BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22701_g2_i3 len=538 path=[2326:0-338 2665:339-537]

Length=538
                                                                      Score     E

ref|XP_009603740.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  71.2    1e-11   
ref|XP_009769485.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  72.4    1e-11   
ref|XP_009603739.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  71.2    1e-11   
ref|XP_009603735.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  71.6    2e-11   
ref|XP_004245273.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  71.2    2e-11   
ref|XP_006365173.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  70.5    4e-11   
ref|XP_009597989.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  67.8    3e-10   
ref|XP_006340260.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  62.0    3e-08   
ref|XP_004251180.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  59.3    2e-07   
gb|KHG18964.1|  putative beta-1,4-xylosyltransferase IRX9H -like ...  58.9    3e-07   
gb|KHG07988.1|  putative beta-1,4-xylosyltransferase IRX9H -like ...  55.8    3e-06   
ref|XP_010908069.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  55.1    5e-06   
ref|XP_010541258.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  55.1    5e-06   
ref|XP_006852709.1|  hypothetical protein AMTR_s00033p00038120        55.1    7e-06   
ref|XP_008791503.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  54.7    7e-06   
ref|XP_010100253.1|  putative beta-1,4-xylosyltransferase IRX9H       54.3    1e-05   
ref|XP_010249639.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  54.3    1e-05   
ref|XP_010934369.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  53.9    1e-05   
ref|XP_007012094.1|  Glycosyl transferase isoform 1                   53.9    1e-05   
ref|XP_009400830.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  53.9    1e-05   
ref|XP_009777181.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  53.5    2e-05   
gb|EMT03092.1|  Galactosylgalactosylxylosylprotein 3-beta-glucuro...  53.5    2e-05   
ref|XP_002516557.1|  beta-1,3-glucuronyltransferase, putative         53.1    2e-05   Ricinus communis
emb|CDM83963.1|  unnamed protein product                              53.1    2e-05   
emb|CDP00965.1|  unnamed protein product                              53.1    2e-05   
emb|CAD98789.1|  3-beta-glucuronosyltransferase                       53.1    2e-05   Hordeum vulgare [barley]
emb|CAI93180.1|  glycosyltransferase                                  53.1    3e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003569552.1|  PREDICTED: probable glucuronosyltransferase ...  53.1    3e-05   
ref|XP_009398431.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  53.1    3e-05   
ref|XP_004969521.1|  PREDICTED: probable glucuronosyltransferase ...  52.8    3e-05   
ref|XP_003526483.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  52.8    3e-05   
ref|XP_008785313.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  52.4    4e-05   
gb|EYU34234.1|  hypothetical protein MIMGU_mgv1a007301mg              52.4    4e-05   
ref|XP_002963107.1|  glycosyltransferase IRX9-like protein            52.0    5e-05   
ref|XP_009398588.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  52.4    5e-05   
ref|XP_002980217.1|  glycosyltransferase IRX9-like protein            52.0    5e-05   
ref|XP_009597765.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  52.0    5e-05   
ref|XP_008466052.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  52.0    5e-05   
ref|NP_001242118.1|  uncharacterized protein LOC100808765             52.0    6e-05   
ref|XP_006833395.1|  hypothetical protein AMTR_s00109p00122730        52.0    6e-05   
ref|XP_006577851.1|  PREDICTED: uncharacterized protein LOC100808...  52.0    6e-05   
gb|KHN10212.1|  Putative beta-1,4-xylosyltransferase IRX9H            52.0    7e-05   
ref|XP_003580881.1|  PREDICTED: probable glucuronosyltransferase ...  51.6    7e-05   
emb|CAI93179.1|  glycosyltransferase                                  51.6    8e-05   Saccharum officinarum [noble cane]
ref|XP_002458309.1|  hypothetical protein SORBIDRAFT_03g030990        51.6    9e-05   Sorghum bicolor [broomcorn]
ref|NP_001131482.1|  uncharacterized protein LOC100192819             51.2    9e-05   Zea mays [maize]
ref|XP_010917546.1|  PREDICTED: probable glucuronosyltransferase ...  51.2    1e-04   
ref|XP_006450659.1|  hypothetical protein CICLE_v10008306mg           51.2    1e-04   
ref|XP_002309550.2|  hypothetical protein POPTR_0006s25690g           51.2    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006476065.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  51.2    1e-04   
ref|XP_009381961.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  51.2    1e-04   
gb|ACN27051.1|  unknown                                               48.5    1e-04   Zea mays [maize]
gb|KDO79768.1|  hypothetical protein CISIN_1g013438mg                 51.2    1e-04   
ref|XP_004136218.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  51.2    1e-04   
ref|XP_010668179.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  50.8    1e-04   
emb|CAN73652.1|  hypothetical protein VITISV_039322                   50.8    1e-04   Vitis vinifera
emb|CBI19320.3|  unnamed protein product                              50.8    1e-04   
ref|XP_002283625.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  50.8    1e-04   Vitis vinifera
ref|XP_002893477.1|  glycosyl transferase family 43 protein           50.8    1e-04   
ref|XP_002281445.2|  PREDICTED: probable beta-1,4-xylosyltransfer...  50.8    2e-04   Vitis vinifera
ref|XP_004501173.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  50.4    2e-04   
ref|XP_007137197.1|  hypothetical protein PHAVU_009G107900g           50.4    2e-04   
gb|EAY75350.1|  hypothetical protein OsI_03246                        50.4    2e-04   Oryza sativa Indica Group [Indian rice]
emb|CDX71576.1|  BnaC09g26170D                                        50.1    2e-04   
ref|NP_001043846.1|  Os01g0675500                                     50.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009384670.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  50.4    2e-04   
gb|KDO81335.1|  hypothetical protein CISIN_1g0160702mg                48.5    2e-04   
ref|XP_006644511.1|  PREDICTED: probable glucuronosyltransferase ...  50.4    2e-04   
ref|XP_010499243.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  50.4    2e-04   
ref|XP_010254664.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  50.4    2e-04   
ref|XP_006305000.1|  hypothetical protein CARUB_v10009365mg           50.4    2e-04   
ref|XP_010530340.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  50.4    2e-04   
ref|XP_006415747.1|  hypothetical protein EUTSA_v10007547mg           50.4    2e-04   
ref|XP_010460516.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  50.1    2e-04   
ref|NP_001051997.1|  Os04g0103100                                     50.1    2e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAH65757.1|  OSIGBa0123D13.6                                      50.1    2e-04   Oryza sativa [red rice]
ref|XP_002446005.1|  hypothetical protein SORBIDRAFT_06g000430        50.1    2e-04   Sorghum bicolor [broomcorn]
gb|EPS67676.1|  hypothetical protein M569_07100                       50.1    2e-04   
ref|XP_009102966.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  50.1    3e-04   
emb|CDY66999.1|  BnaA07g37250D                                        50.1    3e-04   
gb|AHA33627.1|  beta-1,4-xylosyltransferase                           50.1    3e-04   
emb|CAI93172.1|  beta-1,3-glucuronosyltransferase                     50.1    3e-04   Gossypium raimondii
ref|XP_008378090.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  50.1    3e-04   
ref|XP_004974970.1|  PREDICTED: probable glucuronosyltransferase ...  49.7    3e-04   
emb|CDP16179.1|  unnamed protein product                              50.1    3e-04   
emb|CAN81600.1|  hypothetical protein VITISV_024403                   49.7    3e-04   Vitis vinifera
ref|XP_008662210.1|  PREDICTED: uncharacterized protein LOC100383...  49.7    3e-04   
dbj|BAJ88676.1|  predicted protein                                    49.7    3e-04   
tpg|DAA58147.1|  TPA: galactosylgalactosylxylosylprotein 3-beta-g...  49.7    4e-04   
ref|NP_001151473.1|  galactosylgalactosylxylosylprotein 3-beta-gl...  49.7    4e-04   Zea mays [maize]
ref|XP_011078471.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  49.7    4e-04   
gb|KDP34199.1|  hypothetical protein JCGZ_07770                       49.7    4e-04   
gb|EMT28971.1|  Galactosylgalactosylxylosylprotein 3-beta-glucuro...  48.9    4e-04   
emb|CDP00964.1|  unnamed protein product                              49.3    4e-04   
ref|XP_011019628.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  49.7    4e-04   
ref|XP_009410918.1|  PREDICTED: probable glucuronosyltransferase ...  49.3    4e-04   
emb|CDX90097.1|  BnaA08g18870D                                        49.3    4e-04   
ref|XP_002510001.1|  beta-1,3-glucuronyltransferase, putative         49.3    4e-04   Ricinus communis
ref|XP_004238039.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  49.3    5e-04   
ref|XP_006472378.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  49.3    5e-04   
gb|KHG21195.1|  putative beta-1,4-xylosyltransferase IRX9H -like ...  49.3    5e-04   
ref|XP_010060139.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  49.3    5e-04   
emb|CAE12013.1|  beta3-glucuronyltransferase                          48.9    5e-04   Hordeum vulgare [barley]
ref|XP_008352726.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  49.3    5e-04   
ref|XP_010556501.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  49.3    5e-04   
ref|XP_010556502.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  48.9    5e-04   
ref|XP_008655444.1|  PREDICTED: LOC606448 isoform X1                  49.3    6e-04   
ref|XP_009348125.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  48.9    6e-04   
ref|NP_001105786.1|  LOC606448                                        48.9    6e-04   Zea mays [maize]
ref|XP_010047266.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  48.9    7e-04   
ref|XP_010478101.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  48.9    7e-04   
ref|XP_008466103.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  48.5    8e-04   
ref|XP_007222290.1|  hypothetical protein PRUPE_ppa005926mg           48.5    0.001   



