g014880 [Sorghum bicolor]
 gb|EES13694.1| hypothetical protein SORBIDRAFT_07g014880 [Sorghum bicolor]
Length=532

 Score =   157 bits (398),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 109/323 (34%), Positives = 174/323 (54%), Gaps = 22/323 (7%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             G++    + LDV TRWNSTYLML+  L Y+  F   + ++ S    +    P   +W+  
Sbjct  213   GLDTSKGIQLDVSTRWNSTYLMLRDVLHYKPAFLRLKTANRSKYKHIS---PDDDEWKMA  269

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EADGAVKLMGANMKAK  1475
               + + LK FY++T+ + GS Y TAN F+    ++  +L++    +D  ++ M  +M  K
Sbjct  270   VTVSQCLKKFYDLTVLLYGSSYPTANLFYRGFCEIKELLDKWCYSSDFIIREMAKSMSEK  329

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             FEKY       N  +  A  LDPR K + +       YGD   +  L+  L  + +LY  
Sbjct  330   FEKY---WTSSNTALAVACFLDPRYKHKLVEYYFRKFYGD-YFQIKLDHFLDTVKDLYKS  385

Query  1294  YAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK---IE  1124
             YA S   S   +    SV++  LV      P          +++    +  G  K    E
Sbjct  386   YATSKPAS---SKEKASVSANELV-----NPTDHESQ--DDELESFLYDDCGPDKNEVNE  435

Query  1123  LEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVL  944
             L+ Y++E + + +  FDIL +WK N+ ++PIL++IARD++AI +STVASESAFS +GRV+
Sbjct  436   LDKYMAEPLLK-QNPFDILAYWKNNTDKYPILAQIARDMMAIQVSTVASESAFSGAGRVV  494

Query  943   DHFRSSLTPKIVEALVCTQDWLR  875
             D  R+ L P++V+AL+C +DW+ 
Sbjct  495   DPHRNRLDPEMVQALICAKDWIH  517


 Score = 50.1 bits (118),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 3/77 (4%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV--KSKYL  1987
             H G  +A      +++W + + +F +T+DNAS+N VA+  L   +   G++S+     + 
Sbjct  102   HTGHKLAEIFTEVMVKWFVEKKLFALTLDNASNNLVAVTDLIDDLTQNGNASLVCDGMFF  161

Query  1986  HMRCIAHILNLVVQDSL  1936
             H+RC  HILNLV +D L
Sbjct  162   HIRCACHILNLVARDGL  178


 Score = 33.9 bits (76),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R S T D WTS    +YM VT H+ID+ W
Sbjct  58    RFSTTMDIWTSCHNKSYMCVTLHWIDDNW  86



>ref|XP_008790202.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008790203.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
Length=682

 Score =   163 bits (413),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 111/329 (34%), Positives = 167/329 (51%), Gaps = 20/329 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +L LDV T+WN+TYLML +AL Y++ F   E  D+++     +  P++ DW+ V 
Sbjct  345   IPSTKTLSLDVTTQWNTTYLMLVAALEYKQAFTVLETCDDNY-----NEAPSTEDWKKVE  399

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
              +   LK  Y+    I  +   T+N FF E   +   L N  +  D  V      M  KF
Sbjct  400   IVCTYLKLLYDSANVIMATADPTSNIFFHEAWKIQLELTNATLNEDVLVSSFAKEMHEKF  459

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR KL+ +      +YG   G+ Y + +  +++ELY +Y
Sbjct  460   DKYWKDC---SLVLAIAVVMDPRFKLKLVEFSFSKIYGADAGR-YAKVVNDSIHELYLEY  515

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHL-------LKAQIKKQRMELLGGK  1133
                  P        G     N+          RP +L       L   +    M +    
Sbjct  516   VAQPLPLTPAYEEQGEATGNNINGNENGNDNNRPANLVSNGDGLLDFDLYLSEMAVNQPT  575

Query  1132  KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
             K ELE YL E++      FDIL WWK+N+ ++P LSK+ARD+LAIP+S V++ S+   SG
Sbjct  576   KSELEQYLEESLVPRIQEFDILNWWKLNNLKYPTLSKMARDVLAIPMSMVSTGSSIFASG  635

Query  952   ---RVLDHFRSSLTPKIVEALVCTQDWLR  875
                RVLD ++SSL P+ VEAL C +DWL+
Sbjct  636   TGSRVLDEYKSSLRPETVEALFCAKDWLQ  664


 Score = 44.7 bits (104),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             H    ++ A+   L +W +++ +FT+T+DN  SS+D+    L+  + +  +  +K +   
Sbjct  234   HSENALSEAIGVSLSDWSMKSKLFTITLDNNCSSHDIYSANLRDHLSNKNTLMLKGQLFV  293

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             +RC AHILN+V QD +      +  +RE V+++++SP++ + F ++A
Sbjct  294   VRCYAHILNVVAQDVIASIHGIIYNIRESVKFIKASPAREENFAEIA  340


 Score = 33.9 bits (76),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RVS+T   WT+ Q + Y+ +T  FID +W
Sbjct  190   RVSLTIGLWTTSQTLGYVCLTGQFIDSDW  218



>ref|XP_007219124.1| hypothetical protein PRUPE_ppa015847mg, partial [Prunus persica]
 gb|EMJ20323.1| hypothetical protein PRUPE_ppa015847mg, partial [Prunus persica]
Length=458

 Score =   156 bits (395),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 111/318 (35%), Positives = 166/318 (52%), Gaps = 49/318 (15%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             +E KT L  DVPTRWNST+LM+ SAL YQ  F   + SD+++K  L        +W  + 
Sbjct  147   LECKTGLRQDVPTRWNSTFLMIGSALCYQHAFLHLQLSDSNYKHSLSQD-----EWGKLK  201

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
              L K LK FY++T   SG+ Y T N +F ++  +   L N  V++D  +K M   M  KF
Sbjct  202   KLSKFLKVFYDVTCLFSGTKYPTENLYFPQVFMVDDTLRNVKVDSDSFMKSMATEMMEKF  261

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY     + + ++  A ILD R K++++      +YG     + + ++   L  L+D Y
Sbjct  262   DKY---WKEYSLILAIAVILDARYKIQFVEFCYKRLYG--YNSEEMTEVPDMLFSLFDLY  316

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYY  1112
                                 N   E + T                       +K +L+ Y
Sbjct  317   EFD-----------------NFESEEITT---------------------SAQKTQLQLY  338

Query  1111  LSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFR  932
             L E   + +   ++L +WKVN  ++P LS +ARD+L+IPISTVASESAFS+ GRVLD + 
Sbjct  339   LDEPKIDRKTKLNVLDFWKVNQFQYPELSILARDLLSIPISTVASESAFSVGGRVLDQYC  398

Query  931   SSLTPKIVEALVCTQDWL  878
             S+L P+ VEAL+CT+DW+
Sbjct  399   SALKPENVEALICTRDWI  416


 Score = 64.7 bits (156),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             SF+P   H    +   +   LI+WG+ + +F++T+DNASSND  +  LK ++    +  +
Sbjct  45    SFMP-PPHTSVALCEKIYRLLIDWGMEKKLFSMTLDNASSNDTFVELLKGQLNLKDALLM  103

Query  2001  KSKYLHMRCIAHILNLVVQDSLK  1933
               K+ H+RC AHILNL+VQD +K
Sbjct  104   NGKFFHVRCCAHILNLIVQDGIK  126



>ref|XP_009626477.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=310

 Score =   135 bits (340),  Expect(3) = 9e-48, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 107/171 (63%), Gaps = 11/171 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDL-----GDSIP----  1676
             I  + SLCLDVPTRW+STYLML  A  +++ F  Y   D      L      D  P    
Sbjct  137   ITYENSLCLDVPTRWDSTYLMLDVAQEFEEAFVRYGALDPGLMHYLVTYVCDDGKPAGSL  196

Query  1675  TSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA-VKL  1499
              S DWE+V ++VK+LK FYE+T+++SGSLYVT+N  F EI +L  +L  ++E +   + L
Sbjct  197   VSSDWENVRHMVKILKPFYELTLKVSGSLYVTSNVHFEEICELDVVLKNLIENENVEMSL  256

Query  1498  MGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKG  1346
             M   M+ K  KY G+ +KM  MIF A++LDPR+K EY+   LV ++G++KG
Sbjct  257   MAKKMEDKLHKYFGNPEKMK-MIFIASVLDPRNKFEYVAFALVSLFGEEKG  306


 Score = 77.8 bits (190),  Expect(3) = 9e-48, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F P+ SHK + +A  +  CL +WGL  V  VTVDN   +D+ +  L ++ + WG++ + 
Sbjct  23    NFCPITSHKCDDMATVIIKCLRDWGLDKVLAVTVDNL--DDITVEELSKRFIKWGTNIMD  80

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
               +LHMR +AHI+NL+VQ+SL++   +VKRVR+ VRY++ S  + +KF+
Sbjct  81    GNHLHMRYMAHIINLIVQESLEEVGDSVKRVRQAVRYIKQSSKRWRKFK  129


 Score = 28.1 bits (61),  Expect(3) = 9e-48, Method: Compositional matrix adjust.
 Identities = 9/15 (60%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = -1

Query  2240  INYMVVTAHFIDEEW  2196
             +NYM +T HFID++W
Sbjct  1     MNYMCLTTHFIDKDW  15



>ref|XP_010684088.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Beta vulgaris subsp. vulgaris]
Length=661

 Score =   155 bits (393),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 113/333 (34%), Positives = 170/333 (51%), Gaps = 33/333 (10%)
 Frame = -2

Query  1834  YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWES  1655
             + ++ K  L LD+  RWNSTY ML + L Y+ VF        +FK      +PT  +WE 
Sbjct  325   FHLDVKRKLHLDMQIRWNSTYKMLDNVLYYKVVFLHLGSVHVAFKY----IVPTDDEWEK  380

