BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22695_g1_i1 len=1972 path=[1:0-176 @178@!:177-861 863:862-868
870:869-1008 1010:1009-1033 4100:1034-1609 5086:1610-1630
4697:1631-1971]

Length=1972
                                                                      Score     E

ref|XP_009151561.1|  PREDICTED: putative ribonuclease H protein A...    365   6e-108   
ref|XP_009124282.1|  PREDICTED: putative ribonuclease H protein A...    359   3e-107   
ref|XP_009101981.1|  PREDICTED: putative ribonuclease H protein A...    356   1e-104   
sp|P0C2F6.1|RNHX1_ARATH  RecName: Full=Putative ribonuclease H pr...    340   1e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AID60103.1|  hypothetical protein                                    340   2e-103   
ref|XP_009116295.1|  PREDICTED: putative ribonuclease H protein A...    340   5e-102   
emb|CCA66009.1|  hypothetical protein                                   348   3e-101   
gb|AAC63844.1|  putative non-LTR retroelement reverse transcriptase     326   9e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119466.1|  PREDICTED: uncharacterized protein LOC103844431    328   2e-93    
ref|XP_010670869.1|  PREDICTED: uncharacterized protein LOC104887816    325   3e-93    
ref|XP_009344908.1|  PREDICTED: uncharacterized protein LOC103936764    317   2e-90    
gb|ABW81175.1|  non-LTR retrotransposon transposase                     308   8e-90    Arabidopsis cebennensis
ref|XP_006480844.1|  PREDICTED: putative ribonuclease H protein A...    292   4e-84    
ref|XP_009123770.1|  PREDICTED: putative ribonuclease H protein A...    282   1e-82    
dbj|BAE79382.1|  unnamed protein product                                289   1e-80    Ipomoea batatas [batate]
dbj|BAE79385.1|  unnamed protein product                                286   1e-79    Ipomoea batatas [batate]
gb|AAF23831.1|AC007234_3  F1E22.12                                      280   4e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007039838.1|  RNA-directed DNA polymerase (Reverse transcr...    272   5e-78    
dbj|BAE79384.1|  unnamed protein product                                281   2e-77    Ipomoea batatas [batate]
gb|ABD28505.2|  RNA-directed DNA polymerase (Reverse transcriptas...    272   3e-77    Medicago truncatula
ref|XP_010674616.1|  PREDICTED: uncharacterized protein LOC104890737    276   1e-76    
emb|CCA65997.1|  hypothetical protein                                   275   1e-75    
ref|XP_006469117.1|  PREDICTED: putative ribonuclease H protein A...    259   1e-74    
emb|CAB78008.1|  putative protein                                       264   7e-73    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB09815.1|  non-LTR retroelement reverse transcriptase-like        251   7e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008221358.1|  PREDICTED: putative ribonuclease H protein A...    254   2e-69    
ref|XP_009144970.1|  PREDICTED: putative ribonuclease H protein A...    231   1e-64    
ref|XP_006492639.1|  PREDICTED: putative ribonuclease H protein A...    231   2e-63    
ref|XP_009126860.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    236   3e-62    
ref|XP_008221996.1|  PREDICTED: putative ribonuclease H protein A...    224   5e-61    
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg             220   1e-57    
ref|XP_007023230.1|  Non-LTR retroelement reverse transcriptase         220   1e-57    
ref|XP_009107896.1|  PREDICTED: putative ribonuclease H protein A...    210   3e-57    
ref|XP_006490008.1|  PREDICTED: uncharacterized protein LOC102624085    221   3e-57    
ref|XP_010672383.1|  PREDICTED: uncharacterized protein LOC104888966    221   4e-57    
ref|XP_004289367.1|  PREDICTED: putative ribonuclease H protein A...    219   6e-57    
ref|XP_009102110.1|  PREDICTED: putative ribonuclease H protein A...    215   1e-56    
gb|ADK92871.1|  retrotransposon protein                                 212   3e-56    
ref|XP_010520746.1|  PREDICTED: putative ribonuclease H protein A...    207   9e-56    
gb|AAK39575.1|AC025296_10  putative reverse transcriptase               213   9e-56    Oryza sativa [red rice]
gb|AAC26674.1|  putative non-LTR retroelement reverse transcriptase     212   4e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682933.1|  PREDICTED: uncharacterized protein LOC104897695    214   5e-55    
ref|XP_008353155.1|  PREDICTED: putative ribonuclease H protein A...    209   6e-55    
ref|XP_009115910.1|  PREDICTED: putative ribonuclease H protein A...    207   1e-53    
ref|XP_009124780.1|  PREDICTED: putative ribonuclease H protein A...    197   2e-53    
ref|NP_001175214.1|  Os07g0501200                                       204   3e-53    
gb|KFK31801.1|  hypothetical protein AALP_AA6G160600                    198   3e-53    
ref|XP_008237302.1|  PREDICTED: putative ribonuclease H protein A...    198   4e-53    
gb|AAD37021.1|  putative non-LTR retrolelement reverse transcriptase    205   4e-53    Arabidopsis thaliana [mouse-ear cress]
emb|CCA66036.1|  hypothetical protein                                   208   4e-53    
ref|XP_006493638.1|  PREDICTED: putative ribonuclease H protein A...    197   5e-53    
ref|XP_009130050.1|  PREDICTED: putative ribonuclease H protein A...    207   6e-53    
gb|AAQ19327.1|  bZIP-like protein                                       207   2e-52    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066197.2|  Os12g0156200                                       207   3e-52    Oryza sativa Japonica Group [Japonica rice]
emb|CCA65995.1|  hypothetical protein                                   206   3e-52    
ref|XP_004306074.1|  PREDICTED: putative ribonuclease H protein A...    196   3e-52    
ref|XP_008351830.1|  PREDICTED: putative ribonuclease H protein A...    205   3e-52    
ref|XP_008352230.1|  PREDICTED: putative ribonuclease H protein A...    202   6e-52    
ref|XP_010676027.1|  PREDICTED: uncharacterized protein LOC104891937    204   8e-52    
ref|XP_010693383.1|  PREDICTED: uncharacterized protein LOC104906342    204   9e-52    
ref|XP_008382267.1|  PREDICTED: putative ribonuclease H protein A...    192   3e-51    
ref|XP_009105597.1|  PREDICTED: uncharacterized protein LOC103831468    199   4e-51    
ref|XP_008391252.1|  PREDICTED: putative ribonuclease H protein A...    197   5e-51    
ref|XP_008387639.1|  PREDICTED: uncharacterized protein LOC103450094    202   6e-51    
emb|CCA66044.1|  hypothetical protein                                   202   6e-51    
ref|XP_009148188.1|  PREDICTED: uncharacterized protein LOC103871664    198   7e-51    
ref|XP_010688579.1|  PREDICTED: uncharacterized protein LOC104902491    200   2e-50    
ref|XP_008378657.1|  PREDICTED: putative ribonuclease H protein A...    196   3e-50    
ref|XP_010667308.1|  PREDICTED: uncharacterized protein LOC104884364    199   4e-50    
ref|XP_009145555.1|  PREDICTED: putative ribonuclease H protein A...    197   5e-50    
ref|XP_004301145.1|  PREDICTED: putative ribonuclease H protein A...    190   5e-50    
ref|XP_010693052.1|  PREDICTED: uncharacterized protein LOC104906048    199   5e-50    
ref|XP_010673997.1|  PREDICTED: uncharacterized protein LOC104890275    197   9e-50    
gb|AAD22368.1|  putative non-LTR retroelement reverse transcriptase     186   1e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010684763.1|  PREDICTED: uncharacterized protein LOC104899296    197   1e-49    
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385    198   1e-49    
ref|XP_008245529.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    197   2e-49    
ref|XP_006469101.1|  PREDICTED: putative ribonuclease H protein A...    193   3e-49    
ref|XP_008367475.1|  PREDICTED: uncharacterized protein LOC103431103    196   4e-49    
ref|XP_008345114.1|  PREDICTED: putative ribonuclease H protein A...    196   4e-49    
emb|CAH66131.1|  OSIGBa0135L04.5                                        192   4e-49    Oryza sativa [red rice]
ref|XP_007010390.1|  Retrotransposon, unclassified-like protein         196   5e-49    
emb|CCA65974.1|  hypothetical protein                                   196   7e-49    
ref|XP_008385035.1|  PREDICTED: putative ribonuclease H protein A...    194   7e-49    
ref|XP_004289445.1|  PREDICTED: putative ribonuclease H protein A...    192   9e-49    
ref|XP_009107610.1|  PREDICTED: putative ribonuclease H protein A...    192   1e-48    
ref|XP_009115103.1|  PREDICTED: putative ribonuclease H protein A...    183   1e-48    
gb|EEC83100.1|  hypothetical protein OsI_28249                          195   1e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_008372905.1|  PREDICTED: uncharacterized protein LOC103436258    194   2e-48    
ref|XP_010666820.1|  PREDICTED: uncharacterized protein LOC104883940    193   4e-48    
ref|XP_008351723.1|  PREDICTED: putative ribonuclease H protein A...    189   5e-48    
ref|XP_008357937.1|  PREDICTED: putative ribonuclease H protein A...    192   5e-48    
ref|XP_007031938.1|  Ribonuclease H protein                             189   6e-48    
ref|XP_010513002.1|  PREDICTED: uncharacterized protein LOC104788940    192   7e-48    
ref|XP_007225095.1|  hypothetical protein PRUPE_ppa016563mg             191   7e-48    
emb|CCA66140.1|  hypothetical protein                                   192   9e-48    
ref|XP_004306275.1|  PREDICTED: putative ribonuclease H protein A...    188   1e-47    
emb|CCA66188.1|  hypothetical protein                                   191   1e-47    
gb|AEL30350.1|  RNA-directed DNA polymerase                             187   2e-47    
ref|XP_009120305.1|  PREDICTED: putative ribonuclease H protein A...    180   2e-47    
ref|XP_008345353.1|  PREDICTED: putative ribonuclease H protein A...    190   2e-47    
ref|XP_007023195.1|  Non-LTR retroelement reverse transcriptase         189   2e-47    
ref|XP_006584399.1|  PREDICTED: putative ribonuclease H protein A...    184   3e-47    
ref|XP_010039376.1|  PREDICTED: uncharacterized protein LOC104428079    190   3e-47    
ref|XP_009140270.1|  PREDICTED: putative ribonuclease H protein A...    188   5e-47    
ref|XP_008234850.1|  PREDICTED: putative ribonuclease H protein A...    189   5e-47    
emb|CCA66040.1|  hypothetical protein                                   190   5e-47    
ref|XP_006483194.1|  PREDICTED: putative ribonuclease H protein A...    187   6e-47    
ref|XP_008391838.1|  PREDICTED: uncharacterized protein LOC103454030    189   1e-46    
ref|XP_008387750.1|  PREDICTED: putative ribonuclease H protein A...    185   1e-46    
gb|ABA97040.1|  retrotransposon protein, putative, unclassified         189   2e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004959141.1|  PREDICTED: putative ribonuclease H protein A...    186   2e-46    
ref|XP_008222990.1|  PREDICTED: putative ribonuclease H protein A...    177   3e-46    
ref|XP_010463404.1|  PREDICTED: uncharacterized protein LOC104744076    184   3e-46    
ref|XP_010670096.1|  PREDICTED: uncharacterized protein LOC104887198    187   3e-46    
ref|XP_009140200.1|  PREDICTED: putative ribonuclease H protein A...    187   3e-46    
ref|XP_010693635.1|  PREDICTED: uncharacterized protein LOC104906563    187   4e-46    
ref|XP_008367519.1|  PREDICTED: putative ribonuclease H protein A...    184   4e-46    
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413    188   4e-46    
ref|XP_008355389.1|  PREDICTED: putative ribonuclease H protein A...    185   5e-46    
ref|XP_006491472.1|  PREDICTED: uncharacterized protein LOC102626455    187   5e-46    
ref|XP_008375089.1|  PREDICTED: uncharacterized protein LOC103438319    187   5e-46    
ref|XP_009140970.1|  PREDICTED: uncharacterized protein LOC103864947    187   6e-46    
ref|XP_004292002.1|  PREDICTED: uncharacterized protein LOC101312896    187   7e-46    
ref|XP_009121302.1|  PREDICTED: putative ribonuclease H protein A...    181   8e-46    
ref|XP_007203452.1|  hypothetical protein PRUPE_ppa022115mg             187   8e-46    
ref|XP_004299997.1|  PREDICTED: putative ribonuclease H protein A...    179   8e-46    
ref|XP_009114067.1|  PREDICTED: putative ribonuclease H protein A...    181   9e-46    
ref|XP_006493122.1|  PREDICTED: putative ribonuclease H protein A...    183   1e-45    
gb|EPS73861.1|  hypothetical protein M569_00896                         186   1e-45    
ref|XP_009141427.1|  PREDICTED: putative ribonuclease H protein A...    181   1e-45    
gb|EEE62189.1|  hypothetical protein OsJ_16976                          181   2e-45    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010495244.1|  PREDICTED: uncharacterized protein LOC104772312    185   2e-45    
ref|XP_007046402.1|  Uncharacterized protein TCM_011921                 183   3e-45    
ref|XP_010682492.1|  PREDICTED: uncharacterized protein LOC104897331    184   3e-45    
ref|XP_009127063.1|  PREDICTED: uncharacterized protein LOC103851935    181   4e-45    
ref|XP_007022832.1|  Uncharacterized protein TCM_026877                 184   4e-45    
gb|EEE59920.1|  hypothetical protein OsJ_12548                          183   5e-45    Oryza sativa Japonica Group [Japonica rice]
gb|EAY96391.1|  hypothetical protein OsI_18290                          180   5e-45    Oryza sativa Indica Group [Indian rice]
ref|XP_009121250.1|  PREDICTED: uncharacterized protein LOC103846083    181   5e-45    
gb|AAX94970.1|  retrotransposon protein, putative, unclassified         181   6e-45    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006493121.1|  PREDICTED: putative ribonuclease H protein A...    182   7e-45    
ref|XP_008226782.1|  PREDICTED: putative ribonuclease H protein A...    182   7e-45    
gb|EEC76169.1|  hypothetical protein OsI_13484                          184   8e-45    Oryza sativa Indica Group [Indian rice]
ref|XP_007042183.1|  Ribonuclease H protein                             177   9e-45    
ref|XP_008232623.1|  PREDICTED: putative ribonuclease H protein A...    182   1e-44    
ref|XP_010688970.1|  PREDICTED: uncharacterized protein LOC104902764    182   1e-44    
ref|XP_009142123.1|  PREDICTED: putative ribonuclease H protein A...    180   1e-44    
ref|XP_010666306.1|  PREDICTED: uncharacterized protein LOC104883473    182   1e-44    
ref|XP_008374008.1|  PREDICTED: putative ribonuclease H protein A...    179   1e-44    
ref|XP_006464882.1|  PREDICTED: putative ribonuclease H protein A...    180   1e-44    
ref|XP_008382787.1|  PREDICTED: putative ribonuclease H protein A...    180   1e-44    
ref|XP_009113843.1|  PREDICTED: putative ribonuclease H protein A...    180   3e-44    
ref|XP_010054376.1|  PREDICTED: uncharacterized protein LOC104442671    182   3e-44    
ref|XP_007207799.1|  hypothetical protein PRUPE_ppa024472mg             180   3e-44    
gb|EEC68711.1|  hypothetical protein OsI_37193                          181   3e-44    Oryza sativa Indica Group [Indian rice]
ref|XP_008366684.1|  PREDICTED: uncharacterized protein LOC103430323    181   3e-44    
ref|XP_009130307.1|  PREDICTED: putative ribonuclease H protein A...    176   3e-44    
ref|XP_010686872.1|  PREDICTED: uncharacterized protein LOC104901027    181   3e-44    
gb|EMS67609.1|  Alanyl-tRNA synthetase                                  181   4e-44    
ref|XP_010692841.1|  PREDICTED: uncharacterized protein LOC104905886    180   4e-44    
gb|AFP55557.1|  non-ltr retroelement reverse transcriptase              181   4e-44    
ref|XP_009375083.1|  PREDICTED: uncharacterized protein LOC103963932    181   5e-44    
ref|XP_008237273.1|  PREDICTED: uncharacterized protein LOC103336015    181   6e-44    
ref|XP_009147282.1|  PREDICTED: putative ribonuclease H protein A...    169   7e-44    
gb|ABA98491.1|  retrotransposon protein, putative, unclassified         180   7e-44    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ03196.1|  hypothetical protein OsI_25347                          178   8e-44    Oryza sativa Indica Group [Indian rice]
ref|XP_009122881.1|  PREDICTED: putative ribonuclease H protein A...    177   9e-44    
ref|XP_004301440.1|  PREDICTED: putative ribonuclease H protein A...    177   9e-44    
ref|XP_010671205.1|  PREDICTED: uncharacterized protein LOC104888072    180   1e-43    
ref|XP_007017131.1|  Uncharacterized protein TCM_033752                 180   1e-43    
ref|XP_008340459.1|  PREDICTED: putative ribonuclease H protein A...    174   1e-43    
gb|EEE50824.1|  hypothetical protein OsJ_31232                          180   1e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010666276.1|  PREDICTED: uncharacterized protein LOC104883442    179   2e-43    
ref|XP_010686122.1|  PREDICTED: uncharacterized protein LOC104900404    179   2e-43    
ref|XP_010687489.1|  PREDICTED: uncharacterized protein LOC104901596    178   2e-43    
ref|XP_007040950.1|  Uncharacterized protein TCM_016759                 177   2e-43    
ref|XP_008377870.1|  PREDICTED: putative ribonuclease H protein A...    174   2e-43    
ref|XP_008385092.1|  PREDICTED: putative ribonuclease H protein A...    176   2e-43    
ref|XP_008367096.1|  PREDICTED: putative ribonuclease H protein A...    177   2e-43    
ref|XP_008341112.1|  PREDICTED: uncharacterized protein LOC103404034    178   2e-43    
ref|XP_009130450.1|  PREDICTED: putative ribonuclease H protein A...    174   3e-43    
ref|XP_006356603.1|  PREDICTED: putative ribonuclease H protein A...    177   3e-43    
ref|XP_008372934.1|  PREDICTED: putative ribonuclease H protein A...    177   3e-43    
ref|XP_008370907.1|  PREDICTED: putative ribonuclease H protein A...    176   3e-43    
ref|XP_007046404.1|  Uncharacterized protein TCM_011923                 178   4e-43    
ref|XP_007020288.1|  Uncharacterized protein TCM_036737                 178   4e-43    
ref|XP_007008704.1|  Uncharacterized protein TCM_042330                 178   4e-43    
ref|XP_008388177.1|  PREDICTED: putative ribonuclease H protein A...    173   5e-43    
ref|XP_010668235.1|  PREDICTED: uncharacterized protein LOC104885230    177   6e-43    
gb|ABK28199.1|  unknown                                                 167   6e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AAD21515.1|  putative reverse transcriptase                          167   6e-43    Arabidopsis thaliana [mouse-ear cress]
gb|ABE65462.1|  hypothetical protein At2g27870                          167   7e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009361334.1|  PREDICTED: uncharacterized protein LOC103951630    176   1e-42    
gb|EEE52627.1|  hypothetical protein OsJ_34967                          176   1e-42    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010039097.1|  PREDICTED: uncharacterized protein LOC104427753    176   1e-42    
ref|XP_010674085.1|  PREDICTED: uncharacterized protein LOC104890338    176   1e-42    
ref|XP_007026458.1|  Uncharacterized protein TCM_021522                 177   1e-42    
ref|XP_007039706.1|  Non-LTR retroelement reverse transcriptase         168   1e-42    
ref|XP_010673150.1|  PREDICTED: uncharacterized protein LOC104889591    176   1e-42    
ref|XP_008364703.1|  PREDICTED: putative ribonuclease H protein A...    173   1e-42    
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg             174   2e-42    
ref|XP_009118875.1|  PREDICTED: uncharacterized protein LOC103843847    176   2e-42    
ref|XP_008233465.1|  PREDICTED: putative ribonuclease H protein A...    171   3e-42    
ref|XP_009149305.1|  PREDICTED: putative ribonuclease H protein A...    174   3e-42    
emb|CCA66180.1|  hypothetical protein                                   175   3e-42    
ref|XP_007031313.1|  Uncharacterized protein TCM_016763                 175   4e-42    
ref|XP_010668002.1|  PREDICTED: uncharacterized protein LOC104884990    175   4e-42    
gb|EEC83406.1|  hypothetical protein OsI_28856                          174   4e-42    Oryza sativa Indica Group [Indian rice]
ref|XP_010694802.1|  PREDICTED: uncharacterized protein LOC104907559    174   5e-42    
ref|XP_007031312.1|  Uncharacterized protein TCM_016762                 175   5e-42    
ref|XP_008785084.1|  PREDICTED: putative ribonuclease H protein A...    172   7e-42    
gb|ABA96203.1|  retrotransposon protein, putative, unclassified, ...    174   9e-42    Oryza sativa Japonica Group [Japonica rice]
emb|CCA66050.1|  hypothetical protein                                   173   9e-42    
ref|XP_009103763.1|  PREDICTED: uncharacterized protein LOC103829818    173   1e-41    
gb|AAB82639.1|  putative non-LTR retroelement reverse transcriptase     173   1e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010495785.1|  PREDICTED: uncharacterized protein LOC104772929    172   1e-41    
ref|XP_008367240.1|  PREDICTED: putative ribonuclease H protein A...    171   2e-41    
ref|XP_008382376.1|  PREDICTED: uncharacterized protein LOC103445169    172   2e-41    
ref|XP_006367640.1|  PREDICTED: putative ribonuclease H protein A...    172   2e-41    
ref|XP_008354602.1|  PREDICTED: uncharacterized protein LOC103418244    172   2e-41    
gb|AAM18736.1|AC092548_14  putative reverse transcriptase               172   2e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007217321.1|  hypothetical protein PRUPE_ppa019733mg             172   2e-41    
ref|XP_010462630.1|  PREDICTED: uncharacterized protein LOC104743220    169   2e-41    
ref|XP_008367994.1|  PREDICTED: uncharacterized protein LOC103431605    172   3e-41    
ref|XP_009138589.1|  PREDICTED: putative ribonuclease H protein A...    169   3e-41    
ref|XP_008351907.1|  PREDICTED: uncharacterized protein LOC103415345    172   3e-41    
ref|XP_004954924.1|  PREDICTED: uncharacterized protein LOC101756955    172   3e-41    
gb|AAP53315.2|  retrotransposon protein, putative, unclassified         172   3e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009118503.1|  PREDICTED: uncharacterized protein LOC103843513    169   5e-41    
ref|XP_009110782.1|  PREDICTED: uncharacterized protein LOC103836292    169   5e-41    
emb|CCA66153.1|  hypothetical protein                                   171   6e-41    
ref|XP_009129277.1|  PREDICTED: putative ribonuclease H protein A...    166   6e-41    
ref|XP_009146764.1|  PREDICTED: uncharacterized protein LOC103870391    170   6e-41    
gb|EAZ40370.1|  hypothetical protein OsJ_24816                          167   8e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010674186.1|  PREDICTED: uncharacterized protein LOC104890406    171   8e-41    
ref|XP_008346916.1|  PREDICTED: putative ribonuclease H protein A...    169   1e-40    
ref|XP_008355160.1|  PREDICTED: putative ribonuclease H protein A...    166   1e-40    
ref|XP_009118883.1|  PREDICTED: uncharacterized protein LOC103843855    170   1e-40    
ref|XP_007226707.1|  hypothetical protein PRUPE_ppa020120mg             169   2e-40    
ref|XP_008358487.1|  PREDICTED: putative ribonuclease H protein A...    166   2e-40    
ref|XP_010692477.1|  PREDICTED: uncharacterized protein LOC104905588    169   2e-40    
ref|XP_008364002.1|  PREDICTED: putative ribonuclease H protein A...    168   2e-40    
ref|XP_009126346.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    169   2e-40    
gb|AAP54617.2|  retrotransposon protein, putative, unclassified         169   2e-40    Oryza sativa Japonica Group [Japonica rice]
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...    169   2e-40    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ40645.1|  hypothetical protein OsJ_25114                          165   2e-40    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006485451.1|  PREDICTED: uncharacterized protein LOC102622884    169   2e-40    
emb|CCA66054.1|  hypothetical protein                                   169   2e-40    
ref|XP_008358855.1|  PREDICTED: uncharacterized protein LOC103422573    169   3e-40    
ref|XP_010666976.1|  PREDICTED: uncharacterized protein LOC104884079    169   3e-40    
ref|XP_009119675.1|  PREDICTED: putative ribonuclease H protein A...    168   3e-40    
ref|XP_008356436.1|  PREDICTED: putative ribonuclease H protein A...    168   4e-40    
gb|AAD21778.1|  putative non-LTR retroelement reverse transcriptase     169   4e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108245.1|  PREDICTED: putative ribonuclease H protein A...    162   4e-40    
ref|XP_008242678.1|  PREDICTED: putative ribonuclease H protein A...    161   5e-40    
ref|XP_009114817.1|  PREDICTED: putative ribonuclease H protein A...    162   6e-40    
ref|XP_009149643.1|  PREDICTED: putative ribonuclease H protein A...    165   7e-40    
ref|XP_009135908.1|  PREDICTED: uncharacterized protein LOC103860050    167   9e-40    
ref|XP_007033353.1|  Non-LTR retroelement reverse transcriptase-like    161   1e-39    
ref|XP_008356060.1|  PREDICTED: uncharacterized protein LOC103419743    167   1e-39    
ref|XP_009102787.1|  PREDICTED: uncharacterized protein LOC103828902    166   1e-39    
ref|XP_009107495.1|  PREDICTED: putative ribonuclease H protein A...    157   2e-39    
emb|CAB10337.1|  reverse transcriptase like protein                     166   2e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004295829.1|  PREDICTED: uncharacterized protein LOC101302635    165   2e-39    
ref|XP_009132673.1|  PREDICTED: putative ribonuclease H protein A...    165   2e-39    
ref|XP_009103788.1|  PREDICTED: uncharacterized protein LOC103829849    166   2e-39    
ref|XP_010058710.1|  PREDICTED: uncharacterized protein LOC104446568    166   2e-39    
ref|XP_009124968.1|  PREDICTED: uncharacterized protein LOC103850017    165   2e-39    
ref|XP_010474601.1|  PREDICTED: uncharacterized protein LOC104754160    166   3e-39    
ref|XP_008375111.1|  PREDICTED: putative ribonuclease H protein A...    165   3e-39    
gb|AAG51783.1|AC079679_3  reverse transcriptase, putative; 16838-...    165   3e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008389974.1|  PREDICTED: putative ribonuclease H protein A...    164   3e-39    
ref|XP_008369981.1|  PREDICTED: uncharacterized protein LOC103433498    165   3e-39    
ref|XP_009116203.1|  PREDICTED: putative ribonuclease H protein A...    164   4e-39    
ref|XP_009113183.1|  PREDICTED: putative ribonuclease H protein A...    161   4e-39    
ref|XP_009141426.1|  PREDICTED: putative ribonuclease H protein A...    162   4e-39    
ref|XP_009139371.1|  PREDICTED: putative ribonuclease H protein A...    162   4e-39    
gb|EPS61425.1|  hypothetical protein M569_13371                         165   5e-39    
ref|XP_008809469.1|  PREDICTED: putative ribonuclease H protein A...    163   5e-39    
ref|XP_009105634.1|  PREDICTED: putative ribonuclease H protein A...    160   6e-39    
gb|AAO00713.1|  retrotransposon protein, putative, unclassified         165   6e-39    
emb|CDP09717.1|  unnamed protein product                                161   6e-39    
ref|XP_010673168.1|  PREDICTED: uncharacterized protein LOC104889608    165   6e-39    
ref|XP_008244613.1|  PREDICTED: putative ribonuclease H protein A...    164   7e-39    
ref|XP_008377038.1|  PREDICTED: putative ribonuclease H protein A...    157   7e-39    
ref|XP_009136063.1|  PREDICTED: putative ribonuclease H protein A...    161   7e-39    
ref|XP_010667378.1|  PREDICTED: uncharacterized protein LOC104884431    164   7e-39    
gb|AAP54692.2|  retrotransposon protein, putative, unclassified         164   8e-39    
dbj|BAB09192.1|  non-LTR retroelement reverse transcriptase-like ...    155   1e-38    
ref|XP_008391021.1|  PREDICTED: putative ribonuclease H protein A...    160   1e-38    
ref|XP_010696208.1|  PREDICTED: uncharacterized protein LOC104908756    163   1e-38    
gb|ABF97084.1|  retrotransposon protein, putative, unclassified         163   1e-38    
ref|XP_009105552.1|  PREDICTED: putative ribonuclease H protein A...    160   2e-38    
emb|CAN60067.1|  hypothetical protein VITISV_012399                     163   2e-38    
gb|EEE69154.1|  hypothetical protein OsJ_28290                          160   2e-38    
ref|XP_007026457.1|  Uncharacterized protein TCM_021521                 163   2e-38    
emb|CCA66222.1|  hypothetical protein                                   163   2e-38    
ref|XP_010026656.1|  PREDICTED: uncharacterized protein LOC104417027    163   2e-38    
ref|NP_001060259.1|  Os07g0613900                                       163   2e-38    
ref|XP_008808644.1|  PREDICTED: putative ribonuclease H protein A...    162   2e-38    
ref|XP_009367701.1|  PREDICTED: uncharacterized protein LOC103957282    163   2e-38    
ref|XP_008800872.1|  PREDICTED: uncharacterized protein LOC103715119    162   2e-38    
emb|CCA66235.1|  hypothetical protein                                   162   3e-38    
ref|XP_009129032.1|  PREDICTED: uncharacterized protein LOC103853884    162   3e-38    
ref|XP_010506904.1|  PREDICTED: uncharacterized protein LOC104783445    161   3e-38    
emb|CAN64449.1|  hypothetical protein VITISV_008912                     157   4e-38    
ref|XP_007210987.1|  hypothetical protein PRUPE_ppa021345mg             160   4e-38    
ref|XP_008392963.1|  PREDICTED: uncharacterized protein LOC103455142    162   4e-38    
ref|XP_008233458.1|  PREDICTED: putative ribonuclease H protein A...    160   4e-38    
ref|XP_009146521.1|  PREDICTED: putative ribonuclease H protein A...    159   4e-38    
ref|XP_008791839.1|  PREDICTED: putative ribonuclease H protein A...    158   4e-38    
ref|XP_010681977.1|  PREDICTED: uncharacterized protein LOC104896888    161   4e-38    
gb|EMS68524.1|  Cyclopropane-fatty-acyl-phospholipid synthase           162   5e-38    
ref|XP_009108660.1|  PREDICTED: putative ribonuclease H protein A...    159   6e-38    
ref|XP_010495306.1|  PREDICTED: uncharacterized protein LOC104772378    160   7e-38    
ref|XP_010688582.1|  PREDICTED: uncharacterized protein LOC104902493    161   7e-38    
ref|XP_008797688.1|  PREDICTED: putative ribonuclease H protein A...    160   7e-38    
emb|CAN75646.1|  hypothetical protein VITISV_031269                     161   7e-38    
gb|EEC83784.1|  hypothetical protein OsI_29682                          158   8e-38    
gb|AAD20714.1|  putative non-LTR retroelement reverse transcriptase     161   8e-38    
ref|XP_010418809.1|  PREDICTED: uncharacterized protein LOC104704411    160   8e-38    
ref|XP_008382509.1|  PREDICTED: putative ribonuclease H protein A...    153   9e-38    
ref|XP_004301927.1|  PREDICTED: putative ribonuclease H protein A...    160   9e-38    
ref|XP_009790965.1|  PREDICTED: uncharacterized protein LOC104238338    160   1e-37    
ref|XP_006347119.1|  PREDICTED: putative ribonuclease H protein A...    155   1e-37    
ref|NP_194638.1|  ribonuclease H-like protein                           157   2e-37    
gb|AAS55787.1|  hypothetical protein                                    160   2e-37    
ref|XP_009112590.1|  PREDICTED: uncharacterized protein LOC103837948    160   2e-37    
emb|CAN80039.1|  hypothetical protein VITISV_040551                     156   2e-37    
emb|CCA66178.1|  hypothetical protein                                   160   2e-37    
ref|XP_010687808.1|  PREDICTED: uncharacterized protein LOC104901884    159   2e-37    
ref|XP_007210228.1|  hypothetical protein PRUPE_ppa015539mg             158   3e-37    
ref|XP_008369650.1|  PREDICTED: putative ribonuclease H protein A...    156   3e-37    
ref|XP_010480729.1|  PREDICTED: uncharacterized protein LOC104759515    159   3e-37    
ref|XP_010667704.1|  PREDICTED: uncharacterized protein LOC104884717    159   3e-37    
ref|XP_009123679.1|  PREDICTED: putative ribonuclease H protein A...    159   3e-37    
gb|AAD24831.1|  putative non-LTR retroelement reverse transcriptase     159   3e-37    
ref|XP_010506884.1|  PREDICTED: uncharacterized protein LOC104783422    159   4e-37    
ref|XP_009110781.1|  PREDICTED: putative ribonuclease H protein A...    156   4e-37    
ref|XP_010412448.1|  PREDICTED: uncharacterized protein LOC104698743    159   4e-37    
emb|CAE02147.1|  OSJNBa0081G05.2                                        159   5e-37    
ref|XP_010485231.1|  PREDICTED: uncharacterized protein LOC104763574    159   6e-37    
ref|XP_006337991.1|  PREDICTED: putative ribonuclease H protein A...    154   6e-37    
ref|XP_008798809.1|  PREDICTED: putative ribonuclease H protein A...    157   7e-37    
ref|XP_010507122.1|  PREDICTED: uncharacterized protein LOC104783698    157   8e-37    
ref|XP_009138624.1|  PREDICTED: uncharacterized protein LOC103862701    157   9e-37    
ref|XP_009113016.1|  PREDICTED: uncharacterized protein LOC103838337    157   1e-36    
ref|XP_010451493.1|  PREDICTED: uncharacterized protein LOC104733622    157   1e-36    
ref|XP_010451822.1|  PREDICTED: uncharacterized protein LOC104734004    157   1e-36    
ref|XP_009124577.1|  PREDICTED: uncharacterized protein LOC103849567    157   1e-36    
ref|XP_009113011.1|  PREDICTED: putative ribonuclease H protein A...    155   1e-36    
emb|CCA66198.1|  hypothetical protein                                   157   2e-36    
ref|XP_010666352.1|  PREDICTED: uncharacterized protein LOC104883509    157   2e-36    
ref|XP_007227193.1|  hypothetical protein PRUPE_ppa019361mg             156   2e-36    
emb|CAN72359.1|  hypothetical protein VITISV_000131                     155   2e-36    
gb|EEC81552.1|  hypothetical protein OsI_24974                          156   2e-36    
gb|ACK44480.1|  hypothetical protein 2                                  150   2e-36    
ref|XP_007207773.1|  hypothetical protein PRUPE_ppa026368mg             156   2e-36    
emb|CAN72177.1|  hypothetical protein VITISV_012537                     152   2e-36    
ref|XP_009125370.1|  PREDICTED: putative ribonuclease H protein A...    156   2e-36    
ref|XP_008360144.1|  PREDICTED: putative ribonuclease H protein A...    155   2e-36    
emb|CAN62743.1|  hypothetical protein VITISV_033107                     156   2e-36    
ref|XP_007219414.1|  hypothetical protein PRUPE_ppa021915mg             152   3e-36    
ref|XP_009123326.1|  PREDICTED: uncharacterized protein LOC103848097    156   3e-36    
emb|CAN81579.1|  hypothetical protein VITISV_023185                     156   3e-36    
emb|CAN66166.1|  hypothetical protein VITISV_000142                     152   3e-36    
gb|EEC84753.1|  hypothetical protein OsI_31756                          156   3e-36    
ref|XP_009115101.1|  PREDICTED: uncharacterized protein LOC103840357    155   4e-36    
ref|XP_009121338.1|  PREDICTED: uncharacterized protein LOC103846184    155   4e-36    
ref|XP_008393538.1|  PREDICTED: uncharacterized protein LOC103455726    155   4e-36    
ref|XP_004305156.1|  PREDICTED: putative ribonuclease H protein A...    155   4e-36    
ref|XP_009124289.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    156   4e-36    
emb|CAN82037.1|  hypothetical protein VITISV_033902                     155   5e-36    
gb|EPS72636.1|  hypothetical protein M569_02121                         155   6e-36    
ref|XP_008222000.1|  PREDICTED: putative ribonuclease H protein A...    151   7e-36    
ref|XP_009144097.1|  PREDICTED: putative ribonuclease H protein A...    152   8e-36    
ref|XP_004301407.1|  PREDICTED: putative ribonuclease H protein A...    152   1e-35    
ref|XP_010424608.1|  PREDICTED: uncharacterized protein LOC104709742    154   1e-35    
ref|XP_009120002.1|  PREDICTED: putative ribonuclease H protein A...    152   1e-35    
ref|XP_010424493.1|  PREDICTED: uncharacterized protein LOC104709611    153   1e-35    
ref|XP_008232502.1|  PREDICTED: putative ribonuclease H protein A...    151   1e-35    
ref|XP_010430691.1|  PREDICTED: uncharacterized protein LOC104714925    154   1e-35    
gb|AAD29058.1|  putative non-LTR retroelement reverse transcriptase     154   1e-35    
ref|XP_009102231.1|  PREDICTED: uncharacterized protein LOC103828378    154   1e-35    
ref|XP_008231382.1|  PREDICTED: putative ribonuclease H protein A...    152   1e-35    
ref|XP_010490159.1|  PREDICTED: uncharacterized protein LOC104767890    154   1e-35    
ref|XP_009102306.1|  PREDICTED: putative ribonuclease H protein A...    152   1e-35    
ref|XP_009102759.1|  PREDICTED: uncharacterized protein LOC103828873    154   1e-35    
emb|CAN65484.1|  hypothetical protein VITISV_029474                     154   1e-35    
ref|XP_010513536.1|  PREDICTED: uncharacterized protein LOC104789557    153   2e-35    
ref|XP_010667928.1|  PREDICTED: uncharacterized protein LOC104884923    153   2e-35    
emb|CAN63585.1|  hypothetical protein VITISV_026806                     152   2e-35    
emb|CAN68112.1|  hypothetical protein VITISV_040983                     153   2e-35    
ref|XP_009107709.1|  PREDICTED: putative ribonuclease H protein A...    149   2e-35    
ref|XP_010451645.1|  PREDICTED: uncharacterized protein LOC104733795    153   2e-35    
ref|XP_008794416.1|  PREDICTED: uncharacterized protein LOC103710479    153   2e-35    
ref|XP_010446022.1|  PREDICTED: uncharacterized protein LOC104728786    153   2e-35    
ref|XP_009123425.1|  PREDICTED: uncharacterized protein LOC103848222    152   2e-35    
ref|XP_009138123.1|  PREDICTED: putative ribonuclease H protein A...    152   2e-35    
gb|EMT20940.1|  ABC transporter C family member 10                      154   2e-35    
ref|XP_008350747.1|  PREDICTED: uncharacterized protein LOC103414113    154   2e-35    
ref|XP_008226028.1|  PREDICTED: putative ribonuclease H protein A...    145   3e-35    
gb|EEC81662.1|  hypothetical protein OsI_25211                          150   3e-35    
ref|XP_010476358.1|  PREDICTED: uncharacterized protein LOC104755638    153   3e-35    
ref|XP_010054717.1|  PREDICTED: uncharacterized protein LOC104443052    152   3e-35    
emb|CAN74986.1|  hypothetical protein VITISV_008771                     153   3e-35    
ref|XP_009126876.1|  PREDICTED: putative ribonuclease H protein A...    150   3e-35    
gb|EEC72938.1|  hypothetical protein OsI_06800                          149   3e-35    
ref|XP_007203344.1|  hypothetical protein PRUPE_ppa020282mg             153   3e-35    
ref|XP_009149314.1|  PREDICTED: uncharacterized protein LOC103872634    152   3e-35    
ref|XP_009123659.1|  PREDICTED: uncharacterized protein LOC103848514    152   3e-35    
ref|XP_010446251.1|  PREDICTED: uncharacterized protein LOC104729051    152   3e-35    
ref|XP_009115737.1|  PREDICTED: uncharacterized protein LOC103840975    152   4e-35    
emb|CDP14470.1|  unnamed protein product                                150   4e-35    
gb|EEE54600.1|  hypothetical protein OsJ_01823                          150   4e-35    
ref|XP_010684129.1|  PREDICTED: uncharacterized protein LOC104898724    151   5e-35    
ref|XP_004293076.1|  PREDICTED: putative ribonuclease H protein A...    148   6e-35    
ref|XP_008242862.1|  PREDICTED: uncharacterized protein LOC103341160    151   6e-35    
ref|XP_009119498.1|  PREDICTED: putative ribonuclease H protein A...    149   6e-35    
emb|CAN62051.1|  hypothetical protein VITISV_016641                     152   7e-35    
ref|XP_009127418.1|  PREDICTED: uncharacterized protein LOC103852254    152   7e-35    
emb|CAN73354.1|  hypothetical protein VITISV_016753                     152   7e-35    
ref|XP_009137133.1|  PREDICTED: uncharacterized protein LOC103861184    151   8e-35    
ref|XP_008654535.1|  PREDICTED: putative ribonuclease H protein A...    146   8e-35    
ref|XP_008654531.1|  PREDICTED: putative ribonuclease H protein A...    146   9e-35    
ref|XP_008387184.1|  PREDICTED: putative ribonuclease H protein A...    151   9e-35    
ref|XP_009115971.1|  PREDICTED: putative ribonuclease H protein A...    149   9e-35    
ref|XP_006356729.1|  PREDICTED: putative ribonuclease H protein A...    144   1e-34    
emb|CAN76904.1|  hypothetical protein VITISV_016347                     150   1e-34    
ref|XP_008348723.1|  PREDICTED: uncharacterized protein LOC103411886    150   1e-34    
pir||T00833  RNA-directed DNA polymerase homolog T13L16.7 - Arabi...    151   1e-34 
gb|EMS67416.1|  Protein argonaute 1D                                    151   1e-34    
ref|XP_008385416.1|  PREDICTED: putative ribonuclease H protein A...    150   1e-34    
ref|XP_009121253.1|  PREDICTED: uncharacterized protein LOC103846086    149   1e-34    
emb|CAN79789.1|  hypothetical protein VITISV_039779                     151   1e-34    
ref|XP_007015140.1|  Ribonuclease H protein, putative                   144   1e-34    
emb|CAN65706.1|  hypothetical protein VITISV_001745                     150   1e-34    
ref|XP_008650633.1|  PREDICTED: uncharacterized protein LOC103631517    150   2e-34    
ref|XP_009150006.1|  PREDICTED: uncharacterized protein LOC103873342    149   2e-34    
gb|EEC68887.1|  hypothetical protein OsI_37529                          150   2e-34    
ref|XP_008381797.1|  PREDICTED: uncharacterized protein LOC103444619    150   2e-34    
ref|XP_009343973.1|  PREDICTED: uncharacterized protein LOC103935882    150   3e-34    
ref|XP_008344356.1|  PREDICTED: putative ribonuclease H protein A...    143   3e-34    
ref|XP_009150816.1|  PREDICTED: uncharacterized protein LOC103874152    150   3e-34    
ref|XP_008387315.1|  PREDICTED: uncharacterized protein LOC103449768    150   3e-34    
ref|XP_007010351.1|  Polynucleotidyl transferase, putative              144   3e-34    
ref|XP_004292563.1|  PREDICTED: putative ribonuclease H protein A...    146   3e-34    
ref|XP_008372910.1|  PREDICTED: putative ribonuclease H protein A...    147   3e-34    
emb|CAN79956.1|  hypothetical protein VITISV_017151                     149   3e-34    
ref|XP_009118154.1|  PREDICTED: putative ribonuclease H protein A...    146   4e-34    
ref|XP_010481092.1|  PREDICTED: uncharacterized protein LOC104759918    148   4e-34    
ref|XP_008245249.1|  PREDICTED: putative ribonuclease H protein A...    147   4e-34    
ref|XP_004966626.1|  PREDICTED: putative ribonuclease H protein A...    146   4e-34    
ref|XP_010495441.1|  PREDICTED: uncharacterized protein LOC104772536    149   4e-34    
emb|CAN68165.1|  hypothetical protein VITISV_008538                     149   4e-34    
ref|XP_002453810.1|  hypothetical protein SORBIDRAFT_04g018371          145   4e-34    
ref|XP_009114092.1|  PREDICTED: uncharacterized protein LOC103839337    148   5e-34    
gb|KEH41789.1|  endonuclease/exonuclease/phosphatase family protein     149   5e-34    
ref|XP_009123721.1|  PREDICTED: putative ribonuclease H protein A...    147   5e-34    
emb|CAE04866.2|  OSJNBa0086O06.14                                       149   6e-34    
ref|XP_008340321.1|  PREDICTED: putative ribonuclease H protein A...    145   7e-34    
ref|XP_010419203.1|  PREDICTED: uncharacterized protein LOC104704888    148   7e-34    
emb|CAN78850.1|  hypothetical protein VITISV_013214                     148   7e-34    
ref|XP_007017129.1|  Uncharacterized protein TCM_042328                 148   7e-34    
ref|XP_009123796.1|  PREDICTED: putative ribonuclease H protein A...    146   7e-34    
ref|XP_010692491.1|  PREDICTED: uncharacterized protein LOC104905603    149   8e-34    
emb|CAN70608.1|  hypothetical protein VITISV_040198                     148   8e-34    
ref|XP_010468701.1|  PREDICTED: uncharacterized protein LOC104748809    147   9e-34    
ref|XP_004298219.1|  PREDICTED: uncharacterized protein LOC101304768    149   9e-34    
ref|XP_010474119.1|  PREDICTED: uncharacterized protein LOC104753583    148   9e-34    
emb|CAN61978.1|  hypothetical protein VITISV_038568                     147   9e-34    
ref|XP_009140393.1|  PREDICTED: uncharacterized protein LOC103864388    148   1e-33    
ref|XP_008347064.1|  PREDICTED: putative ribonuclease H protein A...    147   1e-33    
emb|CAN60595.1|  hypothetical protein VITISV_015221                     147   1e-33    
ref|XP_009113015.1|  PREDICTED: putative ribonuclease H protein A...    147   1e-33    
ref|XP_009102778.1|  PREDICTED: uncharacterized protein LOC103828890    148   1e-33    
emb|CAN70922.1|  hypothetical protein VITISV_016266                     147   1e-33    
ref|XP_004296207.1|  PREDICTED: uncharacterized protein LOC101297422    148   1e-33    
ref|XP_007220772.1|  hypothetical protein PRUPE_ppa026532mg             141   1e-33    
ref|XP_009113857.1|  PREDICTED: putative ribonuclease H protein A...    145   1e-33    
ref|XP_008366311.1|  PREDICTED: putative ribonuclease H protein A...    147   1e-33    
emb|CAN82584.1|  hypothetical protein VITISV_031018                     145   1e-33    
emb|CAN75028.1|  hypothetical protein VITISV_026823                     148   2e-33    
ref|XP_008359109.1|  PREDICTED: putative ribonuclease H protein A...    142   2e-33    
gb|KHN48361.1|  Putative ribonuclease H protein                         143   2e-33    
ref|XP_009107553.1|  PREDICTED: uncharacterized protein LOC103833206    147   2e-33    
ref|XP_009124321.1|  PREDICTED: putative ribonuclease H protein A...    139   2e-33    
ref|XP_009117698.1|  PREDICTED: putative ribonuclease H protein A...    143   2e-33    
emb|CDY00591.1|  BnaC04g23340D                                          144   2e-33    
ref|XP_010445598.1|  PREDICTED: uncharacterized protein LOC104728296    147   3e-33    
ref|XP_007202950.1|  hypothetical protein PRUPE_ppa016504mg             147   3e-33    
emb|CAN79019.1|  hypothetical protein VITISV_043767                     146   3e-33    
ref|XP_007206246.1|  hypothetical protein PRUPE_ppa015607mg             146   3e-33    
ref|XP_006655090.1|  PREDICTED: uncharacterized protein LOC102699406    147   3e-33    
ref|XP_010451225.1|  PREDICTED: uncharacterized protein LOC104733339    146   3e-33    
ref|XP_006605006.1|  PREDICTED: uncharacterized protein LOC102669369    146   3e-33    
ref|XP_004310201.1|  PREDICTED: uncharacterized protein LOC101298860    146   4e-33    
ref|XP_007224193.1|  hypothetical protein PRUPE_ppa017155mg             146   4e-33    
emb|CAN73982.1|  hypothetical protein VITISV_007640                     147   4e-33    