>ref|XP_009603740.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H isoform 
X3 [Nicotiana tomentosiformis]
Length=327

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 3/52 (6%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPYT---FIKNHSSIITS  389
            ++FIEQ+VEDESQME  P +CSRIMVWQFDTE L PY    ++KN+S  IT+
Sbjct  274  SSFIEQVVEDESQMECFPTHCSRIMVWQFDTELLYPYPHEWWVKNYSGTITA  325



>ref|XP_009769485.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nicotiana 
sylvestris]
 ref|XP_009769486.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nicotiana 
sylvestris]
Length=439

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 3/53 (6%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPYT---FIKNHSSIITSL  386
            + FIEQ+VEDESQME +P +CSRIMVWQF+TE L PY     +KN+SS ITS+
Sbjct  386  STFIEQVVEDESQMECLPMHCSRIMVWQFNTEILYPYPHEWLVKNYSSTITSV  438



>ref|XP_009603739.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H isoform 
X2 [Nicotiana tomentosiformis]
Length=331

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 3/52 (6%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPYT---FIKNHSSIITS  389
            ++FIEQ+VEDESQME  P +CSRIMVWQFDTE L PY    ++KN+S  IT+
Sbjct  278  SSFIEQVVEDESQMECFPTHCSRIMVWQFDTELLYPYPHEWWVKNYSGTITA  329



>ref|XP_009603735.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009603737.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009603738.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H isoform 
X1 [Nicotiana tomentosiformis]
Length=444

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 3/52 (6%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPYT---FIKNHSSIITS  389
            ++FIEQ+VEDESQME  P +CSRIMVWQFDTE L PY    ++KN+S  IT+
Sbjct  391  SSFIEQVVEDESQMECFPTHCSRIMVWQFDTELLYPYPHEWWVKNYSGTITA  442



>ref|XP_004245273.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Solanum 
lycopersicum]
 ref|XP_010325172.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Solanum 
lycopersicum]
Length=440

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 3/52 (6%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPYT---FIKNHSSIITS  389
            + FIEQ+VEDESQMEG+P NCSRIMVWQF+TE L PY     +KN+S   TS
Sbjct  387  STFIEQMVEDESQMEGLPINCSRIMVWQFNTEILYPYPHEWLVKNYSITSTS  438



>ref|XP_006365173.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006365174.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006365175.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006365176.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like isoform 
X4 [Solanum tuberosum]
Length=440

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 3/53 (6%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPYT---FIKNHSSIITSL  386
            + FIEQ+VEDESQMEG+P NCSRIMVWQF+ E L PY     +KN+S   TS+
Sbjct  387  STFIEQMVEDESQMEGLPMNCSRIMVWQFNMEILYPYPHEWMVKNYSRTSTSV  439



>ref|XP_009597989.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nicotiana 
tomentosiformis]
 ref|XP_009597990.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nicotiana 
tomentosiformis]
Length=442

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 3/53 (6%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPYT---FIKNHSSIITSL  386
            + FIEQ+VEDESQME +P +CSRI VWQF+T+ L PY     +KN+SS ITS+
Sbjct  386  STFIEQVVEDESQMECLPMHCSRITVWQFNTDTLYPYPHEWLVKNYSSTITSI  438



>ref|XP_006340260.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like [Solanum 
tuberosum]
Length=444

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPY  425
             + FIEQ+VEDESQME  P +CSRIMVWQF+TE L PY
Sbjct  390  VSTFIEQVVEDESQMEVFPMHCSRIMVWQFNTELLYPY  427



>ref|XP_004251180.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Solanum 
lycopersicum]
Length=444