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA----VKLMGAN  1487
             +  + K LK FY++T   S +   T+N +F      + +   +VE        ++ M   
Sbjct  381   LIVVHKFLKLFYDVTCMFSANKSPTSNIYFK---GAWMVHRRLVETSKGPHVFLRDMVKP  437

Query  1486  MKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNE  1307
             M   F+KY  D    N  +  A ILDPR K++++      ++G  +    + ++L  L  
Sbjct  438   MLKNFDKYWSD---YNVYLSCAAILDPRFKVKFVEYCFDKLFGPDEAMVKVGEVLTTLRS  494

Query  1306  LYDDYAV--SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGK  1133
             LYD+Y +  S SP VVP   SG     +L  ++           ++ QI K         
Sbjct  495   LYDEYKLRSSTSPIVVPTPTSG--IDDDLFDDYH----SYSSRSIRTQITKS--------  540

Query  1132  KIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG  953
               +L+ YL +   +     +IL +W+ N  RFP L+ +ARD+L IP+STVASESAFS+SG
Sbjct  541   --QLDSYLEDPERDLNSEMNILEFWQQNVVRFPDLASLARDLLTIPVSTVASESAFSLSG  598

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLR-RPNTPI  857
             +++   RSSL PK V+ALVC QDW R   N P+
Sbjct  599   KIISPNRSSLKPKTVQALVCIQDWRRDEHNVPL  631


 Score = 57.4 bits (137),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
              + GE I+  +   L  W + + V +VTVDNAS ND  +  L+ ++++ G       + H
Sbjct  215   PYDGESISEEIYMFLNHWRIDDKVLSVTVDNASYNDAMITHLRSRLVARGVLRHGGCFFH  274

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAEYSMELSKK  1816
             +RC AHI+NL+VQ  L      +  VR +V+ +  S S+ K F D+A+ +  L  K
Sbjct  275   IRCCAHIINLIVQSGLGLIQSILDSVRNLVKMITRSSSRSKDFYDVAQKNFHLDVK  330


 Score = 28.1 bits (61),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 19/29 (66%), Gaps = 1/29 (3%)
 Frame = -1

Query  2279  VSITTDSWTSIQR-INYMVVTAHFIDEEW  2196
             + +TTD+W S     +Y+ +T HF+D +W
Sbjct  172   ICLTTDNWKSSHTWQHYICITVHFVDNDW  200



>ref|XP_009379897.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009379898.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009379899.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=678

 Score =   163 bits (413),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 173/325 (53%), Gaps = 16/325 (5%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI    +L LDV T WN+TYLM+++AL Y++ F   E  D+++     +  P++ DW+ V
Sbjct  346   GIPGTKALSLDVTTLWNTTYLMMEAALEYKEAFTFLETCDDNY-----NEAPSADDWKKV  400

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAK  1475
               +   LK  Y+    I  ++  TAN FF E   +   L N  +  D  V  +   M  K
Sbjct  401   EVVCTFLKLLYDSAHTIMTTIDQTANVFFQEAWKVQLELANGTLSEDTMVSSIAKEMHEK  460

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY  D    + ++  + ++DPR K++ +      +YG+   + +++ +  +++ELY +
Sbjct  461   FDKYWKDC---SLVLAISVVMDPRFKMKLVEFSFAKIYGEDSAR-FIKVVNDSIHELYLE  516

Query  1294  YAVSYSPSVVPA-TGSGSVASVNLVVEFV-FTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
             Y VS    ++PA    G    +N        TP      LL   +    M +    K EL
Sbjct  517   Y-VSQPLQLMPAYVDEGEANHMNGNDNNPPATPNSTGDGLLDFDVYLSEMAVNQSTKSEL  575

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---R  950
             + YL E++      FDIL WWK+N+ ++P LSK+ARD+LAIP+S V +  +   SG   R
Sbjct  576   DQYLEESLVPRIQGFDILNWWKLNNLKYPTLSKMARDVLAIPVSMVGTGCSIFGSGTGSR  635

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR  875
             VLD +RSSL P+ VEAL C +DWL+
Sbjct  636   VLDDYRSSLRPETVEALFCAKDWLQ  660


 Score = 45.8 bits (107),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             H    ++ A+   L EW ++  +FT+T+DN  SS+D+    L+  + +  +  +K +   
Sbjct  236   HSENALSEAISVSLSEWNMKTKLFTITLDNNCSSHDIYSANLRDHLSNKNTLMLKGQLFV  295

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             +RC A+ILN+V QD +      V  +RE V++V++SP++ +KF ++A
Sbjct  296   VRCYANILNVVAQDVIASIHGIVYNIRESVKFVKASPAREEKFAEIA  342


 Score = 31.6 bits (70),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ V+  +ID +W
Sbjct  192   RISLTIGLWTTSQTLGYICVSGQYIDSDW  220



>ref|XP_009379895.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009379896.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=685

 Score =   163 bits (413),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 173/325 (53%), Gaps = 16/325 (5%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI    +L LDV T WN+TYLM+++AL Y++ F   E  D+++     +  P++ DW+ V
Sbjct  353   GIPGTKALSLDVTTLWNTTYLMMEAALEYKEAFTFLETCDDNY-----NEAPSADDWKKV  407

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAK  1475
               +   LK  Y+    I  ++  TAN FF E   +   L N  +  D  V  +   M  K
Sbjct  408   EVVCTFLKLLYDSAHTIMTTIDQTANVFFQEAWKVQLELANGTLSEDTMVSSIAKEMHEK  467

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY  D    + ++  + ++DPR K++ +      +YG+   + +++ +  +++ELY +
Sbjct  468   FDKYWKDC---SLVLAISVVMDPRFKMKLVEFSFAKIYGEDSAR-FIKVVNDSIHELYLE  523

Query  1294  YAVSYSPSVVPA-TGSGSVASVNLVVEFV-FTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
             Y VS    ++PA    G    +N        TP      LL   +    M +    K EL
Sbjct  524   Y-VSQPLQLMPAYVDEGEANHMNGNDNNPPATPNSTGDGLLDFDVYLSEMAVNQSTKSEL  582

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---R  950
             + YL E++      FDIL WWK+N+ ++P LSK+ARD+LAIP+S V +  +   SG   R
Sbjct  583   DQYLEESLVPRIQGFDILNWWKLNNLKYPTLSKMARDVLAIPVSMVGTGCSIFGSGTGSR  642

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR  875
             VLD +RSSL P+ VEAL C +DWL+
Sbjct  643   VLDDYRSSLRPETVEALFCAKDWLQ  667


 Score = 45.8 bits (107),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             H    ++ A+   L EW ++  +FT+T+DN  SS+D+    L+  + +  +  +K +   
Sbjct  243   HSENALSEAISVSLSEWNMKTKLFTITLDNNCSSHDIYSANLRDHLSNKNTLMLKGQLFV  302

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             +RC A+ILN+V QD +      V  +RE V++V++SP++ +KF ++A
Sbjct  303   VRCYANILNVVAQDVIASIHGIVYNIRESVKFVKASPAREEKFAEIA  349


 Score = 31.6 bits (70),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ V+  +ID +W
Sbjct  199   RISLTIGLWTTSQTLGYICVSGQYIDSDW  227



>ref|XP_010917997.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Elaeis guineensis]
Length=685

 Score =   144 bits (362),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/329 (33%), Positives = 160/329 (49%), Gaps = 51/329 (16%)
 Frame = -2

Query  1828  IEQKT----SLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDW  1661
             +EQK      L +D PTRWNST+ +L SAL ++  F  Y+  +  +     D  P+  DW
Sbjct  376   VEQKRLKERKLIIDCPTRWNSTFEILSSALKFKIAFSAYKEREPHY-----DYAPSPEDW  430

Query  1660  ESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EADGAVKLMGANM  1484
             E V  + +LL+ F   T  IS S Y TAN + +E+  +  +++    + D  +K M   M
Sbjct  431   EKVEKVYQLLEVFSLATHIISSSEYPTANLYLAEVYRVKEVIDAAARDWDFFIKEMAKPM  490

Query  1483  KAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNEL  1304
             K KF+KY G  +                              + + +  + K+  AL  L
Sbjct  491   KEKFDKYWGKCN------------------------------ETEAEKNVNKVHTALQVL  520

Query  1303  YDDYA--VSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKK  1130
             YD+Y       PS       GS +    V +  FT       ++    +K+ +  L   K
Sbjct  521   YDEYVNLSREKPSSCEVNTDGSNSLSTAVSKSSFTT--EFDQIMSIVHEKEAVPPL---K  575

Query  1129  IELEYYLSEAI----TEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFS  962
              ELE YL E +    +    SF  L WW+ NS ++ ILSK+A DILAIPISTVA ES FS
Sbjct  576   SELESYLEEGVYISDSSSNSSFSALEWWRNNSLKYKILSKMAADILAIPISTVALESTFS  635

Query  961   ISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
               GR++D +R+ L  + VEAL+C +DWLR
Sbjct  636   AGGRIIDEYRAKLNEESVEALICGEDWLR  664


 Score = 60.5 bits (145),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 64/112 (57%), Gaps = 2/112 (2%)
 Frame = -3

Query  2172  VPVKSHKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSVKS  1996
             VP    +G  +A+A+ +CL  W + N VF V VDNAS ND  +  LK  +       +  
Sbjct  267   VPA-PRRGVDVADAIFTCLKAWRIENKVFLVFVDNASYNDSCIRNLKENLSLCNKLVLDG  325

Query  1995  KYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +  H+RC AHILNL+VQD L +    +  +RE V+Y+  S S+LK F D+ E
Sbjct  326   ELFHVRCCAHILNLLVQDGLGKIKNVIHNIRESVKYINHSDSRLKAFCDVVE  377