>ref|XP_009151561.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1204

 Score =   365 bits (936),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 220/613 (36%), Positives = 325/613 (53%), Gaps = 26/613 (4%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L+++++RL GWK +TLSLAGRVT+ K+VL++IP+++M T  +P     +++  +R F+W
Sbjct  605   VLEKVASRLSGWKKQTLSLAGRVTMTKAVLSSIPVHSMSTIHMPVSTLDKLDSLSRSFVW  664

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +        L++WD +   K  GGLG+R    MN+A + K+GWRL  +   LWA+ L
Sbjct  665   GSGQH-------LISWDRVCRPKADGGLGIRVSRDMNKALLAKVGWRLLNDKEGLWARVL  717

Query  1612  TTKYH----HRSGSHLVTTRRRSISNAWKGIS-AERETLESGLTHVVRNGKSTRFWMDSW  1448
              +KY     H S   +  +   ++S+ W+ +    RE +  G + V+ NG+  +FW D W
Sbjct  718   RSKYSVGDMHDSSWMVAGS---NVSSTWRSVVMGIREVVAKGHSWVIGNGREIKFWTDKW  774

Query  1447  LTAKPLYEKLRGTLGLPELY--ATVNEYWDKVRGWKWEKIQRYLPTEE-LERLASLCLTE  1277
             L+ +PL  ++ G L  PE Y   T  E W    GW   +I  Y+P E  LER+A +  T 
Sbjct  775   LSRQPLMGEVLGDL--PEGYENITARELWLDGGGWDLSRISPYIPDERRLERVAVVVDTV  832

Query  1276  ENTPDGWGWSPDPRGCFSVKSAYGWA--DNAARQEADKVWGLIWSLRVPARISMFIWLVK  1103
                 D   W   P G F+VK+AY     DN  RQ+ + ++  +W +  P R+ +F+WLV 
Sbjct  833   SGVKDRLAWGEVPNGQFTVKTAYDLITRDNTPRQQMENLFKSMWRVVAPERVRVFLWLVG  892

Query  1102  HGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNL  923
             +  ++TN ER RRH++  + C  C G  E + H+ R C  ++ IW   +     ++  ++
Sbjct  893   NQAIMTNAERYRRHLSGTDVCQVCKGGVETILHVLRDCPAMEGIWSRFVPSTKRQAFFSM  952

Query  922   DWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCD  743
                 WL  NL  +  Q  E  W   F   +WW WKWR   VF  N L    ++ +LR   
Sbjct  953   PLLEWLYRNLYDNDAQN-EIPWATTFALGVWWGWKWRCGNVFGDNRL-WRDRVKFLRNLA  1010

Query  742   SETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTH  566
              E   A +       R  R  E  + W  P  GW+KLNTDG+   + G AS GGVLRD  
Sbjct  1011  REVMRAKKTEEESRARVQRV-EIMVGWTPPRGGWMKLNTDGASHGNPGLASAGGVLRDGE  1069

Query  565   GNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQE  386
             G WC G+   IGRC++ +AE WGV  GL +A E G RR+ +E DSKM+V  L        
Sbjct  1070  GEWCGGFALNIGRCSAPLAELWGVYYGLVIAWEKGIRRLEVEVDSKMVVGFLTTGIEDTH  1129

Query  385   QNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRM  206
               + +VR C         V  +H+YRE N+LAD LA  A++   G H F+V P EF   +
Sbjct  1130  PLSFLVRLCHGFLTRDWLVRIVHVYREANRLADGLANLAISLPFGFHRFDVVPLEFVSLI  1189

Query  205   ALDRLGASSPRRV  167
               D  G   PR+V
Sbjct  1190  REDVDGLLQPRQV  1202



>ref|XP_009124282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1011

 Score =   359 bits (922),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 220/608 (36%), Positives = 320/608 (53%), Gaps = 20/608 (3%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L+++++RL GWK +TLSLAGRVT+ K+VL++IP++TM T  LP     +++  +R F+W
Sbjct  412   VLEKVASRLSGWKKQTLSLAGRVTMTKAVLSSIPVHTMSTINLPVSTLEKLDSLSRSFVW  471

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +        LV+W+ I   K  GGLG+R    MN+A + K+GWRL  +  +LWA+ L
Sbjct  472   GSGQH-------LVSWEKICKPKAEGGLGIRGSRDMNKALIAKVGWRLLRDTESLWARVL  524

Query  1612  TTKYHHRSGSHLV-TTRRRSISNAWKGIS-AERETLESGLTHVVRNGKSTRFWMDSWLTA  1439
              +KY+  S   L  T RR + S+ W  +    RE + +G +  + NG+  +FW D WL+ 
Sbjct  525   RSKYNVGSIHDLSWTGRRSNGSSTWSSVVLGIREVVMTGHSWAIGNGRDIKFWTDRWLSN  584

Query  1438  KPLYEKLRGTLGLPELY--ATVNEYWDKVRGWKWEKIQRYLPTE-ELERLASLCLTEENT  1268
             +PL     G   LPE Y   TV E W    GW    I  ++  E  LE  A +  T  ++
Sbjct  585   QPLSSVTIGE--LPEGYEDVTVREMWVVGGGWDLAHIAPFVTDETRLELAAVVVDTVNDS  642

Query  1267  PDGWGWSPDPRGCFSVKSAYGWA--DNAARQEADKVWGLIWSLRVPARISMFIWLVKHGR  1094
              D   WS    G F+VKSAY     D+A R   + ++  +W +  P R+ MF+WLV +  
Sbjct  643   EDRLAWSQTNNGQFTVKSAYALITRDDAPRPNMEYLFRRMWHVVAPERVRMFLWLVGNQA  702

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN  914
             ++TN ER RRH++  + C  C G  E + H+ R C  +  IW   +     ++  ++   
Sbjct  703   IMTNAERYRRHLSGTDVCQVCKGGIETILHVLRDCPAMRGIWDRFVPAVKRQTFFSMPLL  762

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSET  734
              WL  NL  D   G E  WP  F   +WW WKWR   +F +N L    ++ +LR    E 
Sbjct  763   EWLYKNLS-DNGTGSEIPWPTTFALAVWWGWKWRCGNIFGKNSL-WRDRVGFLRNLAKEV  820

Query  733   AAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHGNW  557
              +A E         +R  E  + W  P  GW+KLNTDGS   + G A+ GGVLR+  G W
Sbjct  821   MSANEAEKGNSNVDHR-TERMVGWAPPRSGWMKLNTDGSSHGNPGAATAGGVLRNGEGEW  879

Query  556   CRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNN  377
             C G+   IGRC + +AE WGV  GL  A E G RR+ +E DS+++VE L          +
Sbjct  880   CGGFALNIGRCGALLAELWGVYYGLVAAWEKGIRRLELEVDSQVVVEFLTIGIGDTHSLS  939

Query  376   NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALD  197
              +VR C    +    V  +H+YRE N+LAD LA  A +   G H  +  P E  V +  D
Sbjct  940   FLVRMCHGLLKKDWLVHIVHVYREANRLADGLANLAFSLPFGFHRLDETPIEVVVLLQGD  999

Query  196   RLGASSPR  173
              +G   PR
Sbjct  1000  VVGPPRPR  1007



>ref|XP_009101981.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1235

 Score =   356 bits (913),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 220/615 (36%), Positives = 323/615 (53%), Gaps = 25/615 (4%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +++++S++L GWK K LSLAGR+TL KSV+++IP++TM T ALP     +++K  R FIW
Sbjct  631   VVEKVSSKLAGWKRKFLSLAGRITLTKSVISSIPVHTMSTIALPASTLGQLDKIARSFIW  690

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E  GN K  L+AW+ I T K  GGLG+R    MN A + KLGWRL    + LW + L
Sbjct  691   GSSE--GNRKQHLIAWEKICTPKREGGLGIRKAKEMNVALLGKLGWRLLNTHDALWVRIL  748

Query  1612  TTKYHHRSGSHLV---TTRRRSISNAWKG-ISAERETLESGLTHVVRNGKSTRFWMDSWL  1445
               K+  R G          R + S  W+  I   RE +  G   ++ +G+  RFW D+WL
Sbjct  749   QKKF--RVGELYDPCWMVSRGNWSPTWRSLILGIREVVVPGTCWILGDGRRVRFWRDNWL  806

Query  1444  TAKPLYEKLRGTLGLPE--LYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTE-E  1274
               +PLYE    T  +PE  + A   + W    GW  + ++ Y+ T    RLAS+ + E  
Sbjct  807   LDQPLYE--LSTADIPEEIIEAKARDLWQHGTGWLTQLMEPYMSTHNSLRLASVVIDEVT  864

Query  1273  NTPDGWGWSPDPRGCFSVKSAYGW--ADNAARQEADKVWGLIWSLRVPARISMFIWLVKH  1100
                D   WS    G FSVKSAY +   +   RQ  + ++  +W + VP R  +F+WLV H
Sbjct  865   GARDRMSWSGSNDGQFSVKSAYTFLTKNVVPRQNMEALYRRVWRVAVPERTRVFLWLVSH  924

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
               ++TN ER RRH++ +  C  C    E + H+ R C     +W   +     +    L 
Sbjct  925   QVIMTNMERKRRHLSDSSVCLLCKNGDETILHVLRDCPAAAGLWLRIVTPSRRQRFFELP  984

Query  919   WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDS  740
                WL  NL  D     ++ WP  F   +WW WKWR   VF   +     +++++R    
Sbjct  985   LLEWLYENLASDSSVSGDQ-WPTLFALTVWWCWKWRCGYVFG-EVGKCRDRVEFVRDKAK  1042

Query  739   ETAAAFEERHWPLQRHNRGG---EERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRD  572
             E  AA++     L+ H+ GG   E++++W +P+  W+KLNTDG+   + G A+ GGV+RD
Sbjct  1043  EVLAAYKN----LRVHSPGGLRVEKQIAWHRPESNWVKLNTDGAARGNPGLATAGGVVRD  1098

Query  571   THGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETG  392
              +G W  G+   IG C++ +AE WGV  GL +A + G RR+ +E DS+ +V  L+     
Sbjct  1099  EYGTWRGGFAINIGICSAPLAELWGVYYGLCIAWDRGFRRVEVEVDSECVVGFLQTGIQD  1158

Query  391   QEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEV  212
                 + +VR C         V F H+YRE N LAD LA +A +   GLH FEV P     
Sbjct  1159  SHPLSFLVRLCYGFISRDWLVKFSHVYREANHLADGLANYAFSLPFGLHYFEVIPEPVAH  1218

Query  211   RMALDRLGASSPRRV  167
                 D  G S  R++
Sbjct  1219  VFLDDCNGVSRTRQI  1233



>sp|P0C2F6.1|RNHX1_ARATH RecName: Full=Putative ribonuclease H protein At1g65750 [Arabidopsis 
thaliana]
Length=620

 Score =   340 bits (872),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 209/610 (34%), Positives = 310/610 (51%), Gaps = 15/610 (2%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L+R+S+R+ GW+ KTLS AGR+TL K+VL+++P+++M T  LP+ + + +++ +R F+W
Sbjct  16    ILERVSSRMSGWREKTLSFAGRLTLTKAVLSSMPVHSMSTILLPQSILNRLDQLSRTFLW  75

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   +    K  LV W  + + K  GGLG+R   +MNRA + K+GWRL  E N+LW   L
Sbjct  76    GSTAE--KKKQHLVKWSKVCSPKKEGGLGVRAAKSMNRALISKVGWRLLQEKNSLWTLVL  133

Query  1612  TTKYHH---RSGSHLVTTRRRSISNAWKGIS-AERETLESGLTHVVRNGKSTRFWMDSWL  1445
               KYH    R    L+   + S S+ W+ I+   R+ +  G+  +  +G+  RFW D W+
Sbjct  134   QKKYHVGEIRDSRWLIP--KGSWSSTWRSIAIGLRDVVSHGVGWIPGDGQQIRFWTDRWV  191

Query  1444  TAKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTE-ELERLASLCLTEENT  1268
             + KPL E   G            + W   RGW + KI  Y      LE  A +       
Sbjct  192   SGKPLLELDNGERPTDCDTVVAKDLWIPGRGWDFAKIDPYTTNNTRLELRAVVLDLVTGA  251

Query  1267  PDGWGWSPDPRGCFSVKSAYGW--ADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGR  1094
              D   W     G FSV+SAY     D   R      +  +W +RVP R+  F+WLV +  
Sbjct  252   RDRLSWKFSQDGQFSVRSAYEMLTVDEVPRPNMASFFNCLWKVRVPERVKTFLWLVGNQA  311

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN  914
             V+T  ER RRH++++  C  C G  E + H+ R C     IW   + +R ++   +    
Sbjct  312   VMTEEERHRRHLSASNVCQVCKGGVESMLHVLRDCPAQLGIWVRVVPQRRQQGFFSKSLF  371

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSET  734
              WL  NL GDR    +  W   F   +WW WKWR   +F  N      ++ +++    E 
Sbjct  372   EWLYDNL-GDRSGCEDIPWSTIFAVIIWWGWKWRCGNIFGEN-TKCRDRVKFVKEWAVEV  429

Query  733   AAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHGNW  557
               A            R  E  + W  P  GW+K+NTDG+   + G AS GGVLRD  G W
Sbjct  430   YRAHSGNVLVGITQPR-VERMIGWVSPCVGWVKVNTDGASRGNPGLASAGGVLRDCTGAW  488

Query  556   CRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNN  377
             C G++  IGRC++  AE WGV  GL  A E    R+ +E DS+++V  LK   +     +
Sbjct  489   CGGFSLNIGRCSAPQAELWGVYYGLYFAWEKKVPRVELEVDSEVIVGFLKTGISDSHPLS  548

Query  376   NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALD  197
              +VR C    +    V  +H+YRE N+LAD LA +A +   G H F++ P      +  D
Sbjct  549   FLVRLCHGFLQKDWLVRIVHVYREANRLADGLANYAFSLSLGFHSFDLVPDAMSSLLRED  608

Query  196   RLGASSPRRV  167
              LG++ PRRV
Sbjct  609   TLGSTRPRRV  618



>gb|AID60103.1| hypothetical protein [Brassica napus]
Length=620

 Score =   340 bits (871),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 207/592 (35%), Positives = 312/592 (53%), Gaps = 19/592 (3%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +++++S++L GWK + LSLAGR+TL KSVL+++P++TM T ALP    ++++K  R FIW
Sbjct  16    VIEKVSSKLAGWKRRFLSLAGRITLTKSVLSSVPVHTMSTIALPSSTLNQLDKIARAFIW  75

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +  G  K  LV+W+ I   K  GGLG+R    MN A + KLGWR+    + LW   L
Sbjct  76    GSID--GTRKQHLVSWEKICKPKREGGLGIRLAKEMNVALLAKLGWRMLNTEDGLWVNIL  133

Query  1612  TTKY---HHRSGSHLVTTRRRSISNAWKG-ISAERETLESGLTHVVRNGKSTRFWMDSWL  1445
               K+        S LV   R S +  W+  +   RE +  G++ ++ +G+  RFW D WL
Sbjct  134   CKKFRVGELDDASWLVPQGRWSPT--WRSLVMGIREVVAPGVSWILGDGRRVRFWRDRWL  191

Query  1444  TAKPLYEKLRGTLGLPE--LYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTE-E  1274
               +PL E L   + +PE  + A   + W +  GW  ++I+ Y   +   +LASL + E  
Sbjct  192   LKEPL-EAL-SLIDIPEELVEAKTRDLWQQGIGWILQQIEPYTSLQNRLQLASLVIDEVT  249

Query  1273  NTPDGWGWSPDPRGCFSVKSAYGW--ADNAARQEADKVWGLIWSLRVPARISMFIWLVKH  1100
                D   W     G FSVK+AY +   D   R   + ++  +W +  P R+ +F+WLV H
Sbjct  250   GARDRMSWGEAKDGLFSVKAAYAFLTKDAVPRPNMEDLYSRVWRVTAPERVRVFLWLVTH  309

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
               ++TN ER RRHI+ N  C  C    E + H+ R C     +WR  +    ++   NL 
Sbjct  310   QVIMTNMERKRRHISENGTCPLCKSGDETILHVLRDCPAAAGLWRKLVLPTRQQRFFNLT  369

Query  919   WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDS  740
                WL  NL  D+    ++ WP  F   +WW WKWR   VF   +     ++ +++    
Sbjct  370   LFEWLYENLANDKSVNGDQ-WPSLFALTVWWCWKWRCGYVFG-EIGKCRDRVRFVKDKAQ  427

Query  739   ETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHG  563
             E   A ++   P        E +++W  P+ GW+KLNTDG+   + G A+ GG LRD  G
Sbjct  428   EVIKANKKVREP-SAIGVHVERQIAWFVPENGWVKLNTDGASRGNPGLATAGGALRDEEG  486

Query  562   NWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQ  383
              W  G++  IG C++ +AE WGV  GL +A + G R++ +E DSK +V  LK        
Sbjct  487   KWIGGFSLNIGICSAPLAELWGVYYGLCIAWDKGIRKLEVEVDSKSVVGFLKTGIHDSHP  546

Query  382   NNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPP  227
              + +VR C         V F H+YRE N+LAD LA +A + Q GLH F+  P
Sbjct  547   LSFLVRLCYGFVSRDWIVNFSHVYRETNRLADGLANYAFSLQFGLHFFDSVP  598



>ref|XP_009116295.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=782

 Score =   340 bits (873),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 215/609 (35%), Positives = 314/609 (52%), Gaps = 22/609 (4%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L+++++ L GWK +TLSLAGRVT  K+VL++IP++TM T  LP     +++  +R F+W
Sbjct  183   VLEKVASLLSGWKKQTLSLAGRVTTTKAVLSSIPVHTMSTINLPVSTLEKLDSLSRSFVW  242

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +        LV+W+ I   K  GGLG+R    MN+A + K+GWRL  +  +LWA+ L
Sbjct  243   GSGQH-------LVSWEKICKPKAEGGLGIRGSRDMNKALIAKVGWRLLRDTESLWARVL  295

Query  1612  TTKYHHRSGSHLV-TTRRRSISNAWKGIS-AERETLESGLTHVVRNGKSTRFWMDSWLTA  1439
              +KY+  S   L  T RR + S+ W  +    RE + +G +  + NG+  +FW D WL+ 
Sbjct  296   RSKYNVGSIHDLSWTGRRSNGSSTWSSVVLGIREVVMTGHSWAIGNGRDIKFWTDRWLSN  355

Query  1438  KPLYEKLRGTLGLPELY--ATVNEYWDKVRGWKWEKIQRYLPTE-ELERLASLCLTEENT  1268
             +PL     G   LPE Y   TV E W    GW    I  ++  E  LE  A +  T  ++
Sbjct  356   QPLSSVTIGE--LPEGYEDVTVREMWVVGGGWDLAHIAPFVTDETRLELAAVVVDTVNDS  413

Query  1267  PDGWGWSPDPRGCFSVKSAYGWA--DNAARQEADKVWGLIWSLRVPARISMFIWLVKHGR  1094
              D   WS    G  +VKSAY     D+A R   + ++  +W +  P R+ MF+WLV +  
Sbjct  414   EDRLAWSQTKNGQLTVKSAYALITRDDAPRPNMEYLFRRMWHVVPPERVKMFLWLVGNQA  473

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN  914
             ++TN ER R H++  + C  C G  E + H+ R C  +  IW   +     ++  ++   
Sbjct  474   IMTNAERYRWHLSGTDVCQVCKGGIETILHVLRDCPAMRGIWDLFVPAVKRQTFFSMPLL  533

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSET  734
              WL  NL  D   G E  WP  F   +WW WKWR   +F +N L    ++ +LR    E 
Sbjct  534   EWLYKNLS-DNGTGREIPWPTTFALAVWWGWKWRCGNIFGKNSL-WRNRVGFLRNLAKEV  591

Query  733   AAAFE-ERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHGN  560
               A E E+  P   H    E  + W  P  GW+KLNTDGS   + G  + GGVLR+  G 
Sbjct  592   MLANEAEKGNPNVDHRT--EIMVGWAPPQSGWMKLNTDGSSHGNPGPETAGGVLRNGEGE  649

Query  559   WCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQN  380
             WC G+   I RC + +AE W V  G  +A E G RR+ +E DS+++VE L          
Sbjct  650   WCGGFALNIERCGALLAELWRVYYGFVVAWEKGIRRLELEVDSQVVVEFLTTGIGDTHSL  709

Query  379   NNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMAL  200
             + +VR C    +    V  +H+YRE N+LAD LA  A +   G H  +  P E  V +  
Sbjct  710   SFLVRMCHGLLKKDWLVHIVHVYREANRLADCLANLAFSLPFGFHRLDETPIEVVVLLQE  769

Query  199   DRLGASSPR  173
             D +G   PR
Sbjct  770   DVVGPPRPR  778



>emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1378

 Score =   348 bits (893),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 210/608 (35%), Positives = 309/608 (51%), Gaps = 11/608 (2%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+DRI+ +L GWK KTLS+AGR TL +S  ++IP YTMQ+  LP+  C +I++++R F+W
Sbjct  774   LVDRINGKLAGWKTKTLSIAGRATLIQSAFSSIPYYTMQSTKLPRSTCDDIDRKSRSFLW  833

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  EQ G  ++ LVAW+ I+  K  GGLG+R++   N A ++KLGWRL  EP++LW++ L
Sbjct  834   G--EQEGKRRVHLVAWENISKSKKEGGLGIRSMRQANSAFLVKLGWRLLAEPSSLWSRIL  891

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY        +   + + S+ W+GI +  + +  G+   V NG  T FW   W T++P
Sbjct  892   RAKYCDNRCDIDMFKEKSNASSTWRGILSSIDVVRKGINSAVGNGAKTLFWHHRWATSEP  951

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASL-CLTEENTPDGW  1256
             L         +    ATV E WD V GWK +    YLP   L+ +A+   + +E   D  
Sbjct  952   LISLASPIPPIELQDATVKEMWDLVSGWKVDVFANYLPEATLKLIAAHELIDDEEAIDDI  1011

Query  1255  GWSPDPRGCFSVKSAYGWADNA--ARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTN  1082
              W+  P G F++ SA     NA  A  +A   W  +W +  P R+  FIWL    R++TN
Sbjct  1012  YWNGSPSGGFTIGSAMNITRNAELANMDAHPKWSAVWKIPTPQRVRFFIWLAIQDRLMTN  1071

Query  1081  YERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLT  902
               R  R +T +  C  C    E+ DH+ RRC     +WR  L    E +   ++  SW+T
Sbjct  1072  SNRFLRRLTDDPRCLVCGEVEENTDHILRRCPVARILWR-KLGMLGEHNREEINLGSWIT  1130

Query  901   MNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNL-LPLEQKLDWLRRCDSETAAA  725
              NL  D   G E  W   F    WWLW+WRN+  FNRN  +P++Q      R      A 
Sbjct  1131  KNLSADTMMGSE--WLRVFAVSCWWLWRWRNDRCFNRNPSIPIDQVSFIFARVKEIKEAM  1188

Query  724   FEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDG-SCTSDGQASCGGVLRDTHGNWCRG  548
                     Q   R  E  + W+ P EGW+KLNTDG S  + G A  GG++R   G     
Sbjct  1189  DRNDTNKSQHSGRRKEILVRWQCPKEGWVKLNTDGASKGNPGPAGGGGLIRGPRGEIHEV  1248

Query  547   YTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIV  368
             +    G CT T AE   VL+GL +A E   +++++  DS+++ + L           +I+
Sbjct  1249  FAINCGSCTCTKAELLAVLRGLMIAWEGNHKQVIVSVDSELVAKLLISNAPPSSPYIHII  1308

Query  367   RRCIK-EAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDRL  191
              RC+   A     +V  H YRE N+ AD+LA   +     + + E  P +    +  D  
Sbjct  1309  NRCLSLIARKEWKIVIEHCYRETNRAADRLANMGVCAVERVVMIEAIPKDLHAILLEDLS  1368

Query  190   GASSPRRV  167
             G +  R V
Sbjct  1369  GVAWTRMV  1376



>gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1231

 Score =   326 bits (835),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 206/615 (33%), Positives = 305/615 (50%), Gaps = 29/615 (5%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L+R+SARL GWK ++LSLAGR+TL K+VL++IP++ M    LP      +++ +R F+W
Sbjct  631   VLERVSARLAGWKGRSLSLAGRITLTKAVLSSIPVHVMSAILLPVSTLDTLDRYSRTFLW  690

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   +    K  L++W  I   K  GG+GLR+   MN+A + K+GWRL  +  +LWA+ +
Sbjct  691   GSTME--KKKQHLLSWRKICKPKAEGGIGLRSARDMNKALVAKVGWRLLQDKESLWARVV  748

Query  1612  TTKYHHRSGSHLVTTRRRSI---SNAWKGISAE-RETLESGLTHVVRNGKSTRFWMDSWL  1445
               KY  + G    T+  +     S+ W+ ++   RE +  G+  V  +G + RFW+D WL
Sbjct  749   RKKY--KVGGVQDTSWLKPQPRWSSTWRSVAVGLREVVVKGVGWVPGDGCTIRFWLDRWL  806

Query  1444  TAKPLYEKLRGTLGLPE--LYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCL-TEE  1274
               +PL E   GT  +PE        +YW    GW  E +  YLP     RL S+ +    
Sbjct  807   LQEPLVE--LGTDMIPEGERIKVAADYWLPGSGWNLEILGLYLPETVKRRLLSVVVQVFL  864

Query  1273  NTPDGWGWSPDPRGCFSVKSAYGW--ADNAARQEADKVWGLIWSLRVPARISMFIWLVKH  1100
                D   W     G F+V+SAY     D   R      +  IW L  P R+ +FIWLV  
Sbjct  865   GNGDEISWKGTQDGAFTVRSAYSLLQGDVGDRPNMGSFFNRIWKLITPERVRVFIWLVSQ  924

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
               ++TN ER RRH++ N  C  C G  E + H+ R C  ++ IWR  L  R      +  
Sbjct  925   NVIMTNVERVRRHLSENAICSVCNGAEETILHVLRDCPAMEPIWRRLLPLRRHHEFFSQS  984

Query  919   WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDS  740
                WL  N+  D  +G    WP  FG  +WW WKWR   VF    +    +L +++    
Sbjct  985   LLEWLFTNM--DPVKGI---WPTLFGMGIWWAWKWRCCDVFGERKI-CRDRLKFIK----  1034

Query  739   ETAAAFEERHWPLQRHNRGG---EERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRD  572
             + A      H     +   G   E  + W+ P +GW+K+ TDG+   + G A+ GG +R+
Sbjct  1035  DMAEEVRRVHVGAVGNRPNGVRVERMIRWQVPSDGWVKITTDGASRGNHGLAAAGGAIRN  1094

Query  571   THGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETG  392
               G W  G+   IG C + +AE WG   GL +A + G RR+ ++ D K++V  L    + 
Sbjct  1095  GQGEWLGGFALNIGSCAAPLAELWGAYYGLLIAWDKGFRRVELDLDCKLVVGFLSTGVSN  1154

Query  391   QEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEV  212
                 + +VR C         V   H+YRE N+LAD LA +A T   GLH F+  P    +
Sbjct  1155  AHPLSFLVRLCQGFFTRDWLVRVSHVYREANRLADGLANYAFTLPLGLHCFDACPEGVRL  1214

Query  211   RMALDRLGASSPRRV  167
              +  D  G   PR V
Sbjct  1215  LLLADVNGTEFPRAV  1229



>ref|XP_009119466.1| PREDICTED: uncharacterized protein LOC103844431 [Brassica rapa]
Length=1834

 Score =   328 bits (841),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 214/614 (35%), Positives = 311/614 (51%), Gaps = 23/614 (4%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +++R+S++L GWK + LSLAGR+TL KSVL++IP++TM + ALP    ++++K  R FIW
Sbjct  1230  IIERMSSKLAGWKRRFLSLAGRITLTKSVLSSIPVHTMSSIALPMSTLNQLDKIARSFIW  1289

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +  G+ K  LVAW+ +   +  GGLG+R+   MN A + KLGWR+    + LW + L
Sbjct  1290  GSVD--GDRKQHLVAWEKVCKPRREGGLGIRSAKEMNIALLAKLGWRVLNTHDDLWVQIL  1347

Query  1612  TTKYH----HRSGSHLVTTRRRSISNAWKGIS-AERETLESGLTHVVRNGKSTRFWMDSW  1448
               K+     H S S LV   + + S  W+ I     E +  G   ++ +G+  RFW D+W
Sbjct  1348  RKKFRVGEIHES-SWLVP--KGTWSPTWRSIILGVGECVVPGTCWILGDGRRVRFWKDNW  1404

Query  1447  LTAKPLYEKLRGTLGLPE--LYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTE-  1277
             L  +PL      T+ +PE  L A   + W   RGW  + I+ Y+  E    LAS+ + + 
Sbjct  1405  LMQEPLQS--LSTVDIPEELLEAKARDLWQSGRGWLIQCIEPYISMEHRLCLASVVIDDV  1462

Query  1276  ENTPDGWGWSPDPRGCFSVKSAYGW--ADNAARQEADKVWGLIWSLRVPARISMFIWLVK  1103
                 D   W     G FSVKSAY     D   R   +  +  +W + VP R+ +F+WLV 
Sbjct  1463  TGARDRMSWGGSKDGLFSVKSAYALLTKDEKPRPNMNAFYDRVWRVIVPERVRVFLWLVS  1522