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPY  425
             + FIEQ+V+DESQ+E  P +CSRIMVWQF+TE L PY
Sbjct  390  VSTFIEQVVDDESQIEVFPMHCSRIMVWQFNTELLYPY  427



>gb|KHG18964.1| putative beta-1,4-xylosyltransferase IRX9H -like protein [Gossypium 
arboreum]
Length=441

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 3/54 (6%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE---FLQPYTFIKNHSSIITSL  386
            A++ IEQ+VEDESQMEG+P+NCSRIMVW+ + E   F      +KN+  +I  L
Sbjct  387  ASSIIEQVVEDESQMEGLPQNCSRIMVWEVNIESNSFYPQKWLMKNNLDVIAPL  440



>gb|KHG07988.1| putative beta-1,4-xylosyltransferase IRX9H -like protein [Gossypium 
arboreum]
 gb|KHG16441.1| putative beta-1,4-xylosyltransferase IRX9H -like protein [Gossypium 
arboreum]
Length=443

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 4/55 (7%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE----FLQPYTFIKNHSSIITSL  386
            A++FIE++V+DESQMEG+P +CSR+MVW+ + E    F      +KN+  II  L
Sbjct  388  ASSFIERVVQDESQMEGLPHDCSRVMVWELNVESSNSFYPKKWSMKNNLDIIAPL  442



>ref|XP_010908069.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Elaeis 
guineensis]
Length=396

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQI+EDESQMEG+P NCSRIM W    E
Sbjct  340  TTFIEQIIEDESQMEGLPNNCSRIMNWHLHLE  371



>ref|XP_010541258.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Tarenaya 
hassleriana]
Length=434

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPY  425
            ++FIEQIVEDE+QMEG+P+ CS +MVWQ   E   P+
Sbjct  379  SSFIEQIVEDETQMEGLPEGCSNVMVWQLHLESSHPF  415



>ref|XP_006852709.1| hypothetical protein AMTR_s00033p00038120 [Amborella trichopoda]
 gb|ERN14176.1| hypothetical protein AMTR_s00033p00038120 [Amborella trichopoda]
Length=477

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FI QIVEDESQMEG+P++CSRIMVW    E
Sbjct  398  TTFIRQIVEDESQMEGLPQDCSRIMVWHLHLE  429



>ref|XP_008791503.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H isoform 
X1 [Phoenix dactylifera]
Length=416

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQI+EDESQMEG+P NCSRIM W    E
Sbjct  362  TTFIEQIIEDESQMEGLPNNCSRIMNWHLHLE  393



>ref|XP_010100253.1| putative beta-1,4-xylosyltransferase IRX9H [Morus notabilis]
 gb|EXB82260.1| putative beta-1,4-xylosyltransferase IRX9H [Morus notabilis]
Length=453

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE----FLQPYTFIKNHSSIITSL  386
            + FIEQIVEDESQMEG+ ++CSRIMVW    E    F     F+K++  +I SL
Sbjct  399  STFIEQIVEDESQMEGLLEDCSRIMVWHLHLESANDFYPHAWFMKDNLDVIASL  452



>ref|XP_010249639.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nelumbo 
nucifera]
 ref|XP_010249640.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nelumbo 
nucifera]
 ref|XP_010249641.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nelumbo 
nucifera]
 ref|XP_010249642.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nelumbo 
nucifera]
 ref|XP_010249643.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nelumbo 
nucifera]
Length=448

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPY  425
            + FIEQ+VEDESQMEG+  NCSRIMVW    E   P+
Sbjct  394  STFIEQVVEDESQMEGLLLNCSRIMVWHLHLEASHPF  430



>ref|XP_010934369.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Elaeis 
guineensis]
Length=403

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQI+EDESQMEG P NCSRIM W    E
Sbjct  349  TTFIEQIIEDESQMEGFPNNCSRIMNWHLHLE  380



>ref|XP_007012094.1| Glycosyl transferase isoform 1 [Theobroma cacao]
 ref|XP_007012095.1| Glycosyl transferase isoform 1 [Theobroma cacao]
 ref|XP_007012096.1| Glycosyl transferase isoform 1 [Theobroma cacao]
 ref|XP_007012097.1| Glycosyl transferase isoform 1 [Theobroma cacao]
 gb|EOY29713.1| Glycosyl transferase isoform 1 [Theobroma cacao]
 gb|EOY29714.1| Glycosyl transferase isoform 1 [Theobroma cacao]
 gb|EOY29715.1| Glycosyl transferase isoform 1 [Theobroma cacao]
 gb|EOY29716.1| Glycosyl transferase isoform 1 [Theobroma cacao]
Length=443

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 6/56 (11%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE-----FLQPYTFIKNHSSIITSL  386
            A+ FIEQ+VEDESQMEG+ ++CSR+MVW+ + E     + Q ++ +KN+  II  L
Sbjct  388  ASLFIEQVVEDESQMEGLLQDCSRVMVWELNAESSNSFYPQKWS-MKNNLDIIAPL  442



>ref|XP_009400830.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Musa acuminata 
subsp. malaccensis]
Length=435

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQIVEDESQMEG+P +CSRIM W    E
Sbjct  369  TTFIEQIVEDESQMEGLPNDCSRIMNWHLHLE  400



>ref|XP_009777181.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nicotiana 
sylvestris]
 ref|XP_009777182.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nicotiana 
sylvestris]
Length=387

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQP  428
            T FIEQIVEDESQMEGIP  CSR++ W    E   P
Sbjct  333  TTFIEQIVEDESQMEGIPSGCSRVLSWHLHLEAHGP  368



>gb|EMT03092.1| Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 
2 [Aegilops tauschii]
Length=428

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDESQMEG+  NC+RIMVW FD E
Sbjct  378  SRFIERLVEDESQMEGLADNCTRIMVWNFDLE  409



>ref|XP_002516557.1| beta-1,3-glucuronyltransferase, putative [Ricinus communis]
 gb|EEF45898.1| beta-1,3-glucuronyltransferase, putative [Ricinus communis]
Length=438

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 4/54 (7%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE----FLQPYTFIKNHSSIITSL  386
            + FIEQ+VEDESQMEG+ ++CSRIMVW+ + E    F  P  F  ++  +I+ L
Sbjct  384  STFIEQVVEDESQMEGLLEDCSRIMVWRLNLEPPNSFYPPKWFTISNLDVISQL  437



>emb|CDM83963.1| unnamed protein product [Triticum aestivum]
Length=442

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDESQMEG+  NC+RIMVW FD E
Sbjct  392  SRFIERLVEDESQMEGLADNCTRIMVWNFDLE  423