 Score = 36.6 bits (83),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 1/30 (3%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRI-NYMVVTAHFIDEEW  2196
             ++SITTD W S  ++  YMV+T HFID  W
Sbjct  226   KISITTDMWKSSHQVAEYMVITGHFIDGGW  255



>ref|XP_009379900.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X3 [Musa acuminata subsp. malaccensis]
Length=648

 Score =   163 bits (412),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 173/325 (53%), Gaps = 16/325 (5%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI    +L LDV T WN+TYLM+++AL Y++ F   E  D+++     +  P++ DW+ V
Sbjct  316   GIPGTKALSLDVTTLWNTTYLMMEAALEYKEAFTFLETCDDNY-----NEAPSADDWKKV  370

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAK  1475
               +   LK  Y+    I  ++  TAN FF E   +   L N  +  D  V  +   M  K
Sbjct  371   EVVCTFLKLLYDSAHTIMTTIDQTANVFFQEAWKVQLELANGTLSEDTMVSSIAKEMHEK  430

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY  D    + ++  + ++DPR K++ +      +YG+   + +++ +  +++ELY +
Sbjct  431   FDKYWKDC---SLVLAISVVMDPRFKMKLVEFSFAKIYGEDSAR-FIKVVNDSIHELYLE  486

Query  1294  YAVSYSPSVVPA-TGSGSVASVNLVVEFV-FTPVGRPQHLLKAQIKKQRMELLGGKKIEL  1121
             Y VS    ++PA    G    +N        TP      LL   +    M +    K EL
Sbjct  487   Y-VSQPLQLMPAYVDEGEANHMNGNDNNPPATPNSTGDGLLDFDVYLSEMAVNQSTKSEL  545

Query  1120  EYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---R  950
             + YL E++      FDIL WWK+N+ ++P LSK+ARD+LAIP+S V +  +   SG   R
Sbjct  546   DQYLEESLVPRIQGFDILNWWKLNNLKYPTLSKMARDVLAIPVSMVGTGCSIFGSGTGSR  605

Query  949   VLDHFRSSLTPKIVEALVCTQDWLR  875
             VLD +RSSL P+ VEAL C +DWL+
Sbjct  606   VLDDYRSSLRPETVEALFCAKDWLQ  630


 Score = 45.8 bits (107),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             H    ++ A+   L EW ++  +FT+T+DN  SS+D+    L+  + +  +  +K +   
Sbjct  206   HSENALSEAISVSLSEWNMKTKLFTITLDNNCSSHDIYSANLRDHLSNKNTLMLKGQLFV  265

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             +RC A+ILN+V QD +      V  +RE V++V++SP++ +KF ++A
Sbjct  266   VRCYANILNVVAQDVIASIHGIVYNIRESVKFVKASPAREEKFAEIA  312


 Score = 31.6 bits (70),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ V+  +ID +W
Sbjct  162   RISLTIGLWTTSQTLGYICVSGQYIDSDW  190



>ref|XP_009621852.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=314

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 119/321 (37%), Positives = 173/321 (54%), Gaps = 33/321 (10%)
 Frame = -2

Query  1816  TSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIP---------TSLD  1664
             TSLCLD+ +RWNSTYLML  A  ++  F  Y    +     L   +           S D
Sbjct  12    TSLCLDILSRWNSTYLMLNVAKEFKHEFASYGALAHRLLHYLLTHVCEDEKSICSLVSSD  71

Query  1663  WESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGA-VKLMGAN  1487
             WESV    + L+  + + ++ISGSL+VT+N  F EI +L+  L  ++  D   +  M   
Sbjct  72    WESV----RFLETVFVLILKISGSLFVTSNIHFVEICELHYNLKSLIAEDNVDLSSMAGK  127

Query  1486  MKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNE  1307
             MK K +KY G  +KMN MIF A IL+PR + EY+   LV M+ ++  K  + ++ + +  
Sbjct  128   MKEKIDKYWGTPEKMNNMIFIAYILNPRHEFEYVTYALVSMFREETEKYIVGEVKSYMTS  187

Query  1306  LYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGK-K  1130
             L++D +   S +    T S ++ +                     Q K+ + E      K
Sbjct  188   LFNDSSEM-SSASSHGTQSKTLKAT-----------------FSQQNKRHKAENENSNAK  229

Query  1129  IELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGR  950
             IELE YL E   +    FD L WWKVN  RF I+++IARD+LAI +S+V  ESAFS  G 
Sbjct  230   IELEKYLDEECDDGGDGFDNLLWWKVNKPRFSIVAEIARDVLAIHLSSVVLESAFSTGGC  289

Query  949   VLDHFRSSLTPKIVEALVCTQ  887
             +LD F+SSLTPK+V+ALV ++
Sbjct  290   ILDCFKSSLTPKLVQALVLSR  310



>gb|AGH20188.1| transposase [Amaranthus palmeri]
Length=652

 Score =   141 bits (355),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/321 (33%), Positives = 154/321 (48%), Gaps = 91/321 (28%)
 Frame = -2

Query  1828  IEQKTSL--CLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWES  1655
             IE+ +SL   LD+ TRWNSTYLML+ AL Y+         D +FK        T  +WES
Sbjct  368   IEKPSSLKLWLDIVTRWNSTYLMLKRALHYR--------PDYTFKL-------TDREWES  412

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEADGAVKLMGANMKAK  1475
             V N+  +L+ FYEMT   SGS Y TAN +F +                           K
Sbjct  413   VENMASILEPFYEMTNLFSGSDYPTANLYFEQ---------------------------K  445

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMY-GDKKGKDYLEKLLAALNELYD  1298
              EKY G+    + ++  A + DPR K+ Y+      +Y  + +    +E++   L  L++
Sbjct  446   LEKYWGE---SSLILSIAAVFDPRHKIPYLKHHFRKVYQSEDEVYQQIERVRTGLVNLFN  502

Query  1297  DYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELE  1118
             DY      +   A  S ++ S                                    E+E
Sbjct  503   DY------NSQEARFSSNIIS------------------------------------EVE  520

Query  1117  YYLSEAI-TEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLD  941
              YL   +    +  FDIL +WK   A +PI+SKIA+DILAIPI+TVASES FS+ GR+L+
Sbjct  521   KYLESPLHMHGDSKFDILLYWKDQQATYPIMSKIAKDILAIPITTVASESTFSMGGRILN  580

Query  940   HFRSSLTPKIVEALVCTQDWL  878
              +R+SL  + VEAL+ T++WL
Sbjct  581   RWRASLLSRHVEALILTRNWL  601


 Score = 62.8 bits (151),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 64/111 (58%), Gaps = 3/111 (3%)
 Frame = -3

Query  2175  FVPVKSHKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             F P  +  G  I   + + + +WGL + V  +TVDNA++ND  +  L+  +    S    
Sbjct  256   FPPPST--GHAIYELVYAMIKDWGLESKVMCMTVDNATNNDSMIPLLQECLNGHSSFPCD  313

Query  1998  SKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDL  1846
               + H+RC AHILNL+V+D LK  D  V  VR+ V+Y+ SS +++ +FRD 
Sbjct  314   GAHFHIRCAAHILNLIVKDGLKAIDPAVTLVRDNVKYIDSSEARMNRFRDF  364


 Score = 35.8 bits (81),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             +VS+T D WT+     Y+ +TAH+ID++W
Sbjct  216   KVSLTCDIWTACTSRGYLTLTAHYIDKDW  244



>ref|XP_010485286.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
 ref|XP_010489984.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
Length=795

 Score =   142 bits (358),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 109/336 (32%), Positives = 172/336 (51%), Gaps = 44/336 (13%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD-NSFKSDLGDSIPTSLDWES  1655
             G++ K  L +DV TRWNSTY ML  AL Y+  F + +  D  ++K       PT  +W  
Sbjct  452   GLQLKAGLIMDVKTRWNSTYKMLDRALKYRAAFGNLKVIDGRNYKFH-----PTEAEWHR  506

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLY-CILNEMVEADGAVKLMGANMKA  1478
             +  + + L+ F E+T  ISGS Y T+N +F ++  +   +++     D  ++ M   M+ 
Sbjct  507   LKQICEFLEPFDEITNLISGSTYPTSNLYFMQVWKINNWLISNSQNQDEVIRSMIVPMRE  566

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYG-DKKGK-----DYLEKLLAA  1316
             +F+KY  ++  +  M     + DPR KL    T + + +G + KG       +L   LA 
Sbjct  567   RFDKYWEEVSDVFAM---TTVFDPRLKL----TLVNYCFGKNDKGSAEIKIKHLRGKLAT  619

Query  1315  LNELYDDYAVSYSPSVVPAT-------GSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQ  1157
             L E Y++ ++  S S              G   S     +F+               +KQ
Sbjct  620   LFESYENKSIFTSSSTETRETNHQTDENEGKKGSFGNYDDFI-------------NFRKQ  666

Query  1156  RMELLGGKKIELEYYLSEAITE--DEGSFDILRWWKVNSARFPILSKIARDILAIPISTV  983
              +   G  K  LE YL +   +  +  S DIL++WK NS R+  L+ +A D+L+IPI+TV
Sbjct  667   TVVTSG--KSSLEMYLDDPPIDMIEYESLDILKYWKDNSQRYGELASMACDLLSIPITTV  724

Query  982   ASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             ASES+FSI  RVL+ +RS L PK V+AL+C ++WL+
Sbjct  725   ASESSFSIGARVLNKYRSRLLPKNVQALICCRNWLK  760


 Score = 58.9 bits (141),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             +F P   H G  IA  +     +WG+ + VF++T+DNA++ND +   LK +++       
Sbjct  338   AFPP--PHSGMNIAMEILEKWKDWGIEKKVFSITLDNATNNDTSQDILKSQLMLRNDLLC  395