Query  1102  HGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNL  923
             H  ++TN ER RRH++ N  C  C    E + H  R C     +WR  +    ++   + 
Sbjct  1523  HQVIMTNMERKRRHLSDNGMCQLCKSGNETILHTLRDCPASMGLWRRLVDPSRQQRFFDQ  1582

Query  922   DWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCD  743
                 WL  NL    Q    E WP  F   +WW WKWR   VF         ++ +++   
Sbjct  1583  SLLQWLYENLT-SAQSANGERWPTMFALTVWWCWKWRCGYVFGET-GKCPDRVKFVKDKT  1640

Query  742   SETAAAFEERHWPLQRHNRGGEER-LSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDT  569
              E   A  +    L    R  EER + W +P  GW KLNTDG+   + G A+ GGV+RD 
Sbjct  1641  QEVTLANNKLRLHLAVGLR--EERHIKWRRPSNGWCKLNTDGASRGNPGLATAGGVMRDE  1698

Query  568   HGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQ  389
             +G W  G+   IG C++T+AE WGV  G  +A E G RR+ +E DS  +V  LK      
Sbjct  1699  NGEWQGGFAVNIGICSATLAELWGVYYGFVIAWENGIRRLEVEVDSATVVGFLKTGIHDA  1758

Query  388   EQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVR  209
                + +VR C         V   H+YRE N LAD LA +A +   G+H FE+ P      
Sbjct  1759  HPLSFLVRLCYGFISRDWLVKISHVYREANCLADGLANYAFSLSFGVHYFELVPEHVASI  1818

Query  208   MALDRLGASSPRRV  167
             +  D  G +  R+V
Sbjct  1819  LLEDVYGITRSRQV  1832



>ref|XP_010670869.1| PREDICTED: uncharacterized protein LOC104887816 [Beta vulgaris 
subsp. vulgaris]
Length=1295

 Score =   325 bits (833),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 196/588 (33%), Positives = 298/588 (51%), Gaps = 17/588 (3%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L ++I  RL G K K LSLAGR+TLAKS ++++  Y+MQTA +PK VC +I+++TRRF+W
Sbjct  717   LCEKIDRRLAGRKTKYLSLAGRITLAKSTVSSLAYYSMQTAKIPKTVCDDIDRKTRRFVW  776

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G +E +   K+ L+AWD +   K +GGLGL +    N+A M KLGWRL TEPN LW++ L
Sbjct  777   GGNEDT--KKVHLIAWDALQRPKDQGGLGLHSASHANKAFMAKLGWRLLTEPNALWSRVL  834

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              TKY        +   +   SN W  I+     L  G+   + NG  T FW   W++  P
Sbjct  835   RTKYCKGRCDSDMFQPKTGASNVWNRIAENSNILCEGIRSAIGNGIKTLFWDHKWMSNTP  894

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERL-ASLCLTEENTPDGW  1256
             L + +          ATV+E W+   GWKWE    YL  + L+ + A + + +    D  
Sbjct  895   LIDCVTQPPPTEIAGATVSEMWESGGGWKWEVFSPYLSEDSLKLIQAHVVIDDPEVEDLL  954

Query  1255  GWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYE  1076
              W  DP+G FS+KSA       + +  D++W L+W   V  R+  F+WLV H R+L N  
Sbjct  955   YWDGDPKGKFSIKSAIRIIRKESTEFQDQLWNLVWKASVQQRVRAFMWLVCHDRLLGNAN  1014

Query  1075  RTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMN  896
             R +R++T +  C+ C    E   H+ R C     +WR       + +   +D  +W++ N
Sbjct  1015  RFKRNLTDDPKCFVCGDFVESTLHILRDCPAARSVWRKVEGFALDPNFYRVDLKNWISSN  1074

Query  895   LKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNR-NLLPLEQKLDWLRRCDSETAAAFE  719
             L+ + Q    E WP  F   +WWLW+WRN  VF R N +P++       R D      + 
Sbjct  1075  LEYNDQ----ETWPSFFAIIIWWLWRWRNMFVFGRGNEVPIDVGAFLKIRFDE----TWR  1126

Query  718   ERHWPLQRHNRGG---EERLSWEKPDEGWLKLNTDGSC-TSDGQASCGGVLRDTHGNWCR  551
               H  +      G   E+ ++W  P  GW  LNTDG+   + G A  G ++R+  G +  
Sbjct  1127  SLHGDMDTSGSNGHRVEKYIAWSPPPMGWYVLNTDGAARGTPGDAGGGVIIRNHSGMFIS  1186

Query  550   GYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNI  371
               +   GRC +  AE   +L+GL +A       + I+ D+   V+AL    +      ++
Sbjct  1187  ALSLNFGRCCAFRAEVLALLRGLELAINLQFTHLQIQLDNLSCVQALNSGNSSCGGCTHL  1246

Query  370   VRRCIKEA-ENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVP  230
             +R C+         V  +H++RE N+ AD LA   +    G  + E P
Sbjct  1247  IRHCLNLLRREVWVVKVVHVFREGNRAADWLANRGVDHSHGSSVLECP  1294



>ref|XP_009344908.1| PREDICTED: uncharacterized protein LOC103936764 [Pyrus x bretschneideri]
Length=1365

 Score =   317 bits (813),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 198/610 (32%), Positives = 296/610 (49%), Gaps = 21/610 (3%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +++++  RL  WK+ TLS+AGR+   +SV +AIPIY+MQ+  LP  +C +I+K  R F+W
Sbjct  767   IVEKVQRRLSAWKSNTLSMAGRLVYLQSVASAIPIYSMQSTRLPISICDKIDKLNRNFLW  826

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E    +K+ LV W+ ++T K+ GGLGL++ H MN+A + K GW+L      LWA+ L
Sbjct  827   GHTED--KSKVHLVKWETVSTPKSMGGLGLKDTHAMNQALLAKTGWKLMQRDPGLWAQVL  884

Query  1612  TTKY-HHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK  1436
               KY  H       + +  + S+ W+GI    + + +G+   V +G    FW D+WL + 
Sbjct  885   KGKYLKHHDMVGACSAKFTNCSHTWRGILFGAQIIPNGMRWRVGSGSQIHFWKDNWLESG  944

Query  1435  PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENT-PDG  1259
              L       L    L  +V+++     GW  E +   LP + +E + SL +   N   D 
Sbjct  945   VLENFATIPLSADMLEWSVDDFLTD-DGWNVELLYSCLPPDIVEHIFSLHVGIANHREDK  1003

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKV---WGLIWSLRVPARISMFIWLVKHGRVL  1088
               WS    G FSVK+AY     +   + D +   W  IW L++P ++  F+W + HG++L
Sbjct  1004  VIWSLTNSGTFSVKTAYL----SLFGDDDIIPWKWNFIWKLKLPPKLVTFLWTIGHGKIL  1059

Query  1087  TNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSW  908
             TN +R RR  T+N  C  C    E +DH+FR C      W              LD+ SW
Sbjct  1060  TNVQRARRGFTNNPCCPICPNIEESMDHIFRSCKQSPFFWNGVGIPPEVAHSFALDFQSW  1119

Query  907   LTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPL--EQKLDWLRRCDSET  734
             + +NL+          W   F + LW+ WK RN  VFN    P    QK  +    D   
Sbjct  1120  MAINLRTQCSTIHGLPWNLIFASTLWYCWKGRNNLVFNDGQQPPVSPQKFIFQFARDWYD  1179

Query  733   AAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDG-QASCGGVLRDTHGNW  557
             A        P Q  +      + W  P  G  K+NTDGSC       S GG++R++ G+W
Sbjct  1180  ANKSTSSKPPRQIIS------IHWIHPPIGRYKINTDGSCNDPFRHISAGGLIRNSEGDW  1233

Query  556   CRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNN  377
              +G+   +GR T   AE WGV  GL +A + G R +++ECDS   V  ++          
Sbjct  1234  IKGFAANLGRGTIMEAELWGVFMGLSIAWDEGCRDVILECDSWDAVTLIQKPILDSHPLY  1293

Query  376   NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALD  197
             N++  C +           HIYRE N  AD +A        GLH+F  PP      +  D
Sbjct  1294  NLIIDCKEAIGKNWRCEVTHIYREMNASADHMADLGHGLSLGLHVFVSPPTSASNVLVSD  1353

Query  196   RLGASSPRRV  167
              +G + PR V
Sbjct  1354  SIGRALPRAV  1363



>gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis cebennensis]
Length=799

 Score =   308 bits (789),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 206/591 (35%), Positives = 296/591 (50%), Gaps = 54/591 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L R+S+RL GWK + LSLAGR+TL KSVL++IPI+TM T ALPK      ++ ++ F+W
Sbjct  223   ILLRVSSRLAGWKGRMLSLAGRLTLTKSVLSSIPIHTMSTIALPKATLDGFDRISKSFVW  282

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   +    K  L+AW+ I   K  GGLG+R+   MN A + K+GWRL  + ++LWA+ +
Sbjct  283   GSSTE--KKKQHLLAWNKIYCTKQAGGLGIRSSRAMNTALLAKIGWRLLQDKSSLWARVI  340

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
                                       +   RE +  G++ VV +G++TRFW D WL   P
Sbjct  341   --------------------------MLGMREVVIPGVSWVVGDGQTTRFWADKWLMNTP  374

Query  1432  LYEKLRGT--LGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTE-ENTPD  1262
             L E + G   +GL E  A V + W   RGW  E I  Y+  +   RL ++ +       D
Sbjct  375   LREDIIGPAPVGLEE--ARVCDLWQHGRGWLLENIAPYVAPDIRLRLKAVVVDNITGVRD  432

Query  1261  GWGWSPDPRGCFSVKSAYG--WADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVL  1088
                W     G F+VKSAY     DN  R +  +++  +W +  P R+ +F+WL  H  ++
Sbjct  433   RLSWGESLDGKFTVKSAYSSLMKDNTPRSDLSRMYDRVWKVIAPERVKIFLWLGVHQVIM  492

Query  1087  TNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSW  908
             TN ER RRH++    C  C G  E + H+ R C  +  IW   + RR   +        W
Sbjct  493   TNMERQRRHLSDTGICQVCKGGDETIIHILRDCPAMYGIWTRIIPRRKRGTFFTQTLLEW  552

Query  907   LTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAA  728
             +  NL GD   G  +G P    + + W WKWR   VF  N       + ++R   SE   
Sbjct  553   VYDNL-GD--SGKVDGCPW---SCVRWGWKWRCGNVFGVNG-KCRDMVKFVRDRASEVIQ  605

Query  727   AFEERHWPLQRHNRGG-----EERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTH  566
             A       L   N G      E  +SW KP EGWLKLNTDG+   + G A+ GG+LR   
Sbjct  606   AH------LVEGNSGKIRGRIERMVSWVKPAEGWLKLNTDGASKGNPGLATAGGILRQQD  659

Query  565   GNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQE  386
             G+W  G+   IG C++ +AE W V  GL +A E    R+ +E DS+++V  L    +   
Sbjct  660   GSWIGGFAVNIGICSAPLAELWRVYYGLYIAWERKITRLEVEVDSELVVGFLTTWISDSH  719

Query  385   QNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEV  233
               + +VR C         V   H+YRE N+LAD LA +A +   G H F+V
Sbjct  720   PLSFLVRLCYGFISRDWIVRISHVYREANRLADGLANYASSLPLGFHSFDV  770



>ref|XP_006480844.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=768

 Score =   292 bits (748),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 191/612 (31%), Positives = 283/612 (46%), Gaps = 53/612 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +LD+   +L GW A  LSLAGR+TL +SVL A+PIY MQT  LP  + +++++  RRF+W
Sbjct  198   ILDKTDQKLLGWAASQLSLAGRITLTQSVLQAVPIYAMQTTNLPGSIKTKLDQICRRFLW  257

Query  1792  -GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKT  1616
              G DE     KMSLV+W  I   K  GGLG + L  MN A ++K+ W L TEPN L  + 
Sbjct  258   SGNDEL---RKMSLVSWHNICQPKMAGGLGFKRLDIMNEALLLKVAWHLITEPNKLCVQV  314

Query  1615  LTTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK  1436
             L+TKY         T   R  S+ WK +    +  + G+  +V NG   +FW D W T  
Sbjct  315   LSTKYGVPPLEIPHTLPTRYGSHLWKSVGRVWDYAKRGIRWIVGNGWKVKFWWDCWATTP  374

Query  1435  PLYEKLRGTLGLPELY-ATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEE-NTPD  1262
                  L      P+L    V ++      W W K    LP + +  +AS+      N  D
Sbjct  375   LTLADLAIHPIPPDLSDLYVADFVSTDGSWNWPKFSHILPHQAVMIIASIHPPSACNGVD  434

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTN  1082
                W+  P+G F+VKSAY   D +  QE D  W + WS + P  I +FIWLV H R+ T 
Sbjct  435   QVYWAASPQGDFTVKSAYDLLDQSRGQERDSYWKIAWSWKGPQSIKIFIWLVLHNRLKTR  494

Query  1081  YERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLT  902
              E   R +     C  C    E+  H+   C             +   S+          
Sbjct  495   AELATRRLNIEPSCERCGAGLENTIHVLHDCP----------YSKASTSLGT--------  536

Query  901   MNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRN-------LLPLEQKLDWLRRCD  743
                         + W   FG  +W LW WRN  +F ++        L ++ +   +++C+
Sbjct  537   ------------KLWRVIFGVAIWRLWFWRNRFIFTKDHWESSAIALDIKVRAAEIQQCN  584

Query  742   SETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHG  563
             S   A  + R           E+ + W  P   W+KLNTDG+      A  G ++RD  G
Sbjct  585   SSLTATDKSR----------VEKWIRWGAPTWPWVKLNTDGAKKPSDHAGAGELIRDYKG  634

Query  562   NWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQ  383
              W  GY   +G C+ T AE WG+  GL +A  +G RR+++E DS+ +++ +        +
Sbjct  635   VWQIGYCANLGFCSVTSAELWGLFHGLSIAWLHGYRRVIVEVDSRCILQLVSNSNPTINE  694

Query  382   NNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMA  203
             + +++    +       +   HIYRE N  +D LA ++L    GLH F+ PP      + 
Sbjct  695   HLSLITAIQELIGRDWLIQMNHIYREANAASDFLATYSLAFPVGLHYFQSPPLNLLNILN  754

Query  202   LDRLGASSPRRV  167
              D  G +  R V
Sbjct  755   NDVSGVAHSRLV  766



>ref|XP_009123770.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=532

 Score =   282 bits (721),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 192/574 (33%), Positives = 271/574 (47%), Gaps = 57/574 (10%)
 Frame = -1

Query  1861  MQTAALPKGVCSEIEKRTRRFIWGRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMN  1682
             M T ++P G+  +++   R F+WG  +        LV+WD I   K  GGLG+R    MN
Sbjct  1     MSTISMPVGILEKLDSLARSFVWGSGQH-------LVSWDKICKPKASGGLGIRVSRDMN  53

Query  1681  RACMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHLV-TTRRRSISNAWKGIS-AERETLE  1508
             +A + K+GWRL  +  +LWA  L +KY               S S+ WK +    RE + 
Sbjct  54    KALLAKVGWRLLHDTESLWANVLRSKYGVGDIHDTDWMVGSSSSSSTWKSVVMGIREVVL  113

Query  1507  SGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTLGLPELY--ATVNEYWDKVRGWKWEKI  1334
              G + +  NG++ RFW DSW+  +PL  ++    GLPE Y   TV + W +  GW +++I
Sbjct  114   VGHSWITGNGRNIRFWTDSWIAGQPLMTEV--IAGLPEGYEDITVRDMWGEGGGWDFDRI  171

Query  1333  QRYLPTEE-LERLASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWA--DNAARQEADKVW  1163
               ++  E  LE +A +  T     D   W   P G F+VKSAY     D   R +    +
Sbjct  172   TPFVTAERRLELMAVVVDTVTGAKDRLAWGQTPNGQFTVKSAYTLLTRDENPRPQMGSFF  231

Query  1162  GLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHD  983
               +W +  P R+ MF+WLV +  ++TN ER RRH++  + C  C G  E + H+ R C  
Sbjct  232   RSMWRVVAPERVRMFLWLVANQAIMTNAERHRRHLSGTDLCQVCRGGIETIIHVLRDCPA  291

Query  982   VDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEA  803
             +                                  +G    W   F   LWW WKWR   
Sbjct  292   I----------------------------------KGGGVPWATIFALTLWWGWKWRCGN  317

Query  802   VFNRNLLPLEQKLDWLRRCDSE--TAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLN  629
             VF    L    ++ +LR       TA   E  H   +RH    E  + W+ P  GW+KLN
Sbjct  318   VFGDTRL-WRDRVKFLRELAKGVITANRTENAHIK-ERHMV--EIMVGWKPPCVGWMKLN  373

Query  628   TDGSCTSD-GQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARR  452
             TDG+   + G A+ GG LR+  G WC G+   IG CT+ +AE WGV  GL +A E G RR
Sbjct  374   TDGASHGNPGPAAAGGALRNGEGEWCGGFAINIGSCTAPLAELWGVYYGLVVAWEKGVRR  433

Query  451   IMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKW  272
             + +E DS M++E L          + +VR C         V F+H+YRE N+LAD LA  
Sbjct  434   LEVEVDSMMVMEFLTIGIGDTHPLSFLVRLCHGFLTRDWLVRFVHVYREANRLADGLANL  493

Query  271   ALTTQGGLHIFEVPPGEFEVRMALDRLGASSPRR  170
             A T   G H F V P E  V +  D  G   PR+
Sbjct  494   AFTLPFGFHSFVVAPIEVAVLVHEDVAGPLRPRQ  527



>dbj|BAE79382.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score =   289 bits (739),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 186/606 (31%), Positives = 286/606 (47%), Gaps = 17/606 (3%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D++  +L  WKA +L++AGR  L ++ L  +P YTMQ  ALP   C+EI+K  R F+W
Sbjct  772   VIDKMRTKLSSWKASSLNMAGRRVLVQASLATVPTYTMQVMALPVSTCNEIDKTCRNFLW  831

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G D  +   K+  V W  I   +  GGLGLR     NRA + K+ W++ +  + LW K L
Sbjct  832   GHD--TNTRKLHSVNWAEICKPRNEGGLGLRMARDFNRAFLTKMAWQIFSNIDKLWVKVL  889

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  ++   L    + + S  W+ I   ++ L   +   V NG+   FW D W+   P
Sbjct  890   REKYV-KNADFLHLQSQSNCSWGWRSIMKGKDVLAGAIKWNVGNGRKINFWNDWWVGDGP  948

Query  1432  LYEKLRGTLGLPELY-ATVNEYWDKVRGWKWEKIQRYLPTEELERL-ASLCLTEENTPDG  1259
             L       +  P +    V +     R W    +   LPT  ++ + A+         D 
Sbjct  949   LASN-TDCINQPHMTDIKVEDLITSQRRWDTGALHNILPTNMIDMVRATPIAINSEQEDF  1007

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
               W     G  +V SAY     A     D+    IW      +I +F+W +    ++ N 
Sbjct  1008  LSWPHSTTGMVTVSSAYSLI--AGHDGDDRSHDWIWRATCTEKIKLFMWKIVKNGLMVNV  1065

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTM  899
             ER RR +     C  C  + E LDHLFRRC   +  W  ++   T ++  +L  +SW+  
Sbjct  1066  ERKRRGLADAASCPVCGEEDETLDHLFRRCLLAEACWDSAVPPLTFQTSNHLHMHSWMKA  1125

Query  898   NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAA--  725
                  ++ G+   W   F   LW LWK RN  VF+ N+       D L R   E++ A  
Sbjct  1126  ACSSQQKDGYSTNWSLIFPYILWNLWKARNRLVFDNNI---TAPSDILNRSFMESSEARC  1182

Query  724   FEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVLRDTHGNWCRG  548
                +   LQ      +  + W  P  G+ KLN+DG+C S    AS GG+LR+ +G W  G
Sbjct  1183  LLAKRTGLQT---AFQTWVVWSPPAAGFTKLNSDGACKSHSHLASAGGLLRNENGLWVAG  1239

Query  547   YTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIV  368
             YT  IG   S +AE WG+ +GL +AK  G  +++ E DS+ +V+ L+         + +V
Sbjct  1240  YTCNIGTANSFLAELWGLREGLLLAKNRGFTKLIAETDSEAVVQVLRKDGPVTPDASILV  1299

Query  367   RRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDRLG  188
             + C    ++F  +   HI RE N+ AD LA    ++  G  I E PP +  + +  D +G
Sbjct  1300  KDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQRDAIG  1359

Query  187   ASSPRR  170
              +S RR
Sbjct  1360  LASSRR  1365



>dbj|BAE79385.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score =   286 bits (732),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 185/606 (31%), Positives = 285/606 (47%), Gaps = 17/606 (3%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D++  +L  WKA +L++AGR  L ++ L  +P YTMQ  ALP   C+EI+K  R F+W
Sbjct  772   VIDKMRTKLSSWKASSLNMAGRRVLVQASLATVPTYTMQVMALPVSTCNEIDKTCRNFLW  831

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G D  +   K+  V W  I   +  GGLGLR     NRA + K+ W++ +  + LW K L
Sbjct  832   GHD--TNTRKLHSVNWAEICKPRNEGGLGLRMARDFNRAFLTKMAWQIFSNIDKLWVKVL  889

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  ++   L    + + S  W+ I   ++ L   +   V NG+   FW D W+   P
Sbjct  890   REKYV-KNADFLHLQSQSNCSWGWRSIMKGKDVLAGAIKWNVGNGRKINFWNDWWVGDGP  948

Query  1432  LYEKLRGTLGLPELY-ATVNEYWDKVRGWKWEKIQRYLPTEELERL-ASLCLTEENTPDG  1259
             L       +  P +    V +     R W    +   LPT  ++ + A+         D 
Sbjct  949   LASN-TDCINQPHMTDIKVEDLITSQRRWDTGALHNILPTNMIDMVRATPIAINSEQEDF  1007

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
               W     G  +V SAY     A     D+    IW      +I +F+W +    ++ N 
Sbjct  1008  LSWPHSTTGMVTVSSAYSLI--AGHDGDDRSHDWIWRATCTEKIKLFMWKIVKNGLMVNV  1065

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTM  899
             ER RR +     C  C  + E LDHLFRRC   +  W  ++   T ++  +L  +SW+  
Sbjct  1066  ERKRRGLADAASCPVCGEEDETLDHLFRRCLLAEACWDSAVPPLTFQTSNHLHMHSWMKA  1125

Query  898   NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAA--  725
                  ++ G+   W   F   LW LWK RN  VF+ N+       D L R   E++ A  
Sbjct  1126  ACSSQQKDGYGTNWSLIFPYILWNLWKARNRLVFDNNI---TAPSDILNRSFMESSEARC  1182

Query  724   FEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVLRDTHGNWCRG  548
                +   LQ      +  + W  P  G+ KLN+DG+C S    AS GG+LR+ +G W  G
Sbjct  1183  LLAKRTGLQT---AFQTWVVWSPPAAGFTKLNSDGACKSHSHLASAGGLLRNENGLWVAG  1239

Query  547   YTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIV  368
             Y   IG   S +AE WG+ +GL +AK  G  +++ E DS+ +V+ L+         + +V
Sbjct  1240  YICNIGTANSFLAELWGLREGLLLAKNRGFTKLIAETDSEAVVQVLRKDGPVTPDASILV  1299

Query  367   RRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDRLG  188
             + C    ++F  +   HI RE N+ AD LA    ++  G  I E PP +  + +  D +G
Sbjct  1300  KDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQRDAIG  1359

Query  187   ASSPRR  170
              +S RR
Sbjct  1360  LASSRR  1365



>gb|AAF23831.1|AC007234_3 F1E22.12 [Arabidopsis thaliana]
Length=1055

 Score =   280 bits (716),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 193/604 (32%), Positives = 280/604 (46%), Gaps = 22/604 (4%)
 Frame = -1

Query  1909  RVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSG---------NNKMS  1757
             +V + + VL A    + Q  +L K      +  +R       ++SG           K  
Sbjct  135   QVQIVRRVLEAFCTASGQKVSLEKSKIFFSKNVSRELGKLISDESGIQSTCDWGKKKKQH  194

Query  1756  LVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHH---RSG  1586
             LV W  + + K  GGLG+R   +MNRA + K+GWRL  E N+LW   L  KYH    R  
Sbjct  195   LVKWSKVCSPKKEGGLGVRAAKSMNRALISKVGWRLLQEKNSLWTLVLQKKYHVGEIRDS  254

Query  1585  SHLVTTRRRSISNAWKGIS-AERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGT  1409
               L+   + S S+ W+ I+   R+ +  G+  +  +G+  RFW D W++ KPL E   G 
Sbjct  255   RWLIP--KGSWSSTWRSIAIGLRDVVSHGVGWIPGDGQQIRFWTDRWVSGKPLLELDNGE  312

Query  1408  LGLPELYATVNEYWDKVRGWKWEKIQRYLPTE-ELERLASLCLTEENTPDGWGWSPDPRG  1232
                        + W   RGW + KI  Y      LE  A +        D   W     G
Sbjct  313   RPTDCDTVVAKDLWIPGRGWDFAKIDPYTTNNTRLELRAVVLDLVTGARDRLSWKFSQDG  372

Query  1231  CFSVKSAYGW--ADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHI  1058
              FSV+SAY     D   R      +  +W +RVP R+  F+WLV +  V+T  ER RRH+
Sbjct  373   QFSVRSAYEMLTVDEVPRPNMASFFNCLWKVRVPERVKTFLWLVGNQAVMTEEERHRRHL  432

Query  1057  TSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQ  878
             +++  C  C G  E + H+ R C     IW   + +R ++   +     WL  NL GDR 
Sbjct  433   SASNVCQVCKGGVESMLHVLRDCPAQLGIWVRVVPQRRQQGFFSKSLFEWLYDNL-GDRS  491

Query  877   QGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQ  698
                +  W   F   +WW WKWR   +F  N      ++ +++    E   A         
Sbjct  492   GCEDIPWSTIFAVIIWWGWKWRCGNIFGEN-TKCRDRVKFVKEWAVEVYRAHSGNVLVGI  550

Query  697   RHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHGNWCRGYTYRIGRCT  521
                R  E  + W  P  GW+K+NTDG+   + G AS GGVLRD  G WC G++  IGRC+
Sbjct  551   TQPR-VERMIGWVSPCVGWVKVNTDGASRGNPGLASAGGVLRDCTGAWCGGFSLNIGRCS  609

Query  520   STVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAEN  341
             +  AE WGV  GL  A E    R+ +E DS+++V  LK   +     + +VR C    + 
Sbjct  610   APQAELWGVYYGLYFAWEKKVPRVELEVDSEVIVGFLKTGISDSHPLSFLVRLCHGFLQK  669

Query  340   FLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDRLGASSPRRVSH  161
                V  +H+YRE N+LAD LA +A +   G H F++ P      +  D LG++ PRRV  
Sbjct  670   DWLVRIVHVYREANRLADGLANYAFSLSLGFHSFDLVPDAMSSLLREDTLGSTRPRRVRL  729

Query  160   *GPL  149
               P 
Sbjct  730   NNPF  733



>ref|XP_007039838.1| RNA-directed DNA polymerase (Reverse transcriptase), Polynucleotidyl 
transferase, Ribonuclease H fold-like protein [Theobroma 
cacao]
 gb|EOY24339.1| RNA-directed DNA polymerase (Reverse transcriptase), Polynucleotidyl 
transferase, Ribonuclease H fold-like protein [Theobroma 
cacao]
Length=616

 Score =   272 bits (695),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 170/544 (31%), Positives = 265/544 (49%), Gaps = 15/544 (3%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L D++ ++L GWKA +LS AG +TL KSVL+ IP Y MQ  ++P   C  +E+  + F+W
Sbjct  69    LEDKVRSKLSGWKAFSLSFAGILTLVKSVLSTIPYYVMQIVSIPLDSCKRMERYCQNFLW  128

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G D  + + ++ L+  + I   K    LG++ LH MN A +MKL W+L T P +LW   +
Sbjct  129   GGD--ADHKRIHLIRCNQICRPKEERSLGVKRLHVMNNAFLMKLLWQLVTRPKSLWVSII  186

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY+        +      S+ W  +S       + L  V+ +G S RFW D WL   P
Sbjct  187   RGKYNFNMDRRSSSIYCHGASHTWNALSKLWNVFNNNLRWVLGDGLSIRFWKDIWLEDTP  246

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELER-LASLCLTEENTPDGW  1256
             L E+      +      V E+      W  EK+   L ++ + + L  L       PD  
Sbjct  247   LLEQGHTLNIVTSENCCVREFLLDTGEWNHEKLATCLHSDLVNKILMFLPPLLSFKPDTP  306

Query  1255  GWSPDPRGCFSVKSAYGWA----DNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVL  1088
              W+    G  +V S Y        N   Q++ K W + W    P RI  F+    HG++L
Sbjct  307   YWASSASGVCTVASTYEVLREDYPNYIGQQSRK-WAIAWKWDGPQRIRTFLMQCLHGKLL  365

Query  1087  TNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSW  908
             TN E  RR+++S+  C  C+   E + HL R C     +W     R    +  +L  + W
Sbjct  366   TNLECRRRNMSSSATCALCSVSDESVLHLLRDCPHSKEVWLKLGSRMGYGNFFDLLLSDW  425

Query  907   LTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAA  728
             L  NLK          W   FG   W++WKWRN  VF   L+P+++KL  ++      AA
Sbjct  426   LLTNLKNYNVCVDGIPWVILFGFTCWYIWKWRNVKVFEGKLIPMDRKLSMIK---GLVAA  482

Query  727   AFEERHWPLQRHNRGGEER---LSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHGN  560
             ++     P       G +R   + W+ P +GW+ +NTDG+   +   A+ GGV RD +  
Sbjct  483   SYHAVQIPCTHSRLNGYKREMLVGWQNPPQGWVAVNTDGALRRNTNMAAAGGVFRDCNEY  542

Query  559   WCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQN  380
             W  G+  ++G+C S  AE WGVL  LR+ KE G  +I ++ D+K++V+A+         N
Sbjct  543   WLGGFAAKLGKCYSYRAELWGVLHSLRIVKEKGFSKIWLQVDNKIVVKAIISSALHPCAN  602

Query  379   NNIV  368
             ++++
Sbjct  603   SDLL  606



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score =   281 bits (720),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 185/607 (30%), Positives = 284/607 (47%), Gaps = 19/607 (3%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D++  +L  WKA +L++AGR  L ++ L  +P YTMQ  ALP   C+EI+K  R F+W
Sbjct  1304  VIDKMRTKLSSWKASSLNMAGRRVLVQASLATVPTYTMQVMALPVSTCNEIDKTCRNFLW  1363

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G D  +   K+  V W  I   +  GGLGLR     NRA + K+ W++ +  + LW K L
Sbjct  1364  GHD--TNTRKLHSVNWAEICKPRNEGGLGLRMARDFNRAFLTKMAWQIFSNIDKLWVKVL  1421

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  ++   L    + + S  W+ I   ++ L   +   V NG+   FW D W+   P
Sbjct  1422  REKYV-KNADFLHLQSQSNCSWGWRSIMKGKDVLAGAIKWNVGNGRKINFWNDWWVGDGP  1480

Query  1432  LYEKLRGTLGLPELY-ATVNEYWDKVRGWKWEKIQRYLPTEELE--RLASLCLTEENTPD  1262
             L       +  P +    V +     R W    +   LP   ++  R   + +  E   D
Sbjct  1481  LASNT-DCINQPHMTDIKVEDLTTSQRRWDTGALHNILPINMIDMVRATPIAINSEQE-D  1538

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTN  1082
                W     G  +V SAY              W  IW      +I +F+W +    ++ N
Sbjct  1539  FPSWPHSTTGMVTVSSAYSLIAGHDGDGRSHDW--IWRATCTEKIKLFMWKIVKNGLMVN  1596

Query  1081  YERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLT  902
              ER RR +     C  C  + E LDHLFRRC   +  W  ++   T ++  +L  +SW+ 
Sbjct  1597  VERKRRGLADAASCPVCGEEDETLDHLFRRCLLAEACWDSAVPPLTFQTSNHLHMHSWMK  1656

Query  901   MNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAA-  725
                   ++ G+   W   F   LW LWK RN  VF+ N+       D L R   E++ A 
Sbjct  1657  AACSSQQKDGYGTNWSLIFPYILWNLWKARNRLVFDNNI---TAPSDILNRSFMESSEAR  1713

Query  724   -FEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVLRDTHGNWCR  551
                 +   LQ      +  + W  P  G+ KLN+DG+C S    AS GG+LR+ +G W  
Sbjct  1714  CLLAKRTGLQT---AFQTWVVWSPPAAGFTKLNSDGACKSHSHLASAGGLLRNENGLWVA  1770

Query  550   GYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNI  371
             GYT  IG   S +AE WG+ +GL +AK  G  +++ E DS+ +V+ L+         + +
Sbjct  1771  GYTCNIGTANSFLAELWGLREGLLLAKNRGFTKLIAETDSEAVVQVLRKDGPVTPDASIL  1830

Query  370   VRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDRL  191
             V+ C    ++F  +   HI RE N+ AD LA    ++  G  I E PP +  + +  D +
Sbjct  1831  VKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQRDAI  1890

Query  190   GASSPRR  170
             G +S RR
Sbjct  1891  GLASSRR  1897



>gb|ABD28505.2| RNA-directed DNA polymerase (Reverse transcriptase); Polynucleotidyl 
transferase, Ribonuclease H fold [Medicago truncatula]
Length=729

 Score =   272 bits (696),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 166/525 (32%), Positives = 257/525 (49%), Gaps = 21/525 (4%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++++I  +L GWK + LSLAGR+TL+K V+++IP Y MQ A +PK +C EIEK  R F+W
Sbjct  198   IINKIQNKLSGWKQQCLSLAGRITLSKFVISSIPYYHMQYAKIPKTICDEIEKIQRGFVW  257

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   Q    K  LV+WD+    K  GGLG +  H MN A +MK+ W L  +P+ LW + L
Sbjct  258   GDSNQG--RKAHLVSWDVCCLPKMNGGLGFKRPHHMNEAFLMKMLWNLIKQPDKLWCRVL  315

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK-  1436
              +KY   +  +   + +   S  WK I    +  +  +   + +G+ST FW+D W++   
Sbjct  316   YSKYGRNNDLNNNISSQPYDSPLWKAIVGIWDDFKRHVIWQIGDGRSTNFWLDKWISNNT  375

Query  1435  PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEE-NTPDG  1259
              L+     T    +   +V +  +    W    +   L  + + ++ +L    + + PD 
Sbjct  376   SLFSS--STQSYVDTTISVRDAINTSGVWDLNFLMDNLHVDIVNQILALPTPSDFDGPDT  433

Query  1258  WGWSPDPRGCFSVKSAYGW-ADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTN  1082
              GW       F+V+SAY    +N      D  W  +W+ + P RI  FIWL  HGR+LTN
Sbjct  434   IGWGGTNTLKFTVQSAYNLQQENPFAVGGD--WKTLWNWKGPHRIQTFIWLAAHGRILTN  491

Query  1081  YERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLT  902
             Y R++  +  +  C  CA + E + H+ R C    ++W   +      +  + D   W+ 
Sbjct  492   YRRSKWGVGISPTCPCCAREDETVIHVLRDCVHSTQVWLRLIPHNYITNFFSFDCREWVF  551

Query  901   MNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAV----FNRNLLPLEQKLDWLRRCDSET  734
              NL           W   F T  W+LW WRN+++    F R   P      + R  +  T
Sbjct  552   NNLNKKGIGDNPATWQTTFMTTCWYLWNWRNKSIFEIGFQRPSNPTLVIQKFTREIEDNT  611

Query  733   AAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVLRDTHGNW  557
                 +  H       +     + W +P  GW+KLN DG+    G  A CGG+LRD+ G W
Sbjct  612   KLVHKSSH-------QKETIYIGWMRPPFGWVKLNCDGAWKGSGTLAGCGGLLRDSDGRW  664

Query  556   CRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKML  422
              +GY  +IG C +  AE WG+  GL MA       +++E DSK+L
Sbjct  665   IKGYFKKIGMCDAFHAEMWGMYLGLDMAWRENTTHLIVESDSKIL  709



>ref|XP_010674616.1| PREDICTED: uncharacterized protein LOC104890737 [Beta vulgaris 
subsp. vulgaris]
Length=1149

 Score =   276 bits (707),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 188/599 (31%), Positives = 294/599 (49%), Gaps = 38/599 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             LLD+ + R+ GW+AK L++AGR TL KSVLN+ P+Y MQT  LP GV ++I+K  +RF+W
Sbjct  556   LLDKTTDRIRGWQAKLLNMAGRCTLIKSVLNSYPLYVMQTNILPIGVLNDIQKNVKRFLW  615

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
              +  Q   + +S  +WD +      GGLG+R+L   N   M KLGW   T+P+ LW + L
Sbjct  616   NKVGQ--RHYISRTSWDQVCKPMIEGGLGIRDLRHWNLCFMAKLGWTFLTQPSKLWVRIL  673

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              +K + +  + +      S S  W+ I   R+ L  GL   V NG+    W   W+  +P
Sbjct  674   KSK-NCKGSNFMDVIPNVSHSTIWRDILKGRDMLRQGLILNVGNGEDISLWFHHWVGKEP  732

Query  1432  LYEKLRGTLGLPELYATVNEYWDKV-----RGWKWEKIQRYLPTEELERLASLCLTE-EN  1271
             LY KL+  L +PE  A    +W        + W    I   LP E ++ + ++ LT+ + 
Sbjct  733   LY-KLKD-LVIPEDIA----HWRVAHIIHNKEWNITHIANLLPQEIVDEICAIPLTKFDE  786

Query  1270  TPDGWGWSPDPRGCFSVKSAYGWAD--NAARQEADKVWGLIWSLRVPARISMFIWLVKHG  1097
               DG  W     G FS+K+AY   +  N+ R ++ K W  +W + +P +  M  W V H 
Sbjct  787   VKDGLRWLFTTDGEFSIKTAYRNLNPSNSRRIQSLKKWSKLWRIEIPFKYRMLFWNVVHE  846

Query  1096  RVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQ-----RRTE-ES  935
              + T     +R    +  C  C    E   HLFR C   + +W+   Q     R  +   
Sbjct  847   ILPTAVNLQKRIHAFDTTCQCCLLATETHLHLFRNCLHANLLWKFFFQNCHLARAIDIHC  906

Query  934   MRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD--  761
               N DW  W+  NL     Q  E  W + F   LW +WK RN+ VF R +     + +  
Sbjct  907   FFNNDWEDWINFNL----DQSLE--WLQMFVIALWHIWKNRNKVVFERAMARSSSQFNHF  960

Query  760   WLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGV  581
             +L    ++ A   +++  P        ++   W+ P  G+LKLNTDGS  ++ +AS GGV
Sbjct  961   FLDYLHNKNAFQNQDKVAP------NVQQITIWKPPVHGYLKLNTDGSWKANDKASGGGV  1014