>emb|CDP00965.1| unnamed protein product [Coffea canephora]
Length=386

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEGIP  CSRIM W    E
Sbjct  331  TTFIEQVVEDESQMEGIPPGCSRIMNWHLHLE  362



>emb|CAD98789.1| 3-beta-glucuronosyltransferase [Hordeum vulgare]
Length=357

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDESQMEG+  NC+RIMVW FD E
Sbjct  307  SRFIERLVEDESQMEGLADNCTRIMVWNFDLE  338



>emb|CAI93180.1| glycosyltransferase [Triticum aestivum]
Length=357

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDESQMEG+  NC+RIMVW FD E
Sbjct  307  SRFIERLVEDESQMEGLADNCTRIMVWNFDLE  338



>ref|XP_003569552.1| PREDICTED: probable glucuronosyltransferase Os01g0675500 [Brachypodium 
distachyon]
Length=446

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDESQMEG+  NC+RIMVW FD E
Sbjct  392  SRFIERLVEDESQMEGLADNCTRIMVWNFDLE  423



>ref|XP_009398431.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398432.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Musa acuminata 
subsp. malaccensis]
Length=420

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            +AF+EQIVEDESQMEG+P  CSRIM W    E
Sbjct  366  SAFVEQIVEDESQMEGLPNGCSRIMNWHLHEE  397



>ref|XP_004969521.1| PREDICTED: probable glucuronosyltransferase Os01g0675500-like 
[Setaria italica]
Length=446

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDE+QMEG+  NCSR+MVW FD E
Sbjct  392  SRFIEKLVEDETQMEGLADNCSRVMVWNFDLE  423



>ref|XP_003526483.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like [Glycine 
max]
 gb|KHN18186.1| Putative beta-1,4-xylosyltransferase IRX9H [Glycine soja]
Length=433

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            +  IEQ+VEDESQMEG+  NCSR+MVWQ D E
Sbjct  377  STLIEQVVEDESQMEGLMHNCSRVMVWQIDLE  408



>ref|XP_008785313.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Phoenix 
dactylifera]
Length=394

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQF  449
            T FIEQIVEDESQMEG+P NC+RIM W  
Sbjct  340  TTFIEQIVEDESQMEGLPYNCARIMNWHL  368



>gb|EYU34234.1| hypothetical protein MIMGU_mgv1a007301mg [Erythranthe guttata]
 gb|EYU34235.1| hypothetical protein MIMGU_mgv1a007301mg [Erythranthe guttata]
Length=411

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQIVEDESQMEGIP++C RIM W    E
Sbjct  357  TTFIEQIVEDESQMEGIPQSCYRIMNWHLHLE  388



>ref|XP_002963107.1| glycosyltransferase IRX9-like protein [Selaginella moellendorffii]
 gb|EFJ36570.1| glycosyltransferase IRX9-like protein [Selaginella moellendorffii]
Length=357

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDE+QMEG+P  CS+IMVW    E
Sbjct  304  TTFIEQLVEDENQMEGLPSGCSKIMVWHLHLE  335



>ref|XP_009398588.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398589.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Musa acuminata 
subsp. malaccensis]
Length=431

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQIVEDESQMEG+P +C RIM W    E
Sbjct  377  TTFIEQIVEDESQMEGLPNDCPRIMNWHLHLE  408



>ref|XP_002980217.1| glycosyltransferase IRX9-like protein [Selaginella moellendorffii]
 gb|EFJ18477.1| glycosyltransferase IRX9-like protein [Selaginella moellendorffii]
Length=357

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDE+QMEG+P  CS+IMVW    E
Sbjct  304  TTFIEQLVEDENQMEGLPSGCSKIMVWHLHLE  335



>ref|XP_009597765.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nicotiana 
tomentosiformis]
 ref|XP_009597766.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nicotiana 
tomentosiformis]
Length=387

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQIVEDESQMEGIP  CSR++ W    E
Sbjct  333  TTFIEQIVEDESQMEGIPPGCSRVLNWHLHLE  364



>ref|XP_008466052.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Cucumis 
melo]
 ref|XP_008466054.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Cucumis 
melo]
 ref|XP_008466055.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Cucumis 
melo]
Length=435

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 4/55 (7%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEF---LQPYT-FIKNHSSIITSL  386
            A+ FIEQIVEDESQMEG+ ++CSRIMVW  + +    + P+  F+ N+  +  SL
Sbjct  380  ASDFIEQIVEDESQMEGLLEDCSRIMVWNINFKLSSAVYPHKWFMTNYLDVTASL  434



>ref|NP_001242118.1| uncharacterized protein LOC100808765 [Glycine max]
 gb|ACU18893.1| unknown [Glycine max]
Length=433

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 8/56 (14%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPYTF------IKNHSSIITSL  386
            +  IEQ+VEDESQMEG+  NCSR+MVW  D E    Y+F      +KN+   I  L
Sbjct  377  STLIEQVVEDESQMEGLMDNCSRVMVWHIDLE--SSYSFYPQKWIVKNNLDAIVHL  430



>ref|XP_006833395.1| hypothetical protein AMTR_s00109p00122730 [Amborella trichopoda]
 gb|ERM98673.1| hypothetical protein AMTR_s00109p00122730 [Amborella trichopoda]
Length=461

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG+P +CS+IM W+   E
Sbjct  393  TKFIEQLVEDESQMEGLPDDCSKIMAWRLHLE  424



>ref|XP_006577851.1| PREDICTED: uncharacterized protein LOC100808765 isoform X1 [Glycine 
max]
Length=433

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 8/56 (14%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPYTF------IKNHSSIITSL  386
            +  IEQ+VEDESQMEG+  NCSR+MVW  D E    Y+F      +KN+   I  L
Sbjct  377  STLIEQVVEDESQMEGLMDNCSRVMVWHIDLE--SSYSFYPQKWIVKNNLDAIVHL  430



>gb|KHN10212.1| Putative beta-1,4-xylosyltransferase IRX9H [Glycine soja]
Length=433

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            +  IEQ+VEDESQMEG+  NCSR+MVW  D E
Sbjct  377  STLIEQVVEDESQMEGLMDNCSRVMVWHIDLE  408



>ref|XP_003580881.1| PREDICTED: probable glucuronosyltransferase Os04g0103100 [Brachypodium 
distachyon]
Length=396

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQ--FDTEFL  434
             TAF+EQ+VEDESQMEGIP +CS+IM W   F +E L
Sbjct  341  GTAFVEQLVEDESQMEGIPADCSQIMNWHVPFGSESL  377



>emb|CAI93179.1| glycosyltransferase [Saccharum officinarum]
Length=448

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDE+QMEG+  NC+R+MVW FD E
Sbjct  394  SRFIEKLVEDETQMEGLADNCTRVMVWNFDLE  425