Query  2001  KSKYLHMRCIAHILNLVVQDSLK  1933
               +Y H+RC AHILN++VQ  LK
Sbjct  396   GGEYFHVRCAAHILNIIVQIGLK  418


 Score = 38.1 bits (87),  Expect(3) = 4e-47, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S T+D WT+I    YM +TAH++D  W
Sbjct  299   RISFTSDLWTAITHEGYMCLTAHYVDRNW  327



>ref|XP_006386801.1| hypothetical protein POPTR_0002s22070g [Populus trichocarpa]
 gb|ERP64598.1| hypothetical protein POPTR_0002s22070g [Populus trichocarpa]
Length=478

 Score =   137 bits (346),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 104/308 (34%), Positives = 161/308 (52%), Gaps = 55/308 (18%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVF---DDYEYSDNSF---------KSDLGD  1685
             IE K SLCLD+ TRWNSTYLML+    ++KVF    + EY   S+         K ++G 
Sbjct  203   IECKKSLCLDIATRWNSTYLMLEVTEKFEKVFVRLGESEYRYMSYFLEVDSKGNKKNIG-  261

Query  1684  SIPTSL-DWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DG  1511
               P SL DWE+   L+K LK FY +T+R SGSL+ T+N+FF ++  ++  L ++ ++ D 
Sbjct  262   --PPSLEDWENARTLLKFLKIFYMVTLRFSGSLHFTSNSFFKKLIYMHTNLLQLCKSRDD  319

Query  1510  AVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLE  1331
              +  M  NM             + ++++ AN+LDPR +L+Y+      +Y   K +   +
Sbjct  320   ILSGMTMNM-------------IIFLLYVANVLDPRFQLKYVKFYFGELYDYDKAQLLTQ  366

Query  1330  KLLAALNELYDDYAV--------SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLK  1175
             K+   L  LY+ Y          S+   V  A     V  VN + +F        +HL  
Sbjct  367   KVKDNLVSLYEFYLKADEVMDDNSHKQDVNDAIDDIEV-DVNTLAQF-------KRHLQG  418

Query  1174  AQIKKQRMELLGGKKIELEYYLSEAITE-DEGSFDILRWWKVNSARFPILSKIARDILAI  998
                 K R ++        E YL +   + ++   DI+ WWK+N++++ ILSK+A+ +LAI
Sbjct  419   EDSVKNRNDV--------ERYLVDGCEDPNDDKLDIVGWWKINASKYKILSKVAQHVLAI  470

Query  997   PISTVASE  974
             PISTVASE
Sbjct  471   PISTVASE  478


 Score = 80.9 bits (198),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             +F  V +H  E I   +E+CL++WG+  + TVTVDNASSN V + +LK  +  W ++ + 
Sbjct  100   NFCQVSNHMSETIGYVIENCLLDWGIDKLLTVTVDNASSNSVTISYLKNVMKDWPTNILS  159

Query  1998  SKYLHMRCIAHILNLVV  1948
             +K+LH+RC AHI+NL+V
Sbjct  160   NKHLHVRCCAHIVNLIV  176



>ref|XP_010430867.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
Length=880

 Score =   142 bits (359),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 109/337 (32%), Positives = 169/337 (50%), Gaps = 46/337 (14%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD-NSFKSDLGDSIPTSLDWES  1655
             G++ K  L +DV TRWNSTY ML  AL Y+  F + +  D  ++K       PT  +W  
Sbjct  542   GLQLKAGLIMDVKTRWNSTYKMLDRALKYRAAFGNLKVIDGRNYKFH-----PTEAEWHR  596

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLY-CILNEMVEADGAVKLMGANMKA  1478
             +  + + L+ F E+T  ISGS Y T+N +F ++  +   +++     D  ++ M   M+ 
Sbjct  597   LKQICEFLEPFDEITNLISGSTYPTSNLYFMQVWKINNWLISNSQNQDEVIRSMIVPMRE  656

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGK-------DYLEKLLA  1319
             +F KY  ++  +  M     + DPR KL      LV+   +K  K        +L   LA
Sbjct  657   RFNKYWEEVSDVFAM---TTVFDPRLKL-----TLVNYCFEKNDKGSAEIKIKHLRGKLA  708

Query  1318  ALNELYDDYAVSYSPSVVPAT-------GSGSVASVNLVVEFVFTPVGRPQHLLKAQIKK  1160
              L E Y++ ++  S S              G   S     +F+               +K
Sbjct  709   TLFESYENKSIFTSSSTETRETNHQTDENEGKKGSFGNYDDFI-------------NFRK  755

Query  1159  QRMELLGGKKIELEYYLSEAITE--DEGSFDILRWWKVNSARFPILSKIARDILAIPIST  986
             Q +   G  K  LE YL +   +  +  S DIL++WK NS R+  L+ +A D+L+IPI+T
Sbjct  756   QTVVTSG--KSSLEMYLDDPAIDMIEYESLDILKYWKDNSQRYGELASMACDLLSIPITT  813

Query  985   VASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             VASES+FSI  RVL+ +RS L PK V+AL+C ++WL+
Sbjct  814   VASESSFSIGARVLNKYRSRLLPKNVQALICCRNWLK  850


 Score = 58.5 bits (140),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             +F P   H G  IA  +     +WG+ + VF++T+DNA++ND +   LK +++       
Sbjct  428   AFPP--PHSGMNIAMEILEKWKDWGIEKKVFSITLDNATNNDTSQDILKSQLMLRNDLLC  485

Query  2001  KSKYLHMRCIAHILNLVVQDSLK  1933
               +Y H+RC AHILN++VQ  LK
Sbjct  486   GGEYFHVRCAAHILNIIVQIDLK  508


 Score = 38.1 bits (87),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S T+D WT+I    YM +TAH++D  W
Sbjct  389   RISFTSDLWTAITHEGYMCLTAHYVDRNW  417



>ref|XP_010431303.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
Length=757

 Score =   142 bits (357),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/330 (32%), Positives = 172/330 (52%), Gaps = 32/330 (10%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD-NSFKSDLGDSIPTSLDWES  1655
             G++ K  L +DV TRWNSTY ML  AL Y+  F + +  D  ++K       PT  +W  
Sbjct  419   GLQLKAGLIMDVKTRWNSTYKMLDRALKYRAAFGNLKVIDGRNYKFH-----PTEAEWHR  473

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLY-CILNEMVEADGAVKLMGANMKA  1478
             +  + + L+ F E+T  ISGS Y T+N +F ++  +   +++     D  ++ M   M+ 
Sbjct  474   LKQICEFLEPFDEITNLISGSTYPTSNLYFMQVWKINNWLISNSQNQDEVIRSMIVPMRE  533

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGK-------DYLEKLLA  1319
             +F+KY  ++  +  M     + DPR KL      LV+   +K  K        +L   LA
Sbjct  534   RFDKYWEEVSDVFAM---TTVFDPRLKL-----TLVNYCFEKTDKGSAEIKIKHLRGKLA  585

Query  1318  ALNELYDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLG  1139
              L E Y++ ++ ++ S      +      N   +  F   G     +    +KQ   ++ 
Sbjct  586   TLFESYENKSI-FTSSSTETRETNHQTDENEGKKRSF---GNYDDFI--NFRKQ--TVIT  637

Query  1138  GKKIELEYYLSEAITE--DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAF  965
               K  LE YL +   +  +  S DIL++WK NS R+  L+ +A D+L+IPI+TVASES+F
Sbjct  638   SGKCSLEMYLDDPPIDMIEYESLDILKYWKDNSQRYGELASMACDLLSIPITTVASESSF  697

Query  964   SISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             SI  RVL+ +RS L PK V+AL+C ++WL+
Sbjct  698   SIGARVLNKYRSRLLPKNVQALICCRNWLK  727


 Score = 58.9 bits (141),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             +F P   H G  IA  +     +WG+ + VF++T+DNA++ND +   LK +++       
Sbjct  305   AFPP--PHSGMNIAMEILEKWKDWGIEKKVFSITLDNATNNDTSQDILKSQLMLRNDLLC  362

Query  2001  KSKYLHMRCIAHILNLVVQDSLK  1933
               +Y H+RC AHILN++VQ  LK
Sbjct  363   GGEYFHVRCAAHILNIIVQIDLK  385


 Score = 37.7 bits (86),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S T+D WT+I    YM +TAH++D  W
Sbjct  266   RISFTSDLWTAITHEGYMCLTAHYVDRNW  294



>ref|XP_010424150.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
Length=773

 Score =   142 bits (359),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 109/336 (32%), Positives = 172/336 (51%), Gaps = 44/336 (13%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD-NSFKSDLGDSIPTSLDWES  1655
             G++ K  L +DV TRWNSTY ML  AL Y+  F + +  D  ++K       PT  +W  
Sbjct  430   GLQLKAGLIMDVKTRWNSTYKMLDRALKYRAAFGNLKVIDGRNYKFH-----PTEAEWHR  484

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLY-CILNEMVEADGAVKLMGANMKA  1478
             +  + + L+ F E+T  ISGS Y T+N +F ++  +   +++     D  ++ M   M+ 
Sbjct  485   LKQICEFLEPFDEITNLISGSTYPTSNLYFMQVWKINNWLISNSQNQDEVIRSMIVPMRE  544

Query  1477  KFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYG-DKKGK-----DYLEKLLAA  1316
             +F+KY  ++  +  M     + DPR KL    T + + +G + KG       +L   LA 
Sbjct  545   RFDKYWEEVSDVFAM---TTVFDPRLKL----TLVNYCFGKNDKGSAEIKIKHLRGKLAT  597

Query  1315  LNELYDDYAVSYSPSVVPAT-------GSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQ  1157
             L E Y++ ++  S S              G   S     +F+               +KQ
Sbjct  598   LFESYENKSIFTSSSTETRETNHQTDENEGKKGSFGNYDDFI-------------NFRKQ  644