Query  580   LRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEAL-KG  404
             +R T G+W  G++ +        AE   + +GL MAK++   R+ IE D++ L   L + 
Sbjct  1015  IRRTDGSWFMGFSIKFRAVNLAAAELITIREGLSMAKDHNISRLEIETDAQALKIMLDRA  1074

Query  403   KETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPP  227
             +     Q + I+   +K  +    V+FLH  R+ N +A KLA++ +  +        PP
Sbjct  1075  EHQPHHQLSAIICDIVKLIKTNWVVIFLHAKRDANMVAHKLARFGMAMEVDKTTHTAPP  1133



>emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1363

 Score =   275 bits (703),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 188/595 (32%), Positives = 290/595 (49%), Gaps = 33/595 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             LL+++ + + GW+AK L++AGR TL KSV+++ P+Y MQ++ LP  V +EIEK  R+F+W
Sbjct  771   LLEKVKSAINGWQAKYLNMAGRCTLIKSVVSSFPVYGMQSSLLPVSVMNEIEKDCRKFLW  830

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
              + ++S  + ++ ++WD I +   +GGLG R LH  N A M KLGW +  +   LW + L
Sbjct  831   NKMDKS--HYLARMSWDRICSPTGKGGLGFRRLHNWNLAFMAKLGWMIIKDETKLWVRIL  888

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y  R GS L    +   S  W+ I   RE LE GL   + NG+ST  W   W+   P
Sbjct  889   KARYWER-GSFLSAVGKNHHSPIWRDIVKGRELLEKGLVRRIGNGRSTSLWYHWWVGGGP  947

Query  1432  LYEKLRGTLGLPELYA--TVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTE-ENTPD  1262
             L + +     +PE  +   V+    + R W  +KI   LP + L+++  + L       D
Sbjct  948   LVDVMGSN--IPEFMSHWQVSNIIKRGR-WDTKKISHLLPPDILKQIKEIPLASMSEVED  1004

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADK-VWGLIWSLRVPARISMFIWLVKHGRVLT  1085
              + W+ +  G FSVKSAY   +    +   K  W  +W   +P +  + IW   H  + T
Sbjct  1005  DFTWNFEKNGTFSVKSAYYLINRREEETGGKGSWRGLWRKNIPFKYKLLIWNGIHNILPT  1064

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRR---TEESMRNLDWN  914
                  +R    N  C  C    ED+ HLFR C     +W   L+      +    NL+W 
Sbjct  1065  ALFLAKRIHNFNPQCVACDHPIEDMIHLFRDCCVASSVWIEILKHHKPNNQNLFFNLEWE  1124

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSET  734
              W+  NL         + W  +F T  W +W  RN+ VF       E  ++  +   +  
Sbjct  1125  EWIDFNLNQ------HDYWVTKFTTAFWHIWCSRNKTVF-------ECAVNHPKFTYNRV  1171

Query  733   AAAFEERHWPLQRHN---RGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTH  566
              A F       Q +N    G +  L W+ P +G+LKLNTDG+  +D   A  GGV RD  
Sbjct  1172  VADFFTNIRAFQVNNTQGNGSKVVLRWKPPHQGFLKLNTDGAWKADWENAGIGGVFRDAV  1231

Query  565   GNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQE  386
             GNW  G+  R+   +   AE   + +GL++A +    ++ +ECD+K +V+ L      + 
Sbjct  1232  GNWELGFAKRVDAGSPEAAELMAIREGLQVAWDCNYHKLEVECDAKGVVQLLAKPLEAEN  1291

Query  385   QNNNIVRR--CIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPP  227
                 ++    CI    ++ +V FLHI RE NK+A  LA  A+       IF  PP
Sbjct  1292  HPLGVIVMDICILLTRHW-SVEFLHIKREGNKVAHCLAAEAVNQVEERVIFINPP  1345



>ref|XP_006469117.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=491

 Score =   259 bits (663),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 162/457 (35%), Positives = 230/457 (50%), Gaps = 13/457 (3%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D++  RL GW A  LSLAGR+TL +SVL AIP+YTMQT+ +P GV ++I +  +RFIW
Sbjct  7     IVDKVEKRLSGWNASQLSLAGRITLPQSVLQAIPVYTMQTSEIPAGVINKINQICKRFIW  66

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                 +  N KMSL+ WD +   K  GGLGL+NL  MN+A MMKL W L +EP +LW + L
Sbjct  67    SGSNE--NRKMSLIGWDKVCQPKLCGGLGLKNLGMMNKALMMKLAWGLVSEPTSLWCRVL  124

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTA-K  1436
              TKY        +    RS S+ WK I         GL   + NG+  RFW+D W+T  K
Sbjct  125   YTKYGVADSDFPLGLPTRSGSHLWKSIGKVWSDTLKGLQWNIVNGRRVRFWLDCWVTKHK  184

Query  1435  PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENT-PDG  1259
             PL       + +  L   + ++ D    W+W+  +  LP   + R+A++    E    D 
Sbjct  185   PLSSYALAPIPVESLMNLIVDFVDANGNWRWDSFEHLLPNCIILRIAAVQPPMEGKGDDK  244

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
             + W+   RG FSVKSAY              W + W  + P R+  FIWL  H R+ T  
Sbjct  245   FFWANSQRGDFSVKSAYMAITKNEIGIEHSRWNIAWKWKGPPRVQTFIWLALHDRLKTKA  304

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTM  899
             E  RRHI  +  C +C    E   H+ R C    R+W   L     +   + +   WLT+
Sbjct  305   EIGRRHIHIDWTCDHCGVASETTLHVLRDCFMAKRLWNQLLPSEWRQVFFSSNLLDWLTL  364

Query  898   NLKGDRQQGFEEG--WPERFGTRLWWLWKWRNEAVFNR-NLLPLEQKLDWLRRCDSETAA  728
             NL+ +  Q  E G  W   FG  +W LW WRN+  FN+ +   +    D L R    T++
Sbjct  365   NLRSN--QCMENGLEWSCMFGVAIWRLWFWRNQYQFNKVSTDSISMAQDVLIRAKEITSS  422

Query  727   AFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGS  617
                  + P     R  E+ + W+ P     KLN+DG+
Sbjct  423   NKSGLNSP----TRKVEKWIGWQPPVWPLCKLNSDGA  455



>emb|CAB78008.1| putative protein [Arabidopsis thaliana]
 emb|CAB82119.1| putative protein [Arabidopsis thaliana]
Length=947

 Score =   264 bits (674),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 181/550 (33%), Positives = 265/550 (48%), Gaps = 63/550 (11%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L+R+S+RL GWK ++LS AGR+TL KSVL+ IPI+TM T +LP+     ++K  R F+ 
Sbjct  445   VLERVSSRLAGWKGRSLSFAGRLTLTKSVLSLIPIHTMSTISLPQSTLEGLDKLARVFLL  504

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   +    K+ LVAWD +   K+ GGLG+R    MN+A + K+GWRL  +  +LWA+ L
Sbjct  505   GSSAE--KKKLHLVAWDRVCLPKSEGGLGIRTSKCMNKALVSKVGWRLINDRYSLWARIL  562

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              +KY  R G                     RE +  G   VV NG+   FW D+WL+ + 
Sbjct  563   RSKY--RVGL--------------------REVVSRGSRWVVGNGRDILFWSDNWLSHEA  600

Query  1432  LYEKLRGTLGLP--ELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLC---LTEENT  1268
             L    R  + +P  E    V + W    GWK +KI+ Y+       LA++    +T    
Sbjct  601   LIN--RAVIEIPNSEKELRVKDLWANGLGWKLDKIEPYISYHTRLELAAVVVDSVTGARD  658

Query  1267  PDGWGWSPDPRGCFSVKSAYGWA--DNAARQEADKVWGLIWSLRVPARISMFIWLVKHGR  1094
                WG+S D  G F+VKSAY     D+  R      +  +W +    R+  F+W      
Sbjct  659   RLSWGYSAD--GVFTVKSAYRLLTEDHDPRPNMAAFFDRLWRVVALERVKTFLW------  710

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN  914
                       HI     C  C G  E + H+ + C  +  IWR  +Q +      N    
Sbjct  711   ----------HIGDTSVCQVCKGGDETILHVLKDCPSIAGIWRRLVQVQRSYDFFNGSLF  760

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSET  734
              WL +NL G +       W   F   +WW WKWR   VF   +     ++ + R   +E 
Sbjct  761   GWLYVNL-GMKNAETGYAWATLFAIVVWWSWKWRCGYVFG-EVGKCRDRVKFFRDLAAEV  818

Query  733   AAAFEERHWPLQRHNRGGEER----LSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDT  569
             + A       +   N G   R    ++W+ PD  W+KLNTDG+   + G A+ GGVLRD 
Sbjct  819   SHAH-----AIHSQNGGLRTRVERLVAWKPPDGEWVKLNTDGASRGNLGLATTGGVLRDG  873

Query  568   HGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQ  389
              G+WC G+   IG C++ +AE WGV  GL MA E    R+ +E DS+++V  L    +  
Sbjct  874   IGHWCGGFALDIGVCSAPLAELWGVYYGLYMAWERRFTRVELEVDSELVVGFLTTGISDT  933

Query  388   EQNNNIVRRC  359
                + +VR C
Sbjct  934   HSLSFLVRLC  943



>dbj|BAB09815.1| non-LTR retroelement reverse transcriptase-like [Arabidopsis 
thaliana]
Length=676

 Score =   251 bits (641),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 164/499 (33%), Positives = 242/499 (48%), Gaps = 15/499 (3%)
 Frame = -1

Query  1636  NTLWAKTLTTKYH----HRSGSHLVTTRRRSISNAWKGISAE-RETLESGLTHVVRNGKS  1472
              +LWA+ L +KY     H S      T + + S  W+ ++   RE +  G+  V+ +GK 
Sbjct  182   TSLWARVLRSKYKIGDIHDSAW---MTPKGTWSALWRSVNVGLREVVNRGIGWVLGDGKI  238

Query  1471  TRFWMDSWLTAKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLAS  1292
              RFW D WL + PL E +   L + E    V +YW +  GW  E+I  +LP    +RL +
Sbjct  239   IRFWQDRWLLSTPLLEWVSDQLPVEERGQRVADYWIEGVGWDMERIAVFLPEFMRQRLLA  298

Query  1291  LCLTE-ENTPDGWGWSPDPRGCFSVKSAY--GWADNAARQEADKVWGLIWSLRVPARISM  1121
             + +       D   W     G F+V SAY     D  ++Q   + +  +W + VP R  +
Sbjct  299   VVIGGCYGVEDKMSWVGTENGRFTVSSAYLIQSVDEISKQCMSRFFDRVWRVMVPERARI  358

Query  1120  FIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTE  941
             F+WLV +  VLTN ER RRH+  ++ C  C G  E L H+ R C  +  IW   +    +
Sbjct  359   FLWLVGNQVVLTNAERVRRHMADSDVCPLCKGASESLIHVLRDCPAMMGIWMRVVPVMEQ  418

Query  940   ESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
                       W+  NLK +R       WP  F   +WW WKWR   VF  +      ++ 
Sbjct  419   RRFFETSLLEWMYGNLK-ERSDSERRSWPTLFALTVWWGWKWRCGYVFGEDSR-CRDRVK  476

Query  760   WLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGG  584
             +L+   +E  AA    +    R +   E  ++W KP EGW+ +NTDG+   + GQA+ GG
Sbjct  477   FLKSAVAEVEAAHLAANGD-AREDVLVERMIAWRKPAEGWVTMNTDGASHGNPGQATAGG  535

Query  583   VLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKG  404
             V+RD HG+W  G+   IG C++ +AE WGV  GL +A E G RR+ +E DS ++V  L+ 
Sbjct  536   VIRDEHGSWLVGFALNIGVCSAPLAELWGVYYGLVVAWERGWRRVRLEVDSALVVGFLQS  595

Query  403   KETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPG  224
                       +VR C         V   H+YRE N+LAD LA +A T   G  + +  P 
Sbjct  596   GIGDSHPLAFLVRLCHGFISKDWIVRITHVYREANRLADGLANYAFTLPFGFLLLDSCPE  655

Query  223   EFEVRMALDRLGASSPRRV  167
                  +  D +G S PR V
Sbjct  656   HVSSILLEDVMGTSFPRHV  674



>ref|XP_008221358.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=877

 Score =   254 bits (648),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 180/613 (29%), Positives = 275/613 (45%), Gaps = 71/613 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++ +I  RL  WK+ TL +A R+TL +SV  AIPIYTMQTA LP  V  ++++  ++F+W
Sbjct  323   VIAKIQTRLASWKSHTLFMACRMTLLQSVTPAIPIYTMQTAKLPMSVYDKLDQLNKKFLW  382

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G    +  +K+ LV W+ +   K  GGLG++    MN+A + K GWRL      LW++  
Sbjct  383   GHTNNT--SKIHLVNWEQVCKPKIVGGLGIKRSAWMNQALLAKTGWRLLQHEQGLWSQ--  438

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
                   R GS                                  G +  FW D WL+  P
Sbjct  439   ------RVGS----------------------------------GDNVLFWTDRWLSRGP  458

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENT-PDGW  1256
             LY+     L    L   V ++ ++   W +  ++  LP   ++ + S+  +   +  D  
Sbjct  459   LYQYALIDLSEEMLQLNVCDFLEE-GVWDFNCLRECLPLHIIQLILSVHASFNGSGADRC  517

Query  1255  GWSPDPRGCFSVKSAYG-WADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
              W   P G FSVKSAY  +    A  + D  W  IW L +P ++  F+W+V H ++LTN 
Sbjct  518   IWQFTPNGSFSVKSAYSSFLPTEASVKWD--WQFIWGLLLPPKVKTFLWIVCHQKLLTNV  575

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTM  899
             +R +R +T    C  C    + + HLF+ C     IW + LQ     S+  +D+  WL  
Sbjct  576   QRQKRGLTQVPTCPKCDYPMKAIAHLFKDCPFSLAIWNY-LQIGDNSSLDLMDFKEWLLR  634

Query  898   NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF--------NRNLLPLEQKLDWLRRCD  743
             NL+  R+      WP  F   LW++WKWR + VF        N   L L+  L+W     
Sbjct  635   NLQSKRKVYNGLPWPLVFALYLWFIWKWRCKGVFYQRFVMPGNLQQLILQYALEWFNATK  694

Query  742   SETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVLRDTH  566
                 +                  +L W  P  G  K+NTDGS  S  +    GG+LRD +
Sbjct  695   PPPPSY------------VPYVVQLHWIAPTYGVCKINTDGSRNSVSRFIGVGGLLRDNY  742

Query  565   GNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQE  386
             G W +G++  +G  +   A+ WG+  GL +A E   R +  E DS + V  L        
Sbjct  743   GAWIKGFSVNLGVGSVLEAKLWGIFLGLHLAWESSFRFVEAESDSSVAVALLSSSTISTH  802

Query  385   QNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRM  206
                +++  C  + +        HI+REQN  AD LA  +     G+  F   P      +
Sbjct  803   PLFSLMSCCKLKVQAGWRFSIKHIFREQNVAADVLASKSSEFGPGVRYFTEVPAFLVNCL  862

Query  205   ALDRLGASSPRRV  167
             A+D +G S  R +
Sbjct  863   AVDAIGVSRSRVI  875



>ref|XP_009144970.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=448

 Score =   231 bits (589),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 152/448 (34%), Positives = 217/448 (48%), Gaps = 11/448 (2%)
 Frame = -1

Query  1492  VVRNGKSTRFWMDSWLTAKPLYEKLRGTLGLPE--LYATVNEYWDKVRGWKWEKIQRYLP  1319
             V  +G   RFW D WL  +        T+ LPE  L   V + W    GW  E I+ Y+ 
Sbjct  4     VTGDGCQIRFWRDRWLLKE--LLSELSTVELPEEGLEERVCDLWQTGTGWIQEIIEPYMS  61

Query  1318  TEELERLASLCLTE-ENTPDGWGWSPDPRGCFSVKSAYGWA--DNAARQEADKVWGLIWS  1148
                  RLAS+ + E   T D   W     G F+VKSAY +   +   R   + ++  +WS
Sbjct  62    EMNCLRLASVVIDEVTGTRDRMSWGESKDGLFTVKSAYTFLTRNTVPRPNMEALYRRVWS  121

Query  1147  LRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW  968
             +  P R+ +F+WLV H  ++TN ER RRH++ N  C  C G  E + H+ R C     +W
Sbjct  122   VINPERVRVFLWLVTHQVIMTNMERKRRHLSENSVCPLCKGGDETILHVLRECPAAAGLW  181

Query  967   RHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRN  788
                +    ++    L    WL  NL   R+  + + WP  F   +WW WKWR   VF  +
Sbjct  182   IRLVPISQQQRFFTLPLLEWLFENL-AKREPNWGDSWPTLFALTVWWCWKWRCGYVFG-D  239

Query  787   LLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTS  608
                   ++ +LR    E   A +      Q   R  E ++SW+KP  GW+K+NTDG+   
Sbjct  240   EGKCRDRVKFLREKAREVVVANDNLCGRSQGRERV-EMQISWQKPASGWIKINTDGAAKG  298

Query  607   D-GQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDS  431
             + G A+ GGVLRD +G W  G+   IG C++ +AE WGV  G+ +A E G RR+ +E DS
Sbjct  299   NPGLATAGGVLRDEYGMWHGGFALNIGICSARMAELWGVYYGMCIAWERGFRRVELEVDS  358

Query  430   KMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGG  251
             + +V  L+         + +VR C         V   H+YRE N LAD LA +A +   G
Sbjct  359   ESVVGFLRTGINDSHPLSFLVRLCYGFISRDWIVKISHVYREANHLADGLATYAFSLSFG  418

Query  250   LHIFEVPPGEFEVRMALDRLGASSPRRV  167
             LH+FE  P         D  G S PR +
Sbjct  419   LHVFEFVPDSVGAISLEDINGISRPRHI  446



>ref|XP_006492639.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=569

 Score =   231 bits (589),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 160/547 (29%), Positives = 244/547 (45%), Gaps = 62/547 (11%)
 Frame = -1

Query  1756  LVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKY----HH--  1595
             +++W  I   K+ GGLG ++L  MNRA  MKL W L + PN+ W + L +KY    H+  
Sbjct  1     MISWKEICKPKSAGGLGFKSLAMMNRALHMKLAWGLISSPNSFWVQVLVSKYGVDIHNLP  60

Query  1594  -----RSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
                  R GSHL     +S+ N W  + A      + L   + NGK               
Sbjct  61    LMLPTRYGSHL----WKSLRNVWSEVLATYTI--NNLPSNISNGK---------------  99

Query  1429  YEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASL-CLTEENTPDGWG  1253
                             V ++      W W++ +++LP+  + ++A+L   + +   D   
Sbjct  100   ----------------VADFVKADSSWYWDRFEQFLPSHIILQIAALHPPSPDKGTDSLF  143

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYER  1073
             W+    G F+  SAY    N      D++W ++W+ + P  + +F+W V H R+ T  E 
Sbjct  144   WAHSKSGRFTTHSAYLALSNDTPMHDDRLWRMVWNWKGPQSVRIFLWQVFHDRLKTKAEL  203

Query  1072  TRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMNL  893
              RRHI  +  C  C    ED  H+ R C  V   W   L     +   N     WL  N+
Sbjct  204   ARRHIPVSTSCDRCGAVNEDAMHVLRDCALVKLFWLLILPANKRQQFFNSRLQEWLRTNV  263

Query  892   KGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNR-NLLPLEQKLDWLRRCDSETAAAFEE  716
                 + G    W   FG  LW LW WRN+  FN+ ++ P    +D L R    TA   + 
Sbjct  264   GIVGRLGSVSNWAIFFGIALWRLWFWRNQFFFNQASMDPNVVLMDVLTR----TAEMHKI  319

Query  715   RHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGNWCRGYTYR  536
                PL   +      +SW+ PD  W  LNTDG+    G ++  G++RD  G W  G+   
Sbjct  320   HTHPLTTGHIRVTRWISWKPPDWPWCSLNTDGAHNRGGTSTAWGLIRDHMGRWLSGFGMM  379

Query  535   IGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCI  356
             IG C+ TVAE WG+ QGL++A   G R++ +E DS  +++ +    T      N     I
Sbjct  380   IGSCSITVAELWGLYQGLQLAWNSGIRKLQVEIDSLCVLQLV----TKPSLEINHYAPLI  435

Query  355   KEAENFL----AVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDRLG  188
             +  +++L     V   HIYRE N  AD +A  A +   GL I+  PP   +  +  D  G
Sbjct  436   QAIKDYLKMDWQVSISHIYREANFAADYMANLAFSIPLGLAIYHTPPLGVKSFLFKDVYG  495

Query  187   ASSPRRV  167
              +  R +
Sbjct  496   MAHSRSI  502



>ref|XP_009126860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851737 
[Brassica rapa]
Length=1638

 Score =   236 bits (603),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 151/456 (33%), Positives = 233/456 (51%), Gaps = 22/456 (5%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +++++S++L GWK + LSLAGR+TL KSVL+++P++TM T ALP    ++++K  R FIW
Sbjct  1194  VIEKVSSKLAGWKRRFLSLAGRITLTKSVLSSVPVHTMSTIALPSSTLNQLDKIARAFIW  1253

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +  G  K  LV+W+ I   K  GGLG+R    MN A + KLGWR+    + LW   L
Sbjct  1254  GSID--GTRKQHLVSWEKICKPKREGGLGIRLAKEMNVALLAKLGWRMLNTEDGLWVNIL  1311

Query  1612  TTKY---HHRSGSHLVTTRRRSISNAWKG-ISAERETLESGLTHVVRNGKSTRFWMDSWL  1445
               K+        S LV   R S +  W+  +   RE +  G++ ++ +G+  RFW D WL
Sbjct  1312  CKKFRVGELDDASWLVPQGRWSPT--WRSLVMGIREVVAPGVSWILGDGRRVRFWRDRWL  1369

Query  1444  TAKPLYEKLRGTLGLPELY--ATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTE-E  1274
               +PL E L   + +PE    A   + W +  GW  ++I+ Y   +   +LASL + E  
Sbjct  1370  LKEPL-EAL-SLIDIPEELEEAKTRDLWQQGIGWILQQIEPYTSLQNRLQLASLVIDEVT  1427

Query  1273  NTPDGWGWSPDPRGCFSVKSAYGW--ADNAARQEADKVWGLIWSLRVPARISMFIWLVKH  1100
                D   W     G FSVK+AY +   D   R   + ++  +W +  P R+ +F+WLV H
Sbjct  1428  GARDRMSWGEAKDGLFSVKAAYAFLTKDAVPRPNMEDLYSRVWRVTAPERVRVFLWLVTH  1487

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
               ++TN ER RRHI+ N  C  C    E + H+ R C     +WR  +    ++   NL 
Sbjct  1488  QVIMTNMERKRRHISENGTCPLCKSGDETILHVLRDCPAAAGLWRKLVLPTRQQRFFNLT  1547

Query  919   WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDS  740
                WL  NL  D+    ++ WP  F   +WW WKWR   VF   +     ++ +++    
Sbjct  1548  LFEWLYENLANDKSVNGDQ-WPSLFALTVWWCWKWRCGYVFG-EIGKCRDRVRFVKDKAQ  1605

Query  739   ETAAAFEERHWPLQRHNRGG--EERLSWEKPDEGWL  638
             E   A ++   P      GG  E  ++W  P+ GW+
Sbjct  1606  EVIKANKKVREP---SAIGGHVERPIAWVVPENGWV  1638



>ref|XP_008221996.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=545

 Score =   224 bits (571),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 166/564 (29%), Positives = 247/564 (44%), Gaps = 62/564 (11%)
 Frame = -1

Query  1807  RRFIWGRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTL  1628
             R F+WG       +K+ LV W+I+   KT GGLG++    MN+A + K  WRL      L
Sbjct  27    RNFLWGHTVD--KSKVHLVKWEIVGQPKTAGGLGIKKTAWMNQALLAKTSWRLLQNDQGL  84

Query  1627  WAKTLTTKYHHRSGSHLVTTRRRSI-SNAWKGISAERETLESGLTHVVRNGKSTRFWMDS  1451
             W++ L  KY  +           S  S+AW+G+    + L  GL   V +G +  FW DS
Sbjct  85    WSQILNAKYLRQYDLLAAKDLHLSCNSSAWRGVLYGAKLLPHGLQWRVGSGDNILFWTDS  144

Query  1450  WLTAKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEEN  1271
             WL+  PL             +A ++                 L  E L+    L +  + 
Sbjct  145   WLSCGPLLS-----------HALID-----------------LSEEMLQLNMILSIHADF  176

Query  1270  TPDGWG---WSPDPRGCFSVKSAYGWADNAARQEADKV---WGLIWSLRVPARISMFIWL  1109
                G     W   P G FSVKS YG     +  E + +   WG IW L++P +I  F+WL
Sbjct  177   LGSGLDKRIWKCTPNGDFSVKSVYG----ISFLEGNVLPWQWGFIWKLKIPPKIKAFLWL  232

Query  1108  VKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMR  929
             + H ++LTN++R +R + S   C  C+   E ++HL   C     IW             
Sbjct  233   LCHKKLLTNFQRQKRGLASCAACPRCSYPVETIEHLVSGCCCSMDIWSGFGLNDEWAHCH  292

Query  928   NLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRN-LLPLEQ------  770
             + D++ WL  NL+  R    +  WP  F   LW++WKWR + VF    ++P E       
Sbjct  293   DGDFDVWLLHNLQSKRVGCDKLSWPLVFAVCLWFIWKWRCKIVFEAGFVMPSEPHKMIQQ  352

Query  769   -KLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGS-CTSDGQA  596
               +DW   C             P+    +    ++ W     G  KLNTDGS  +  G  
Sbjct  353   YAMDWFIACK------------PMLSSPKKCVVQVHWHASLPGVFKLNTDGSRNSGSGAI  400

Query  595   SCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVE  416
               GGV+R++ G W  G+    G  ++  AE WGV  GL +A E G R I +ECD+  +V 
Sbjct  401   GAGGVIRNSAGVWITGFAVNQGVGSTLEAELWGVFWGLHLAWEIGCRHIEVECDANSVVS  460

Query  415   ALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFE  236
              L G         +++  C  + +        H++REQN +AD LA  +     GLH  E
Sbjct  461   LLTGSIASTHPLFSLLSCCKLKLQQDWVCSLTHVFREQNCVADGLAHMSHGMFPGLHRLE  520

Query  235   VPPGEFEVRMALDRLGASSPRRVS  164
             + P      +A D    + PR V+
Sbjct  521   LAPPCVRESLAADVCSLARPRVVA  544



>ref|XP_007227312.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
 gb|EMJ28511.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
Length=992

 Score =   220 bits (560),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 183/612 (30%), Positives = 275/612 (45%), Gaps = 75/612 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +R+  +L+ WK K LS AG+  L K V  AIPIYTM    LPK VC ++ K   +F W
Sbjct  413   LKERLWKKLQTWKGKLLSGAGKEILIKVVAQAIPIYTMSCFLLPKYVCEDLNKLVAQFWW  472

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               +  + N K+  +AWD +   K  GGLG RNLH  N A + K GWRL   P++L  K L
Sbjct  473   --NSSTENKKIHWMAWDRLCAPKEEGGLGFRNLHAFNLALLAKQGWRLLQNPDSLVTKVL  530

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY   + S L TT     S  WK +   R  +  G    V +G +   W D WL    
Sbjct  531   KAKY-FPTRSFLETTVSPYASVVWKSLCDARTVIIQGSRWQVGSGDTIGIWEDRWLPQPN  589

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRG----WKWEKIQRYLPTEELERLASLCLTEENTP  1265
              ++        PE ++ + +  D + G    W    +Q     EE+  + S+ L+   TP
Sbjct  590   SFQIFSPR---PE-HSAITKVSDLIHGDSREWNAPLLQNVFFPEEVMLIRSIPLSLRLTP  645

Query  1264  DGWGWSPDPRGCFSVKSAYGWADN-------AARQEADKV---WGLIWSLRVPARISMFI  1115
             D   W  D +G F+VKSAY  A +       A+   +D V   W L+W   VPAR+  F 
Sbjct  646   DMLVWHYDKKGMFTVKSAYHVARSLHSSTGRASSSNSDAVARNWSLLWKAIVPARVKTFW  705

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQR-----  950
             W V  G + T     R+ ++ +E C  C G  + L H+ R C      W +         
Sbjct  706   WRVISGILPTKANLARKKVSLDEECMLCEGPVKSLIHILRDCP-----WNNGAHSPKDWV  760

Query  949   -RTEESMRNLDWNSWLTMNLKGDRQQGFEEGWP--ERFGTRLWWLWKWRNEAVFNRNLLP  779
              R  E + + D+ ++L +            GW   E     LW   K R+E V     L 
Sbjct  761   CRCAEQLSSQDFATFLMV------------GWAIWEARNGLLWNNKKSRHEQVSLHASLR  808

Query  778   LEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGS---CTS  608
             L    D+LR  +             L   +R G+ +  W+ P E  LK+N DG+    T+
Sbjct  809   LH---DFLRVSNC------------LGSQSRQGQIKQMWQPPHENSLKINVDGAWKPGTT  853

Query  607   DGQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIECDS  431
             +G    G V+RD+ G +  G   ++    S    EA        +A E G + ++ E D+
Sbjct  854   EG--GVGVVVRDSTGKFVAGCATKLTNVFSAPQVEALAARTNTILAMERGYQNVVFESDA  911

Query  430   KMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVV----FLHIYREQNKLADKLAKWALT  263
               +V AL+        + +++   +++ ++ L  +    F HI R  N +A +LA++AL 
Sbjct  912   LQIVTALRNHSI----DRSVIGPVVEDTKSLLTQITGEGFTHIRRTANGVAHRLARFALH  967

Query  262   TQGGLHIFEVPP  227
               G L+ FE PP
Sbjct  968   IGGSLYWFEEPP  979



>ref|XP_007023230.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY25852.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=1011

 Score =   220 bits (560),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 144/493 (29%), Positives = 229/493 (46%), Gaps = 55/493 (11%)
 Frame = -1

Query  1765  KMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHRSG  1586
             K+ L+ W+ +   K +GG+G+R L  MN A ++ L W L ++P+ LW + L  KY+    
Sbjct  544   KVHLLRWNTLCKPKAQGGMGIRRLSLMNDAFILILCWGLLSKPDALWVRVLVNKYN----  599

Query  1585  SHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTL  1406
                                             +R   S      +W+   PL   +    
Sbjct  600   -------------------------------FIRADYSKDPMRYTWVGEVPLINVVADMG  628

Query  1405  GLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCL---TEENTPDGWGWSPDPR  1235
              +  L A V +Y      W  E++   LP E + ++  LC+   T   + D   W+  P 
Sbjct  629   FMLNLRARVKDYIMPNGDWDKERLTSILPIEVVNQI--LCIIPPTLSASLDMPYWALSPY  686

Query  1234  GCFSVKSAY---GWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRR  1064
             G F++ S Y   G   ++ R+E +K+W L+W LR P R+ +F++   H R+LTN ER RR
Sbjct  687   GYFTISSTYKHLGSLADSTREENNKMWRLVWDLRGPHRVCLFLFFCLHKRILTNAERVRR  746

Query  1063  HITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGD  884
              ++S+  C +C G  E   H+ R C  ++ +WR  L +        +    WL+ NL   
Sbjct  747   KMSSDASCPHCYGVEETCLHVLRDCPALETLWRRILPQSGINQFFQIPLIDWLSSNLNLK  806

Query  883   RQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFEERHWP  704
                 F+  W    G   W+ WKWRN  +F    L +E +L  +R     + A      W 
Sbjct  807   NLYVFDVPWNIVLGITCWYTWKWRNLFIFEGRELSVEGRLSIIR-----SVAVDSHNTWS  861

Query  703   LQRHNRGG-----EERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHGNWCRGYT  542
               R   GG     E  + W  P E W+ +N+DG+  S  G A+ GGVLRD+HG W  GY 
Sbjct  862   TPRIISGGMRHQEEILVGWSPPPEDWIAVNSDGAFKSAVGIAAAGGVLRDSHGTWIVGYA  921

Query  541   YRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRR  362
              ++   +   AE WGV +GL++A E G R++ ++ D+K +V+A+         N +++ R
Sbjct  922   CKLETSSVFRAELWGVYKGLQLAWERGFRKVKLQSDNKAVVQAISFSSVHPGSNLDLI-R  980

Query  361   CIKEAENFLAVVF  323
              IK   N L++ F
Sbjct  981   AIKGQSNKLSLKF  993



>ref|XP_009107896.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=416

 Score =   210 bits (535),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 131/387 (34%), Positives = 194/387 (50%), Gaps = 12/387 (3%)
 Frame = -1

Query  1309  LERLASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWA--DNAARQEADKVWGLIWSLRVP  1136
             LE LA +  T     D   W   P G F+VK+AY     D+ +RQ+ + ++  +W +  P
Sbjct  34    LELLAVVVDTVTGVKDRLAWGETPNGQFTVKTAYELIRRDDTSRQQMESLFKSVWRVVAP  93

Query  1135  ARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSL  956
              R+ +F+WLV +  ++TN ER RRH++  + C  C G  E + H+ R C  ++ IW   +
Sbjct  94    ERVRVFLWLVGNQAIITNAERYRRHLSGTDVCQICKGGVETILHVLRDCPAMEGIWNRFV  153

Query  955   QRRTEESMRNLDWNSWLTMNL-KGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLP  779
                   +  ++    WL  NL   D   G    W   F   +WW WKWR   VF  N L 
Sbjct  154   TGTKRHAFFSMPLLEWLYRNLCDNDAPSGIP--WATTFALAVWWGWKWRGGNVFGDNRL-  210

Query  778   LEQKLDWLRRCDSETAAA--FEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD  605
                ++ +LR   SE       EE++  +++     +  + W  P  GW+KLNTDG+   +
Sbjct  211   WRDRVQFLRNLASEVTCVKKAEEKNMVMKQRV---DIMIGWTPPRVGWMKLNTDGASHGN  267

Query  604   -GQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSK  428
              G AS GGVLRD +G W  G+   IGRC++ +A+ WGV  GL +A E    R+ +E DSK
Sbjct  268   PGLASVGGVLRDGNGEWYGGFALNIGRCSAPLADLWGVYYGLVIAWENNISRLEVEVDSK  327

Query  427   MLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGL  248
             M+V  L          + +V  C         V  +H+YRE N+LAD LA  A++   G 
Sbjct  328   MVVGFLSAGIEDTHPLSFLVCLCHGFLTRDWLVRIVHVYREANRLADGLANLAISLPFGF  387

Query  247   HIFEVPPGEFEVRMALDRLGASSPRRV  167
             H F+V P E    +  D  G+  PR+V
Sbjct  388   HRFDVVPIELVSFIREDVDGSLQPRQV  414



>ref|XP_006490008.1| PREDICTED: uncharacterized protein LOC102624085 [Citrus sinensis]
Length=1635

 Score =   221 bits (564),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 136/394 (35%), Positives = 184/394 (47%), Gaps = 48/394 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D+I  RL GW A  L+LAGR+TLA+SVL AI +Y MQT  LP+ +  +I++  RRFIW
Sbjct  1264  IVDKIDQRLSGWNASHLTLAGRITLAQSVLQAISVYAMQTTKLPRSIKMKIDQLCRRFIW  1323

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                 +  + KMSLV WD+I T K +GGLG + L  MN A +MK  WRL TEP  L  + L
Sbjct  1324  SGSAE--HQKMSLVNWDMICTPKCKGGLGFKKLDIMNHALLMKNTWRLITEPTKLSNQVL  1381

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              TKY         +   R  S+ WK + +  E    G+   + +GK  R+          
Sbjct  1382  LTKYGVHLDEFPTSLPTRYGSHLWKAMGSTWEQTRVGMCWNIGDGKRVRY----------  1431

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASL-CLTEENTPDGW  1256
                                                 LP   L ++AS+   T  +  D +
Sbjct  1432  -----------------------------------LLPNNILLKIASVHPPTASHGADSF  1456

Query  1255  GWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYE  1076
              W     G FSVKSAY   D+         W L+WS + P  I +F+WL+ HGR+ T  E
Sbjct  1457  FWGASSNGNFSVKSAYELLDDPIGNGDHSFWCLVWSWKGPHSIRVFLWLLLHGRLKTKKE  1516

Query  1075  RTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMN  896
               RRH+  +  C  C G  ED+ H  R C    R+W H L      S      + WL MN
Sbjct  1517  LNRRHLIDSTQCDRCGGPVEDILHTLRDCVTARRVWSHLLPNNYPHSFFLCPLSDWLQMN  1576

Query  895   LKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFN  794
             L   +    +E W   FG  +W LW WRN  +FN
Sbjct  1577  LMRKKNNTSQEYWRVCFGVAVWRLWFWRNNFLFN  1610



>ref|XP_010672383.1| PREDICTED: uncharacterized protein LOC104888966 [Beta vulgaris 
subsp. vulgaris]
Length=1431

 Score =   221 bits (562),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 175/582 (30%), Positives = 267/582 (46%), Gaps = 34/582 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D++  +L  WK K LS AGR+ L  S L+ IP Y MQ  ALP     ++++    F+W
Sbjct  834   VVDKVKKKLANWKTKYLSRAGRLCLISSTLSTIPAYYMQAMALPAATLKDLDRVCNNFLW  893

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E     ++ LV  +     KT GGLG+RN   MN+A M KLGW+L   P  L  K +
Sbjct  894   GDVE--NQKRIHLVGMERTFRPKTMGGLGVRNQTLMNKAYMAKLGWKLSQGPENLAQKCI  951

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
             T+KY H   +H VT+  +  S  W+ I    + L      ++ NG    FW D+WL    
Sbjct  952   TSKYIH---NHYVTSFAKG-SPIWQSIGKGWDLLTKDSQWILGNGADIDFWEDNWLGIGN  1007

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRG--WKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
             +  ++ G L     Y    +  D   G  WK E++   LP   + R+  LCL   +  D 
Sbjct  1008  IRSQIAGPLNQ---YEETYKVRDVTGGGVWKLERLSLTLPAHIVSRI--LCLEPPHPEDQ  1062

Query  1258  WGW-SP---DPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRV  1091
                 +P   +P+G FS+  AY   +        +  G +W +    +I  F+WLV   R+
Sbjct  1063  KDIRAPIFLEPQG-FSLALAY---NEQFLDHNTENLGELWKINTSPKIQFFLWLVCLDRL  1118

Query  1090  LTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNS  911
               N     RH+T    C  CA   ED +H+ R C    RIW    Q  T  S  N +  +
Sbjct  1119  PHNKMLRDRHLTQEARCPRCASDVEDTNHILRLCPTSQRIWD---QVDTYTSTHNQNMKA  1175

Query  910   WLTMNLKGDRQ-QGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSET  734
             W+  N+K  R  +G E  W   F    + +WK RN +VF  NL       D + +   + 
Sbjct  1176  WVGENIKSRRDYRGLE--WAVVFPFLCFEIWKSRNHSVFKPNLN--HPGPDVVLQLAWKN  1231