>ref|XP_002458309.1| hypothetical protein SORBIDRAFT_03g030990 [Sorghum bicolor]
 gb|EES03429.1| hypothetical protein SORBIDRAFT_03g030990 [Sorghum bicolor]
Length=448

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDE+QMEG+  NC+R+MVW FD E
Sbjct  394  SRFIEKLVEDETQMEGLTDNCTRVMVWNFDLE  425



>ref|NP_001131482.1| uncharacterized protein LOC100192819 [Zea mays]
 gb|ACF79909.1| unknown [Zea mays]
Length=387

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQ  452
            AT F+EQ+VEDESQMEGIP +CS+IM W 
Sbjct  332  ATTFVEQLVEDESQMEGIPADCSQIMNWH  360



>ref|XP_010917546.1| PREDICTED: probable glucuronosyltransferase Os01g0675500 [Elaeis 
guineensis]
Length=441

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG+  NCS IMVW    E
Sbjct  387  TTFIEQLVEDESQMEGLANNCSEIMVWHLHLE  418



>ref|XP_006450659.1| hypothetical protein CICLE_v10008306mg [Citrus clementina]
 ref|XP_006450660.1| hypothetical protein CICLE_v10008306mg [Citrus clementina]
 ref|XP_006450661.1| hypothetical protein CICLE_v10008306mg [Citrus clementina]
 gb|ESR63899.1| hypothetical protein CICLE_v10008306mg [Citrus clementina]
 gb|ESR63900.1| hypothetical protein CICLE_v10008306mg [Citrus clementina]
 gb|ESR63901.1| hypothetical protein CICLE_v10008306mg [Citrus clementina]
Length=443

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 4/55 (7%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE----FLQPYTFIKNHSSIITSL  386
            A+ F+EQIVEDESQMEG+ + CSRIM W    E    F     F+KN+  ++  L
Sbjct  385  ASTFVEQIVEDESQMEGLLEECSRIMAWLLPLESSNAFYPQKWFLKNNLDVMAPL  439



>ref|XP_002309550.2| hypothetical protein POPTR_0006s25690g [Populus trichocarpa]
 gb|EEE93073.2| hypothetical protein POPTR_0006s25690g [Populus trichocarpa]
Length=442

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 4/52 (8%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVW----QFDTEFLQPYTFIKNHSSIIT  392
            ++FIEQ+VEDESQMEG+ ++CSR+MVW    Q       P  F+  +  +IT
Sbjct  388  SSFIEQVVEDESQMEGLLEDCSRVMVWLLQLQSSNSLYPPKWFLDGNLDVIT  439



>ref|XP_006476065.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476066.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like isoform 
X2 [Citrus sinensis]
 ref|XP_006476067.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like isoform 
X3 [Citrus sinensis]
Length=443

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 4/55 (7%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE----FLQPYTFIKNHSSIITSL  386
            A+ F+EQIVEDESQMEG+ + CSRIM W    E    F     F+KN+  ++  L
Sbjct  385  ASTFVEQIVEDESQMEGLLEECSRIMAWLLPLESSNAFYPQKWFLKNNLDVMAPL  439



>ref|XP_009381961.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Musa acuminata 
subsp. malaccensis]
Length=364

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQIVEDE Q+EG+P +CSRIM W+   E
Sbjct  310  TGFIEQIVEDEGQLEGLPNDCSRIMNWRLQLE  341



>gb|ACN27051.1| unknown [Zea mays]
Length=113

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++V++E Q+EG+P NCSR+MVW F+ E
Sbjct  59   SRFIEKLVKNERQVEGLPDNCSRVMVWNFNLE  90



>gb|KDO79768.1| hypothetical protein CISIN_1g013438mg [Citrus sinensis]
 gb|KDO79769.1| hypothetical protein CISIN_1g013438mg [Citrus sinensis]
Length=443

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 4/55 (7%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE----FLQPYTFIKNHSSIITSL  386
            A+ F+EQIVEDESQMEG+ + CSRIM W    E    F     F+KN+  ++  L
Sbjct  385  ASTFVEQIVEDESQMEGLLEECSRIMAWLLPLESSNAFYPQKWFLKNNLDVMAPL  439



>ref|XP_004136218.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like [Cucumis 
sativus]
 gb|KGN60327.1| hypothetical protein Csa_3G895730 [Cucumis sativus]
Length=435

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPYTFIKNHSSIITS  389
            A+ FIEQIVEDESQMEG  ++CSRIMVW  +    +P + +  H   +T+
Sbjct  380  ASDFIEQIVEDESQMEGFLEDCSRIMVWNVN---FKPSSAVYPHKWFVTN  426



>ref|XP_010668179.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Beta vulgaris 
subsp. vulgaris]
Length=449

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            A+ FIEQ+VEDESQMEG+ +NCS IMVW+   E
Sbjct  392  ASTFIEQVVEDESQMEGLLENCSSIMVWRLPLE  424



>emb|CAN73652.1| hypothetical protein VITISV_039322 [Vitis vinifera]
Length=306

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG P  CSRIM W    E
Sbjct  252  TTFIEQLVEDESQMEGTPAGCSRIMNWHLHLE  283



>emb|CBI19320.3| unnamed protein product [Vitis vinifera]
Length=381

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG P  CSRIM W    E
Sbjct  327  TTFIEQLVEDESQMEGTPAGCSRIMNWHLHLE  358



>ref|XP_002283625.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Vitis 
vinifera]
Length=405

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG P  CSRIM W    E
Sbjct  351  TTFIEQLVEDESQMEGTPAGCSRIMNWHLHLE  382



>ref|XP_002893477.1| glycosyl transferase family 43 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69736.1| glycosyl transferase family 43 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 5/53 (9%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQ-----FDTEFLQPYTFIKNHSSIIT  392
            T+FIEQ+V DES+MEG+P  CSRI+ W       D  + Q +   KN  ++IT
Sbjct  341  TSFIEQVVADESEMEGVPPACSRILNWHLHLDALDVPYPQGWAIQKNLQALIT  393



>ref|XP_002281445.2| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Vitis 
vinifera]
 emb|CBI20871.3| unnamed protein product [Vitis vinifera]
Length=448

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 4/54 (7%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE----FLQPYTFIKNHSSIITSL  386
            + FIE++VEDESQMEG+P+ CS IMVW    E    F      +KN+  +I  L
Sbjct  394  STFIERLVEDESQMEGLPEGCSTIMVWHLHLESSHSFYPREWLMKNNLDVIAQL  447



>ref|XP_004501173.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501174.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like isoform 
X2 [Cicer arietinum]
Length=442