Query  1156  RMELLGGKKIELEYYLSEAITE--DEGSFDILRWWKVNSARFPILSKIARDILAIPISTV  983
              +   G  K  LE YL +   +  +  S DIL++WK NS R+  L+ +A D+L+IPI+TV
Sbjct  645   TVVTSG--KSSLEMYLDDPPIDMIEYESLDILKYWKDNSQRYGELASMACDLLSIPITTV  702

Query  982   ASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             ASES+FSI  RVL+ +RS L PK V+AL+C ++WL+
Sbjct  703   ASESSFSIGARVLNKYRSRLLPKNVQALICCRNWLK  738


 Score = 57.0 bits (136),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             +F P   H G  I   +     +WG+ + VF++T+DNA++ND +   LK +++       
Sbjct  316   AFPP--PHSGMNITMEILEKWKDWGIEKKVFSITLDNATNNDTSQDILKSQLMLRNDLLC  373

Query  2001  KSKYLHMRCIAHILNLVVQDSLK  1933
               +Y H+RC AHILN++VQ  LK
Sbjct  374   GGEYFHVRCAAHILNIIVQIDLK  396


 Score = 38.1 bits (87),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S T+D WT+I    YM +TAH++D  W
Sbjct  277   RISFTSDLWTAITHEGYMCLTAHYVDRNW  305



>ref|XP_010490052.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Camelina sativa]
Length=680

 Score =   186 bits (472),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 130/370 (35%), Positives = 191/370 (52%), Gaps = 63/370 (17%)
 Frame = -2

Query  1843  RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQ----------KVFDDYEYSDNSFKSD  1694
             RV  G   + SLCLDV TRWNSTYLML +A+ ++          K+++DY          
Sbjct  291   RVDTGNVGRGSLCLDVATRWNSTYLMLTAAIKFRVAFEKMLTEDKLYNDYFMETEENGET  350

Query  1693  LGDSI----------PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDL-  1547
              GD            PT  DW+ V  LVK LK F+  T+  S +  VT+   ++EI  + 
Sbjct  351   TGDEAELNGQKRVGPPTFADWDQVQRLVKFLKIFFNCTLSFSATKSVTSTFCYNEIVTIE  410

Query  1546  YCILNEMVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVH  1367
               ++N     D  +K     M++KFEKY   +  MN ++  A++ DPR+K+++       
Sbjct  411   RNLINLSTNGDVLLKTEAMMMRSKFEKYCDGLLNMNPLVIIASVFDPRNKMQFAGLCFDK  470

Query  1366  MYGDKKGKDYLEK------LLAALNELYDDYA--VSYSPSVVPAT---GSGSVASVNLVV  1220
             +Y     KD +E       +   + +LY +Y   +S S S VP T   G+  V S N + 
Sbjct  471   LYR----KDSVESTHLRSSIKGVMKKLYAEYVMKLSLSESGVPTTAGVGTDLVVSANDLF  526

Query  1219  EFVFTPVGRPQHLLKAQIKKQRMELLGGKKI----------ELEYYLSEAITEDEGS---  1079
             +            L  +   +RM+ L  + +          EL+ YL E       S   
Sbjct  527   D------------LSDEDGYERMDTLYSEMVAEITNEECSSELDIYLLEKPVPRTPSALG  574

Query  1078  --FDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVE  905
               FD+L WW  NS++FP+LS++ARDILA+ +S+VASESAFS SGR+LD +RSS++P +VE
Sbjct  575   LDFDVLSWWGRNSSKFPVLSELARDILAVQVSSVASESAFSTSGRILDPYRSSMSPFMVE  634

Query  904   ALVCTQDWLR  875
             +LVCTQ WLR
Sbjct  635   SLVCTQQWLR  644


 Score = 60.5 bits (145),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVK  1999
             SF PV  HKG+ IA  L +CL EWG+  VFTVTVDNA  ND AL      ++  G  ++ 
Sbjct  199   SFKPVTYHKGDTIAEHLVACLEEWGIEKVFTVTVDNAKGNDKALRVFTDALIMRGPDALV  258

Query  1998  S  1996
             S
Sbjct  259   S  259


 Score = 34.7 bits (78),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
             QRVS+ TD W +     +YMVVTAH+ID +W
Sbjct  161   QRVSMPTDIWVAPTTSCSYMVVTAHWIDRDW  191



>ref|XP_008776870.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008776871.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008776872.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008776873.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
Length=679

 Score =   162 bits (410),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 170/326 (52%), Gaps = 18/326 (6%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +L LDV T+WN+TYL+L +AL Y++ F   E  D+++     +  P++ DW+ V 
Sbjct  346   IPSTKTLSLDVTTQWNTTYLLLVAALEYKQAFTVLETCDDNY-----NEAPSTEDWKKVE  400

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
              +   LK  Y+    I  +   TAN FF E   +   L    +  D  V  +   M  KF
Sbjct  401   IVCTYLKLLYDSANVIMATADPTANIFFHEAWKIQLELATATMNEDVLVSSIAKEMHEKF  460

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR K++ +      +YG    + Y++ +  +++ELY +Y
Sbjct  461   DKYWKDC---SLVLAIAVVMDPRFKMKLVEFSFSKIYGADAAR-YVKVVDDSIHELYLEY  516

Query  1291  AVSYSPSVVPATGSGSVASVNLVVE----FVFTPVGRPQHLLKAQIKKQRMELLGGKKIE  1124
                  P + PA      A+ N +         TP      LL   +    M +    K E
Sbjct  517   VAQPLP-LTPAYEEQGEATTNNINGNDSCRPATPASTGDGLLDFDLYLSEMAVNQPTKSE  575

Query  1123  LEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---  953
             L+ YL E++      FDIL WWK+N+ ++P LSK+ARDILAIP+S V++ S+   SG   
Sbjct  576   LDQYLEESLVPRIQEFDILNWWKLNNLKYPTLSKMARDILAIPMSMVSTGSSIFASGTGS  635

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLR  875
             RVLD +RSSL P+ VEAL C +DWL+
Sbjct  636   RVLDEYRSSLRPETVEALFCAKDWLQ  661


 Score = 40.8 bits (94),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             H    ++  +   L +W +++ +FT+T+DN  SS+D+    L+  + +  +  +K +   
Sbjct  235   HSENALSEVIGVSLSDWNMKSKLFTITLDNNCSSHDIYSANLRDHLSNKNTLMLKGQLFV  294

Query  1983  MRCIAHILNLVVQD  1942
             +RC AHILN+V QD
Sbjct  295   VRCYAHILNVVAQD  308


 Score = 33.5 bits (75),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RVS+T   WT+ Q + Y+ +T  FID +W
Sbjct  191   RVSLTIGLWTTSQTLGYVCLTGQFIDSDW  219



>ref|XP_010906913.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Elaeis guineensis]
Length=687

 Score =   159 bits (402),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/334 (34%), Positives = 172/334 (51%), Gaps = 26/334 (8%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I    +L LDV T+WN+TYLML +AL Y++     E  D+++     +  P++ DW+ V+
Sbjct  346   IPSTKTLSLDVTTQWNTTYLMLVAALEYKQALTVLETCDDNY-----NEAPSTEDWKKVD  400

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAKF  1472
              +   LK  Y+    I  +   TAN FF E   +   L N  +  D  V      M  KF
Sbjct  401   IVCTYLKLLYDSANVIMATADPTANIFFHEAWKIQLELTNATLNEDVLVSSFAKEMHEKF  460

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY  D    + ++  A ++DPR KL+ +      +YG++  + Y++ +  +++ELY +Y
Sbjct  461   DKYWKDC---SLVLAIAVVMDPRFKLKLVEFSFSKIYGEEAVR-YIKVVNDSIHELYLEY  516

Query  1291  AVSYSPSVVPATGSGSVASVNLVV------------EFVFTPVGRPQHLLKAQIKKQRME  1148
                  P + PA      A+ N +             +   T V     LL   +    M 
Sbjct  517   VAQPLP-LTPAYEEQGEATANNINGNENGSGSGNDNDRPATLVTNGDGLLDFDLYLSEMA  575

Query  1147  LLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESA  968
             +    K ELE YL E++      FDIL WWK+N+ ++P LSK+ARD+LAIP+S V++ S+
Sbjct  576   VNQPTKSELEQYLEESLVPRIQEFDILNWWKLNNLKYPTLSKMARDVLAIPMSMVSTGSS  635

Query  967   FSISG---RVLDHFRSSLTPKIVEALVCTQDWLR  875
                SG   RVLD + SSL P+ VEAL C +DWL+
Sbjct  636   IFASGTGSRVLDDYHSSLRPETVEALFCAKDWLQ  669


 Score = 43.5 bits (101),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 70/115 (61%), Gaps = 3/115 (3%)
 Frame = -3

Query  2178  SFVPVKS-HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSS  2008
             +F+ V S H    ++ A+   L +W +++ +FT+T+DN  SS+D+    L+  + +  + 
Sbjct  227   NFMMVSSPHSENALSEAIGVSLSDWNMKSKLFTITLDNNCSSHDIYSANLRDHLSNKNTL  286

Query  2007  SVKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
              +K +   +RC A+ILN+V QD +      +  +RE V+++++SP++ +KF ++A
Sbjct  287   MLKGQLFVVRCYANILNVVAQDVIASIHGIIYNIRESVKFIKASPAREEKFAEIA  341


 Score = 33.9 bits (76),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             RVS+T   WT+ Q + Y+ +T  FID +W
Sbjct  191   RVSLTIGLWTTSQTLGYVCLTGQFIDSDW  219



>ref|XP_009390780.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009390781.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009390782.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
Length=673