Query  733   AAAFEERHWPLQ-RHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCG--GVLRDTHG  563
             A  F +   P + +  +     L+   P   W  L+ D +   D   +CG  G+ R + G
Sbjct  1232  ARDFIQAKGPHEAQPEKTTINHLAHHTPS-NWTMLSVDAA-FKDQTRTCGLGGIFRTSEG  1289

Query  562   NWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQ  383
              W  G+T       +  AE  G+  GL++A  YG +++ +  D K  VE L  + T    
Sbjct  1290  LWVLGFTKTAYARDALGAELQGIQLGLQLALHYGFKKLALLSDCKKAVELLDQEVTQTNI  1349

Query  382   NNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQ  257
               N++ +C +   +F      H  R+ N LAD+LAK+ + T+
Sbjct  1350  YTNVLCKCRELGRSFEDFKIRHCRRQDNSLADRLAKYCMETE  1391



>ref|XP_004289367.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=1152

 Score =   219 bits (558),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 162/591 (27%), Positives = 266/591 (45%), Gaps = 46/591 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+DR+  R +GW+ KTLS  G+  L K+V+ +IP Y M    LP+ +C+E+ +   RF W
Sbjct  526   LIDRVRKRTQGWRDKTLSGVGKEVLLKAVIQSIPTYVMSCFELPRHLCNEMHQLMARFWW  585

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E     K+  +AWD + + K  GGLG R++H  N+A + K GWR+   P +L A+ L
Sbjct  586   G--EFGDERKIHWIAWDKLCSSKKEGGLGFRDMHVFNKALLAKQGWRMLCRPQSLLAQVL  643

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----  1445
               KY   S        +R IS +W+ +   +E L+ GL   V NG++   W D WL    
Sbjct  644   KMKYFPTSSLIQAEVGKR-ISYSWRSLMRGKELLQQGLRFQVGNGENIHLWDDPWLPLPY  702

Query  1444  TAKPLYEKLRGTLGL--PELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEEN  1271
             T KP    + G+ G+   EL       W++   W  E++  + P E  E +  + L+   
Sbjct  703   TFKPFSLPMHGSEGMRVCELIEEGTGGWNE---WLLEEL--FTPMES-EIILKIPLSLNG  756

Query  1270  TPDGWGWSPDPRGCFSVKSAY-------GWADNAARQEAD----KVWGLIWSLRVPARIS  1124
               D   W  D +GC++VKS Y       G    A+  ++D    ++W  +W  +VP ++ 
Sbjct  757   GEDRLVWHFDNKGCYNVKSGYFVGRLLDGLNRKASGSDSDVQWSRLWCKLWRTQVPPKVR  816

Query  1123  MFIWLVKHGRVLTNYERTRRHITSNEY-CYNCAGQREDLDHLFRRCHDVDRIWRHSLQR-  950
             M  W +  G + +     ++ +   +  C  C+   ED  HLF+ C  +   W+  + + 
Sbjct  817   MHAWRLVKGTLPSRAALVKKQVQLPDVNCVFCSTNVEDSLHLFKNCEALQPFWQQGMVQI  876

Query  949   --RTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPL  776
               RT  S+    W   +   L G++ +GF           LW +W  RN  V+      +
Sbjct  877   HPRTHPSISVEVWFWDMVEMLSGEKLEGFLMA--------LWVIWVERNNMVWRGQFYNI  928

Query  775   EQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCT-SDGQ  599
                +DW       ++   E +H   +      + +  W  P  G L++N DGS    +G+
Sbjct  929   TNMMDW------SSSLLLEYKHCHQRSVGTRKKNKSKWTCPPSGRLRVNIDGSFAHEEGR  982

Query  598   ASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIECDSKML  422
                G V+RD  G              S +  E   +  GL +  + G R + +E D   L
Sbjct  983   GGVGVVIRDHKGACVASLARPFPNAASAIHMEVEALRAGLLVCVQQGWRDVEVESDCMNL  1042

Query  421   VEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWA  269
             V+A++           I+  C +    F      H+ RE N +A++LA +A
Sbjct  1043  VQAMQTDGEDFSMVGRIIEDCQRYVSAFNFFQLQHVCREANSVANRLAHFA  1093



>ref|XP_009102110.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=712

 Score =   215 bits (547),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 170/594 (29%), Positives = 273/594 (46%), Gaps = 46/594 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D++   + GWK K L+  G+  L KS+  A+PI++M    LPK VC EI     RF W
Sbjct  110   IVDKVKKVVHGWKQKHLTHGGKEVLLKSIALAMPIFSMNIFRLPKEVCEEINAILARFWW  169

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E  G   +   AW  +   K  GGLG R+L + N+A + K  WR+   PN L A+ L
Sbjct  170   GTGESKG---LHWYAWKRVCIPKREGGLGFRDLESFNQALLGKQVWRIMQNPNCLMARVL  226

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y    G  L  T ++  S AWK I   ++ +  G+ +++ NG+ST+ W DSWL+  P
Sbjct  227   RARYFPE-GDILKATLKKKSSYAWKSILHGKDLIVKGMRYIIGNGESTKMWTDSWLSLHP  285

Query  1432  LYEKLRGTLGLPELYATVNEY-WDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
                +   + G     + V++Y  +  RGW  +K++  +  E++E++  L ++ +   D  
Sbjct  286   --PRPPRSRGEVNTNSKVSDYVLNNGRGWNLDKLREDVIQEDIEKILELKISSKARQDLM  343

Query  1255  GWSPDPRGCFSVKSAY----GWADNAARQEADKVWGL---IWSLRVPARISMFIWLVKHG  1097
             GW     G ++VKS Y       DN           L   +W ++VPA++  F+W +   
Sbjct  344   GWHYTDNGLYTVKSGYWLVTHLPDNNYIPPTYGSVALKQKLWKVKVPAKLKHFLWRISSR  403

Query  1096  RVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDW  917
              + T     RRH+T +  C  C  + E  +HLF  C    ++WR S        + NL  
Sbjct  404   SIATGNNLKRRHVTPDAICKRCWLEEETEEHLFFTCPYAKKVWRAS-------GINNLVL  456

Query  916   NSWLTM---NLKGDRQQGFEEGWPERFGTRLWWLWK-WRNEAVFNRNLLPLEQK-LDWLR  752
             +S ++     L+   Q              +W LW+ W+     +RN+L  +Q+   W  
Sbjct  457   DSTMSTYEEKLEACLQVSTAISLSHYQDLPIWILWRLWK-----SRNVLVFQQRDFHWKN  511

Query  751   RCDSETAAAFEERHWPLQRHNRGGEERLS--------WEKPDEGWLKLNTDGSCTSDGQA  596
                +  + A E R+   Q +N      +S        W+ P   WLK N D S     + 
Sbjct  512   ILSAARSDAREWRNIETQDNNASDGHSISPTSRSSQRWKAPPNRWLKCNVDASFIDTREP  571

Query  595   SCGG-VLRDTHGNWCRGYTYRIGR--CTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKM  425
             S  G V+RD HG + +G     G   C+   +E   +L  ++     G  RI+IE D + 
Sbjct  572   SSAGWVIRDEHGIY-KGAVQVQGNMVCSPLESELQAILMAVQFCWTKGYNRIIIESDCRK  630

Query  424   LVEALKGKETGQEQNNNIVRRCIK-EAENFLAVVFLHIYREQNKLADKLAKWAL  266
              ++ L       +  N   +R I+  AE    + F  + RE NK+AD LA+  L
Sbjct  631   AIDILNDLVLHFDSFN--WKREIRWWAEKIQNISFQWVKREANKVADSLARTPL  682



>gb|ADK92871.1| retrotransposon protein [Hypericum perforatum]
Length=593

 Score =   212 bits (539),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 167/597 (28%), Positives = 246/597 (41%), Gaps = 51/597 (9%)
 Frame = -1

Query  1951  RLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSG  1772
             +   WK +TLS AGR  + KSVL +I  Y M    LP+G C  IEK    F WG D    
Sbjct  15    KFGSWKVRTLSRAGREIMIKSVLQSISTYIMGCFELPEGTCDRIEKMMCNFYWGGDRNG-  73

Query  1771  NNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHR  1592
              +KM   +W+ +   K  GGLG R L   NRA + K GWRL T PN+L A  L  KY+ R
Sbjct  74    -SKMHWRSWEKLCRSKRNGGLGFRRLKNFNRAMLAKQGWRLLTLPNSLAATILRAKYYPR  132

Query  1591  SGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRG  1412
                  +++   S S  W+ I    + L+ G+   +  G + R W D W+           
Sbjct  133   KSPLEISSSPYS-SYTWRSILKGSQLLQKGIEWRIGQGNTVRTWSDPWIPG--------S  183

Query  1411  TLGLPELYATVNEYWDKVR------GWKWEKIQRYLPTEELERLASLCLTEENTPDGWGW  1250
               GLP+ ++  ++ +  V       GW    ++     E++ R+  + L+     D   W
Sbjct  184   DTGLPKYHSPGSDLYTHVSDFIQNGGWNENLLRLCFEEEDVTRILQIRLSLRRPLDMVRW  243

Query  1249  SPDPRGCFSVKSAYG------WADNAA---RQEADKVWGLIWSLRVPARISMFIWLVKHG  1097
                  G ++V+S Y       W +N A       ++ W   W LR P RI   +W +   
Sbjct  244   KFIKDGEYTVRSGYYIDFNCWWHENYATPLTHAGEERWKTCWGLRCPPRIKTLLWRLIDN  303

Query  1096  RVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDW  917
              +      TRR I  +E C  CAG  E   HLF  C     IW+    +   ES  N+  
Sbjct  304   NLSVRTNLTRRGIQVDEVCPCCAGPSETAAHLFFCCPYTLDIWKEVNVQIQVESSENILL  363

Query  916   NSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRN-LLPLEQKLD-----WL  755
                  +N++   +Q        R    LW +W+ RN  VF     + + ++L+     W 
Sbjct  364   AIDSLLNIRDPVEQS-------RRAATLWIIWRVRNSIVFRTGEEIVICKELEKGFRFWQ  416

Query  754   RRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLR  575
                D+E                RG      W  P  G+ K+N D    ++     G V+R
Sbjct  417   DFMDTEGNPTV-----------RGAPRTSKWNAPTAGFYKINVDAGLRAERGGQVGIVVR  465

Query  574   DTHGNWCRGYTYRIGRCT-STVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKE  398
             D  G +    T         T+ E   V  GL  A   G  R+ +E D   +V  L    
Sbjct  466   DDTGAFVMATTRSFPNLVHPTLLEGQAVYTGLEFANALGLERVELESDCLPVVMQLSKGY  525

Query  397   TGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPP  227
             T +   +NI+  C     NF  V   H+ RE N+ A ++AK  +     L +F  PP
Sbjct  526   TDRSDLSNIIDDCKMLLSNFQQVRIAHVRREANQAAHEMAKMTIPPDRELLVFSWPP  582



>ref|XP_010520746.1| PREDICTED: putative ribonuclease H protein At1g65750 [Tarenaya 
hassleriana]
Length=451

 Score =   207 bits (527),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 127/366 (35%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L++R+S  L GW++K LSLAGR+TL KS+LN IP + MQT  LP  VC E+++  RRFIW
Sbjct  73    LIERVSRHLSGWQSKLLSLAGRITLTKSILNTIPAFVMQTIKLPSSVCLELDRIMRRFIW  132

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E     K+SL  WD++++ K  GGLG+R +   N+A +MKL ++  T+ ++LW + L
Sbjct  133   GSTET--RRKLSLANWDLVSSLKNLGGLGIRPIQRFNKAFLMKLAFQFITKQDSLWVRLL  190

Query  1612  TTKY---HHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL-  1445
               KY    +RSGSHL       I   W+GI +       G   ++RNG++T FW D+W+ 
Sbjct  191   RDKYIPPSYRSGSHLPGHDGSII---WRGIKSVWYLTRGGCATLIRNGRNTDFWRDNWVE  247

Query  1444  TAKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENT-  1268
               KPL E L            V E+ +    WKW+K    LP     R+ASL    ++  
Sbjct  248   DDKPLIEYLSEEDRPSINPVMVAEFANADGKWKWDKFASLLPNSTCLRIASLLPPRQSAE  307

Query  1267  PDGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVL  1088
              D   W     G  +VKSAY          +  +W +IW    P RI  F+WL  + R+L
Sbjct  308   SDRLYWCSSRDGKCTVKSAYNSLLPDNITSSHTIWSVIWKWGDPERIRTFLWLACNNRLL  367

Query  1087  TNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSW  908
             TN  R +R+++S+  C       E + H+ R C     +W     +  +     +    W
Sbjct  368   TNMARFKRNLSSSGQCPLGCPSDESVLHVLRDCSVAKVLWNDLGVKMIQSGFFQVGILDW  427

Query  907   LTMNLK  890
                NL+
Sbjct  428   FESNLR  433



>gb|AAK39575.1|AC025296_10 putative reverse transcriptase [Oryza sativa Japonica Group]
 gb|AAP54636.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=791

 Score =   213 bits (543),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 168/607 (28%), Positives = 269/607 (44%), Gaps = 60/607 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L  +I  R+  W    LS  G+  L K+V+ AIP+Y M    LP+ V  ++ K T+ F W
Sbjct  178   LQAKIWKRVIQWGENHLSTGGKEVLIKAVIQAIPVYVMGIFKLPESVIDDLTKLTKNFWW  237

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D  +G  K    AWD +T  K+ GGLG R+    N+A + +  WRL T P++L A+ L
Sbjct  238   --DSMNGQRKTHWKAWDSLTKPKSLGGLGFRDYWLFNQALLARQAWRLITYPDSLCARVL  295

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----  1445
               KY    GS + T+   + S AW+ I    + L+ G+   V NG S R W D WL    
Sbjct  296   KAKYFPH-GSLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDPWLPRDH  354

Query  1444  TAKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
             + +P+  K    L       T +  WD        KI +Y    + E + ++C++  +  
Sbjct  355   SRRPITGKANCRLKWVSDLITEDGSWDV------PKIHQYFHNLDAEVILNICISSRSEE  408

Query  1264  DGWGWSPDPRGCFSVKSAYGWA---------DNAARQEADKVWGLIWSLRVPARISMFIW  1112
             D   W PD  G FSV+SAY  A          ++     +K W +IW  +VP ++ +F W
Sbjct  409   DFIAWHPDKNGMFSVRSAYRLAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKVKIFAW  468

Query  1111  LVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR--HSLQRRTEE  938
              V    + T   + +R +  ++ C  C  + ED  H   RC    ++W   H     + +
Sbjct  469   RVASNCLATMVNKKKRKLEQSDMCQICDRENEDDAHALCRCIQASQLWSCMHKSGSVSVD  528

Query  937   SMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDW  758
                ++    WL      D  +   E     F   LW  W  RNE +  ++  P E    +
Sbjct  529   IKASVLGRFWLF-----DCLEKIPEYEQAMFLMTLWRNWYVRNELIHGKSAPPTETSQRF  583

Query  757   LRRCDSETAAAFEERHWPLQRHNRG------------------GEERLSWEKPDEGWLKL  632
             ++   S     F+ R  P     +G                     +  WE+P +GW+KL
Sbjct  584   IQ---SYVDLLFQIRQAPQADLVKGKHVVRTVPLKGGPKYRVLNNHQPCWERPKDGWMKL  640

Query  631   NTDGSC-TSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGA  458
             N DGS   S G+   G +LR++ G+        + RC + + +E    ++GL++A  +  
Sbjct  641   NVDGSFDASSGKGGLGMILRNSAGDIIFTSCKPLERCNNPLESELRACVEGLKLAIHWTL  700

Query  457   RRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFL----AVVFLHIYREQNKLA  290
               I +E D   +V+ L+G  TG++   +++   I EA + L     +    I R QN ++
Sbjct  701   LPIQVETDCASVVQLLQG--TGRD--FSVLANIIHEARHLLVGERVISIKKICRSQNCIS  756

Query  289   DKLAKWA  269
               LA  A
Sbjct  757   HHLANTA  763



>gb|AAC26674.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=970

 Score =   212 bits (540),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 173/614 (28%), Positives = 253/614 (41%), Gaps = 120/614 (20%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L+ +S+ L GWK+++LSLA R+TL K+VL+ IP++                        
Sbjct  463   VLEHVSSSLAGWKSRSLSLAWRITLTKAVLSTIPVHV-----------------------  499

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                       MS +   + T D                       WRL  +  TLWA+ L
Sbjct  500   ----------MSAIILPVATLDSLDW-------------------WRLLHDKETLWARVL  530

Query  1612  TTKYH--HRSGSHLVTTRRRSISNAWKGISAE-RETLESGLTHVVRNGKSTRFWMDSWLT  1442
             + KY       S+ +  +  S S+ W+ ++   RE +  G+  V  +GK+  FW D WL 
Sbjct  531   SKKYKVGEMQNSNWLKPKS-SWSSTWRSVTVGLREVVAKGVRWVPGDGKTISFWSDRWLL  589

Query  1441  AKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
              + L    + ++    L +                                        D
Sbjct  590   QEQLSAVAKESISADALLS----------------------------------------D  609

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAA--RQEADKVWGLIWSLRVPARISMFIWLVKHGRVL  1088
                W     G F+V+SAY      A  R         IW L  P R+ +FIWLV H  ++
Sbjct  610   ELSWKGTQNGDFTVRSAYELLKPEAEERPLIGSFLKQIWKLVAPERVRVFIWLVSHMVIM  669

Query  1087  TNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSL-QRRTEESMRNLDWNS  911
             TN ER RRH++    C  C G  E + H+ R C  +  IW+  L QRR  E     +   
Sbjct  670   TNVERVRRHLSDIATCSVCNGADESILHVLRDCPAMTPIWQRLLPQRRQNEFFSQFE---  726

Query  910   WLTMNL---KGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDS  740
             WL  NL   KGD        WP  F   +WW WKWR   VF    L    +L +++    
Sbjct  727   WLFTNLDPAKGD--------WPTLFSMGIWWAWKWRCGDVFGERKL-CRDRLKFIKDIAE  777

Query  739   ETAAAFEERHWPLQRHNRGG--EERLSWEKPDEGWLKLNTDGSCTS-DGQASCGGVLRDT  569
             E   A       L  H +    E  + W+ P + W+KL TDG+     G A+  G + + 
Sbjct  778   EVRKAHVG---TLNNHVKRARVERMIRWKAPSDRWVKLTTDGASRGHQGLAAASGAILNL  834

Query  568   HGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQ  389
              G W  G+   IG C + +AE WG   GL +A + G RR+ +  DS+++V  L    +  
Sbjct  835   QGEWLGGFALNIGSCDAPLAELWGAYYGLLIAWDKGFRRVELNLDSELVVGFLSTGISKA  894

Query  388   EQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVR  209
                + +VR C         V   H+YRE N+LAD LA +A     G H FE+ P +  + 
Sbjct  895   HPLSFLVRLCQGFFTRDWLVRVSHVYREANRLADGLANYAFFLPLGFHCFEICPEDVLLF  954

Query  208   MALDRLGASSPRRV  167
             +  D  G S PR V
Sbjct  955   LVEDANGTSFPRAV  968



>ref|XP_010682933.1| PREDICTED: uncharacterized protein LOC104897695 [Beta vulgaris 
subsp. vulgaris]
Length=1326

 Score =   214 bits (545),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 166/605 (27%), Positives = 263/605 (43%), Gaps = 44/605 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +R+  +L+GWK K LS AG+  L K+V+ +IP Y M   A+P  + SEI     RF W
Sbjct  734   LKERVWKKLQGWKEKLLSRAGKEVLLKAVIQSIPTYMMSLFAIPDCILSEINAMCARFWW  793

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   +    +M  ++W+ +   K  GG+G R+L   N+A + K GWRL     ++     
Sbjct  794   G--SRGTERRMHWLSWEKMCLPKAYGGMGFRDLKVFNQALLAKQGWRLLCHNGSMAHAVF  851

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y+ RS + L   R    S  W+ I   +  L  GL   V +G S   W +SWL  + 
Sbjct  852   NARYYPRS-NFLNARRGFDPSYVWRSIWGAKSLLLEGLKWRVGDGSSIGVWEESWLPGES  910

Query  1432  LYEKLRGTLGLPELYAT----VNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
                     +  P + +     V++  D    W    ++ +   E++  +  + L+    P
Sbjct  911   -----AAVVPTPNMESPADLRVSDLLDASGRWDELVLRNHFTEEDILLIREIPLSSRKPP  965

Query  1264  DGWGWSPDPRGCFSVKSAY---------GWADNAARQEADKVWGLIWSLRVPARISMFIW  1112
             D   W P   G F+ KSAY         GW  +      + VW +IW L  P ++  F+W
Sbjct  966   DLQYWWPSTDGFFTTKSAYWLGRLGHLRGWLGHFGGANGE-VWKVIWGLEGPPKLKHFLW  1024

Query  1111  LVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS---LQRRTE  941
                 G + T      RHI  +  C +C  + E + H   RC  V  IW +S      R  
Sbjct  1025  RACMGALATRGRLKERHIVEDGCCTHCNREDESIVHAIFRCSLVSPIWENSPFTYYVRDG  1084

Query  940   ESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
              +   +D+  WL   ++      F            W  W +RN   F      +   + 
Sbjct  1085  PTSSFMDFFVWLISRMERTDLLSFM--------AMAWAAWSYRNSVTFEEPWSNVTVSVV  1136

Query  760   WLRR--CDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCG  587
                +   D ++ AA   R  P+     G   R SW  PDEG  +LNTD +  ++G    G
Sbjct  1137  GFMKLVSDYKSYAALVFRAGPV---TTGFPSRSSWVAPDEGRFRLNTDAAMLAEGLVGVG  1193

Query  586   GVLRDTHGNWCRGYT--YRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEA  413
              V+RD+ G+        YR+ R T T+AEA G   G+ MAK++G   + +ECD+  + +A
Sbjct  1194  AVVRDSRGSVLLVAVRRYRV-RWTVTLAEAMGARFGVEMAKQFGYEALELECDASNITKA  1252

Query  412   LKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIF--  239
             L  K  G+   + ++       ++F      H+ R  N +A  +A+      G  H+F  
Sbjct  1253  LCRKAFGRSPTDLVLEDVSMLGDSFPIFSISHVKRGGNTVAHFVAR-LYPADGVQHVFVN  1311

Query  238   EVPPG  224
             + P G
Sbjct  1312  DFPQG  1316



>ref|XP_008353155.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=637

 Score =   209 bits (532),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 162/582 (28%), Positives = 253/582 (43%), Gaps = 28/582 (5%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             R+  +++GWK  T+S AGR  L K+V  A+P Y M     PK  C++++    +F WG++
Sbjct  31    RLLGKIQGWKRSTISQAGREVLIKAVAQAVPAYPMNLFKFPKTFCNDLDALISKFWWGQN  90

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
             +  G N++  V+ + +   K  GGLGLR     N A + K  WRL +EPN+LWA  +  +
Sbjct  91    D--GENRIHWVSKEQMGKSKEEGGLGLRCFTEFNNALLAKQCWRLLSEPNSLWASVIKGR  148

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL-Y  1427
             Y     S     R    S AW  +   RE +  G    + NGK  R W+D WL + P  +
Sbjct  149   YFPNC-SFFDAKRGGRASWAWSSLLVGREIIRGGAHWQIMNGKDVRVWVDKWLPSIPSGH  207

Query  1426  EKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENTPDGWGW  1250
                 G++ +  L   VN       G W+ + ++ +L  EE++ +      + ++ D   W
Sbjct  208   PSPLGSVPV-SLNLRVNSLLSTDYGSWEIDFLKPFLVEEEIKAIYETHSGDPSSNDRLVW  266

Query  1249  SPDPRGCFSVKSAYGWADNAARQE-----------ADKVWGLIWSLRVPARISMFIWLVK  1103
                  G +SVKS Y WA     Q+             +VW  +W L V  +I  F W   
Sbjct  267   PFVKNGIYSVKSGYHWAMTRNIQQRIGNPHRSALIPKQVWKCVWKLEVQPKIRSFXWRSL  326

Query  1102  HGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNL  923
                V T      R  +S+  C  C    E L HLF +C  V+ +W      R        
Sbjct  327   QEAVATXVNLFMRRSSSSTLCPICNRYEESLVHLFLQCSWVEEVWIGXRLIRGLRRDAVT  386

Query  922   DWNSWL-TMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRC  746
              W  WL ++    + Q G          T  W++WK R   +FN+  +   Q +  +   
Sbjct  387   SWAXWLGSIVGLANGQSGVRNDMLSYVATTCWFIWKARCXFLFNQQPIVPRQIIAVI---  443

Query  745   DSETAAAFEERH----WPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVL  578
               ++ AAF+E        L     G    + W  P  G++K+N D S    G     GV+
Sbjct  444   -XQSVAAFKEYXQATVCSLPISVNGLXSDVQWSPPCVGFIKINVDASWLRSGAPGFVGVV  502

Query  577   -RDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK  401
              RD  G +      R+   +  VAEA  VL G  + +  G   +++E DS+  +  ++  
Sbjct  503   ARDDEGRFMAAIRRRVTASSVAVAEALAVLHGCELGRSMGWNFVIVESDSQESISCIRDS  562

Query  400   ET-GQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLA  278
             +T G  +   I+ RC +  E F    +    R  N  AD+LA
Sbjct  563   DTRGSWEAFPILARCKRMGEAFNDCRWSWTPRSANMAADRLA  604



>ref|XP_009115910.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=869

 Score =   207 bits (528),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 170/589 (29%), Positives = 270/589 (46%), Gaps = 41/589 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DR+ +  +GW  K LS  G+  L KS+  A+PI++M    LPK VC EI     +F W
Sbjct  268   IVDRVKSVTQGWSKKYLSHGGKEVLLKSIALAMPIFSMNVFRLPKEVCEEINGVLAKFGW  327

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  ++ G   M   AW  ++  K  GGLG R+L   N+A + K  WR+   P+ L A+ +
Sbjct  328   GNTDKKG---MHWYAWKRVSVPKREGGLGFRDLQNFNQALLGKQVWRILQHPDCLMARVI  384

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y    G+ L   ++R  S AWK I   +E ++ GL +V+ +G  T  W D WL   P
Sbjct  385   RARY-FADGNILDAVQKRKASYAWKSILYGKELVKQGLRYVIGDGTLTNLWTDPWLPVHP  443

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
                  R   G+P +    +      RGW  +K+   +  E+++++  + +  +   D  G
Sbjct  444   PRPP-RARDGVPLVGKVKDLIRSDGRGWNEQKLHDVVVEEDIDKILGVKIFSKAQWDLLG  502

Query  1252  WSPDPRGCFSVKSAYGWADNAARQE-ADKVWG------LIWSLRVPARISMFIWLVKHGR  1094
             W  +  G +SVKS Y  + +    E    V+G       IW+ ++P +I  F+W      
Sbjct  503   WHYNEDGIYSVKSGYWLSTHLPTNELIQPVYGDVNLKKKIWATKMPPKIHHFLWKTLSRS  562

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN  914
             + T     RRH+T+ + C  C    E   H+   C     IWR S       S+  +D N
Sbjct  563   LATGSNLKRRHVTNMDQCLRCCQGEESEKHILFDCIYAQSIWRAS---GISNSII-MDPN  618

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWK-WRNEAVFNRNLLPLEQK-LDWLRRCDS  740
             + L   ++   Q              LW LW+ W+     +RN+L  + K ++W      
Sbjct  619   ATLEAKMEVCLQCCSSSTLSHLQNLPLWVLWRIWK-----SRNILLFQHKHINWRIILMQ  673

Query  739   ETAAAFEERHWPLQRHNRGG---------EERLSWEKPDEGWLKLNTDGSCTSDGQASCG  587
                 A E  +      +R G           R  W +PD GW+K N DGS T+    S  
Sbjct  674   AHKDAQEWMNNQATVDSRAGVSSARGTYRNRRNEWRRPDTGWIKCNVDGSFTNSNIPSRA  733

Query  586   G-VLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKE----YGARRIMIECDSKML  422
             G V+RD+ G + +G    IG+      E+   LQ + MA +    +G ++I+IE D +  
Sbjct  734   GWVIRDSRGVY-QGAGQGIGQVVRNPLES--ELQAIIMAMQNCWSHGYKKIIIEGDCQKA  790

Query  421   VEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
             +  L  +      + N +R  +   + F +V F  I RE N++ADKLAK
Sbjct  791   IHLL-NRIGLCFHSYNWIREALWWKQKFESVEFQWINREGNRVADKLAK  838



>ref|XP_009124780.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=332

 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 123/332 (37%), Positives = 166/332 (50%), Gaps = 8/332 (2%)
 Frame = -1

Query  1156  IWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVD  977
             +W +  P R+ MF+WLV +  ++TN ER RRH++  + C  C G  E + H+ R C  + 
Sbjct  1     MWRVVAPERVRMFLWLVANQAIMTNAERHRRHLSGTDLCQVCRGGIETIIHVLRDCPAIK  60

Query  976   RIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF  797
              IW   + R   E+   +    WL  NL  D   G    W   F   LWW WKWR   VF
Sbjct  61    GIWERFVPRMRREAFFRMPLLEWLYKNLC-DNNAGGGVPWATIFALTLWWGWKWRCGNVF  119

Query  796   NRNLLPLEQKLDWLRRCDSE--TAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTD  623
                 L    ++ +LR       TA   E  H   +RH    E  + W+ P  GW+KLNTD
Sbjct  120   GDTRL-WRDRVKFLRDLAKGVITANRTENAHIK-ERHMV--EIMVGWKPPCVGWMKLNTD  175

Query  622   GSCTSD-GQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIM  446
             G+   + G A+ GG LR+  G WC G+   IG CT+ +AE WGV  GL +A E G RR+ 
Sbjct  176   GASHGNPGPAAAGGALRNGEGEWCGGFAINIGSCTAPLAELWGVYYGLVVAWEKGVRRLE  235

Query  445   IECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
             +E DS M++E L          + +VR C         V F+H+YRE N+LAD LA +A 
Sbjct  236   VEVDSMMVMEFLTIGIGDTHPLSFLVRLCHGFLTRDWLVRFVHVYREANRLADGLANFAF  295

Query  265   TTQGGLHIFEVPPGEFEVRMALDRLGASSPRR  170
             T   G H F V P E  V +  D  G   PR+
Sbjct  296   TLPFGFHSFVVAPIEVAVLVHEDVAGPLRPRQ  327



>ref|NP_001175214.1| Os07g0501200 [Oryza sativa Japonica Group]
 dbj|BAH93942.1| Os07g0501200 [Oryza sativa Japonica Group]
Length=620

 Score =   204 bits (518),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 161/599 (27%), Positives = 258/599 (43%), Gaps = 52/599 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +++  R+  W    LS+ G+  L KSVL AIP+Y M    +P  VC E+ K  R F W
Sbjct  9     LQEKVWKRILLWGENHLSVGGKEILIKSVLQAIPVYVMGIFKIPDSVCDELTKAVRNFWW  68

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G D   G  K    AWD +   K  GG+G R+    N+A + +  WR+    N+L A+ L
Sbjct  69    GADR--GKRKTHWRAWDTLIKPKQCGGMGFRDFKLFNQALLARQAWRILDNLNSLCARVL  126

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----  1445
               KY   +GS + T+   + S  WKGI    E L+ G+   V NG S R W D WL    
Sbjct  127   KAKYFP-NGSIIDTSFGGNSSPGWKGIEYGLELLKKGIIWRVGNGHSIRIWRDPWLPRDF  185

Query  1444  TAKPLYEKLRGTLG-LPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENT  1268
             + +P+  K    +  +P+L     E       W  E+IQ++    + + +  +  +    
Sbjct  186   SRRPITRKGNCRIKWVPDLLNDNGE-------WDLERIQQHFNQIDTDIILKIRPSRSQE  238

Query  1267  PDGWGWSPDPRGCFSVKSAYGWADNAAR---------QEADKVWGLIWSLRVPARISMFI  1115
              D   W PD  G FSV+SAY  A + A           +  K W L+W+  +P ++ +F 
Sbjct  239   ADFVAWHPDKHGIFSVRSAYHLAVSLANVNSSSSSSGHDLSKAWKLVWNCNIPQKVKIFA  298

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEES  935
             W      + T   +  R +     C  C  + ED+ H   RC     +W   L  R+ + 
Sbjct  299   WKAATNSLATLQNKKTRRLEPMAICSICGREEEDVAHALCRCPHATNLW---LSLRSSKD  355

Query  934   MRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWL  755
             +      SW       D+     +     F   LW +W  RNE    ++  P+       
Sbjct  356   ISFEAGASWSGSGWILDQLGLIAKEEGAMFLMLLWRIWYNRNEIYHGKSAPPVSVS---H  412

Query  754   RRCDSETAAAFEERHWPLQRHNRG-----------GEERLS-------WEKPDEGWLKLN  629
             R   S  ++  E + +P     +G           G  ++        WEKP+ GW+KLN
Sbjct  413   RFIVSYVSSLREIKQFPRADFAKGKFVVSNLGCMKGTSQVPDPKVLNHWEKPNPGWMKLN  472

Query  628   TDGSCTSD-GQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGAR  455
              DGS  +  G    G VLR++ G+    +   + RC   + AE     +G+ MA ++   
Sbjct  473   VDGSFDARYGSGGIGAVLRNSAGSLI--FCGNMSRCGGALEAELLACREGIIMALQWTLL  530

Query  454   RIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLA  278
               ++E DS  L++ +    + + +   +V+           ++   I+RE N ++D LA
Sbjct  531   PFIVETDSLELLKLVGAGSSDRSELAFLVKEVRDPLSGNREIIIRKIHRENNCVSDFLA  589



>gb|KFK31801.1| hypothetical protein AALP_AA6G160600 [Arabis alpina]
Length=373

 Score =   198 bits (503),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 130/394 (33%), Positives = 189/394 (48%), Gaps = 30/394 (8%)
 Frame = -1

Query  1336  IQRYLPTEELERLASLCL-TEENTPDGWGWSPDPRGCFSVKSAYGWA--DNAARQEADKV  1166
             I  Y+P E   +L SL + T     D   WS +  G F+VKSAY     +   RQ+  ++
Sbjct  4     IGPYVPEEITLQLRSLVVDTMMGAKDKISWSGNSDGKFTVKSAYSMLTRNLTLRQDLSRL  63

Query  1165  WGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCH  986
             +  +W+L VP R+ +FIWL  H  ++TN ER RRH+TS+  C  C G  E + H+   C 
Sbjct  64    FQRVWALIVPERVRIFIWLGVHKVLMTNVERQRRHLTSSGVCEVCRGSEETIMHILWDCP  123

Query  985   DVDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNE  806
              ++ IWR  +  R +          WL   L  D + G               +WK R+ 
Sbjct  124   AMEGIWRRFVPPRKQGLFFTQTLLEWLYTKLGDDSKVGNS-------------IWKCRD-  169

Query  805   AVFNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNT  626
                         +L +L+    E  +A  +      R+    E  + W+ P +GW+KLNT
Sbjct  170   ------------RLKFLKDLALEVTSAHNKLGKRQSRNQERIEHMIKWQPPRDGWVKLNT  217

Query  625   DGSCTSD-GQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRI  449
             DG+   + G A+ GGVLRD  GNWC G+   IG C + +AE WGV  GL +A E    R+
Sbjct  218   DGASRGNPGLAAAGGVLRDGDGNWCGGFVLNIGICFAPLAELWGVYYGLYIAWERRITRL  277

Query  448   MIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWA  269
              IE DS ++VE LK   +     + +VR C         V  +H+YRE N+LAD LA +A
Sbjct  278   EIEVDSAIVVEFLKTGISEYHPLSFLVRLCHGFISRDWIVRIVHVYREANRLADGLANYA  337

Query  268   LTTQGGLHIFEVPPGEFEVRMALDRLGASSPRRV  167
              +   G    E  P    +  A D  G + PR++
Sbjct  338   FSLPLGFLFLESIPDSVRLIFAEDASGTAIPRQI  371



>ref|XP_008237302.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=394

 Score =   198 bits (504),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 117/396 (30%), Positives = 188/396 (47%), Gaps = 10/396 (3%)
 Frame = -1

Query  1342  EKIQRYLPTEELERLASLCLTEENT--PDGWGWSPDPRGCFSVKSAYGWADNAARQEADK  1169
             EK++  LP E ++R+ S C    N+   D   W     G FSVKSAY      +   +D 
Sbjct  2     EKLRAALPDELVQRVIS-CPVGFNSGLQDAQIWKFSSNGIFSVKSAYNMVFEGSTC-SDV  59

Query  1168  VWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRC  989
              W  +W LR+P ++ +F WLV  G++L+N +R RR ++ +  C +C    E + H+ R C
Sbjct  60    AWTFLWKLRIPPKLHIFFWLVFQGKILSNEQRVRRQLSLDASCGSCHWPMESILHILRDC  119

Query  988   HDVDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRN  809
                 ++W   L          +D+  WL +NL           W   F    W++WKWRN
Sbjct  120   VKAKKVWNALLNSSQSARFFTMDFQPWLRVNLMSKIVWADGIPWNLVFVFTCWYIWKWRN  179

Query  808   EAVFNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLN  629
               VF+ +    +   D ++   +     F+  +    +  +  E   +WE P  G  KLN
Sbjct  180   HYVFHGD---EDLAFDSIQIITAAVKEWFKTSNVSFTKCAK-VEAWFAWEPPPAGVFKLN  235

Query  628   TDGS-CTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARR  452
              DGS   + G    GGVLRD  G+WC G+   +G+     AE WG+  GLRMA   G   
Sbjct  236   VDGSRKVASGHIGAGGVLRDVSGDWCSGFAINLGKGQILEAELWGLFFGLRMAIAKGFNN  295

Query  451   IMIECDSKMLVEALKGKETGQEQN-NNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
             +++E DS + ++ ++  ++       ++V  C +  +        HI+RE+N +AD+LA 
Sbjct  296   LIVEMDSAVAIQLVQQHDSLTVHPLASLVSSCWQLMQQLEKCSMRHIFREKNSVADRLAA  355

Query  274   WALTTQGGLHIFEVPPGEFEVRMALDRLGASSPRRV  167
             W+     G+ +F+  P      +  D LG S PR +
Sbjct  356   WSYNLDLGICVFDEAPSWIGTSLVEDLLGVSRPRLI  391



>gb|AAD37021.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis 
thaliana]
Length=732

 Score =   205 bits (521),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 119/349 (34%), Positives = 186/349 (53%), Gaps = 25/349 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L++++ RL GWK + LSLAGRVTL K+VL++IP++TM T ALPK     ++K +R F+W
Sbjct  293   ILEKLTTRLAGWKGRFLSLAGRVTLTKAVLSSIPVHTMSTIALPKSTLDGLDKVSRSFLW  352