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPYTF  419
            +  IEQIVEDESQMEG+  +CSR+MVW  D   +  Y+F
Sbjct  383  STLIEQIVEDESQMEGLMNDCSRVMVWHID--LVSSYSF  419



>ref|XP_007137197.1| hypothetical protein PHAVU_009G107900g [Phaseolus vulgaris]
 ref|XP_007137198.1| hypothetical protein PHAVU_009G107900g [Phaseolus vulgaris]
 gb|ESW09191.1| hypothetical protein PHAVU_009G107900g [Phaseolus vulgaris]
 gb|ESW09192.1| hypothetical protein PHAVU_009G107900g [Phaseolus vulgaris]
Length=433

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            +  IEQ++EDESQMEG+  NCSR+MVW  D E
Sbjct  377  STLIEQVIEDESQMEGLMDNCSRVMVWHIDLE  408



>gb|EAY75350.1| hypothetical protein OsI_03246 [Oryza sativa Indica Group]
Length=446

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDESQMEG+  NC+R+MVW F+ E
Sbjct  392  SRFIEKLVEDESQMEGLGDNCTRVMVWNFELE  423



>emb|CDX71576.1| BnaC09g26170D [Brassica napus]
Length=244

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQ-----FDTEFLQPYTFIKNHSSIIT  392
            T FIEQ+V DES MEG+P  CSRI+ W       D  + Q +   KN  ++IT
Sbjct  190  TTFIEQVVADESDMEGVPSACSRILNWHLHLDALDVPYPQGWVMQKNLEAVIT  242



>ref|NP_001043846.1| Os01g0675500 [Oryza sativa Japonica Group]
 sp|Q5QM25.1|GT12_ORYSJ RecName: Full=Probable glucuronosyltransferase Os01g0675500 [Oryza 
sativa Japonica Group]
 dbj|BAD73380.1| 3-beta-glucuronosyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAD73527.1| 3-beta-glucuronosyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAF05760.1| Os01g0675500 [Oryza sativa Japonica Group]
 gb|EAZ13068.1| hypothetical protein OsJ_02989 [Oryza sativa Japonica Group]
 gb|AHW98786.1| GT43 family glycosyltransferase F [Oryza sativa Japonica Group]
Length=446

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDESQMEG+  NC+R+MVW F+ E
Sbjct  392  SRFIEKLVEDESQMEGLGDNCTRVMVWNFELE  423



>ref|XP_009384670.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Musa acuminata 
subsp. malaccensis]
Length=363

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIE IVEDE QMEG+P +CSRIM W+   E
Sbjct  309  TGFIEHIVEDEHQMEGLPDDCSRIMNWRMHLE  340



>gb|KDO81335.1| hypothetical protein CISIN_1g0160702mg, partial [Citrus sinensis]
 gb|KDO81336.1| hypothetical protein CISIN_1g0160702mg, partial [Citrus sinensis]
Length=139

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG P +CSRI+ W    +
Sbjct  85   TTFIEQVVEDESQMEGTPPSCSRILNWHLHLD  116



>ref|XP_006644511.1| PREDICTED: probable glucuronosyltransferase Os01g0675500-like 
[Oryza brachyantha]
Length=445

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDESQMEG+  NC+R+MVW F+ E
Sbjct  391  SRFIEKLVEDESQMEGLGDNCTRVMVWNFELE  422



>ref|XP_010499243.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Camelina 
sativa]
Length=396

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 5/53 (9%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQF-----DTEFLQPYTFIKNHSSIIT  392
            T FIEQ+V DES+MEG+P  CSRI+ W       D  + Q +   KN  ++IT
Sbjct  342  TTFIEQVVADESEMEGVPPACSRILNWHLHLDARDVPYPQGWAIQKNLQALIT  394



>ref|XP_010254664.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Nelumbo 
nucifera]
Length=409

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEGIP  C R++ W    E
Sbjct  355  TTFIEQVVEDESQMEGIPHGCGRVLNWHLHLE  386



>ref|XP_006305000.1| hypothetical protein CARUB_v10009365mg [Capsella rubella]
 gb|EOA37898.1| hypothetical protein CARUB_v10009365mg [Capsella rubella]
Length=395

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 5/53 (9%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQF-----DTEFLQPYTFIKNHSSIIT  392
            T FIEQ+V DES+MEG+P  CSRI+ W       D  + Q +   KN  ++IT
Sbjct  341  TTFIEQVVADESEMEGVPPACSRILNWHLHLDARDVPYPQGWAIQKNLQALIT  393



>ref|XP_010530340.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Tarenaya 
hassleriana]
Length=397

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG+P +CSRI+ W    +
Sbjct  357  TTFIEQVVEDESQMEGVPPDCSRILNWHLHLD  388



>ref|XP_006415747.1| hypothetical protein EUTSA_v10007547mg [Eutrema salsugineum]
 gb|ESQ34100.1| hypothetical protein EUTSA_v10007547mg [Eutrema salsugineum]
Length=469

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 5/53 (9%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQF-----DTEFLQPYTFIKNHSSIIT  392
            T FIEQ+V DES+MEG+P  CSRI+ W       D  + Q +   KN  ++IT
Sbjct  415  TTFIEQVVADESEMEGVPPACSRILNWHLHLDARDVPYPQGWVIQKNLEALIT  467



>ref|XP_010460516.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Camelina 
sativa]
Length=397

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 5/53 (9%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQF-----DTEFLQPYTFIKNHSSIIT  392
            T FIEQ+V DES+MEG+P  CSRI+ W       D  + Q +   KN  ++IT
Sbjct  343  TTFIEQVVADESEMEGVPPACSRILNWHLHLDARDVPYPQGWAIQKNLQALIT  395



>ref|NP_001051997.1| Os04g0103100 [Oryza sativa Japonica Group]
 sp|Q7XTB2.2|GT41_ORYSJ RecName: Full=Probable glucuronosyltransferase Os04g0103100 [Oryza 
sativa Japonica Group]
 emb|CAE01585.2| OSJNBa0068L06.11 [Oryza sativa Japonica Group]
 emb|CAD39333.2| OSJNBa0094O15.1 [Oryza sativa Japonica Group]
 dbj|BAF13911.1| Os04g0103100 [Oryza sativa Japonica Group]
 gb|EEE60368.1| hypothetical protein OsJ_13499 [Oryza sativa Japonica Group]
 gb|AHW98788.1| GT43 family glycosyltransferase H [Oryza sativa Japonica Group]
Length=381

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQ  452
             +AF+EQ+VEDESQMEGIP +CS+IM W 
Sbjct  326  GSAFVEQLVEDESQMEGIPADCSQIMNWH  354