 Score =   164 bits (416),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 168/326 (52%), Gaps = 18/326 (6%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI    +L LDV T WN+TY+ML +AL Y++ F   E  D+++     +  P++ DW+ V
Sbjct  341   GIPGTKALSLDVTTLWNTTYIMLDAALEYKEAFTFLETCDDNY-----NEAPSADDWKKV  395

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCIL-NEMVEADGAVKLMGANMKAK  1475
               +   LK  YE    +  ++  TAN FF E   +   L N  +  D  V  +   M  K
Sbjct  396   EVVCTYLKLLYESANTVMATIDQTANIFFQEAWKIQLELTNATLSQDLMVSSIAKEMHEK  455

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+KY  D    + ++  A ++DPR K++ +      +YG+   + Y++ +  +++ELY +
Sbjct  456   FDKYWKDC---SLVLALAVVMDPRFKMKLVEFSFSKIYGEDSAR-YVKVVNDSIHELYIE  511

Query  1294  YAVSYSPSVVPATGSGSVASVNLVVEFVFT---PVGRPQHLLKAQIKKQRMELLGGKKIE  1124
             Y     P        G    VN       T   P+G    LL   I      +    K E
Sbjct  512   YVAQPLPLTPAYIDQGEANHVNGNDNNPHTTPNPMG--DGLLDFDIYLSETAVNQATKSE  569

Query  1123  LEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISG---  953
             L+ YL E++      FDIL WWK+N+ ++PILSK+A+DIL IP+S V +  +   SG   
Sbjct  570   LDQYLEESLVPRIQGFDILNWWKLNNLKYPILSKMAKDILGIPVSIVGTGCSIFGSGTGS  629

Query  952   RVLDHFRSSLTPKIVEALVCTQDWLR  875
             RVLD +RSSL P+ VEAL C +DWL+
Sbjct  630   RVLDEYRSSLRPETVEALFCAKDWLQ  655


 Score = 42.4 bits (98),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 63/107 (59%), Gaps = 2/107 (2%)
 Frame = -3

Query  2157  HKGEYIANALESCLIEWGLRN-VFTVTVDN-ASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             H    ++  +   L +W ++  +FT+T+DN  SS+D+    L+  + +  +  +K +   
Sbjct  231   HSENALSEVISVSLSDWNMKTKLFTITLDNNCSSHDIYSANLRDHLSNKNTLVLKGQLFV  290

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLA  1843
             +RC A+ILN+V QD +      V  +RE V++V++SP++ +KF ++A
Sbjct  291   VRCYANILNVVAQDVIASIHGIVYNIRESVKFVKASPAREEKFSEIA  337


 Score = 29.6 bits (65),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+T   WT+ Q + Y+ ++  +ID +W
Sbjct  187   RISLTIGLWTTSQTLGYICLSGQYIDLDW  215



>ref|XP_007048823.1| BED zinc finger,hAT family dimerization domain [Theobroma cacao]
 gb|EOX92980.1| BED zinc finger,hAT family dimerization domain [Theobroma cacao]
Length=657

 Score =   168 bits (426),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 109/334 (33%), Positives = 171/334 (51%), Gaps = 44/334 (13%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVF---DDYEYSDNSFKSDLGDSIPTSLDWE  1658
             +E +  L +D P +WNST+LML+ AL Y+KVF    D +  +  F       +P+ L+W+
Sbjct  347   VESQKCLRIDNPLKWNSTFLMLEVALEYRKVFCCLQDRDPVNMKF-------LPSDLEWD  399

Query  1657  SVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGANMK  1481
              V+ +   LK F E+T   + S Y TAN FF EI D++  L E  +  D  +  +   M+
Sbjct  400   RVSVIASFLKLFVEVTNVFTRSKYPTANIFFPEICDIHLQLIEWCKNPDDYINSLAVKMR  459

Query  1480  AKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELY  1301
              KFE Y    DK +  +  A +LDPR K++ +      +YGD    + ++ +   +  LY
Sbjct  460   KKFEDY---WDKCSLGLAVAAMLDPRFKMKLLEYYYPQLYGDS-ASELIDDVFECIKSLY  515

Query  1300  DDYA------------VSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQ  1157
             ++++            +S+  S +P +G  S   +    +F+                  
Sbjct  516   NEHSMVSPLASSLDQGLSWQVSGIPGSGKDSRDRLMGFDKFL-----------------H  558

Query  1156  RMELLGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVAS  977
                   G   +L+ YL + +      F+IL WWKV++  +PILS +A +IL IPIS VA+
Sbjct  559   ETSQSDGSNSDLDKYLEDPLFPRNVDFNILNWWKVHTPSYPILSMMAHNILGIPISKVAA  618

Query  976   ESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             ES F   GRV+DH  SSL P  V+AL+C+QDW+R
Sbjct  619   ESTFDTGGRVVDHNWSSLPPTTVQALMCSQDWIR  652


 Score = 35.4 bits (80),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             ++S+T D WT+     Y+ +TAH+IDE+W
Sbjct  194   KISVTADVWTASDDSAYLSLTAHYIDEDW  222


 Score = 32.7 bits (73),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = -3

Query  2178  SFVPV-KSHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSS  2005
             +FV +  SH  +  +  + +CL++W + R +F++  D+ +S ++ +  ++ ++       
Sbjct  230   NFVTIDPSHTEDMHSEVIMTCLMDWDIDRKLFSMIFDSYTSENI-VDRIRDRLSQNRFLY  288

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQ-CDIT  1918
                +   +RC   +LN +VQD+L   C++T
Sbjct  289   CNGQLFDVRCAVDLLNRMVQDALDAVCEVT  318



>emb|CDP06055.1| unnamed protein product [Coffea canephora]
Length=685

 Score =   168 bits (426),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/330 (33%), Positives = 175/330 (53%), Gaps = 38/330 (12%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI     L +D P +WNSTYLML++A+ Y+  F   + +D S+ + L ++     +WE  
Sbjct  353   GISTDRHLVVDCPMQWNSTYLMLEAAVEYKGAFSLLQENDPSYMTALSET-----EWEWA  407

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
             + +   +K F E+T    G  Y TAN +F E+ D++  L E  ++ D  +  + A MK+K
Sbjct  408   SAVTGYMKLFLEVTNVFVGCKYPTANMYFPELCDIHIQLIEWCKSPDDFLSSIAAKMKSK  467

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYG-DKKGKDYLEKLLAALNELYD  1298
             F+KY     K +  +  A ILDPR K++ +      +YG D  G  +++++   +  L+ 
Sbjct  468   FDKY---WKKCSLAVAIAAILDPRFKMKLVEYYYPQIYGSDAVG--HIKEVSNGIRGLFS  522

Query  1297  DYAV---------SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMEL  1145
             +YAV         +     +P+T +G+   +           G  + L +  I +  +  
Sbjct  523   EYAVSSSSVDQDSALPDGSLPSTINGTRDRLR----------GFDKFLHETSISQSMIS-  571

Query  1144  LGGKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAF  965
                   +L+ YL E +      F+IL WWKV++ R+PILS +ARD+L +P++T+  +  F
Sbjct  572   ------DLDKYLEEPVFPRNNDFNILNWWKVHTPRYPILSMMARDVLGLPVATLGRDLVF  625

Query  964   SISGRVLDHFRSSLTPKIVEALVCTQDWLR  875
             S  GRVLDH RSSL P   EALVC QDWLR
Sbjct  626   SNRGRVLDHHRSSLNPDTREALVCGQDWLR  655


 Score = 37.0 bits (84),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 60/109 (55%), Gaps = 3/109 (3%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGL-RNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             SH  + ++  +  CL EW + R +F++T D+  + D  + F  +  LS     +K+  L 
Sbjct  243   SHTDDILSEVVIKCLTEWAVERKLFSMTFDDCFAYD-DMVFRIKDWLSQNKPLLKNGELF  301

Query  1983  -MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
              +RC A +L  +VQD ++       ++RE +R+VRSS + L KF + ++
Sbjct  302   DVRCAAQVLKSIVQDVMEALRDVTDKIRESIRHVRSSQTTLGKFNEFSQ  350


 Score = 31.2 bits (69),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+S+  D W S +   YM +TA+++D +W
Sbjct  200   RISLAIDMWFSSENARYMSLTAYYVDGDW  228



>ref|XP_010690214.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Beta vulgaris subsp. vulgaris]
Length=448

 Score =   106 bits (265),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 86/144 (60%), Gaps = 2/144 (1%)
 Frame = -2

Query  1834  YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWES  1655
             + +E K  LCLD PT WNSTY+ML++A+ +Q+VF      D    S L +  P + DW+ 
Sbjct  305   FNVESKCYLCLDDPTNWNSTYMMLETAMKFQRVFSALNLPDEMGVS-LNERPPDAHDWKK  363

Query  1654  VNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGANMKA  1478
             +  LV  L+ FY  T RIS SLYVT+N    EI  L  IL + V+  D   + M  +MK 
Sbjct  364   IERLVVFLEGFYLFTRRISNSLYVTSNKGLYEIMALNNILKKWVQNVDLDFQAMAISMKQ  423

Query  1477  KFEKY*GDIDKMNYMIFFANILDP  1406
             K++KY G+++KMN +I+ A I  P
Sbjct  424   KYDKYWGNVEKMNMLIYIAVIHIP  447


 Score = 80.5 bits (197),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 77/114 (68%), Gaps = 2/114 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSV  2002
             +F P+ + +GE I   ++ CL  WGL + +FTVTVDNAS ND A   L++     G  S 
Sbjct  191   NFCPMFTQQGEAIGKGIKECLESWGLEDKLFTVTVDNASYNDFACTDLRKMAQQTGCVS-  249