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G        K  L++W  +   ++ GGLG+R    MN+A + K+GWRL  + ++LWA+ +
Sbjct  353   G--SSVTQRKQHLISWKRVCKPRSEGGLGIRKAQDMNKALLSKVGWRLIQDYHSLWARIM  410

Query  1612  TTKYHHRSGSHLVTTRRRSI-SNAWKGIS-AERETLESGLTHVVRNGKSTRFWMDSWLTA  1439
                Y  +       T+ RS+ S+ W+ ++   RE +  GL+ V+ +G+   FWMD WLT 
Sbjct  411   RCNYRVQDVRDGAWTKVRSVCSSTWRSVALGMREVVIPGLSWVIGDGREILFWMDKWLTN  470

Query  1438  KPLYEKLRGTLGLPELYATVNEYWDKVR---------GWKWEKIQRYLPTEELERLASLC  1286
              PL E L     + E  A     W  +R         GW    I  Y+ +    +L S  
Sbjct  471   IPLAELL-----VQEPPAG----WKGMRARDLRRNGIGWDMATIAPYISSYNRLQLQSFV  521

Query  1285  LTE-ENTPDGWGWSPDPRGCFSVKSAYGWA--DNAARQEADKVWGLIWSLRVPARISMFI  1115
             L +     D   W     G F V + Y +   D A RQ+  + +  +WS+  P R+ +F+
Sbjct  522   LDDITGARDRISWGESQDGRFKVSTTYSFLTRDEAPRQDMKRFFDRVWSVTAPERVRLFL  581

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW  968
             WLV    ++TN ER RRH+++   C  C G +E + H+ R C  ++ IW
Sbjct  582   WLVAQQAIMTNQERHRRHLSTTTICQVCKGAKESIIHVLRDCPAMEGIW  630


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = -1

Query  679  EERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHGNWCRGYTYR--IGRCTSTVA  509
            E ++SW KP+EGW+KLNTDG+   + G+A+ GG LRD     C G+  R  + R +    
Sbjct  659  ERQVSWRKPNEGWVKLNTDGASHGNPGEATAGGALRDEEVRLCYGFLSRDWLVRVSHVYR  718

Query  508  EAWGVLQGL  482
            EA  +  GL
Sbjct  719  EANRLADGL  727



>emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1369

 Score =   208 bits (530),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 174/611 (28%), Positives = 267/611 (44%), Gaps = 36/611 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             + DR+  +L+GWK K LS AGR  L K+V  AIP Y MQ   +PK +   IEK  R F W
Sbjct  777   IQDRVWKKLKGWKGKYLSQAGREVLIKAVAQAIPTYAMQCFVIPKSIIDGIEKMCRNFFW  836

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G+ E+    +++ VAW+ +   K  GGLG+RN    NRA + K  WR+ T+P++L A+ +
Sbjct  837   GQKEEE--RRVAWVAWEKLFLPKKEGGLGIRNFDVFNRALLAKQAWRILTKPDSLMARVI  894

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  RS + L      ++S   K I + R  ++ G+  V+ +G+ T  W D W+ +  
Sbjct  895   KGKYFPRS-NFLEARVSPNMSFTCKSILSARAVIQKGMCRVIGDGRDTTIWGDPWVPSLE  953

Query  1432  LYEKLRGTLGLPELYAT--VNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
              Y  +  T G+ E      V E     R W  E +       E   +  + +  +  PD 
Sbjct  954   RY-SIAATEGVSEDDGPQKVCELISNDR-WNVELLNTLFQPWESTAIQRIPVALQKKPDQ  1011

Query  1258  WGWSPDPRGCFSVKSAY--------GWADNAARQEADKVWGLIWSLRVPARISMFIWLVK  1103
             W W     G F+V+SAY            + +R    K+W  IW  ++P ++ +F W   
Sbjct  1012  WMWMMSKNGQFTVRSAYYHELLEDRKTGPSTSRGPNLKLWQKIWKAKIPPKVKLFSWKAI  1071

Query  1102  HGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNL  923
             H  +       +R +  +  C  C  + E  +HL   C +  R W  S  R    ++   
Sbjct  1072  HNGLAVYTNMRKRGMNIDGACPRCGEKEETTEHLIWGCDESSRAWYISPLRIHTGNIEAG  1131

Query  922   DWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRR--  749
              +  W+   L  D  +  E  W   F    W +W  RN+ VF +  L  ++ ++   R  
Sbjct  1132  SFRIWVESLL--DTHKDTE--WWALFWMICWNIWLGRNKWVFEKKKLAFQEVVERAVRGV  1187

Query  748   CDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDT  569
              + E   A       L  H  G      W  P  G +KLN D +         GGV+RD 
Sbjct  1188  MEFEEECAHTSPVETLNTHENG------WSVPPVGMVKLNVDAAVFKHVGIGMGGVVRDA  1241

Query  568   HGN-----WCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKG  404
              G+      C G+          +AEA  +  GL++A E G R +++E D K L   L+G
Sbjct  1242  EGDVLLATCCGGWAME----DPAMAEACSLRYGLKVAYEAGFRNLVVEMDCKKLFLQLRG  1297

Query  403   KETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPG  224
             K +       +V   +  A     VVF H+ R  NK+A  LA+            E  P 
Sbjct  1298  KASDVTPFGRVVDDILYLASKCSNVVFEHVKRHCNKVAHLLAQMCKNAMEKRVWLEEYPS  1357

Query  223   EFEVRMALDRL  191
             E    + LD++
Sbjct  1358  EVSSAVLLDKI  1368



>ref|XP_006493638.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=360

 Score =   197 bits (500),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 115/337 (34%), Positives = 164/337 (49%), Gaps = 4/337 (1%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +LD+++  L  W A  LSLAGR+TL +SV+ AIPIY MQT  +P G+  +I++  RRFIW
Sbjct  16    ILDKVNQHLLRWNAIHLSLAGRITLTQSVIQAIPIYAMQTTKIPFGIREKIDQACRRFIW  75

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                  +   K+SLV WD I   K  GGLGL+ L+ MN A +MK+GW L   PN+LW K L
Sbjct  76    S--GAADKKKISLVKWDTICQLKPSGGLGLKQLNLMNDALLMKIGWVLIASPNSLWVKVL  133

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK-  1436
              +KY     +   T   +  S  WK +      +  G+   + NG   RFW D+W+T + 
Sbjct  134   LSKYGLAPNALPSTLPTKCGSYMWKAVGGIWHEVLKGIKWDIGNGNRVRFWWDNWVTEEY  193

Query  1435  PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
             PLY      + L +L   V  +      W W   +   P   L ++A+      N  D +
Sbjct  194   PLYTFALQPIRLQQLEECVARFITVEGTWNWRLFENLFPHHLLLKIAATKPPSVNDEDDY  253

Query  1255  G-WSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
               W+      F+  SAY           +  W ++W  R P RI  F+W+V   R+ T  
Sbjct  254   MYWAYSKSEDFTTNSAYRALSKMEVHNEESFWRILWQWRGPQRIKTFLWVVGQNRLKTKA  313

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW  968
             E  RRHI  +  C  C    E+  H+ R C     +W
Sbjct  314   ELFRRHIVDDMSCAKCGCVVENTLHVLRDCPSAKHVW  350



>ref|XP_009130050.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1128

 Score =   207 bits (527),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 170/626 (27%), Positives = 275/626 (44%), Gaps = 53/626 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D++ A  +GW  K LS  G+  L KS+  A+PI++M    LPK VC EI +   RF W
Sbjct  527   IVDKVKAVTQGWSQKYLSPGGKEVLLKSIALAMPIFSMNVFRLPKEVCDEINRVLARFWW  586

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E  G   M    W  ++  K+ GGLG R+L   N+A + K  WR+   P  L A+ L
Sbjct  587   GSGENKG---MHWYDWKRVSLPKSEGGLGFRDLEKFNQALLGKQVWRILQNPGCLMARIL  643

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y    G  L    +   S AWK I   R+ ++ G+ +++ +G     W D W+    
Sbjct  644   KARY-FLDGDILSAELKTKASYAWKSILYGRDLVKQGMRYIIGDGSLINTWTDPWIPDHT  702

Query  1432  LYEKLRGTLGLPELYATVNEYWDKV-RGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
                    T GL      VN+ + +   GW  +K++  +  E++ ++ +L L+     D  
Sbjct  703   PRAPRPRTPGL--RIGKVNQLFSQYGYGWDEQKVRAVIVDEDIPKVLALKLSTTAKQDLL  760

Query  1255  GWSPDPRGCFSVKSAYGWADN-AARQEADKVWG------LIWSLRVPARISMFIWLVKHG  1097
             GW     G ++VKS Y  + +   R+  +   G       IW+ ++P++I  FIW V   
Sbjct  761   GWHYKDDGIYTVKSGYWLSTHLPTRERMEPTLGNPSLKKKIWNTKLPSKIHHFIWKVLSR  820

Query  1096  RVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS--------LQRRTE  941
              + +     RRHI  +  C  C    E   HL   C    +IWR S          R + 
Sbjct  821   SIASGANLKRRHIMPDAQCRRCCNGDETDKHLLFDCIYAQQIWRASGISNTILTDPRASL  880

Query  940   ESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
             E    +      +++L+      F   W       LW +WK RN  +F    +     L 
Sbjct  881   EEKIEVCLQCCTSIHLRHLTNLPF---W------LLWRIWKSRNLLIFQNKQIDGRHVLQ  931

Query  760   WLRRCDSETAAAFEERHWPLQRHNRGGEERLS----WEKPDEGWLKLNTDGS-CTSDGQA  596
               RR D++  +     +    R N   ++ L     W++P  GWLK N D S   ++  +
Sbjct  932   QARR-DAQEWSTHSTLNVSSGRPNISSQQTLMQNQRWKRPPVGWLKCNVDASFVNAETPS  990

Query  595   SCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEY----GARRIMIECDSK  428
               G ++RD +G + +G    IG C  +  E  G +QG+ MA +     G  R++ E D K
Sbjct  991   KAGWIIRDENGTY-KGAGQGIGVCVRSPME--GEIQGIIMAMQQCWARGYTRVIFESDCK  1047

Query  427   MLVEALKGKETGQEQNNNIVRRCIKEA----ENFLAVVFLHIYREQNKLADKLAKWALTT  260
               ++ L G     +  N      I+EA    + F+   +  + R  NK+ADKLAK  +  
Sbjct  1048  QAIDILNGSGLYFKGYN-----WIREAWWWRDKFMGATYSWVRRNANKIADKLAKQNIPY  1102

Query  259   QGGLHIFEVPPGEFEVRMALDRLGAS  182
                   +   P    V + +D +G++
Sbjct  1103  NALFWFYNYVPRSIVVDLHIDYIGST  1128



>gb|AAQ19327.1| bZIP-like protein [Oryza sativa Japonica Group]
Length=2367

 Score =   207 bits (527),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 158/574 (28%), Positives = 255/574 (44%), Gaps = 56/574 (10%)
 Frame = -1

Query  1951  RLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSG  1772
             R+  W    LS  G+  L K+V+ AIP+Y M    LP+ V  ++ K T+ F W  D  +G
Sbjct  1509  RVIQWGENHLSTGGKEVLIKAVIQAIPVYVMGIFKLPESVIDDLTKLTKNFWW--DSMNG  1566

Query  1771  NNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHR  1592
               K    AWD +T  K+ GGLG R+    N+A + +  WRL T P++L A+ L  KY   
Sbjct  1567  QRKTHWKAWDSLTKPKSLGGLGFRDYRLFNQALLARQAWRLITYPDSLCARVLKAKYFPH  1626

Query  1591  SGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----TAKPLYE  1424
              GS + T+   + S AW+ I    + L+ G+   V NG S R W DSWL    + +P+  
Sbjct  1627  -GSLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDSWLPRDHSRRPITG  1685

Query  1423  KLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSP  1244
             K    L       T +  WD        KI +Y    + E + ++C++  +  D   W P
Sbjct  1686  KANCRLKWVSDLITEDGSWD------VPKIHQYFHNLDAEVILNICISSRSEEDFIAWHP  1739

Query  1243  DPRGCFSVKSAYGWA---------DNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRV  1091
             D  G FSV+SAY  A          ++     +K W +IW  +VP ++ +F W V    +
Sbjct  1740  DKNGMFSVRSAYRLAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKVKIFAWRVASNCL  1799

Query  1090  LTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR--HSLQRRTEESMRNLDW  917
              T   + +R +  ++ C  C  + ED  H   RC    ++W   H     + +   ++  
Sbjct  1800  ATMVNKKKRKLEQSDMCQICDRENEDDAHALCRCIQASQLWSCMHKSGSVSVDIKASVLG  1859

Query  916   NSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSE  737
               WL      D  +   E     F   LW  W  RNE +  ++  P E    +++   S 
Sbjct  1860  RFWLF-----DCLEKIPEYEQAMFLMTLWRNWYVRNELIHGKSAPPTETSQRFIQ---SY  1911

Query  736   TAAAFEERHWPLQRHNRG------------------GEERLSWEKPDEGWLKLNTDGSC-  614
                 F+ R  P     +G                     +  WE+P +GW+KLN DGS  
Sbjct  1912  VDLLFQIRQAPQADLVKGKHVVRTVPLKGGPKYRVLNNHQPCWERPKDGWMKLNVDGSFD  1971

Query  613   TSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIEC  437
              S G+   G +LR++ G+        + RC + + +E    ++GL++A  +    I +E 
Sbjct  1972  ASSGKGGLGMILRNSAGDIIFTSCKPLERCNNPLESELRACVEGLKLAIHWTLLPIQVET  2031

Query  436   DSKMLVEALKGKETGQEQNNNIVRRCIKEAENFL  335
             D   +V+ L+G      ++ +++   I EA + L
Sbjct  2032  DCASVVQLLQGI----GRDFSVLANIIHEARHLL  2061



>ref|NP_001066197.2| Os12g0156200 [Oryza sativa Japonica Group]
 gb|ABA96496.2| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29216.2| Os12g0156200 [Oryza sativa Japonica Group]
Length=1764

 Score =   207 bits (526),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 154/551 (28%), Positives = 245/551 (44%), Gaps = 52/551 (9%)
 Frame = -1

Query  1951  RLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSG  1772
             R+  W    LS  G+  L K+V+ AIP+Y M    LP+ V  ++ K T+ F W  D  +G
Sbjct  906   RVIQWGENHLSTGGKEVLIKAVIQAIPVYVMGIFKLPESVIDDLTKLTKNFWW--DSMNG  963

Query  1771  NNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHR  1592
               K    AWD +T  K+ GGLG R+    N+A + +  WRL T P++L A+ L  KY   
Sbjct  964   QRKTHWKAWDSLTKPKSLGGLGFRDYRLFNQALLARQAWRLITYPDSLCARVLKAKYFPH  1023

Query  1591  SGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----TAKPLYE  1424
              GS + T+   + S AW+ I    + L+ G+   V NG S R W DSWL    + +P+  
Sbjct  1024  -GSLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDSWLPRDHSRRPITG  1082

Query  1423  KLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSP  1244
             K    L       T +  WD        KI +Y    + E + ++C++  +  D   W P
Sbjct  1083  KANCRLKWVSDLITEDGSWD------VPKIHQYFHNLDAEVILNICISSRSEEDFIAWHP  1136

Query  1243  DPRGCFSVKSAYGWA---------DNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRV  1091
             D  G FSV+SAY  A          ++     +K W +IW  +VP ++ +F W V    +
Sbjct  1137  DKNGMFSVRSAYRLAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKVKIFAWRVASNCL  1196

Query  1090  LTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR--HSLQRRTEESMRNLDW  917
              T   + +R +  ++ C  C  + ED  H   RC    ++W   H     + +   ++  
Sbjct  1197  ATMVNKKKRKLEQSDMCQICDRENEDDAHALCRCIQASQLWSCMHKSGSVSVDIKASVLG  1256

Query  916   NSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSE  737
               WL      D  +   E     F   LW  W  RNE +  ++  P E    +++   S 
Sbjct  1257  RFWLF-----DCLEKIPEYEQAMFLMTLWRNWYVRNELIHGKSAPPTETSQRFIQ---SY  1308

Query  736   TAAAFEERHWPLQRHNRG------------------GEERLSWEKPDEGWLKLNTDGSC-  614
                 F+ R  P     +G                     +  WE+P +GW+KLN DGS  
Sbjct  1309  VDLLFQIRQAPQADLVKGKHVVRTVPLKGGPKYRVLNNHQPCWERPKDGWMKLNVDGSFD  1368

Query  613   TSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIEC  437
              S G+   G +LR++ G+        + RC + + +E    ++GL++A  +    I +E 
Sbjct  1369  ASSGKGGLGMILRNSAGDIIFTSCKPLERCNNPLESELRACVEGLKLAIHWTLLPIQVET  1428

Query  436   DSKMLVEALKG  404
             D   +V+ L+G
Sbjct  1429  DCASVVQLLQG  1439



>emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1389

 Score =   206 bits (524),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 160/583 (27%), Positives = 261/583 (45%), Gaps = 29/583 (5%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++ +   +L  WKA +LS AGR  L +S L +   + MQ+  LPK V + ++   R F W
Sbjct  784   VISKTVQQLPKWKANSLSQAGRTVLIQSNLASKASFQMQSFTLPKKVLTTLDTTYRNFFW  843

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
              +D  +     + + W+ I   K+ GG+G R     N A  MKL W++    + +W K +
Sbjct  844   NKDPAA--KSANFIGWNKICQPKSVGGVGFRKAEVTNIALQMKLLWKIMVSKDNIWVKLV  901

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
             T KY  +  + LV     + S  WK +   R     GL  ++ +G+   FW D+W+   P
Sbjct  902   TQKY-LKEQNLLVCKIPSNASWQWKNLLRHRNFFSKGLRWLIGDGQDISFWTDNWIFQYP  960

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             L  K   T+G   +   V E ++ + GW   K+   +P   ++ ++S+ +   +  D   
Sbjct  961   LNSKYVPTVGSENI--KVAECFNGLGGWDIPKLLTLVPPNIVKAISSVFIPSSSQQDRLL  1018

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEADKV-WGLIWSLRVPARISMFIWLVKHGRVLTNYE  1076
             W   P G +SVKS             +KV +  IW +  P +I  F+W   +  + T   
Sbjct  1019  WGLTPTGQYSVKSGASLIREVNGGTIEKVEFNWIWGIHAPPKIKNFLWKACNDGLATTSR  1078

Query  1075  RTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWL-TM  899
               R HI   + C  C    E + HL  +C     I+ H      E+  +   + SW  T+
Sbjct  1079  LERSHIFVPQNCCFCDCPSETICHLCFQCPFTLDIYSH-----LEDKFQWPAYPSWFSTL  1133

Query  898   NLKGDRQ--QGFEEGWPERFGTRL----WWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSE  737
              L   R   +         + T+L    W +W +RN+ +FN       Q    +     +
Sbjct  1134  QLSSFRSVLEACHINLTLEYLTKLSIVWWHVWYFRNKLIFNNESTSFSQASFIIHSFMGK  1193

Query  736   TAAA---FEERHWPLQRH----NRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVL  578
                A       + PL +      R G+  L W  P+E  LK+N DGS   +GQA+ G V+
Sbjct  1194  WEKANLEIPSFNTPLPKDCKLPVRSGKN-LIWSPPNEDVLKVNFDGSKLDNGQAAYGFVI  1252

Query  577   RDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYG--ARRIMIECDSKMLVEALK  407
             R+++G         +G   S + AEA G+L+G++ A      +R+I+ E D+  ++ A+ 
Sbjct  1253  RNSNGEVLMARAKALGVYPSILMAEAMGLLEGIKGAISLQNWSRKIIFEGDNIAVINAMS  1312

Query  406   GKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLA  278
                TG     NI+        +F  V F H YRE N+LAD +A
Sbjct  1313  PSATGPWTIANIILDAGALLGHFQEVKFQHCYREANRLADFMA  1355



>ref|XP_004306074.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=407

 Score =   196 bits (498),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 116/367 (32%), Positives = 181/367 (49%), Gaps = 17/367 (5%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             + D++ +RL  WK+K LS+AGR+TL +SV +AIP Y MQTA  P  +C  ++K  R F+W
Sbjct  31    IFDQVQSRLSSWKSKVLSMAGRLTLIQSVSSAIPNYAMQTAKFPVSLCENLDKLNRNFLW  90

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E     K+ LV WD++   K  G +G++    MN+A + K+ WR+      LWA   
Sbjct  91    GDTEI--KKKVHLVNWDVVCQPKQLGDIGIKKTEDMNQAMLAKISWRMFQCDKGLWASMF  148

Query  1612  TTKYHHRSGSHLVTTRRRSI--SNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTA  1439
               KY  ++          ++  S+ W+GI    + L S L   + +GKS +FW D W  A
Sbjct  149   AEKY-LKNCCLFDDNYEVAVDCSSTWRGIIFGAKLLRSNLKWRLGDGKSIKFWHDYWFPA  207

Query  1438  KPLYEKLRGTLGLPELY----ATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTE-E  1274
              PL         LP  +    ATV ++W +  GW   K+   +P E + ++ ++ +    
Sbjct  208   GPLIN-----FALPSAFINHAATVCDFWIE-DGWDVHKLLDVVPFEIVNKIVNVPIDFGV  261

Query  1273  NTPDGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGR  1094
             +  D   W     G F VKSAY    + +    +  W  IW +++P ++  F+W   H +
Sbjct  262   SGSDTLIWGATANGKFFVKSAYNSLFDMS-APLNPQWNYIWRMKIPPKLKTFLWTFLHKK  320

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN  914
             +LTN +R  R  T++  C  C    E   HLFR C     IW   ++  +     +LDWN
Sbjct  321   LLTNMQRVTRGFTASALCPICQSADESFLHLFRDCPRSVLIWNAFVKPGSISQSFSLDWN  380

Query  913   SWLTMNL  893
              W+   L
Sbjct  381   GWIQAQL  387



>ref|XP_008351830.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1106

 Score =   205 bits (521),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 176/596 (30%), Positives = 260/596 (44%), Gaps = 47/596 (8%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW-G  1790
             D++ ARL GW  + LS AG+  L KSV  A+P Y M    LP GVC +IEK  R+F W G
Sbjct  493   DKVEARLAGWTEQFLSQAGKEVLIKSVAMALPNYAMSCFKLPIGVCRDIEKAIRKFWWKG  552

Query  1789  RDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
              D++ G   +  V+WD I+  K  GGLG +++   N A + K+GWRL   P +L A  L 
Sbjct  553   NDQRHG---IHWVSWDRISKRKMSGGLGFKDIQCFNLALLAKIGWRLTCYPTSLLATVLK  609

Query  1609  TKYHHRSGSHLVTTRRRSISN-AWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              KYH   G       R  +++  WKGI   R+ L  G+   V NG+      D W   KP
Sbjct  610   DKYH--PGCTFKEAGRGKLTSWGWKGIYEARKVLLQGIRWRVGNGQRINIRDDPWF-PKP  666

Query  1432  ------LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEEN  1271
                    YE L  T+    +    N        WK  +I      E+ E + S+ L+   
Sbjct  667   STFRVCPYENLDATMVCELIEPASNS-------WKDNRIFAGFHREDAETILSIPLSHFG  719

Query  1270  TPDGWGWSPDPRGCFSVKSAYGWA----DNAA-----------RQEADKVWGLIWSLRVP  1136
               D   W     G +SVKS YG A    +N A             +  KVW  IW L+VP
Sbjct  720   CEDKLMWHYSVNGVYSVKSGYGIAREMMENGALGKKGLGAPSEPTQLKKVWSRIWRLQVP  779

Query  1135  ARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSL  956
              +I  FIW   +  +       +RH+  +  C  C    E  +HLF RC      W  S 
Sbjct  780   NKIKFFIWRCCNNALAVRRNIQKRHMRVDNVCGVCNAVDETENHLFFRCRFSHIFWFSSP  839

Query  955   QRRTEESMRNLDW-NSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLP  779
                    +   D+ +SW         ++  EE   E F   LW +WK RN+AVF      
Sbjct  840   LHLNSHVLEGYDFLDSWGKFQAGMKGKENAEEICQE-FAFGLWRIWKNRNDAVFKGLYRQ  898

Query  778   LEQKLDW-----LRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGS-  617
               + +D      +   ++ T      R   +   +      L W++P  G +K+NTD + 
Sbjct  899   PNEVMDLWWKNIIEFREASTCLGDTARSTVVTPLSATARPSLHWQRPRYGTIKINTDAAW  958

Query  616   CTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQ-GLRMAKEYGARRIMIE  440
             C +  +A  G V RD  G           RC S  A     ++  L+    +    ++IE
Sbjct  959   CKATLRAGVGWVGRDLAGVLHAAGGLGTVRCLSAAAAEAIAIRNALKACITHRFNHVVIE  1018

Query  439   CDSKMLVEALKGKETGQEQNNNIVRRCIKE-AENFLAVVFLHIYREQNKLADKLAK  275
              D+K++++ ++ KE   + N + V   I+  A+  ++V F  + RE N  A  +AK
Sbjct  1019  SDAKLIIQMIR-KEVSVDCNLDCVLGDIEILAQRLMSVTFDFVPRESNHAAHLVAK  1073



>ref|XP_008352230.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=775

 Score =   202 bits (513),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 160/584 (27%), Positives = 244/584 (42%), Gaps = 35/584 (6%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             R+  +L+GWK  TLS AGR  L K+V  AIP Y M     P   C+E++    +  WG  
Sbjct  103   RLLDKLQGWKKSTLSQAGREILIKAVAQAIPAYPMNLFKFPVSFCNEMDALIAKXWWG--  160

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
             ++ G N++  V+ + +   K  GGLGLR+    N A + K  WRL +EPNTLWA  L  +
Sbjct  161   QKLGENRIHWVSXERLGRSKEEGGLGLRSFSIXNDALLAKQCWRLISEPNTLWALVLKAR  220

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL--  1430
             Y     S L   +    S  W  + A RE L +G    + +G  TR W+D W+   PL  
Sbjct  221   YFPNC-SFLDAKKGGRASWVWASLLAXREILRAGAHWQIMDGNDTRVWVDRWIPPIPLGR  279

Query  1429  -----YEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
                     +   L +  L   V+  WD       + ++ +L   E+E +  L   +    
Sbjct  280   PSPLGSVXVSKNLKVKSLICPVSGEWD------LDFLKPFLADSEVEXILDLHTGDPTLK  333

Query  1264  DGWGWSPDPRGCFSVKSAYGWADNAARQEADK----------VWGLIWSLRVPARISMFI  1115
             D   W  + RG +SVKS Y W+ N ++    +          +W  +W L+VP +I  F+
Sbjct  334   DRLVWPFEKRGSYSVKSGYYWSLNRSQVRCQQSIRLVSIPSTLWKTVWKLKVPPKIRTFM  393

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEES  935
             W   H  + T      R  + +  C  C    E ++HLF  C  V+ +W           
Sbjct  394   WKTLHAALATMKNLYIRRSSPSPTCXLCNSFDESIEHLFLFCPXVEVVWFGGRLNLRPNR  453

Query  934   MRNLDWNSWLTMNLKGDRQQGFEEGWPER---FGTRLWWLWKWRNEAVFNRNLL-PLEQK  767
              +   W SWL     G+ + G  E   +R        W  WK R E  FN  ++ P    
Sbjct  454   QQVSSWASWLVQ--MGEAENGSAEVRIDRISYIAFTCWHXWKSRCEFQFNNQVIYPSRVV  511

Query  766   LDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTS-DGQASC  590
                 R         F      L      G   + W  PD G +K+N   S  +  G    
Sbjct  512   AXVXRSVXDYQGTIFRXSSRSLLNQXSLGAG-VXWSPPDHGVIKINVXASWEAKSGVGFT  570

Query  589   GGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEAL  410
             G V RD  G +     ++I    + +AEA  ++ G  +    G   I +E DS   +  L
Sbjct  571   GVVARDEQGCFLAASRHKIKXTGAXMAEALAIMHGCNLGVSNGWNSICVESDSYDAISCL  630

Query  409   KGK-ETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKL  281
             +   + G      ++R+C++    F A  +  + R  N +AD L
Sbjct  631   RDPAKKGNWDAFPVLRKCLRLGRAFQACRWSWVPRLANSVADCL  674



>ref|XP_010676027.1| PREDICTED: uncharacterized protein LOC104891937 [Beta vulgaris 
subsp. vulgaris]
Length=1261

 Score =   204 bits (520),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 166/617 (27%), Positives = 265/617 (43%), Gaps = 36/617 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++++   +L  WKA  LS AGR  L KS L +   Y MQ+  LP  + S ++K  R F W
Sbjct  655   VINKTVGQLPKWKANALSQAGRSILIKSNLASKASYQMQSFLLPNSILSSLDKTYRNFFW  714

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
              +D  + +   +L+ WD I   K  GGLG R     N+A  MKL WR+      LW   L
Sbjct  715   NKDPNAKSP--NLIGWDKICKPKVAGGLGFRKAEVNNQALQMKLLWRIVKNDTNLWV-NL  771

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               K + ++ S       +S S  W+ + + R+  + GL   + +G   RFW D+W    P
Sbjct  772   VRKRYLKNRSLFTIKVSKSASWQWRNLLSLRDLFKKGLRWQIGDGSCVRFWSDNWAFQYP  831

Query  1432  LYEKLRGTLGLPE-LYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
             L   +  T   PE +   V +       W  + +   +P   +  ++S+ L      D  
Sbjct  832   LDSIITPT---PETINFLVKDCLTANGNWNTQLLLSLVPPNIVSHISSIYLPSSPQQDTL  888

Query  1255  GWSPDPRGCFSVKSAYGWADNAARQEADKV-WGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
              W     G +SVKS    A      E D V +  IW+L +P +I  F+W   +  + T  
Sbjct  889   IWGLTSDGEYSVKSGALLAQGLISAELDTVEYKWIWNLIIPPKIKNFLWKACNDGLPTKV  948

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH-------SLQRRTEESMRNLD  920
                R H+   + C  C+   E + HL   C     ++ H        L  R   S+    
Sbjct  949   RLERSHVFLPQQCVFCSNASESIGHLCFACPFTLDVFSHLKASFDWPLPNRCLASIDLTS  1008

Query  919   WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQK--------L  764
             + S L   L    +         +F    W++W +RN+ +FN  ++   +         +
Sbjct  1009  FRSALEACLSLACKSEV-----TKFSFVWWFIWFFRNKLIFNNEVVSSRKASAIIAKYYV  1063

Query  763   DWLRRCDSET-AAAFEERHWP-LQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASC  590
             DW +   S+T   +    H P + R  R G     W  P + + KLN DGS  S    + 
Sbjct  1064  DWSKALTSDTRHPSTSISHCPIISRSPRSGPASF-WSPPPQNYFKLNFDGSKLSSNSTAL  1122

Query  589   GGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIECDSKMLVEA  413
             G V+R+  G      +  +G  TS + AEAW + +G+  A  +    ++IE D+  ++ A
Sbjct  1123  GFVIRNVAGEAMVAGSKSLGYSTSVLQAEAWALKEGILAALSFNISNLIIEGDNLAVINA  1182

Query  412   LKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEV  233
             ++       + NNIV         F +    H +RE NK+AD LA        G+ +F  
Sbjct  1183  IRKIWKIPWEINNIVLDIRANLPLFGSFQVQHCFREANKVADLLANRG-HGLDGMQLF-Y  1240

Query  232   PPGEFEVRMAL--DRLG  188
             PP + ++ M +  D LG
Sbjct  1241  PPFDIDLSMCVRKDVLG  1257



>ref|XP_010693383.1| PREDICTED: uncharacterized protein LOC104906342 [Beta vulgaris 
subsp. vulgaris]
Length=1157

 Score =   204 bits (518),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 165/597 (28%), Positives = 264/597 (44%), Gaps = 20/597 (3%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +LDRI  +L GWK K LS AG+  L KSV+ AIP Y M     P  V S I     +F W
Sbjct  575   ILDRIWKKLRGWKEKLLSRAGKEVLLKSVIQAIPTYLMGIYKFPVSVTSTISSAMAQFFW  634

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +  G  ++    W  +   K  GGLG ++L   N A + +  WR+    +TL  K +
Sbjct  635   G--QSGGGRRIHWKNWKAMCELKCLGGLGFKDLEIFNDALLGRQAWRIMNGEHTLLGKVM  692

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY +R  S L      + S +W+GI + +  ++ G+   V NG+    W D W+ A  
Sbjct  693   KAKY-YRHCSFLDAPLGYAPSYSWRGIWSSKALVKEGMLWRVGNGQDINIWRDPWI-ADE  750

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
                 ++      E  + V+E      G W  E + R     + E + ++ L+E +  D  
Sbjct  751   TGRFIQSDEA--EEVSKVSELIHSDTGEWNLELLARLFTERDQECILAIPLSERSQRDII  808

Query  1255  GWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYE  1076
              W+    G +SVK+AY              W  IW++    ++  F+W +  G + T   
Sbjct  809   TWAFTKSGEYSVKTAYMVGKGFELDNFHNAWVTIWNIEASPKVRFFLWRLCTGTLPTKAL  868

Query  1075  RTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMN  896
                RH+   E+C  C     D   +F  C  V  +W  S      +S+      +   ++
Sbjct  869   LHYRHLIEEEHCPWCGAVETDRHAIF-ECSRVAELWEGSGSSHLIQSV-----GTTTMLD  922

Query  895   LKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFEE  716
                 R +  E+   ++     W +W  RNE VFN    P    L  L R  +E    + +
Sbjct  923   FVASR-KSLEKKEQQKLAMLAWCIWSERNEKVFNNTFTPNTVLLARLHRLTTE-HDKYSQ  980

Query  715   RHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGNWCRGYTYR  536
             R +  +R    G  ++ W+ P  G +KLN D S   DG    G V RD  G        R
Sbjct  981   RIYGSRREGSRGSAKI-WQSPAVGHVKLNCDASLAVDGWRGLGVVARDNAGRVLFAACRR  1039

Query  535   I-GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRC  359
             +       +AE   +L  LR+A+ +G R++ +E DS++L+  L    T     ++++   
Sbjct  1040  VRANWPVEIAEGKALLMALRLAERFGLRQVTLESDSQVLITRLSKAMTYFSDLDSVLDDI  1099

Query  358   IKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVP-PGEFEVRMALDRL  191
             + ++ NFL+V + H+ R+ N +A  LAK  L   G   I+E   P E +  + +D L
Sbjct  1100  LAKSCNFLSVDWSHVKRDGNVVAHHLAK--LVPFGVEQIWENHCPSEVQPYVLMDIL  1154



>ref|XP_008382267.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=377

 Score =   192 bits (489),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 121/390 (31%), Positives = 194/390 (50%), Gaps = 23/390 (6%)
 Frame = -1

Query  1741  IITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHLVTTR-  1565
             ++   K++GGLG++    MN+A + KLGWR+  + + LW++    KY    G  ++  + 
Sbjct  1     MVCKPKSKGGLGIKRACVMNQALLAKLGWRIYAKDSGLWSQIYQAKYLK--GYSILDPKI  58

Query  1564  --RRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTLGLPEL  1391
               R   S +WKGI      L+ G+T  + NG+S +FW DSW+   PL E +     +  +
Sbjct  59    HERTECSYSWKGILYGVNLLKKGMTWRIGNGESVKFWKDSWVLNVPLMETI-DVANISNI  117

Query  1390  YATVNEYWDKVRG--WKWEKIQRYLPTEELERLASLCLTEENTPDGWG---WSPDPRGCF  1226
                V+E+   +R   W  +K++  LP + ++++  +C     T  G     W     G F
Sbjct  118   DCVVSEF---LRNGWWDIDKLRDVLPEDMVQKI--ICRPAGTTGAGMDKIIWRCASNGVF  172

Query  1225  SVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNE  1046
             +VK AY    +      D  W  IW + VP ++ +F+WL+  GR+L+N +R RR +TS+ 
Sbjct  173   TVKLAYNLFFDE-EDLPDSCWDFIWRVNVPPKLKVFLWLMSKGRLLSNEQRVRRQLTSDS  231

Query  1045  YCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFE  866
              C  C G  E + H+F+ C     IW+         + +NL++ +WL  NLK   +   E
Sbjct  232   SCMTCCGPIESIAHIFKDCSRAMCIWKSMGVPWQLRNAQNLEFKAWLLANLKVSSKGTNE  291

Query  865   EGWPERFGTRLWWLWKWRNEAVFNRN-LLPLEQKLDWLRRCDSETAAAFEERHWPLQRHN  689
               W   F    W +WKWRN+ +F+ N ++P+  K    R  D    A  +    P++R  
Sbjct  292   GAWCTLFLFICWHIWKWRNKQIFDVNFVMPMYPKAIIERDVDEWLKACVKYSVKPVKR--  349

Query  688   RGGEERLSWEKPDEGWLKLNTDGSCTSDGQ  599
                +  LSW+ PD GW KLN DGS     Q
Sbjct  350   ---QISLSWDHPDVGWCKLNVDGSVNVSLQ  376



>ref|XP_009105597.1| PREDICTED: uncharacterized protein LOC103831468 [Brassica rapa]
Length=773

 Score =   199 bits (506),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 169/581 (29%), Positives = 261/581 (45%), Gaps = 31/581 (5%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DRI  +  GW  K LS AG++ + KSVL+ IP + M    LP+ +C+ I+    RF W
Sbjct  198   IVDRIKIKASGWSNKFLSTAGKMIMLKSVLSPIPSHAMSCFKLPRSLCNRIQSAVTRFWW  257

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D++SGN K++ V+WD +T  K  GGLG R+  + N A + KL WRL   P+ L ++ L
Sbjct  258   --DDRSGNRKIAWVSWDKMTNTKGDGGLGFRDFESFNDAFLAKLSWRLIHNPSGLLSRVL  315

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY    G+ L    R   S+ WKGI   R+ +       V +G+S   W D WL+   
Sbjct  316   MGKYGG-DGTFLEAGHRSVESHGWKGILIGRDLILQNAGWAVGDGESISVWADPWLS---  371

Query  1432  LYEKLRGTLGLPELYATV---NEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
             L    R     PE +A +   +        W  + IQ+ +P EE   L S+  +   TPD
Sbjct  372   LSAPRRPMGPTPERFANLKVKDLMLPNGSDWNRDLIQQIMPQEEATIL-SIKASRSGTPD  430

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGL-----IWSLRVPARISMFIWLVKHG  1097
                W     G +++KS Y  A  ++         +     +W L V  +I +F+W +  G
Sbjct  431   KLIWLGTTSGEYTMKSGYLKALESSPTSPPPNRAIDWNKGVWQLEVAPKIKLFLWKIFQG  490

Query  1096  RVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDW  917
              +        R+I++   C  C    E ++HLF  C    ++W+ +      +S R LD 
Sbjct  491   ALAIGDRLVTRNISTGTGCKTC-NNVESINHLFLHCDIAYKVWKLAPFSSCIDSRRLLDL  549

Query  916   N-SWLTMN-LKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCD  743
             N +W  ++ L      G   G    +   LW LW  RN  +FN  +   E+ +       
Sbjct  550   NTAWQGLSKLVCLPPTGISTGPLAPW--ILWSLWLARNNRLFNNKISTPEEIV------S  601