>emb|CAH65757.1| OSIGBa0123D13.6 [Oryza sativa Indica Group]
 emb|CAH65764.1| OSIGBa0148I18.1 [Oryza sativa Indica Group]
 gb|EEC76622.1| hypothetical protein OsI_14506 [Oryza sativa Indica Group]
Length=381

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQ  452
             +AF+EQ+VEDESQMEGIP +CS+IM W 
Sbjct  326  GSAFVEQLVEDESQMEGIPADCSQIMNWH  354



>ref|XP_002446005.1| hypothetical protein SORBIDRAFT_06g000430 [Sorghum bicolor]
 gb|EES10333.1| hypothetical protein SORBIDRAFT_06g000430 [Sorghum bicolor]
Length=385

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 2/36 (6%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQ--FDTEFL  434
            T FIEQ+VEDESQMEGIP +CS+IM W   F +E L
Sbjct  331  TTFIEQLVEDESQMEGIPADCSQIMNWHVPFGSENL  366



>gb|EPS67676.1| hypothetical protein M569_07100 [Genlisea aurea]
Length=400

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T+FIEQ+VEDE+QMEG+P  C RIM W    E
Sbjct  335  TSFIEQVVEDEAQMEGVPGGCDRIMNWHLHLE  366



>ref|XP_009102966.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Brassica 
rapa]
Length=385

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQ-----FDTEFLQPYTFIKNHSSIIT  392
            T FIEQ+V DES MEG+P  CSRI+ W       D  + Q +   KN  ++IT
Sbjct  331  TTFIEQVVADESDMEGVPSACSRILNWHLHLDALDVPYPQGWVMQKNLEAVIT  383



>emb|CDY66999.1| BnaA07g37250D [Brassica napus]
Length=382

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQ-----FDTEFLQPYTFIKNHSSIIT  392
            T FIEQ+V DES MEG+P  CSRI+ W       D  + Q +   KN  ++IT
Sbjct  328  TTFIEQVVADESDMEGVPSACSRILNWHLHLDALDVPYPQGWVMQKNLEAVIT  380



>gb|AHA33627.1| beta-1,4-xylosyltransferase [Brassica oleracea var. italica]
Length=384

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQ-----FDTEFLQPYTFIKNHSSIIT  392
            T FIEQ+V DES MEG+P  CSRI+ W       D  + Q +   KN  ++IT
Sbjct  330  TTFIEQVVADESDMEGVPPACSRILNWHLHLDALDVPYPQGWVMQKNLEAVIT  382



>emb|CAI93172.1| beta-1,3-glucuronosyltransferase [Gossypium raimondii]
Length=394

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEGIP  CS++M W    +
Sbjct  340  TTFIEQVVEDESQMEGIPPGCSKVMNWHLHLD  371



>ref|XP_008378090.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Malus 
domestica]
 ref|XP_008378091.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Malus 
domestica]
Length=443

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQ  452
             + FIEQ+VEDESQMEG+  +CSRIMVWQ
Sbjct  385  TSTFIEQVVEDESQMEGLLHDCSRIMVWQ  413



>ref|XP_004974970.1| PREDICTED: probable glucuronosyltransferase Os04g0103100-like 
[Setaria italica]
Length=385

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 2/37 (5%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQ--FDTEFL  434
             T F+EQ+VEDESQMEGIP +CS IM W   F +E L
Sbjct  330  GTTFVEQLVEDESQMEGIPADCSHIMNWHVPFGSENL  366



>emb|CDP16179.1| unnamed protein product [Coffea canephora]
Length=460

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 2/46 (4%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPYTFIKNHSS  401
             + FIEQIVE +++ME +P  CSR MVW+ D EFL  Y+F + +S+
Sbjct  394  VSRFIEQIVEGQNEMECLPLACSRAMVWRLDGEFL--YSFPRENST  437



>emb|CAN81600.1| hypothetical protein VITISV_024403 [Vitis vinifera]
Length=265

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
             + FIE++VEDESQMEG+P+ CS IMVW    E
Sbjct  210  VSTFIERLVEDESQMEGLPEGCSTIMVWHLHLE  242



>ref|XP_008662210.1| PREDICTED: uncharacterized protein LOC100383623 isoform X1 [Zea 
mays]
 gb|AFW57750.1| hypothetical protein ZEAMMB73_821216 [Zea mays]
Length=392

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQ  452
            T F+EQ+VEDESQMEGIP +CS+IM W 
Sbjct  338  TTFVEQLVEDESQMEGIPADCSQIMNWH  365



>dbj|BAJ88676.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93271.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQ  452
             T F+EQ+VEDESQMEGIP +CS+IM W 
Sbjct  338  GTTFVEQLVEDESQMEGIPADCSQIMNWH  366



>tpg|DAA58147.1| TPA: galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 
1 [Zea mays]
Length=448

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDE+QMEG+  NC+R+MVW  D E
Sbjct  394  SRFIEKLVEDETQMEGLADNCTRVMVWNLDLE  425



>ref|NP_001151473.1| galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 
1 [Zea mays]
 gb|ACG42986.1| galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 
1 [Zea mays]
Length=448

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++VEDE+QMEG+  NC+R+MVW  D E
Sbjct  394  SRFIEKLVEDETQMEGLADNCTRVMVWNLDLE  425



>ref|XP_011078471.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Sesamum 
indicum]
Length=415

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQIVEDE QMEGIP  C RIM W    E
Sbjct  361  TTFIEQIVEDERQMEGIPPGCYRIMNWHLHIE  392



>gb|KDP34199.1| hypothetical protein JCGZ_07770 [Jatropha curcas]
Length=439

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTEFLQPY  425
             +  IEQ+VEDESQMEG+ ++CSR+MVW    E   P+
Sbjct  384  VSTIIEQVVEDESQMEGLLQDCSRVMVWHLQLESSNPF  421



>gb|EMT28971.1| Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 
1 [Aegilops tauschii]
Length=204

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQ  452
             T F+EQ+VEDESQMEGIP +CS+IM W 
Sbjct  149  GTTFVEQLVEDESQMEGIPADCSQIMNWH  177



>emb|CDP00964.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
             T FIEQ+VEDESQMEG+P  CS+I+ W    E
Sbjct  349  GTTFIEQVVEDESQMEGLPLGCSKILNWHLKLE  381



>ref|XP_011019628.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H isoform 
X1 [Populus euphratica]
Length=442

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 4/52 (8%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVW----QFDTEFLQPYTFIKNHSSIIT  392
            ++FIEQ+VEDESQMEGI ++CSR+ VW    Q       P  F+  +  +IT
Sbjct  388  SSFIEQVVEDESQMEGILEDCSRVKVWLLQLQSSNSLYPPKWFLDGNMDVIT  439