Query  2001  KSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
               KYL +RCIAH++N++V D++++  + ++RVR  V++V+ S ++ ++F+DLA+
Sbjct  250   DGKYLQIRCIAHVINVIVSDAIEENGLCIERVRHAVKFVKVSTARKRRFKDLAQ  303


 Score = 49.7 bits (117),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -1

Query  2285  QRVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             QR+ +TTD+WTSIQ  NY+ VTAHFID +W
Sbjct  154   QRICVTTDTWTSIQDKNYLSVTAHFIDNDW  183



>ref|XP_006851229.1| hypothetical protein AMTR_s00180p00017340 [Amborella trichopoda]
 gb|ERN12810.1| hypothetical protein AMTR_s00180p00017340 [Amborella trichopoda]
Length=841

 Score =   170 bits (430),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 109/322 (34%), Positives = 176/322 (55%), Gaps = 21/322 (7%)
 Frame = -2

Query  1828  IEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVN  1649
             I  K  LCLDV   WN+T+LML++AL +++ F      D+++     +  P+  +W+ V 
Sbjct  331   IPSKKDLCLDVQGEWNTTFLMLEAALEFKQAFSCLGSHDSNY-----EGAPSEDEWKKVE  385

Query  1648  NLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAKF  1472
              L   LK FY++    S   + TAN +F E+  ++  LN  V + D  +  +  N++ KF
Sbjct  386   VLCIYLKVFYDVLRAFSEVTHPTANLYFHELWKIHMHLNHTVTSPDIVIIPVIRNLQDKF  445

Query  1471  EKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDY  1292
             +KY     + + ++  A  +DPR K++++      +YG      Y   ++ A+ +LY  Y
Sbjct  446   DKY---WREYSLVLAIAVSMDPRFKMKFVEFSFSKVYGTNAFM-YTRVVIEAIRDLYSQY  501

Query  1291  AVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGK--KIELE  1118
             A +    V  AT +G  +S N   +         Q L          EL G +  K EL+
Sbjct  502   ARNIPGPVPLATYNGDQSSSNNSFQINDGLQDFDQFL---------SELSGSQQTKSELD  552

Query  1117  YYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDH  938
              YL E +      FDILRWWK+++ ++P+LS++ARDILAI ++TV SES F+  G+VLD 
Sbjct  553   QYLEEPLFPRNQEFDILRWWKMSAPKYPVLSEMARDILAIRVTTVDSESMFNTGGKVLDQ  612

Query  937   FRSSLTPKIVEALVCTQDWLRR  872
             ++SSL+P+ +EAL+C +DWL  
Sbjct  613   YQSSLSPETIEALICARDWLHH  634


 Score = 33.1 bits (74),  Expect(3) = 3e-46, Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFID  2205
             R+S++ D WT+ + + YM +T HF+D
Sbjct  177   RISLSLDKWTTEETLEYMRITGHFVD  202


 Score = 33.1 bits (74),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 39/71 (55%), Gaps = 1/71 (1%)
 Frame = -3

Query  2142  IANALESCLIEWG-LRNVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLHMRCIAH  1966
             +++ + +CL +W  L  + TVT+D   ++D     LK  + S     +  +  ++ C A 
Sbjct  226   LSDVILTCLTDWNILTKLSTVTLDRHHTDDCIGSNLKDCLSSKNMLLLSGRVFNVCCCAD  285

Query  1965  ILNLVVQDSLK  1933
             +LNL+VQD L+
Sbjct  286   VLNLIVQDGLE  296



>emb|CCI55351.1| PH01B019A14.20 [Phyllostachys edulis]
Length=988

 Score =   130 bits (327),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/314 (32%), Positives = 151/314 (48%), Gaps = 37/314 (12%)
 Frame = -2

Query  1810  LCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESVNNLVKLL  1631
             L LDV TRW+STY ML   L Y+     Y  +D +++       P+  DW     +  +L
Sbjct  677   LSLDVSTRWSSTYKMLSICLAYKDALVCYTDTDANYQWQ-----PSGEDWALYEKIAPIL  731

Query  1630  KCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVE-ADGAVKLMGANMKAKFEKY*GD  1454
             K   E+T   SGS Y TAN F+  I ++   L   +   D  +KLM   M  KF+KY   
Sbjct  732   KSLAEVTSAFSGSTYPTANVFYPYIVNVKIALRAAIAYGDEHLKLMAVAMLNKFDKY---  788

Query  1453  IDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDDYAVSYSP  1274
              ++ N  +  A ILDPR K+ ++                        N++Y+    +Y  
Sbjct  789   WEEKNNAMVLATILDPRFKMRFIGW--------------------CFNQMYEPSKAAYEL  828

Query  1273  SVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSEAIT  1094
               V + G  + +S       + +   + Q  L++   +         K EL  YL EA  
Sbjct  829   EDVASAGDVTSSSAMGTSSSLSSVSSQFQSFLRSTSTEP-------SKSELLIYLDEANE  881

Query  1093  E-DEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVLDHFRSSLTP  917
               D     +L WW +N+ RFP++SK+AR+ L IP S+V+SES FS  GRVLD +RSSL P
Sbjct  882   SLDNKGLKLLEWWNLNAHRFPVVSKMARNFLTIPASSVSSESTFSAGGRVLDDYRSSLRP  941

Query  916   KIVEALVCTQDWLR  875
              +V+ LVC   W++
Sbjct  942   AMVQYLVCASSWIK  955


 Score = 69.3 bits (168),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLRN-VFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
              H G  IA A+  C+ EW + + + T+T+DNASSN  A+  L  K  + GS+   +KY H
Sbjct  560   PHTGVVIAQAVFDCITEWKIEDKIITLTLDNASSNTAAIRSLMAKFAARGSARFIAKYFH  619

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKF  1855
             +RC  HI+NLV+ D L      + ++RE V+Y++ SPS++ KF
Sbjct  620   VRCGCHIVNLVINDGLLPLAPLINKLRETVKYIKKSPSRMHKF  662


 Score = 36.2 bits (82),  Expect(3) = 3e-46, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = -1

Query  2279  VSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             +S+T D WTS Q I YM +  H+ID+ W
Sbjct  518   ISLTCDLWTSNQNICYMSLVVHYIDKNW  545



>gb|KHG07030.1| Putative AC transposase [Gossypium arboreum]
Length=672

 Score =   154 bits (389),  Expect(3) = 4e-46, Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 166/324 (51%), Gaps = 28/324 (9%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI+    + LD P RWNSTY+ML++A+ Y+ VF      D  F   L D      +WE  
Sbjct  350   GIDNHKIVVLDYPIRWNSTYMMLETAVEYRNVFHHLPELDPDFA--LSDE-----EWERA  402

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
             +++V  LK   E+    S +   TAN +F EI  ++  L E  ++ D  +  +   MKAK
Sbjct  403   SSIVSCLKLLIEIINVFSSNKCPTANIYFPEICHVHIQLIEWCKSSDAFLSSLATKMKAK  462

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAA---LNEL  1304
             F+KY     K +  +  A ILDPR K++ +      +YG       LE++  A   + EL
Sbjct  463   FDKY---WSKCSLALAVAAILDPRFKMKLVEYYYSQIYGSTA----LERIKEASDGIKEL  515

Query  1303  YDDYAVSYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI-  1127
             ++ Y++    S +   GS    S       + +     +  LK   K           I 
Sbjct  516   FNAYSIC---STLIDQGSALPGSS------LPSSSNDTRDRLKGFDKFLHETSQSQTAIS  566

Query  1126  ELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRV  947
             +LE YL E +      F+IL WW+V++ R+PILS +ARD+L  P+ST+A E AF+  GR+
Sbjct  567   DLEKYLDEPVFPRNCDFNILNWWRVHTPRYPILSMMARDVLGTPMSTIAQEFAFNAGGRM  626

Query  946   LDHFRSSLTPKIVEALVCTQDWLR  875
             LD  +SSL P   +AL+CT+DWLR
Sbjct  627   LDSNQSSLPPDTQQALICTRDWLR  650


 Score = 48.5 bits (114),  Expect(3) = 4e-46, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = -3

Query  2160  SHKGEYIANALESCLIEWGLR-NVFTVTVDNASSNDVALGFLKRKVLSWGSSSVKSKYLH  1984
             SH  + +++ +  CL++W +   +F +T D+ S+ND  +  +K +V          + L 
Sbjct  240   SHTEDVLSDVIIKCLMDWDIDCKLFAMTFDDCSTNDDIVSRIKDQVSESRPRLSNGQLLD  299

Query  1983  MRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFRDLAE  1840
             +R  AH+LN + QD+++   + ++++R  V+YV+SS S L KF ++A+
Sbjct  300   VRSAAHVLNSIAQDAIEALQVVIQKIRGSVKYVKSSQSILGKFNEIAQ  347


 Score = 33.1 bits (74),  Expect(3) = 4e-46, Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -1

Query  2282  RVSITTDSWTSIQRINYMVVTAHFIDEEW  2196
             R+++  + W+S +   Y+ +TAH++D+EW
Sbjct  197   RINLAIEMWSSPENSKYVCLTAHYVDDEW  225



>ref|XP_009129514.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brassica rapa]
Length=485

 Score =   116 bits (290),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/320 (27%), Positives = 151/320 (47%), Gaps = 44/320 (14%)
 Frame = -2

Query  1843  RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYE-----YSDNSFKSDLGDSI  1679
             RV  G   + SL LD+ T WN TYLMLQ A+ ++ VFD  E     Y+D   + + G+  
Sbjct  168   RVESGKMSRGSLPLDIKTMWNFTYLMLQRAIRFKVVFDKMEPEDRLYNDYFNEVENGNKR  227

Query  1678  ---PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DG  1511
                P ++DW +V  LVK L  FY  T+ +S S  V+++  + EI  +   L  + ++ D 
Sbjct  228   IGPPATVDWNAVERLVKFLIIFYNSTLVVSASTTVSSHKCYGEIVTIETNLTRLSQSLDK  287