Query  742   SETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGG--VLRDT  569
               TAAA E             + R+     +    +L TD +  +D Q +  G  ++   
Sbjct  602   RATAAAQEWLKEQRTEPPNTKDTRVLGPPRETDSSRLQTDAAWRADLQCAGLGWTIIEKD  661

Query  568   HGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQ  389
                    Y Y +   +  VAEA  V   L   +  G  R+  + DS+ LV+AL  K+   
Sbjct  662   QSTTHLSYCYFVS--SPLVAEALAVRDALAHCRALGILRLRCQTDSQQLVKALATKDPNP  719

Query  388   EQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
             E    IV   +  A +F ++ F  + R QN +AD LAK AL
Sbjct  720   EI-YGIVSDTLILASSFDSISFEWLPRAQNNVADALAKQAL  759



>ref|XP_008391252.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=623

 Score =   197 bits (502),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 164/594 (28%), Positives = 262/594 (44%), Gaps = 39/594 (7%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW-G  1790
             ++I ARL GW  + LS AG+  L K+V  A+P Y M    LP GVC ++E+  R + W G
Sbjct  12    EKIEARLAGWSEQFLSHAGKEVLVKAVAMALPNYAMSCFKLPIGVCRDVERAIRNYWWRG  71

Query  1789  RDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
              D++ G   +  ++WD +  +K  GGLG +++   N A + K+GWR+   P++L A  L 
Sbjct  72    NDQKMG---VHWISWDRLMRNKKLGGLGFKDIQCFNLAFLAKIGWRILQNPSSLLACVLR  128

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
              KY     +     + ++ S  WKGI   R  L+ G+   V +G       D W   KP 
Sbjct  129   EKY-FPDKTFREAGKGKNTSWGWKGIFEARRVLQHGIRWRVGDGNQINIRNDPWF-PKPT  186

Query  1429  YEKLRGTLGLPELYATVNEYWD-KVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
                ++    L E    V+E  +   R WK E I     +E+ + + S+ L++    D   
Sbjct  187   TFLVKPRECLQE--TLVSELIEPNSRSWKREVILHGFSSEDTKHILSIPLSKFGCCDRLV  244

Query  1252  WSPDPRGCFSVKSAY---------------GWADNAARQEADKVWGLIWSLRVPARISMF  1118
             W     G +SVK+ Y               G    +    +++VW  IW+L+VP +I  F
Sbjct  245   WHHTVDGSYSVKTGYRVAVSLLENGALGKKGRGAPSTHHTSNQVWKGIWNLQVPNKIKFF  304

Query  1117  IWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEE  938
             IW   +  +   +   RRH+  +  C  C    E  +HLF RC    R+W  S       
Sbjct  305   IWRCCNKALAVRHNLKRRHMRIDNVCGVCNLVDESENHLFFRCDLSQRLWFCSPLHLYSI  364

Query  937   SMRNLD----WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQ  770
              +   D    WN++ T ++K DR+    E   + F   LW +WK RN+ VF  +     +
Sbjct  365   ELIGADFLESWNNFCT-SIK-DREDA--EAILQEFAFGLWRIWKNRNDVVFKGSHCQPNE  420

Query  769   KLDWLRRCDSETAAAFEE---RHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGS-CTSDG  602
              L   R+   E   A          ++ H    +  + WEKP  G  KLNTD + C +  
Sbjct  421   ILTVWRKNIGEYREAMNRGSLEECAVRPHQPPPKMPMLWEKPKFGSFKLNTDAAWCCTSY  480

Query  601   QASCGGVLRDTHG--NWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSK  428
             +A  G V+RD  G  +   G       C +       +  GL+   +YG   + +E D+K
Sbjct  481   RAGAGWVIRDFAGILHAAGGSGTSTFHCAAAAEAH-AIRTGLQFCTDYGFENVFVEADAK  539

Query  427   MLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
              ++  +            I+      A+   +V F  + RE+N+ A  +AK+  
Sbjct  540   TVILMINKGIAPNCSFECILGDIEVLAQRLTSVTFGFVPRERNRAAHSVAKFVF  593



>ref|XP_008387639.1| PREDICTED: uncharacterized protein LOC103450094 [Malus domestica]
Length=1306

 Score =   202 bits (513),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 149/534 (28%), Positives = 227/534 (43%), Gaps = 24/534 (4%)
 Frame = -1

Query  1960  ISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDE  1781
             +  +++GWK   LS AG+  L K+V+ AIP Y M     P  VC +++  +  F+WG  +
Sbjct  746   VXGKIQGWKQSALSFAGKEVLLKAVVQAIPTYXMNLFKFPVAVCKDLDSMSAGFLWG--D  803

Query  1780  QSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKY  1601
               G+  +  V WD +   K  GGLG RN    N A ++K  W L   PN+LWA+TL  +Y
Sbjct  804   CGGHRXIHWVNWDTLGRPKYEGGLGFRNFQDFNDALLVKQCWXLILNPNSLWAQTLKARY  863

Query  1600  HHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEK  1421
                S S L          AW  +   R+ L++G    + NG  TR W+D WL + PL   
Sbjct  864   FXHS-SFLDAKLGSRAXWAWASLPVGRDILKNGAHWQILNGXDTRLWVDRWLPSXPLGHP  922

Query  1420  LRGTLGLPELYATVNEYW-DKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSP  1244
             +  +     L   V+       + W  E ++ ++   E + +  + L   +  D   W+ 
Sbjct  923   IPSSPTSVTLNTKVSSLICPSTKSWDIEFLRPFISEVEJKXIYDIPLGNCSRRDRLIWTS  982

Query  1243  DPRGCFSVKSAYGWADNA---ARQEADKV--------WGLIWSLRVPARISMFIWLVKHG  1097
                G + V+S Y    ++    R  A  V        W  IW  + P +I  F+W     
Sbjct  983   SXXGNYXVRSGYHXIHSSXELTRAPASVVTSTLGTSFWKAIWHAKAPPKIRHFLWRAVSE  1042

Query  1096  RVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSL--QRRTEESMRNL  923
              + T     +R   S+  C  C  Q E +  L  RC  V+ IW       RR  E + + 
Sbjct  1043  ALATVGGLFKRRSASSPMCPICKTQEESVLXLLLRCPWVEPIWXGGPLGXRRVGEGVSSX  1102

Query  922   DWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCD  743
               + WL++ +                     ++WK R    F  + L   Q L  +    
Sbjct  1103  --HHWLSVLINXTPNLQDRSRLLSVIXFSCXYIWKXRCNFXFKASALAXSQVLHSI----  1156

Query  742   SETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGS-CTSDGQASCGGVLRDTH  566
             S +  +F E   PL R          W  P   ++K+N D S C  DG A    VLRD +
Sbjct  1157  SFSLGSFLEVQVPLSRSRPSPILDPRWXPPSAPFIKVNVDASWCQFDGMARLAAVLRDHN  1216

Query  565   GNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKG  404
             G +   + + IG      AEA  +L+G  +A E G R I+   DS  +V +LKG
Sbjct  1217  GLFVAAHKWSIGAPFVVFAEALAMLKGCELAAELGFRWIVAXSDSLEVVSSLKG  1270



>emb|CCA66044.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score =   202 bits (513),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 163/602 (27%), Positives = 263/602 (44%), Gaps = 27/602 (4%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+DRI  +L+GWK K LS AG+  L KSV+ AIP Y M    LP  +  +I     RF W
Sbjct  772   LMDRIWKKLQGWKEKLLSRAGKEILLKSVIQAIPTYLMGVYKLPCSIIQKIHSAMARFWW  831

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +     ++    WD + T K  GG+G R+L   N A + +  WRL  EP++L A+ +
Sbjct  832   GSSDT--QRRIHWKNWDSLCTLKCFGGMGFRDLRVFNDALLGRQAWRLVREPHSLLARVM  889

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL---T  1442
               KY + +   L      S S +W+ I + +  L+ G+   + NG + R W D W+    
Sbjct  890   KAKY-YSNHDFLDAPLGVSTSYSWRSIWSSKALLKEGMVWRIGNGTNVRIWEDPWVLDEL  948

Query  1441  AKPLYEKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENTP  1265
              + +  +  G L +      V+E  D  R  WK   I+      +++ + S+ L+     
Sbjct  949   GRFITSEKHGNLNM------VSELIDFDRMEWKVSLIETVFNERDIKCILSIPLSSLPLK  1002

Query  1264  DGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLT  1085
             D   W+      +SVK+AY            + W  IWS+ V  ++  F+W +    +  
Sbjct  1003  DELTWAFTKNAHYSVKTAYMLGKGGNLDSFHQAWIDIWSMEVSPKVKHFLWRLGTNTLPV  1062

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWL  905
                   RH+  ++ C    G+ E   H    C  +  +W  S      ++ R L  ++ +
Sbjct  1063  RSLLKHRHMLDDDLCPRGCGEPESQFHAIFGCPFIRDLWVDS----GCDNFRALTTDTAM  1118

Query  904   TMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAA  725
             T  L      G +     +     W LW  RN  VFN++  P    L  + R   E    
Sbjct  1119  TEALVN--SHGLDASVRTKGAFMAWVLWSERNSIVFNQSSTPPHILLARVSRL-VEEHGT  1175

Query  724   FEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGNWCRGY  545
             +  R +P  R+         W  P    +KLN D S  S G      + RD+HG      
Sbjct  1176  YTARIYP-NRNCCAIPSARVWAAPPPEVIKLNVDASLASAGWVGLSVIARDSHGTVLFAA  1234

Query  544   TYRI-GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIV  368
               ++  + ++ +AEA  +   LR+ + YG   I++E D +++V  L  +       + I+
Sbjct  1235  VRKVRAQWSAEIAEAKAIEMALRLGRRYGFAAIIVESDCQVVVNRLSKQALYLADLDIIL  1294

Query  367   RRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFE--VPPGEFEVRMALDR  194
                     NF +V++ H+ R+ N +A  LAK  LT  G   I+E  VPP E    + +D 
Sbjct  1295  HNIFSSCINFPSVLWSHVKRDANSVAHHLAK--LTPFGIEQIWENHVPP-EVAPYVLMDN  1351

Query  193   LG  188
             L 
Sbjct  1352  LS  1353



>ref|XP_009148188.1| PREDICTED: uncharacterized protein LOC103871664 [Brassica rapa]
Length=743

 Score =   198 bits (504),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 170/593 (29%), Positives = 253/593 (43%), Gaps = 43/593 (7%)
 Frame = -1

Query  1969  LDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWG  1790
             +DRI  +  GWK K LS AG++ + +SVL A+P Y M    +P  +C  ++    RF W 
Sbjct  163   VDRIKQKARGWKNKYLSTAGKLVMLQSVLTAVPSYPMSNFLMPVSLCKRLQSAATRFWWD  222

Query  1789  RDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
             RDE     KM+ ++WD +   K  GGLG R+  + N A + K+GWRL   P+ L  K L 
Sbjct  223   RDEN--ERKMAWISWDSMAQPKANGGLGFRDFQSFNIALLAKIGWRLFQNPDCLLGKVLF  280

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
              KY H S + L  T   S+S+ W+ + A R  L   L  VV NG S   W D WL+    
Sbjct  281   GKYCHDS-NILQATESSSMSHGWRSVLAGRNLLLENLGWVVGNGTSINIWNDPWLSLA-Y  338

Query  1429  YEKLRGTLGLPELYATVNEYWDKV-RGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
              E+  G    P    TV++  +   R W   KI+  LP  E E++     +    PD   
Sbjct  339   QERPMGPPNEPHSQFTVSDLINPATRDWDVSKIKLILPFYE-EQILCFKPSLTGAPDKQV  397

Query  1252  WSPDPRGCFSVKSAYGWADN--AARQEADKVWGL-----IWSLRVPARISMFIWLVKHGR  1094
             W     G ++ KS Y  A      RQ+     G      +W+++   ++ +F W +  G 
Sbjct  398   WLATKSGDYTTKSGYYTAVTRVETRQDITTDHGFKWRSNVWNMQCAPKVKLFSWKLLKGA  457

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD-W  917
             +       +RH+ ++  C  C G  E + HLF +C    R+W+ +      +    +D  
Sbjct  458   IPVGERLVQRHVPADPRCKRC-GCSESIIHLFFQCGFTQRVWQLAPLNTDMDFSGIIDLM  516

Query  916   NSWLTM-NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKL--------  764
             +SW T+ +LK     G   G    +   LW +WK RN+ VF  +    E+ L        
Sbjct  517   SSWETLCSLKCLPPAGIISGSLTPW--LLWSIWKARNKFVFEGHSASPEETLSGAIVLAR  574

Query  763   DWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGG  584
             +W      E          P+  H      R      D  W              A  G 
Sbjct  575   EWNTEVKKEPLTGIRHLPAPILTHPEATVIR-----SDAAW--------APGSNIAGLGW  621

Query  583   VLRDTHGNWCRGYTYRIGRCTST-VAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALK  407
             VL    GN  + +   +    S  +AE   + + +R     G   +  E DS  L++A+K
Sbjct  622   VLLSHSGN--QSFKVPLKSVASPLLAEGLALREAVRSCATLGLNYVAFESDSLNLIKAVK  679

Query  406   GKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGL  248
              + T  E   +++      A  F  V F  I RE+N LAD LAK AL     L
Sbjct  680   LEVTIAEL-YSVIADITSFASVFEFVSFSWISREKNVLADCLAKEALNVSDTL  731



>ref|XP_010688579.1| PREDICTED: uncharacterized protein LOC104902491 [Beta vulgaris 
subsp. vulgaris]
Length=1325

 Score =   200 bits (509),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 166/589 (28%), Positives = 250/589 (42%), Gaps = 50/589 (8%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +RI  +L+GWK K LS  G+  L K+V+ AIP Y M    LP G+  EI     RF WG 
Sbjct  736   ERIWKKLQGWKEKLLSRPGKEVLIKAVVQAIPTYMMSVFCLPSGLIDEIHSLIARFWWGS  795

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
              E  G  KM    W+ +   K+ GGLG R+LH  N+A + K  WRL     +L +  L  
Sbjct  796   KE--GERKMHWHKWEALCMPKSMGGLGFRDLHCFNQALLAKQAWRLCNNSYSLLSLLLKA  853

Query  1606  KYHHRSGSHLVTTRR-RSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
             +Y+ +     +  RR  + S  W+ I   +  L  GL   V +G+S R W D+WL  +  
Sbjct  854   RYYKK--VEFIDARRGYNPSFTWRSIWGSKSLLLEGLKWCVGSGRSIRVWDDAWLMGEGA  911

Query  1429  YEKLRGTLGLPELYATVNEYWD-KVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             +      L   ++   V+   D +  GW  E +++    EE + +  + L+     D   
Sbjct  912   HLTPTPRLD-SDMELRVSALLDYEGGGWNVELVRQTFVEEEWDMILKIPLSRFWPDDHLY  970

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEA---------DKVWGLIWSLRVPARISMFIWLVKH  1100
             W P   G FSVKS Y W        A          ++W  +WS+  P ++  F+W    
Sbjct  971   WWPTQNGYFSVKSCY-WLARLGHIRAWQLYHGERDQEIWRRVWSIPGPPKMVHFVWRACK  1029

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS----LQRRTEESM  932
             G +        RHI+ +  C  C  Q+E + H    C     IW+ S    L      S 
Sbjct  1030  GSLGVQERLFHRHISESPMCSICGEQQETICHALFDCPQAKAIWQVSAYATLIADVPRSS  1089

Query  931   RNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLR  752
              ++ +  WL +    D              T +W  W  RN+ +F    L          
Sbjct  1090  FDVSFE-WLVIKCSKDDLS--------VVCTLMWAAWFCRNKFIFESQAL----------  1130

Query  751   RCDSETAAAFE-------ERHWPLQRHNRGGEER-LSWEKPDEGWLKLNTDGSCTSDGQA  596
              C  E A+ F        E    + RH  GG     +W  P EGWLK+N D     +G+ 
Sbjct  1131  -CGMEVASNFVKMVLEYGEYAGRVFRHVAGGAPSPTNWSFPAEGWLKVNFDAHVNGNGEI  1189

Query  595   SCGGVLRDTHGNWCRGYTYRI-GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLV  419
               G V+RD+ G      T R+  R  +T+AEA      + +    G   ++ E D+  +V
Sbjct  1190  GLGAVMRDSAGVVKFAATKRVEARWDATLAEAMAAKFAVEVTLRLGYDNVLFEGDALEVV  1249

Query  418   EALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKW  272
             +A+K    G      +     +   +F+A  FLH+ R  N +A  LA+W
Sbjct  1250  QAVKNNSEGVAPLFRVFYDIRRLVSSFVAFSFLHVKRTGNVVAHLLARW  1298



>ref|XP_008378657.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=653

 Score =   196 bits (497),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 155/570 (27%), Positives = 245/570 (43%), Gaps = 41/570 (7%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             R+  +L+GWK  TLS AGR  L K+V  AIP Y M     P   C+E++    +F WG  
Sbjct  23    RLLDKLQGWKKSTLSQAGREILIKAVAQAIPAYPMNLFKFPVSFCNEMDALITKFWWG--  80

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
             ++ G N++  V+ + +   K  GGLGL +    N A + K  WRL +EPNTLWA  L  +
Sbjct  81    QKLGENRIHWVSRERLGRSKEEGGLGLXSFTIFNDALLAKQCWRLISEPNTLWALVLKAR  140

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL--  1430
             Y   + S L        S  W  +   RE L +G    + +G  TR W+D W+   PL  
Sbjct  141   YFP-NXSFLDAKXGXRASWVWASLLXGREILRAGAHWQIMDGNDTRVWVDRWIPPIPLGR  199

Query  1429  -----YEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
                    ++   L +  L   V+  WD       + ++ +L   E+E +  L   +    
Sbjct  200   PSPLGSVQVSKNLKVKSLICPVSGEWDL------DFLKPFLADSEVEAILDLXTGDPMLK  253

Query  1264  DGWGWSPDPRGCFSVKSAYGWADNAARQEADK----------VWGLIWSLRVPARISMFI  1115
             D   W  D RG +SVKS Y W+ N ++    +          +W  +W L+VP +I  F+
Sbjct  254   DRLVWPFDKRGSYSVKSGYYWSLNRSQVRCQQPTRLVSIPSTLWKNVWKLKVPPKIRTFL  313

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW---RHSLQRRT  944
             W   H  + T      R  + +  C  C    E ++HLF  C  V+ +W   R +L+   
Sbjct  314   WKTLHAALATMKNLYIRRSSPSPTCPLCNSFDESIEHLFLFCPWVEVVWFGGRLNLRPNR  373

Query  943   EESMRNLDWNSWLTMNLKGDRQQGFEEGWPER---FGTRLWWLWKWRNEAVFNRNLLPLE  773
             ++      W     +   G  + G  E   +R        W +WK R +  FN  ++   
Sbjct  374   QQVSSXASW-----LXQMGAAENGSXEVRIDRISYIAFTCWHIWKSRCDFQFNNQVIYPS  428

Query  772   QKLDWLRRCDSE-TAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTS-DGQ  599
             + +  + R  S+       +    L  H+  G+  + W  PD G +K+N D +  +  G 
Sbjct  429   RVVAAVSRSVSDYQGTILRQSSRSLLNHSSLGDG-VKWXHPDHGVIKINVDANWEAKSGV  487

Query  598   ASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLV  419
                G V RD  G +      +I    +T+AEA  +L G  +    G   I +E DS   +
Sbjct  488   GFTGVVARDEQGCFLAASRQKIKATGATMAEALAILHGCNLGVSNGWNSICVESDSYDAI  547

Query  418   EAL-KGKETGQEQNNNIVRRCIKEAENFLA  332
               L      G      ++R+C++    F A
Sbjct  548   SCLWDPALKGNWDAFPVLRKCLRLGRAFQA  577



>ref|XP_010667308.1| PREDICTED: uncharacterized protein LOC104884364 [Beta vulgaris 
subsp. vulgaris]
Length=1286

 Score =   199 bits (506),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 167/612 (27%), Positives = 267/612 (44%), Gaps = 34/612 (6%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +++ A+L  WKA +LS AGR  L +S L     Y MQ  +LP  +   ++K  R F W +
Sbjct  682   EKVQAQLSKWKANSLSQAGRTILIQSNLATKANYQMQCFSLPTHILHSLDKSYRNFFWNK  741

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
               +S +   +L+ W+ +   K  GGLGLR    MN A   KL W++      LW   ++ 
Sbjct  742   SPESKSP--NLIGWEKVCKSKREGGLGLRKAKVMNMALQFKLLWKILVSQGNLWVDLVSK  799

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             KY  +  S      + + S  W+ +   R+T + GL  VV NG+   FW D+W    PL 
Sbjct  800   KY-LKDESLFDHNVKATASWQWRKLMQFRKTFKKGLRWVVGNGEKISFWFDNWAFQYPLS  858

Query  1426  E---KLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
                  +RG+  L      V  + D+   W + ++  ++P E    +  + +  +   D  
Sbjct  859   SICPVIRGSESL-----VVAHFIDQDSHWDYRRLLDFVPEEVGTSIKGIFIPRQGPEDKL  913

Query  1255  GWSPDPRGCFSVKSAY----GWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVL  1088
              W+  P GC+SVKS      G   +  R  A   +  IW+L +P +I  F+W + +  + 
Sbjct  914   VWALSPDGCYSVKSGVELIQGNGAHLTRPIASP-FSWIWNLLIPPKIKFFLWKICNDGLP  972

Query  1087  TNYERTRRHITSNEYCYNCAGQREDLDHLFRRCH---DV-DRIWRHSLQRRTEESMRNLD  920
             T       H+ S   C  C    E+L HLF  C    DV D +  H           +L 
Sbjct  973   TKKRLEISHVFSPLECIFCNHHSENLMHLFLECPFCIDVFDLLGLHHGWPSLPPKPSDLS  1032

Query  919   WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLL-PLEQKLDWLRRCD  743
             +  +L+     ++    E+    +     W++W  RN   F +    P+   L  + +  
Sbjct  1033  FVEFLS---NMNKVVSLED--IAKIAITWWFIWYARNGVSFRQEPCSPIGTSL-MVWKFY  1086

Query  742   SETAAAFEERHWPLQ------RHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGV  581
             S     FE     +       R  +   + +SW  P  G+ KLN DGS  +DG AS G +
Sbjct  1087  SRIVENFEGVKLAISNVRSPPRMRKIPRKNISWVAPPSGFCKLNFDGSKLNDGSASLGFI  1146

Query  580   LRDTHGNWCRGYTYRIGRCTST-VAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKG  404
             +RD  G         I    S  VAEAW + +G+R A   G  +++IE D+  +++A+K 
Sbjct  1147  IRDEFGIIKICGASPISPSHSILVAEAWALREGIRGACNLGIEKLIIEGDNLSVIQAIKR  1206

Query  403   KETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPG  224
                     ++I+    ++ + F  V   H  RE N  AD LA    +     + F+ P  
Sbjct  1207  IWKIPWTIHSIILDAGEDLKQFSEVHINHEVREGNAAADWLAHRGHSCSNLTYWFDSPDS  1266

Query  223   EFEVRMALDRLG  188
              F V +  D LG
Sbjct  1267  SFSVIIRKDALG  1278



>ref|XP_009145555.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=900

 Score =   197 bits (500),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 165/596 (28%), Positives = 264/596 (44%), Gaps = 56/596 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +++++ +  + WK + LS  G+  L K++  A+PI++M    LPK VC+EI     +F W
Sbjct  301   IIEKVKSVTQSWKQRYLSTGGKEVLLKAIAVAMPIFSMNIFRLPKEVCAEINAVLAKFWW  360

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  ++ G   +   +WD ++  K  GGLG ++L   N+A + K  WR+   P+ L A+ L
Sbjct  361   GAGDKKG---LHWYSWDRVSVPKREGGLGFKDLEIFNQALLSKQVWRVMQHPHCLMARIL  417

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y       L    ++  S  WK I   R+ +  G+ +++ +G     W D W+   P
Sbjct  418   KARYFPEEDI-LNAKLKKKASYPWKSILHGRDLINKGMRYIIGDGSLVNMWTDPWIPDHP  476

Query  1432  L-YEKLRGTLGLPELYATVNEYWDKV-RGWKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
                 + RG   L E    V EY++     W  +K++  +  E+++++ +L ++     D 
Sbjct  477   PRSPRARGVYQLEE---KVREYFNTTGDQWNEQKLREMIIDEDVDKILALKISPVAQQDL  533

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWG--------LIWSLRVPARISMFIWLVK  1103
              GW  +  G ++VKS Y W           +           +W  + PA++  F+W V 
Sbjct  534   LGWHYNEDGIYTVKSGY-WLGTHLPSNPPTIPTHGPAVLKHKVWKTKAPAKLKHFLWRVL  592

Query  1102  HGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNL  923
                + T     RRHI  N+ C  C    E  DH+F  C     IWR S        + NL
Sbjct  593   SRSLATGNNLKRRHIIQNDQCRRCCLAIETADHIFFECPYAKIIWRAS-------GVSNL  645

Query  922   DWNSWLTMNLKGDRQQGFEEGWPERFGTR-----------LWWLWKWRNEAVFNRNLLPL  776
               N     N     ++  E        TR           LW +WK RN  +F +  +P 
Sbjct  646   IIN-----NSSSTLEEKIEACLQCSLSTRLSHMQDLPFWLLWRIWKSRNTLIFRQKEIPW  700

Query  775   EQKLDWLRRCDSE---TAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTS-  608
                L + R    E        EE H   +R +    E L W+KP  GW+K NTDG+  S 
Sbjct  701   RSLLRYAREDAKEWKQLDNKGEEGHLR-RRQSHHLTECLHWKKPMIGWIKCNTDGAYNST  759

Query  607   DGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEY----GARRIMIE  440
               Q S G V+RD +G + +G     GR  +   E    LQ + MA ++    G R+I++E
Sbjct  760   QHQTSAGWVIRDENGIY-KGSAQARGRTRNDALEC--ELQAILMALQHCWSLGYRKIIME  816

Query  439   CDSKMLVEALKGKETGQEQNNNIVRRCIK-EAENFLAVVFLHIYREQNKLADKLAK  275
              D +  ++ +  K       N   +R I+  A  F  + F    R  NK+AD LAK
Sbjct  817   SDCQKAIDIINKKRLHFAYYN--WKREIQWWANKFQDISFQWTRRSANKVADLLAK  870



>ref|XP_004301145.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=411

 Score =   190 bits (482),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 130/418 (31%), Positives = 190/418 (45%), Gaps = 29/418 (7%)
 Frame = -1

Query  1387  ATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG--------WSPDPRG  1232
             AT+ E+W    GW    ++  LP   + ++ S+       P G+G        W+    G
Sbjct  3     ATIKEFWCD-TGWNIPLLKSVLPDHVVMQIISV-------PSGFGVSGHDKLIWNATANG  54

Query  1231  CFSVKSAY-GWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHIT  1055
              FSVKSAY  + D+A    ++ +W  +W L  P ++  F+W V H ++LTN +R RR  +
Sbjct  55    KFSVKSAYNSFFDSAGV--SNPLWTHLWKLNCPPKLKTFMWYVLHQKILTNVQRVRRGFS  112

Query  1054  SNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQ  875
             +   C  C    E L HL R C     IW   L   +  +  +LDWN W+          
Sbjct  113   TIASCPICKNADETLLHLLRDCPRSQAIWNSILSPGSITNSFSLDWNGWICAQFHCHVVI  172

Query  874   GFEEGWPERFGTRLWWLWKWRNEAVFNRN-LLP-LEQKLDWLRRCDSETAAAFEERHWPL  701
                  W   F    W++WKWRN+ +F+   +LP    K+ W    D  ++A  +      
Sbjct  173   KNNIQWCNLFVFVCWFIWKWRNKVIFDPAFILPACPNKVIW-NYVDEWSSAQSKA-----  226

Query  700   QRHNRGGEERLSWEKPDEGWLKLNTDGS-CTSDGQASCGGVLRDTHGNWCRGYTYRIGRC  524
                +       SW KP E + KLN DGS   S G    GGVLRD  G W  G+   +G  
Sbjct  227   SMQSMFSYTMFSWCKPPENFYKLNIDGSRSFSSGCIGAGGVLRDHLGIWIDGFQVNLGTG  286

Query  523   TSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAE  344
                 AEAWG+  GLRM   +    + IE DS +LV+ +   +TG     +++  C     
Sbjct  287   EVLDAEAWGLFFGLRMVAMHNIVNLEIESDSALLVQLMLKSDTGVHPFGSLLDSCSVMMS  346

Query  343   NFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDRLGASSPRR  170
               L V   HI+RE N +AD LAK ++    GL  F+V P    ++  LD L   +  R
Sbjct  347   KLLNVNIKHIFRECNMVADALAKNSINHDLGLISFDVVPAH-AIQAVLDDLAGVTRAR  403



>ref|XP_010693052.1| PREDICTED: uncharacterized protein LOC104906048 [Beta vulgaris 
subsp. vulgaris]
Length=1259

 Score =   199 bits (505),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 172/606 (28%), Positives = 260/606 (43%), Gaps = 37/606 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+DRI  +L+GWK K LS AG+  L KSV+ AIP Y M    LP  +  +I     RF W
Sbjct  676   LMDRIWKKLQGWKEKLLSRAGKEILLKSVIQAIPTYLMGVYKLPCSIIQKIHSAMARFWW  735

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +   + K+   +WD + T K  GG+G R+L   N A + +  WRL  EP++L A+ +
Sbjct  736   GSSDT--HRKIHWKSWDSLCTLKCFGGMGFRDLRVFNDALLGRQAWRLVREPHSLLARVM  793

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL---T  1442
               KY + +   L      S S  W  I + +  L+ G+   + NG + R W D WL    
Sbjct  794   KAKY-YSNFDFLDAPLGVSTSYTWSSIWSSKALLKEGMVWRIGNGTNVRIWEDPWLLDEL  852

Query  1441  AKPLYEKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENTP  1265
              + +  +  G L +      V+E  D  R  WK   I+      +++ + S+ L+     
Sbjct  853   GRFITSEKHGDLTM------VSELIDFDRMEWKVSLIEALFNDRDIKCILSIPLSSIPMK  906

Query  1264  DGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLT  1085
             D   W+      +SVK+AY            K W  IW + V  ++  F+W     R+ T
Sbjct  907   DELTWAFTNDAHYSVKTAYMLGKGGNLDLFHKAWVDIWKMEVSPKVKHFLW-----RLCT  961

Query  1084  NYERTR-----RHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
             N    R     RH+   + C    G+ E   H    C  +  +W  S      E  R L 
Sbjct  962   NTLPVRSLLKHRHMLDADECPRGCGEPETQSHAIFGCPFLRDLWVDS----GCERFRTLI  1017

Query  919   WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDS  740
               + L   L     QG +EG   +     W LW  RN  VFN    P    L  + R   
Sbjct  1018  SATSLFEGLAN--SQGMDEGVRTKGAFLAWVLWSERNALVFNAVTTPPPILLARVARLVE  1075

Query  739   ETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGN  560
             E  +     + P  R++        W  P    +KLN D S  + G      V RD+ G 
Sbjct  1076  EHGSYTARIYSP--RNSLAPSSPRVWAAPPTEVIKLNVDASLATAGWVGLSVVARDSQGT  1133

Query  559   WCRGYTYRI-GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQ  383
                    RI    T+ +AEA  +   LR+ + YG + IM+E D +++V  L  +      
Sbjct  1134  VLFAAVRRIRSHWTAEIAEAKAIEMALRLGRRYGLQAIMVESDCQVVVNRLSKQALYLAD  1193

Query  382   NNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFE--VPPGEFEVR  209
              + I+   +    +F +VV+ H+ R+ N +A  LA   LT  G   ++E   PP E    
Sbjct  1194  LDIILHNVLSACVSFSSVVWSHVKRDANAVAHHLA--MLTPFGVEQVWENHYPP-EVAPY  1250

Query  208   MALDRL  191
             + +D L
Sbjct  1251  ILMDNL  1256



>ref|XP_010673997.1| PREDICTED: uncharacterized protein LOC104890275 [Beta vulgaris 
subsp. vulgaris]
Length=1098

 Score =   197 bits (502),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 159/565 (28%), Positives = 254/565 (45%), Gaps = 53/565 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++ + +++L  WKA  LS AGR  L +S L A   Y MQ+  LPK +   +++  R F W
Sbjct  533   VVSKTTSQLPKWKANALSQAGRSVLLQSNLAAKASYQMQSFLLPKSILVNLDRTYRNFFW  592

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
              +  ++ N   +L+ WD I   K+ GGLG R     N+A  MKL WR+    N LW K L
Sbjct  593   NK--ETTNKSPNLIGWDRICKPKSAGGLGFRKAEANNQALQMKLLWRIVKNDNNLWVK-L  649

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL---T  1442
               K + ++ S       +S S  W+ + + R+  + GL   + NGKS  FWMD+W+   +
Sbjct  650   VRKRYIKNKSIFSIKASKSASWQWRNLLSLRDIFKKGLRWQIGNGKSINFWMDNWVFQYS  709

Query  1441  AKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
              K +   + GT  L     TVN        W  + +   +P   + ++ S+ +  E+ PD
Sbjct  710   LKSIISPIPGTENL-----TVNRCIMPSGQWDSQMLLSLVPPHIVLQICSIYIPSESQPD  764

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKV-WGLIWSLRVPARISMFIWLVKHGRVLT  1085
                W     G +SVKS    A        +KV +  IW L +P +I  F+W   +  + T
Sbjct  765   NLIWGLTADGEYSVKSGALLAQGMLPSSLEKVEFNWIWKLNIPPKIKNFLWKACNDGIPT  824

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH---SLQRRTEES-MRNLDW  917
                  + HI   + C  C    E + H+   C     I+ H   S    +  S + N+D 
Sbjct  825   KLRLEKSHIFLPQQCVFCNNAGESIGHICFACPFTLDIFSHLKASFDWPSPPSCLANIDL  884

Query  916   NSW-------LTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQ----  770
              S+       L+++ K +    F   W        W++W +RN+ VFN  ++   +    
Sbjct  885   TSFRSVLEACLSLSSKSEISL-FSFVW--------WFVWFFRNKLVFNDEVVSSRKASFI  935

Query  769   ----KLDWLRRCDSE------TAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDG  620
                    W +  +SE        AA  +R  P     R G   + W  P  G+ KLN DG
Sbjct  936   ISNFATSWSKALNSEEMGSKPILAANTKRDKP-----RTGPGSV-WSPPAPGFCKLNFDG  989

Query  619   SCTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMI  443
             S  ++G A+ G V+RD+ G+        +G   S + AEAWG+ +GL  A       + I
Sbjct  990   SKLNNGNAALGFVIRDSSGDALMAGARSLGSNISILQAEAWGLKEGLSAALSLNISNLEI  1049

Query  442   ECDSKMLVEALKGKETGQEQNNNIV  368
             E D+  ++ A++       + NNI+
Sbjct  1050  EGDNLAVINAVRNIWKVPWEINNII  1074



>gb|AAD22368.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=321

 Score =   186 bits (473),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 161/325 (50%), Gaps = 9/325 (3%)
 Frame = -1

Query  1138  PARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS  959
             P R+ +F+WLV    ++TN ER RRH++    C  C G  E + H+ R C  +  IW   
Sbjct  3     PERVRVFLWLVVQQVIITNVERYRRHLSDTRVCQICQGGEETILHVLRDCPAMAGIWSRL  62

Query  958   LQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLP  779
             + R             W+  NL   R++G    WP  F   +WW WKWR   +F  N   
Sbjct  63    VPRDQIRQFFTASLLEWIYKNL---RERG---SWPTVFVMAVWWGWKWRCGNIFGGNG-K  115

Query  778   LEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-G  602
                ++ +++    E A A         R +R  E  +SW  P++GW+KLNTDG+   + G
Sbjct  116   CRDRVKFIKDLAEEVAIANAFVKGNEVRVSRV-ERLVSWVSPEDGWVKLNTDGASRGNPG  174

Query  601   QASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKML  422
              A+ GGVLRD +G W  G+   IG C++ +AE WGV  GL +A   GARR+ +E DSKM+
Sbjct  175   FATAGGVLRDHNGAWIGGFAVNIGVCSAPLAELWGVYYGLFIAWGRGARRVELEVDSKMV  234

Query  421   VEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHI  242
             V  L          + ++R C         V   H+YRE N+LAD LA +A +   GLH+
Sbjct  235   VGFLTTGIADSHPLSFLLRLCYDFLSKGWIVRISHVYREANRLADGLANYAFSLSLGLHL  294

Query  241   FEVPPGEFEVRMALDRLGASSPRRV  167
              E  P      +  D  G S PR V
Sbjct  295   LESRPDVVSSILLDDVAGVSYPRHV  319



>ref|XP_010684763.1| PREDICTED: uncharacterized protein LOC104899296 [Beta vulgaris 
subsp. vulgaris]
Length=1107

 Score =   197 bits (501),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 156/552 (28%), Positives = 249/552 (45%), Gaps = 53/552 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++ + +++L  WKA  LS AGR  L +S L A   Y MQ+  LPK +   +++  R F W
Sbjct  533   VVSKTTSQLPKWKANALSQAGRSVLLQSNLAAKASYQMQSFLLPKSILVNLDRTYRNFFW  592

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
              +  ++ N   +L+ WD I   K+ GGLG R     N+A  MKL WR+    N LW K L
Sbjct  593   NK--ETTNKSPNLIGWDRICKPKSAGGLGFRKAEANNQALQMKLLWRIVKNDNNLWVK-L  649

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL---T  1442
               K + ++ S       +S S  W+ + + R+  + GL   + NGKS  FWMD+W+   +
Sbjct  650   VRKRYIKNKSIFSIKASKSASWQWRNLLSLRDIFKKGLRWQIGNGKSINFWMDNWVFQYS  709

Query  1441  AKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
              K +   + GT  L     TVN        W  + +   +P   + ++ S+ +  E+ PD
Sbjct  710   LKSIISPIPGTENL-----TVNRCIMPSGQWDSQMLLSLVPPHIVLQICSIYIPSESQPD  764

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKV-WGLIWSLRVPARISMFIWLVKHGRVLT  1085
                W     G +SVKS    A        +KV +  IW L +P +I  F+W   +  + T
Sbjct  765   NLIWGLTADGEYSVKSGALLAQGMLPSSLEKVEFNWIWKLNIPPKIKNFLWKACNDGIPT  824

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH---SLQRRTEES-MRNLDW  917
                  + HI   + C  C    E + H+   C     I+ H   S    +  S + N+D 
Sbjct  825   KLRLEKSHIFLPQQCVFCNNAGESIGHICFACPFTLDIFSHLKASFDWPSPPSCLANIDL  884

Query  916   NSW-------LTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQ----  770
              S+       L+++ K +    F   W        W++W +RN+ VFN  ++   +    
Sbjct  885   TSFRSVLEACLSLSSKSEISL-FSFVW--------WFVWFFRNKLVFNDEVVSSRKASFI  935