>ref|XP_009410918.1| PREDICTED: probable glucuronosyltransferase Os01g0675500 [Musa 
acuminata subsp. malaccensis]
Length=423

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            TAFIE++ EDESQMEG+  NCS IMVW    E
Sbjct  369  TAFIEELFEDESQMEGLANNCSLIMVWHLRVE  400



>emb|CDX90097.1| BnaA08g18870D [Brassica napus]
Length=389

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQ-----FDTEFLQPYTFIKNHSSIIT  392
            T FIEQ+V DES MEG+P  CSRI+ W       D  + Q +   KN  ++IT
Sbjct  335  TTFIEQVVADESDMEGVPPACSRILNWHLHLDALDVPYPQGWVVQKNLEALIT  387



>ref|XP_002510001.1| beta-1,3-glucuronyltransferase, putative [Ricinus communis]
 gb|EEF52188.1| beta-1,3-glucuronyltransferase, putative [Ricinus communis]
Length=405

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG+P  CSR++ W    +
Sbjct  351  TTFIEQVVEDESQMEGVPPGCSRVLNWHLHLD  382



>ref|XP_004238039.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Solanum 
lycopersicum]
 ref|XP_010320243.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Solanum 
lycopersicum]
Length=386

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQIVEDESQME +P  CSR++ W    E
Sbjct  332  TTFIEQIVEDESQMEAVPPGCSRVLNWHLHLE  363



>ref|XP_006472378.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H-like [Citrus 
sinensis]
Length=395

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG P +CSRI+ W    +
Sbjct  341  TTFIEQVVEDESQMEGTPPSCSRILNWHLHLD  372



>gb|KHG21195.1| putative beta-1,4-xylosyltransferase IRX9H -like protein [Gossypium 
arboreum]
Length=385

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG+P  CS++M W    +
Sbjct  331  TTFIEQVVEDESQMEGLPPGCSKVMNWHLHLD  362



>ref|XP_010060139.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Eucalyptus 
grandis]
 gb|KCW66698.1| hypothetical protein EUGRSUZ_F00463 [Eucalyptus grandis]
 gb|KCW66699.1| hypothetical protein EUGRSUZ_F00463 [Eucalyptus grandis]
 gb|KCW66700.1| hypothetical protein EUGRSUZ_F00463 [Eucalyptus grandis]
Length=407

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FI+Q+VEDESQMEGIP  CSRI+ W    E
Sbjct  353  TTFIQQVVEDESQMEGIPFGCSRIINWHLHLE  384



>emb|CAE12013.1| beta3-glucuronyltransferase [Hordeum vulgare]
Length=276

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQ  452
             T F+EQ+VEDESQMEGIP +CS+IM W 
Sbjct  221  GTTFVEQLVEDESQMEGIPADCSQIMNWH  249



>ref|XP_008352726.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Malus 
domestica]
Length=441

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG P  CS++M W    E
Sbjct  386  TTFIEQVVEDESQMEGTPAGCSKVMNWHLHLE  417



>ref|XP_010556501.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H isoform 
X1 [Tarenaya hassleriana]
Length=417

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG+P +CS+I+ W    +
Sbjct  363  TTFIEQVVEDESQMEGVPSDCSKILNWHLHLD  394



>ref|XP_010556502.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H isoform 
X2 [Tarenaya hassleriana]
Length=319

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG+P +CS+I+ W    +
Sbjct  265  TTFIEQVVEDESQMEGVPSDCSKILNWHLHLD  296



>ref|XP_008655444.1| PREDICTED: LOC606448 isoform X1 [Zea mays]
 ref|XP_008655445.1| PREDICTED: LOC606448 isoform X1 [Zea mays]
 gb|ACN26728.1| unknown [Zea mays]
 gb|AFW81092.1| beta3-glucuronyltransferase isoform 1 [Zea mays]
 gb|AFW81093.1| beta3-glucuronyltransferase isoform 2 [Zea mays]
Length=451

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++V++E Q+EG+P NCSR+MVW F+ E
Sbjct  397  SRFIEKLVKNERQVEGLPDNCSRVMVWNFNLE  428



>ref|XP_009348125.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Pyrus 
x bretschneideri]
 ref|XP_009348126.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Pyrus 
x bretschneideri]
Length=409

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            T FIEQ+VEDESQMEG P  CS++M W    E
Sbjct  354  TTFIEQVVEDESQMEGTPAGCSKVMNWHLHLE  385



>ref|NP_001105786.1| LOC606448 [Zea mays]
 emb|CAE11883.1| beta3-glucuronyltransferase [Zea mays]
Length=329

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            + FIE++V++E Q+EG+P NCSR+MVW F+ E
Sbjct  275  SRFIEKLVKNERQVEGLPDNCSRVMVWNFNLE  306



>ref|XP_010047266.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Eucalyptus 
grandis]
 gb|KCW79139.1| hypothetical protein EUGRSUZ_C00584 [Eucalyptus grandis]
Length=441

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE  440
            +  +EQIVEDESQMEG+ +NCSR+MVW    +
Sbjct  387  STLVEQIVEDESQMEGLLQNCSRVMVWHLHVD  418



>ref|XP_010478101.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Camelina 
sativa]
Length=397

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 5/53 (9%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQF-----DTEFLQPYTFIKNHSSIIT  392
            T FIEQ+V DES+MEG+P  CS+I+ W       D  + Q +   KN  ++IT
Sbjct  343  TTFIEQVVADESEMEGVPPACSKILNWHLHLDARDVPYPQGWAIQKNLQALIT  395



>ref|XP_008466103.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Cucumis 
melo]
 ref|XP_008466104.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Cucumis 
melo]
Length=408

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 5/47 (11%)
 Frame = -1

Query  535  TAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE---FLQP--YTFIKN  410
            T FIEQ+VEDESQMEG+P  C ++M W    E   F+ P  + F KN
Sbjct  354  TTFIEQVVEDESQMEGVPTGCLKVMNWHLHLEVPNFVYPSGWVFQKN  400



>ref|XP_007222290.1| hypothetical protein PRUPE_ppa005926mg [Prunus persica]
 gb|EMJ23489.1| hypothetical protein PRUPE_ppa005926mg [Prunus persica]
Length=437

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 4/55 (7%)
 Frame = -1

Query  538  ATAFIEQIVEDESQMEGIPKNCSRIMVWQFDTE---FLQPYTFI-KNHSSIITSL  386
            A+ FIEQ+VEDESQMEG+  +CS IMVW    E      P+ +I K+   +I SL
Sbjct  382  ASTFIEQVVEDESQMEGLQHDCSTIMVWYHHHESSNTFYPHKWIMKDSLDVIASL  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507948461360