Query  1510  AVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDK--KGKDY  1337
              +K     MKAKF KY G +  +N M+  A++ DP  K+++       ++G +  + K  
Sbjct  288   ELKGKADCMKAKFGKYWGGMKNVNKMVIVASVFDPTKKMQFAKLYFEKLHGKETPEAKAM  347

Query  1336  LEKLLAALNELYDDYAVSYSPSVVPAT-----------------------GSGSVASVNL  1226
              + +   L +++ +Y++                                 G     +++L
Sbjct  348   YQSVHIVLTDMFKEYSLRLRKDSTRGQSSQSTQASSSNGQDQDQDQDQVLGENVEEAMDL  407

Query  1225  VVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDEG----SFDILRWW  1058
             V +  +  +      L A+I  +        + ELE YL E +   +      +D+L WW
Sbjct  408   VDDLCYERMNFAYIELVAEIGVEE------ARDELELYLKEKVENPKNFLGTEYDVLSWW  461

Query  1057  KVNSARFPILSKIARDILAI  998
             K+N  ++PIL+++A+D+LA+
Sbjct  462   KLNCQKYPILAEMAKDVLAM  481


 Score = 82.4 bits (202),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = -3

Query  2178  SFVPVKSHKGEYIANALESCLIEWGLRNVFTVTVDNASSNDVALGFLKRKVLSWGSSS--  2005
              F  V  H+G+ IAN L  CL EW ++ VFT+TVDNA++N   L   + + +  G  +  
Sbjct  56    GFKHVCDHRGQMIANVLLECLAEWAIQKVFTITVDNATANTSVLRKFQSEFILLGDEALV  115

Query  2004  VKSKYLHMRCIAHILNLVVQDSLKQCDITvkrvrevvryvRSSPSKLKKFR  1852
             +   Y+HMRC AHI+NLVV+D L+  D  V+ +R  V+YVRSS  + K F+
Sbjct  116   MDGNYMHMRCAAHIINLVVRDGLQDIDGNVEAIRNAVQYVRSSTQRQKSFQ  166


 Score = 37.0 bits (84),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
             QRVS+TT  WT+     +YMVVTAHFID+ W
Sbjct  18    QRVSLTTYIWTAHATGASYMVVTAHFIDDTW  48



>ref|XP_009145274.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like, partial [Brassica rapa]
Length=677

 Score =   159 bits (402),  Expect(3) = 6e-46, Method: Compositional matrix adjust.
 Identities = 114/350 (33%), Positives = 179/350 (51%), Gaps = 35/350 (10%)
 Frame = -2

Query  1843  RV*YGIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSD---NSFKSDLGDSI--  1679
             RV  G   + SL +DV TRWNST+LML  AL ++  FD  E  D   N +  ++ + +  
Sbjct  315   RVITGKMTRRSLPMDVKTRWNSTFLMLSRALQFKVAFDRMEAEDKLYNDYFLEVENGVKR  374

Query  1678  ---PTSLDWESVNNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMV-EADG  1511
                P   DW +V  L + L  FY  T+ +S S  V +   + EI  +   L  +    D 
Sbjct  375   CGPPGLSDWNAVEKLKRFLVIFYNSTLVVSASSKVNSYKCYGEIVTVERNLTTLTCNLDP  434

Query  1510  AVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGD--KKGKDY  1337
              +KL   +M  KF KY   +  +N M+ FA I++PR K+ Y       +YG    + K+ 
Sbjct  435   YLKLKVEDMLQKFLKYWDGMKNVNKMLIFAAIINPRKKMTYPNVCFEKLYGKDYTEAKEM  494

Query  1336  LEKLLAALNELYDDYAVSY------------SPSVVPATGSGSVASVNLVVE-FVFTPVG  1196
              E +L  L  ++++YA  +            + SVV       +  + LVVE F +    
Sbjct  495   SESVLDLLTSMFNEYARRFKGVSTGYSQLKQAESVVVQESQDHLDRLKLVVEDFGYLK--  552

Query  1195  RPQHLLKAQIKKQRMELLGGKKIELEYYLSEAITEDE----GSFDILRWWKVNSARFPIL  1028
                  + ++ K   ++     + ELE YL E +   +      FDIL WWKV+  +FP+L
Sbjct  553   -----MDSEYKNLAVDSGNEPRYELEMYLREPVENQKLMMGFEFDILGWWKVHRIKFPVL  607

Query  1027  SKIARDILAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWL  878
             +++ARD+LA+ +S+VASESAFS SG +L+ +RS LT  ++E L+C++  L
Sbjct  608   AEMARDLLAMQVSSVASESAFSTSGTILEPYRSCLTHYLIEVLMCSEQIL  657


 Score = 38.9 bits (89),  Expect(3) = 6e-46, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%)
 Frame = -1

Query  2285  QRVSITTDSWTS-IQRINYMVVTAHFIDEEW  2196
             QRVS+TTD W S +  ++YMVV AHF+D  W
Sbjct  190   QRVSLTTDIWVSQVTCVSYMVVAAHFVDTTW  220


 Score = 37.0 bits (84),  Expect(3) = 6e-46, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 4/54 (7%)
 Frame = -3

Query  2076  DNASSNDVALGFLKRKVLSWGSSSV--KSKYLHMRCIAHILNLVVQDSLKQCDI  1921
             DNA++N  A+     +  S    ++     +LHMRC AHI+NL+ ++ L  CD+
Sbjct  237   DNATANTSAIRRFHNEFRSVSPDALVLDGNFLHMRCSAHIINLIAREGL--CDL  288



>ref|XP_010315628.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Solanum lycopersicum]
Length=300

 Score =   176 bits (446),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 142/232 (61%), Gaps = 8/232 (3%)
 Frame = -2

Query  1528  MVEADGAVKLMGANMKAKFEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKK  1349
             M   D  +K M  +M   F+KY G+   MN MIF +++LDPR+KL+Y+P  +V M+G + 
Sbjct  1     MTNEDRNLKEMVESMNENFKKYLGEPQNMNKMIFISSVLDPRNKLDYVPFSIVDMFGKEV  60

Query  1348  GKDYLEKLLAALNELYDDYAVSYSPSV---VPATGSGSVASVNLVVEF-VFTPVGRPQHL  1181
             G++   ++   +N+L+  Y V  SP     VP + + S  S ++         V R +  
Sbjct  61    GENLCSEVKKYMNKLFG-YYVKKSPKSSLHVPYSPTSSDNSSSISSVSGCGNFVNRGRLR  119

Query  1180  LKAQIKKQRMELLG--GKKIELEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDI  1007
              K Q +K + E+ G    K E+E YL+E I  D   FDIL WWKVN  RFPIL+++ RD+
Sbjct  120   TKQQFEKHK-EVSGSSANKSEMERYLAEDIESDSDDFDILMWWKVNEPRFPILAEMVRDV  178

Query  1006  LAIPISTVASESAFSISGRVLDHFRSSLTPKIVEALVCTQDWLRRPNTPISI  851
             LAIPIS+VASE AFS  GRV D FRSSLTPKIV++L+C QDWLR     I+I
Sbjct  179   LAIPISSVASECAFSTGGRVFDPFRSSLTPKIVQSLICVQDWLRSEYFSINI  230



>ref|XP_010675272.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675273.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Beta vulgaris subsp. vulgaris]
Length=671

 Score =   183 bits (465),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 114/323 (35%), Positives = 178/323 (55%), Gaps = 25/323 (8%)
 Frame = -2

Query  1831  GIEQKTSLCLDVPTRWNSTYLMLQSALIYQKVFDDYEYSDNSFKSDLGDSIPTSLDWESV  1652
             GI+ + +L  D P RWNST +ML++AL Y+  F   +  D+++ + L +      +WE +
Sbjct  349   GIDNQKNLLADCPMRWNSTSVMLETALAYRAAFSLLQEHDSAYTAGLSEE-----EWEWM  403

Query  1651  NNLVKLLKCFYEMTIRISGSLYVTANTFFSEISDLYCILNEMVEA-DGAVKLMGANMKAK  1475
             N++   LK F E+T  I+ + + T+N +F EI D++  L +  ++ D  ++ M   MKAK
Sbjct  404   NSVTGYLKLFVEITNAITSNKFPTSNIYFPEICDVHVQLIDWCKSSDECIRSMALKMKAK  463

Query  1474  FEKY*GDIDKMNYMIFFANILDPRDKLEYMPTQLVHMYGDKKGKDYLEKLLAALNELYDD  1295
             F+ Y     K +  +  A ILDPR K++ +      +YG    +D ++++   + EL+D+
Sbjct  464   FDIY---WKKCSLSLAIAAILDPRFKMKLVEYYYPQIYG-SSAEDNIKEVSDGIRELFDE  519

Query  1294  YAV-SYSPSVVPATGSGSVASVNLVVEFVFTPVGRPQHLLKAQIKKQRMELLGGKKI--E  1124
             Y++ S S SV    GS +              +G           K   E   GK    +
Sbjct  520   YSIGSVSVSVDHGVGSSNGG------------IGSDSRDRLKGFDKFLHETSQGKNAVSD  567

Query  1123  LEYYLSEAITEDEGSFDILRWWKVNSARFPILSKIARDILAIPISTVASESAFSISGRVL  944
             LE YL E +      F+I  WWKV++ R+PILS +A+D+L +P+STVA E AF   GRVL
Sbjct  568   LEKYLEEPVFPRNYDFNIFTWWKVHTPRYPILSMMAQDVLGVPMSTVAPELAFRTGGRVL  627

Query  943   DHFRSSLTPKIVEALVCTQDWLR  875
             D +RSSL+   V+AL+CTQDWLR
Sbjct  628   DQYRSSLSSDTVQALICTQDWLR  650



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7041065150936