Query  769   ----KLDWLRRCDSE------TAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDG  620
                    W +  +SE        AA  +R  P     R G   + W  P  G+ KLN DG
Sbjct  936   ISNFATSWSKALNSEEMGSKPILAANTKRDKP-----RTGPGSV-WSPPAPGFCKLNFDG  989

Query  619   SCTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMI  443
             S  ++G A+ G V+RD+ G+        +G   S + AEAWG+ +GL  A       + I
Sbjct  990   SKLNNGNAALGFVIRDSSGDALMAGARSLGSNISILQAEAWGLKEGLSAALSLNISNLEI  1049

Query  442   ECDSKMLVEALK  407
             E D+  ++ A++
Sbjct  1050  EGDNLAVINAVR  1061



>ref|XP_010689711.1| PREDICTED: uncharacterized protein LOC104903385 [Beta vulgaris 
subsp. vulgaris]
Length=1533

 Score =   198 bits (503),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 153/580 (26%), Positives = 255/580 (44%), Gaps = 39/580 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             LLDR+  +L GWK K LS AG+  L K+V+ A+P Y M    +P  V  EI     RF W
Sbjct  949   LLDRMWKKLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVYKIPATVIQEIHSAMARFWW  1008

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   +    KM  ++W+ +   K  GGLG ++L   N A + K  W L    N+L ++ +
Sbjct  1009  G-GGKGEERKMHWLSWEKLCKPKCMGGLGFKDLRVFNDALLGKQVWCLLHYKNSLLSRVM  1067

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL-TAK  1436
             + KY+   G         S S +W+ I + +  ++ G+   V +GK    W + W+    
Sbjct  1068  SAKYYPH-GDIFQAHLGHSNSYSWRSIWSAKSLVKEGMIWRVGDGKLIDLWSEPWVGDVD  1126

Query  1435  PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
               + +     GL  +   ++   D    W+ + I+ +    +   + ++ L+     D  
Sbjct  1127  GRFIRSSRVAGLEVVGDLID---DDSMEWRTDMIETHFDERDQRCILAIPLSSRRISDKL  1183

Query  1255  GWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYE  1076
              W+    G +SVK+AY        ++  +VWGLIWSL V  ++  F+W V    +     
Sbjct  1184  TWAYSKDGLYSVKTAYMLGKGGNLEDFHRVWGLIWSLEVSPKVRHFLWRVCTNSLPVRAA  1243

Query  1075  RTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW-----RHSLQRRTEESMRNL--DW  917
               RRH+T ++ C  CA   E   H+F  C    ++W     +   +    E M +L   W
Sbjct  1244  LKRRHLTDDDSCPRCACGEESAQHVFFDCTHASQLWDLVGCKEMTRHDVGEEMVDLIIRW  1303

Query  916   NSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSE  737
             N               ++   ++    +W LW  +N+ VF     P       + R    
Sbjct  1304  ND-------------LDKKLVQKGSYLMWNLWTEKNKIVFENCSHPPVVVAQRVGR----  1346

Query  736   TAAAFEERHWPLQRHNRGGEERLS-----WEKPDEGWLKLNTDGSCTSDGQASCGGVLRD  572
                  EE +  + R   GG++R+      W  P +G++KLN+D S   DG    G V RD
Sbjct  1347  ---QVEEFNEHITRIYGGGQQRVMASSSRWTTPPDGFVKLNSDASIGDDGWIGLGVVARD  1403

Query  571   THGNWCRGYTYRIGRC-TSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKET  395
             + G        R        VAE   V   +R+AK +G + ++IE DS+++   L     
Sbjct  1404  SQGKILFSAVRRTKAYWPPEVAECKAVHFAIRLAKSHGLQSVVIESDSQIVTTRLSRAAL  1463

Query  394   GQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
                  ++I+   +    +F +V F+H+ R+ N +A  LA+
Sbjct  1464  FYSDLDSILGDVLALCRSFNSVNFMHVKRDGNTVAHNLAR  1503



>ref|XP_008245529.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103343662 
[Prunus mume]
Length=1725

 Score =   197 bits (502),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 159/550 (29%), Positives = 242/550 (44%), Gaps = 47/550 (9%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             D+I  +++GWK   LS AGR  L KSV  A+P Y M     P G C EI+     F WG+
Sbjct  794   DKILGKIQGWKHGLLSQAGREVLIKSVAQAVPSYPMSVFLFPNGFCQEIDSILANFWWGQ  853

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
              +QS  NK+  ++W  +   K  GG+G RNL   N A + K GWR+ TEP   WA+ L +
Sbjct  854   SQQS--NKIHWISWKDLGMPKNEGGMGFRNLKDFNVALLAKQGWRMVTEPQAFWAQLLKS  911

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             KY       L   +    S AW  +   R  + +G    V +G     W D W+     +
Sbjct  912   KYFPNC-DFLRAGKGAKSSWAWSSLLVGRNIIMNGARWQVLDGSRVHLWTDKWIPGCTEH  970

Query  1426  EKLRGTLGLPELYATVNEYWD-KVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGW  1250
                   L   +L A V    D   R W  E I         + + ++ L +    D   W
Sbjct  971   ALQPSHLSQVDLEAKVETIIDCHSREWNLEAIGGMFSPNAAKIIKAMPLGDGWEKDRLIW  1030

Query  1249  SPDPRGCFSVKSAYGWA-----DNAARQEADKV-----WGLIWSLRVPARISMFIWLVKH  1100
               +  G ++VKS Y        D + R  + ++     W LIW  ++  ++  F W +  
Sbjct  1031  PLNQTGSYTVKSGYNMIHMAHLDTSVRPSSSRILDKALWKLIWGSQMVPKLMNFWWRLVR  1090

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW-----RHSLQRRTEES  935
             G + T     RRH+ ++  C  C    E ++HLF  C+ V  +W      + + R++  S
Sbjct  1091  GCLPTRDALFRRHLGTSPLCPICGEFPESVEHLFLLCNWVRPVWFGGPLNYRINRQSITS  1150

Query  934   MRNLDWNSWLTMNLKGDRQQGFEEGW-PERFGTRLWWLWKWRNEAVFN------RNLLPL  776
             M +     WL   LK  +  G++  W   +     W +WK R  A+F+      RN L +
Sbjct  1151  MSD-----WLMQILKFSQGLGYDRKWLISQIFYSCWSIWKSRCSAIFDDISVCPRNTLLV  1205

Query  775   EQKL--DW-LRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDG---SC  614
              +KL  D+ L  C    A         L+     G   + W  P     K+N D    SC
Sbjct  1206  AKKLMNDFNLVGCPHGDAI--------LEEDIDDGHRVVRWSPPPTSVYKINIDASWVSC  1257

Query  613   TSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECD  434
             T   QA  G V+R++ G +  G        ++  AEA   L+G+++A E G   ++ E D
Sbjct  1258  TL--QAGLGVVVRNSAGIFMGGCCGPRLASSAIEAEAHAALKGVKLAVERGFPNVVFESD  1315

Query  433   SKMLVEALKG  404
             SK LV+++KG
Sbjct  1316  SKELVQSVKG  1325



>ref|XP_006469101.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=684

 Score =   193 bits (490),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 123/426 (29%), Positives = 191/426 (45%), Gaps = 7/426 (2%)
 Frame = -1

Query  1678  ACMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGL  1499
             A +MKL W++ +  + LW K + +KY        ++   +  +  W+ I         G 
Sbjct  208   ALLMKLSWQVVSNSDKLWVKVVCSKYGLDHRHLPLSLPDKQGTRIWRAIRNTWSATMMGA  267

Query  1498  THVVRNGKSTRFWMDSWLTAK-PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYL  1322
                V +G  TRFW+D W T + PL       +    + ATV+E+ +    W W   +   
Sbjct  268   RWAVCDGTRTRFWLDCWATKQGPLINLAIHPVPQELVKATVSEFINVHGDWNWSAFEHLF  327

Query  1321  PTEELERLASLCLTEENT-PDGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSL  1145
             P   L ++AS+         D   W  +PRG F+V+SAY         +    W L W+ 
Sbjct  328   PNSVLLQIASVMPPNHLLGVDKLFWRYEPRGNFTVRSAYEALCQLDSNDTGTAWKLAWTW  387

Query  1144  RVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR  965
             + P  + +F+W   H ++ T  E +RRHI  +  C  C    ED+ H+ R C  + R+W 
Sbjct  388   KGPQAVRIFLWQALHAKLKTKEELSRRHIPISIGCERCGAPIEDVIHVLRDCQCIMRVWL  447

Query  964   HSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNL  785
               +  R   S        W+T NL+   +      W   FG  +W LW WRN  + +  L
Sbjct  448   RLVPARNHLSFFQSTLRDWITANLQNKWKIASPSTWECIFGVAIWRLWFWRNHFMVDGKL  507

Query  784   LPLEQ-KLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTS  608
                    LD   R +          H  + +  R  E  + W  P   W KLNTDGSC  
Sbjct  508   TDSSTIYLDITARANE--IHKLNNSH--ISQQPRRKEIFIGWIPPPWPWCKLNTDGSCRK  563

Query  607   DGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSK  428
                A  GG+LRD+ G+W  G+   IG  +  +AE WG+ QGLR+A + G + +++E DS 
Sbjct  564   SEGAGAGGILRDSVGHWISGFCLNIGESSVLMAELWGLYQGLRIAWDTGIKCLLVEVDSL  623

Query  427   MLVEAL  410
              + + +
Sbjct  624   CVTQMI  629



>ref|XP_008367475.1| PREDICTED: uncharacterized protein LOC103431103 [Malus domestica]
Length=1108

 Score =   196 bits (497),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 139/452 (31%), Positives = 203/452 (45%), Gaps = 26/452 (6%)
 Frame = -1

Query  1855  TAALPKGVCSEIEKRTRRFIWGRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRA  1676
             T  LP   C  I+   R+F+WG  E    +K  LV W  +   K +GGLGL+ +  MN  
Sbjct  664   TTKLPISTCDLIDGLNRKFLWGSXEV--KSKTCLVRWSSVCLQKNKGGLGLKRMKYMNAX  721

Query  1675  CMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHLVT-TRRRSISNAWKGISAERETLESGL  1499
              + K  WRL    + LWA T   KY     S ++     R  S++W+ +    + LE+GL
Sbjct  722   LLAKSSWRLLQRDDDLWASTFRGKYLSGVNSDILKWPTGRVASSSWRAVVYGGQLLENGL  781

Query  1498  THVVRNGKSTRFWMDSWLTAKPLYEKLRGTLGLPELYATVNEYWDKVRG--WKWEKIQRY  1325
                V +G +  FW D+WL    L  K    L   ++ A   +  D   G  W    ++  
Sbjct  782   IWRVGSGANISFWFDAWLDDGILTNKALIPL---DVSAKAVKVIDFCYGNCWNVSALRAV  838

Query  1324  LPTEELERLASLCL-TEENTPDGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWS  1148
             LP E + +++++ +   +   D   W     G FSVKSAY  A        D  W  IW 
Sbjct  839   LPEEYVWKISAIPIGLNDGDSDCIIWKHSNDGNFSVKSAY-LASIDDEDFVDWSWSDIWK  897

Query  1147  LRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW  968
             L++P R+  F+WL  HGR+L N +R +R IT N YC  C G  E +DH+ RRC     +W
Sbjct  898   LKLPPRVLHFLWLTLHGRLLCNEQRAKRXITDNSYCDFCDGCVESIDHILRRCDRAKLVW  957

Query  967   RHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRN  788
                       S   +D++  + +NL   R       W   F    WWL K RN ++F  +
Sbjct  958   NQLGMHSIVLSSVGIDFHXXMRVNLFSRRLLCQNLXWWGVFAFACWWLXKLRNLSIFASD  1017

Query  787   LLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEER-----LSWEKPDEGWLKLNTD  623
              +   Q    + +   E         W  +  N G +       L+W+ P   ++KLN D
Sbjct  1018  FIFPSQPYILIFKAAKE---------W-FEVQNFGAKPVKSRIFLAWDPPSPNYVKLNVD  1067

Query  622   GSCTS-DGQASCGGVLRDTHGNWCRGYTYRIG  530
             GS  S  G +S GG+LR     W  G+T  IG
Sbjct  1068  GSRKSGKGCSSAGGILRAAACVWIAGFTINIG  1099



>ref|XP_008345114.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1067

 Score =   196 bits (497),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 168/592 (28%), Positives = 256/592 (43%), Gaps = 33/592 (6%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW-G  1790
             +RI +R+ GW  + LS AG+  L K V  A+P + M    LP GVC +IEK  R + W G
Sbjct  270   ERIESRMTGWAEQFLSPAGKEILIKXVATAMPNHAMSCFKLPIGVCRDIEKAIRXYWWRG  329

Query  1789  RDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
              + + G +  S   WD +   K  GGLG ++    N A + K+GWRL   P++L A  + 
Sbjct  330   SEXRRGVHXTS---WDRLIQKKCLGGLGFKDFQCFNLAFLGKIGWRLIIFPDSLLASVMR  386

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
              KY+        T  R S S  WKGI   R+ LE GL   V +G++ +   D W      
Sbjct  387   DKYYPEKSFREATIGRGS-SWGWKGILEARKVLEKGLIWRVGDGETIKIREDPWFPMXST  445

Query  1429  YEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGW  1250
             + ++R  + L  LY + +    + + WK + I     +EE   + S+ ++   + D  GW
Sbjct  446   F-RIRPAVNLGALYVS-BLINQESKTWKADLISACFSSEEANTILSIPISXFGSCDRMGW  503

Query  1249  SPDPRGCFSVKSAYGWA---------------DNAARQEADKVWGLIWSLRVPARISMFI  1115
                  G +SVKS YG A                 + + + +K+W  IW L VP ++  FI
Sbjct  504   FHXXNGXYSVKSGYGIALELMXSGGLGKKGRGAPSXKTKYNKIWNAIWRLDVPRKMRFFI  563

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEES  935
                 +  +       RRH+  +  C  C    E  +H+F RC         S  +     
Sbjct  564   XKCXNHALAVRRNLKRRHMRVDNICGVCGXVDETENHIFFRCETSHLFXFCSPLQINSFD  623

Query  934   MRNLDW-NSWLTM-NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
             +   D+  SW+   N   D     E      FG  LW LWK RN+A+F+ + LP  + L+
Sbjct  624   LEGADFLQSWVNFCNRVADLANTNELLQEFVFG--LWRLWKNRNDAIFSGSFLPPTEILE  681

Query  760   WLRRCDSETAAAFEE----RHWPLQRHNRGGEER-LSWEKPDEGWLKLNTDGS-CTSDGQ  599
               +R   E  AA E        P    + G   R + W KP  G +K+NTD + C    +
Sbjct  682   VWKRNVXEYRAANERVDSGSKVPASNGDLGVVRRQVGWMKPCFGMIKVNTDAAWCKESQK  741

Query  598   ASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQG-LRMAKEYGARRIMIECDSKML  422
             A  G V RD  G   R       R  S  A     ++G L      G   + IE D++ +
Sbjct  742   AGLGWVARDFXGVLQRAGGTGASRFHSAAAAEAAXIRGALDFCLLQGFVNVFIESDARDI  801

Query  421   VEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
             +  ++ + T   +   ++      A     V F+   RE N  A  +AK+  
Sbjct  802   ILMIRKELTQDFRIGCLLGDIETLARRMQVVSFVFAPRESNXAAHSVAKFVF  853



>emb|CAH66131.1| OSIGBa0135L04.5 [Oryza sativa Indica Group]
Length=611

 Score =   192 bits (487),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 159/593 (27%), Positives = 255/593 (43%), Gaps = 49/593 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L ++I  R+  W    LS  G+  + K+V+ AIP+Y M    LP  VC ++ K +R F W
Sbjct  9     LQEKIWKRIIMWGENFLSSGGKEIMLKAVIQAIPVYVMGLFKLPDSVCEDLNKISRSFWW  68

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G D   G  K    +WD +   K  GGLG R+    N+A + +  WRL   P +L A+ L
Sbjct  69    GADR--GKRKTYWRSWDKLVKPKQNGGLGFRDFRLFNQALLARQAWRLIDRPKSLCARVL  126

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----  1445
               KY+  SGS + T    + S  W+ I    E L+ G+   V NG S R W D WL    
Sbjct  127   RAKYYP-SGSLIDTAFGGNASPGWRAIEYGLELLKKGIIWRVGNGHSIRIWRDPWLPRNH  185

Query  1444  TAKPLYEKLRG---TLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEE  1274
             + +P+   +RG   T  + +L   V+  WD+      + ++R     + E + ++ L+  
Sbjct  186   SRRPI--TVRGNCRTKWVADLMG-VDGTWDE------QVVKRIFWPMDAELILTIRLSAR  236

Query  1273  NTPDGWGWSPDPRGCFSVKSAYGWA------DN---AARQEADKVWGLIWSLRVPARISM  1121
                D   W PD  G FSV+SAY  A      DN   ++  E  K W L+W   VP ++ +
Sbjct  237   AEEDFLAWHPDKWGVFSVRSAYKLALQLAAIDNGSGSSEAETSKAWNLVWKCNVPQKVKV  296

Query  1120  FIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW--RHSLQRR  947
             F W      + T   + +R + +   C  C  + ED+ H   RC    ++W       + 
Sbjct  297   FTWRAATNSLATMENKNKRKLEATGTCGICGVEAEDVAHALCRCPQAKKMWDAMQVAGKG  356

Query  946   TEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEA---VFNRNLLPL  776
              ++ + N     W+   LK           P         +   ++     V  R L   
Sbjct  357   AKDIVGNCTRADWILYQLK---------IMPREQHAMFLMITHGKSPPPVEVSKRFLESY  407

Query  775   EQKLDWLRRCDSETAAAFE-----ERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSC-  614
                L  +R+C S+     +      R   ++  +      L WEKP++GW+KLN DGS  
Sbjct  408   ISSLLEVRQCQSKNLIKGKHIVQYSRMPKIKDTSASTPVLLRWEKPNQGWMKLNVDGSFD  467

Query  613   TSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIEC  437
              S G+   G VLR++ G         + RC+  +  E     +G+ MA ++    I++E 
Sbjct  468   ASSGKGGIGAVLRNSQGEVIFSACGFLDRCSGPLEVELLACKEGINMALQWTLLPIVVEM  527

Query  436   DSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLA  278
             D    V+ +     G+ +   IV    +       ++   I+  QN  +  LA
Sbjct  528   DCSEAVKLISSVSKGRSEVAFIVNDIKQLMFGNREIIIRKIHHNQNGCSHILA  580



>ref|XP_007010390.1| Retrotransposon, unclassified-like protein [Theobroma cacao]
 gb|EOY19200.1| Retrotransposon, unclassified-like protein [Theobroma cacao]
Length=1368

 Score =   196 bits (498),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 172/627 (27%), Positives = 279/627 (44%), Gaps = 66/627 (11%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+++I  R+ GW+ K LS  GR+TL +SVL+++PIY +Q    P  V  +IE+    F+W
Sbjct  735   LINKIRERITGWENKILSPGGRITLLRSVLSSMPIYLLQVLKPPACVIQKIERLFNSFLW  794

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G    S   ++   AW  IT   + GGLG+R+L     A   KL WR  T   +LW + +
Sbjct  795   GSSMDS--TRIHWTAWHNITFPSSEGGLGIRSLKDSFDAFSAKLWWRFDT-CQSLWVRYM  851

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY      H +  +    S  WK + A R T    +   +  G    FW D+W+  +P
Sbjct  852   RLKYCTGQIHHNIAPKPHD-SATWKPLLAGRATASQQIRWRIGKG-DIFFWHDAWMGDEP  909

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             L           +    VN +++    W  +K++ ++P   +E +  + ++ E     + 
Sbjct  910   LVNSFP---SFSQSMMKVNYFFND-DAWDVDKLKTFIPNAIVEEILKIPISREKEDIAY-  964

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYER  1073
             W+    G FS+KSA  W     R++ + V  LIW   +P  +S F+W   H  +      
Sbjct  965   WALTANGDFSIKSA--WELLRQRKQVNLVGQLIWHKSIPLTVSFFLWRTLHNWLPVEVRM  1022

Query  1072  TRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH---SLQRRTEESMRNLD-WNSWL  905
               + I     C  C  + E L H+        ++W +     Q         L   NSW 
Sbjct  1023  KAKGIQLASKCLCCKSE-ESLLHVLWESPVAQQVWNYFSKFFQIYVHNPQNILQILNSWY  1081

Query  904   TMNLKGDRQQGFEEGWPERFGTRL-----WWLWKWRNEAVFNRNLLPLEQKLDW-----L  755
                  GD  +      P    T +     W++W  RN+A  +R+L     ++ W     L
Sbjct  1082  ---YSGDFTK------PGHIRTLILLFIFWFVWVERNDAK-HRDLGMYPDRIIWRIMKIL  1131

Query  754   RRC-------------DSETAAAFEERHWPLQ--RHNRGGEERLSWEKPDEGWLKLNTDG  620
             R+              D + A      HW     +  +   + ++W KP  G LKLN DG
Sbjct  1132  RKLFQGGLLCKWQWKGDLDIAI-----HWGFNFAQERQARPKIINWIKPLIGELKLNVDG  1186

Query  619   SCTSDGQ-ASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMI  443
             S   + Q A+ GGVLRD  GN   G++   G   S  AE   + +GL +  EY   R+ I
Sbjct  1187  SSKDEFQNAAGGGVLRDHTGNLIFGFSENFGYQNSLQAELLALHRGLCLCMEYNVSRVWI  1246

Query  442   ECDSKMLVEALKGKETGQEQNNNI---VRRCIKEAENFLAVVFLHIYREQNKLADKLAKW  272
             E D++++++ ++    G  +   +   +R+C++     ++V   HI+RE N+ AD L+K 
Sbjct  1247  EVDAQVVIQMIQNHHKGSYKIQYLLESIRKCLQ----VISVRISHIHREGNQAADFLSKH  1302

Query  271   ALTTQGGLHIFEVPPGEFEVRMALDRL  191
               T Q  LH+F    GE   R  ++R+
Sbjct  1303  GHTHQ-NLHVFTEAQGELRGRTLVNRV  1328



>emb|CCA65974.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1379

 Score =   196 bits (497),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 171/624 (27%), Positives = 271/624 (43%), Gaps = 67/624 (11%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +++++  +L  WK+K LS+ GR+TL KS L ++P+Y M    +PKGV  +I   TRRF+W
Sbjct  764   VIEKLCEKLAMWKSKMLSIGGRLTLIKSSLASLPLYFMSLFPIPKGVVEKINMITRRFLW  823

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                 +     +  V+W ++   K+RGGL + N+   N A + K  WR   EPN LW K +
Sbjct  824   SGCAE--KKTLPPVSWKVVQLPKSRGGLNIGNVMHKNLAMLFKWIWRFFQEPNNLWCKVI  881

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGI-------SAERETLESGLTHVVRNGKSTRFWMD  1454
              +KY++ +   + +         W  I        A +  ++ GL  ++ NG +T FW+D
Sbjct  882   KSKYNYAAPLTISSLTIPKSGGPWSKICTAILNDQAAKSVMKIGLRKIIGNGGNTLFWLD  941

Query  1453  SWLTAKP---LYEKLRGTLGLPELYATVNEYWDK---VRGWKWEKIQRYLPTEELERLAS  1292
              W+++ P   LY +L      P      + +W+    V  + W +  R  P +++E+   
Sbjct  942   PWISSHPLKILYPRLFSIAIHPNASVAAHGFWEGYFWVWSFSWRRNLR--PRDKIEKANM  999

Query  1291  LCLTEENTP-----DGWGWSPDPRGCFSVKSAYGWADN-AARQEADKVWGLIWSLRVPAR  1130
               L +   P     D   W+ D  G FS KS     D        D V G +W   VP R
Sbjct  1000  DALLKSVCPSLLCEDKLAWTHDKSGKFSTKSFNAELDKLLPHVHQDAVKG-VWRGLVPHR  1058

Query  1129  ISMFIWLVKHGRVLTNYERTRRHITSNE--YCYNCAGQREDLDHLFRRCHDVDRIWR---  965
             I +F+W    G++ T ++     I   E   C  C    E  DHL   C    RIW    
Sbjct  1059  IEIFVWSAMIGKINTRHKLATYGIIPVEDSSCPMCNSTPETSDHLLLHCLFAQRIWTWWL  1118

Query  964   --HSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNR  791
                S++     S+R + ++ W + N    +   F++ W   F   +W +WK RN+ +FN 
Sbjct  1119  DLWSIKWVFPMSLR-MAFDQWQSTN----KSPFFKKIWASIFFIVVWSVWKERNDRIFNN  1173

Query  790   NLLPLEQKLDW-LRRCD---SETAAAFEERHWPLQRH--------NR-----GGEERLSW  662
                 ++   D  L R     S  +  F      +QR+        NR           +W
Sbjct  1174  KNTSIKDIRDMVLLRLGWWISGWSEKFPYSPLDIQRNPSCLRWEENRCIVDCSPASVTTW  1233

Query  661   EKPDEGWLKLNTDGSCTSDGQASC---GGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVL  491
             + P    +K N D S   D + SC   G VLR+ HGN+   ++  I       AE   + 
Sbjct  1234  QAPGCSSIKWNVDASV--DPRTSCSAIGRVLRNQHGNFMCLFSSPIPPMEINCAEVLAIH  1291

Query  490   QGLRMAKEYGA---RRIMIECDSKMLVEALKGKETG---QEQNNNIVRRCIKEAENFLAV  329
             + + ++    +    +I++E DS   V    G+E G      + N +R        FL V
Sbjct  1292  RAISISLASDSIKDAKIILESDSANAVSWCNGEEGGPWNMSHHLNFIRNA---RNKFLDV  1348

Query  328   VFLHIYREQNKLADKLAKWALTTQ  257
                H  R  N +AD LAK  L  Q
Sbjct  1349  TISHKGRGSNMVADALAKQGLRRQ  1372



>ref|XP_008385035.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=992

 Score =   194 bits (494),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 158/584 (27%), Positives = 239/584 (41%), Gaps = 35/584 (6%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             R+  +L+GWK  TLS  GR  L K V  AIP Y M     P   C+E++    +  WG  
Sbjct  387   RLLDKLQGWKKSTLSQXGREILIKXVAQAIPAYPMNLFKFPVSFCNEMDALIAKXWWG--  444

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
                G N++  V+ + +   K   GLGLR+    N A + K  WRL  EPNTLWA  L  +
Sbjct  445   XXLGENRIHWVSXERLGRSKEEXGLGLRSFSIXNDALLAKQCWRLIXEPNTLWALVLKAR  504

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y     S L   +    S  W  + A RE L +G    + +G  TR W+D W+   PL  
Sbjct  505   YFPNC-SFLDAKKGGRASWVWASLLAXREILRAGAHWQIMDGNDTRVWVDRWIPPIPLGR  563

Query  1423  K-------LRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
                     +   L +  L   V+  WD       + ++ +L   E+E +  L   +    
Sbjct  564   PSPLGSVXVSKNLKVKSLICPVSGEWD------LDFLKPFLADSEVEXILDLHTGDPTLK  617

Query  1264  DGWGWSPDPRGCFSVKSAYGWADNAARQEADK----------VWGLIWSLRVPARISMFI  1115
             D   W  + RG +SVKS Y W+ N ++    +          +W  +W L+VP +I  F+
Sbjct  618   DRLVWPFEKRGSYSVKSGYYWSLNRSQVRCQQSIRLVSIPSTLWKTVWKLKVPPKIRTFM  677

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEES  935
             W   H  + T      R  + +  C  C    E ++HLF  C  V+ +W           
Sbjct  678   WKTLHAALATMKNLYIRRSSPSPTCXLCNSFDESIEHLFLFCPXVEVVWFGGRLNLRPNR  737

Query  934   MRNLDWNSWLTMNLKGDRQQGFEEGWPER---FGTRLWWLWKWRNEAVFNRNLL-PLEQK  767
              +   W SWL     G+ + G  E   +R        W  WK R E  FN  ++ P    
Sbjct  738   QQVSSWASWLVQ--MGEAENGSAEVRIDRISYIAFTCWHXWKSRCEFQFNNQVIYPSRVV  795

Query  766   LDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTS-DGQASC  590
                 R         F      L   +  G   + W  PD G +K+N   S  +  G    
Sbjct  796   AXVXRSVXDYQGTIFRXSSRSLLNQSSLGAG-VQWSPPDHGVIKINVXASWEAKSGVGFT  854

Query  589   GGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEAL  410
             G V RD  G +     ++I    + +AEA  ++ G  +    G   I +E DS   +  L
Sbjct  855   GVVARDEQGCFLAASRHKIKATGAXMAEALAIMHGCNLGVSNGWNSICVESDSYDAISCL  914

Query  409   KGK-ETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKL  281
             +   + G      ++R+C++    F A  +  + R  N +AD L
Sbjct  915   RDPAKKGNWDAFPVLRKCLRLGRAFQACRWSWVPRLANSVADCL  958



>ref|XP_004289445.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=719

 Score =   192 bits (487),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 122/399 (31%), Positives = 182/399 (46%), Gaps = 45/399 (11%)
 Frame = -1

Query  1948  LEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSGN  1769
             L GW +KTLS+AGR+TL +SV  +IPIY MQTA LP  +C  I+K    F+WG   +   
Sbjct  327   LSGWSSKTLSMAGRLTLVQSVTASIPIYAMQTAKLPLSLCESIDKANINFLWGDSNE--K  384

Query  1768  NKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHRS  1589
              K+ LV W+ +   K RGGLGL+    MN+A + K  WR+    + LWA     KY    
Sbjct  385   KKIHLVNWESVCKPKHRGGLGLKKTADMNQAMLAKASWRIFQNDHGLWADIYRKKYLQDC  444

Query  1588  GSHLVTTRRRS-ISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRG  1412
                   +   +  SN W+GI    E +   L   + +G   +FW                
Sbjct  445   CIESSNSIAPADCSNTWRGIVHGVELMRRNLKWRIGDGAKIKFW----------------  488

Query  1411  TLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG-------  1253
                     AT+ E+W     W    ++  LP   + ++ S+       P G+G       
Sbjct  489   -------NATIKEFWCDT-SWNISLLKSVLPDHVVMQIISV-------PSGFGVSGHDKL  533

Query  1252  -WSPDPRGCFSVKSAY-GWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
              W+    G FSVKS Y  + D+A    ++ +W  +W L  P ++  F+W V H ++LTN 
Sbjct  534   IWNATANGKFSVKSTYNSFFDSAG--VSNPLWTHLWKLNCPPKLKTFMWSVLHQKILTNV  591

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTM  899
             +R RR  ++   C  C    E L HL R C     IW   L+  +  +  +LDWN W++ 
Sbjct  592   QRVRRGFSTIASCPICKNADETLLHLLRDCPRSQAIWNSILRPGSITNSFSLDWNGWISA  651

Query  898   NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLL  782
                          W   F    W++WKWRN+ +F+   +
Sbjct  652   QFHCHVVIKNNIQWCNLFVFVCWFIWKWRNKVIFDPAFI  690



>ref|XP_009107610.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=836

 Score =   192 bits (488),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 172/587 (29%), Positives = 257/587 (44%), Gaps = 44/587 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D+I  R   W  K LS AG+  + +SVL A+P ++M +  +P  +C  I+    RF W
Sbjct  270   VVDKIRQRAHSWTTKFLSGAGKHVMLQSVLTALPTFSMSSFKIPISLCRRIQSILTRFWW  329

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D      K+S VAW I+   K RGGLG +N+   N + + KL WR+ + PN+L ++ L
Sbjct  330   --DSAPDKRKISWVAWSIMAQPKCRGGLGFKNIEEYNDSLLGKLSWRILSNPNSLLSRIL  387

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTA-K  1436
               KY       + +  +   S+ W GI A +  LE GL  +V  GK+ R W D WL+  +
Sbjct  388   KGKYFPDC-DFMESRDKTGSSHGWTGIMAGKAVLEKGLGFLVGEGKNIRVWSDQWLSPLR  446

Query  1435  PLYEKLRGTLGLPELYATVNEYWD-KVRGWKWEKIQRYLPTEELERLASLCLTEENTP-D  1262
             PL      TL   +L   V +  D +   W   KI+ +LP  + E L  L +   + P D
Sbjct  447   PLAPIGPPTLANKDLL--VADLLDHQTNEWDLAKIRLHLP--QYEDLIRLIIPGNSKPMD  502

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLI---WSLRVPARISMFIWLVKHGRV  1091
                W PDP G +S KS Y            + +  I   W LR   +I  F+W + +  +
Sbjct  503   KLVWLPDPSGVYSTKSGYKKICEVEEPPPPEAFDWIKNVWKLRTSPKIQHFLWRMLNNAL  562

Query  1090  LTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW-RHSLQRRTEESMRNLDWN  914
                     R I +   C  C G +E ++HLF  C      W +  L      +   +   
Sbjct  563   PVGSLLAIRGIQTELSCKRC-GAQESIEHLFTNCPFAAEFWTKAPLMSTPGITTEMVSLK  621

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSET  734
             +WL++N                    LW LWK RN  VF    + +E         D  T
Sbjct  622   NWLSINASMRALPPVGVADTVLVPWLLWNLWKARNGLVFEGKSVQVE---------DIIT  672

Query  733   AAAFEERHW-PLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDG----QASCGG---VL  578
              A  E R W          E++    +P        T   C +DG     +  GG   ++
Sbjct  673   KAVAEARAWEAANVLTSTKEKKTPSSRPPL------TGPVCWTDGAWREPSKLGGMGWII  726

Query  577   RDTHGN-WCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEAL-KG  404
             +   G   CRG + R    ++ +AEA  V + LR AKE   + + I  DS++LV AL +G
Sbjct  727   KSREGEVICRGSSNRTHVGSALMAEALAVREALRKAKELNLQSLQIFSDSQVLVSALCQG  786

Query  403   KETGQEQNNNIVRRCIKE-AENFLAVVFLHIYREQNKLADKLAKWAL  266
              +  +      V++ IK  A  F  + F  I R +N  AD LAK  L
Sbjct  787   LDLNEIAG---VQQDIKSLATLFCPLSFSVISRLENSQADSLAKSGL  830



>ref|XP_009115103.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/313 (36%), Positives = 157/313 (50%), Gaps = 12/313 (4%)
 Frame = -1

Query  1090  LTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNS  911
             +TN ER RRH++  + C  C G  E + H+ R C  +  IW   +  R  ++  ++    
Sbjct  1     MTNAERFRRHLSGTDVCQICKGGIETILHVLRDCPAMSGIWDRLVPTRKRQAFFSMSLFE  60

Query  910   WLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETA  731
             W  +NL  D Q+G    W   F   +WW WKWR   VF  N L  + ++ +LR   +E  
Sbjct  61    WFYLNLS-DTQEGSGVPWATTFSLAVWWGWKWRCGNVFGDNRL-WKDRVKFLRNLATEVM  118

Query  730   AA--FEERHWPLQRHNRGG--EERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTH  566
             AA   E R W     +RGG  E  + W  P  GW+KLNTDG+   + G A+ GGVLR+  
Sbjct  119   AAKDAESRKW-----DRGGRTEIMIGWTPPRVGWMKLNTDGASHGNPGLATAGGVLRNGD  173

Query  565   GNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQE  386
             G WC G+   IGRC++ +AE WGV  GL +A E G  R+ +E DSKM+VE L        
Sbjct  174   GEWCGGFVLNIGRCSAPLAELWGVYYGLVIAWEKGISRLEVEVDSKMVVEFLTMGIGETH  233

Query  385   QNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRM  206
               + +VR C         V  LH+YRE N LAD L   A +   G H  +  P +    +
Sbjct  234   PLSFLVRLCHGFLTRDWLVRILHVYREANHLADGLTHLAFSFPFGFHRLDTAPLDVVSLL  293

Query  205   ALDRLGASSPRRV  167
               D  G   PR+V
Sbjct  294   REDVDGPLRPRQV  306



>gb|EEC83100.1| hypothetical protein OsI_28249 [Oryza sativa Indica Group]
Length=1300

 Score =   195 bits (495),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 154/552 (28%), Positives = 238/552 (43%), Gaps = 48/552 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +R+  R+  W    LS  G+  L KSV+ A+P+Y M    LP  VC ++ K  R F W
Sbjct  690   LHERVWKRIIQWGENFLSSGGKEVLIKSVMQALPVYVMGIFKLPDSVCEDLSKAVRNFWW  749

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +  G  +    AWD +T  K  GG+G R+    N+A + +  WR+   P +L A+ L
Sbjct  750   GAGD--GKRRTHWRAWDSLTKPKQCGGMGFRDFRLFNQALLARQSWRILEFPESLCARVL  807

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----  1445
               KY   +GS + T+   + S  W+GI    E L+ G+   V NG++ R W D W+    
Sbjct  808   KAKYFP-NGSLIDTSFSGNASPGWRGIEYGLELLKQGIIWRVGNGRTIRIWRDPWIPRDF  866

Query  1444  TAKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
             + +P+  K  GT         V+E  D+   W   KIQ+     ++E++ S+  +  +  
Sbjct  867   SRRPITHK--GT----SRVKWVSELLDQNGEWDSHKIQQIFLPIDVEKILSIHTSRFHEN  920

Query  1264  DGWGWSPDPRGCFSVKSAYGWA---------DNAARQEADKVWGLIWSLRVPARISMFIW  1112
             D   W  D  G FSV+SAY  A          +++ QE  K W  +WS  VP ++ +FIW
Sbjct  921   DFVAWHSDKLGRFSVRSAYHLALSLSNVVASSSSSGQELSKAWNQLWSCHVPQKVRIFIW  980

Query  1111  LVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESM  932
                   + T   + ++ +     C  C  + ED+ H   RC     +W   + RR +   
Sbjct  981   RAASNSLATMVNKKKKRLEHCSMCSICGTEEEDVAHALCRCPHAKYLWE--VMRRAKAIT  1038

Query  931   RNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLR  752
                D N W   +   D  +   +         LW +W  RNE    +  +P E      R
Sbjct  1039  VQADRN-WTGADWIFDISERISKEERPTLLMMLWRIWYVRNEITHGKAAVPAEVS---QR  1094

Query  751   RCDSETAAAFEERHWP------------------LQRHNRGGEERLSWEKPDEGWLKLNT  626
                S   +  E R +P                     H R     + W +P  GW+KLN 
Sbjct  1095  FISSYITSLLEIRQFPDANLCKGKHVIRCAAAGAQVNHPRVNSVPVRWVRPQAGWMKLNV  1154

Query  625   DGSCTS-DGQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARR  452
             DGS    DG    G VLR++ G         + R  S + AE     +G+ +A ++    
Sbjct  1155  DGSYDPRDGSGGIGAVLRNSEGKLIFAACGSMCRPVSALEAELVACKEGIILALQWTFLP  1214

Query  451   IMIECDSKMLVE  416
             I++E D   LV+
Sbjct  1215  IIVETDCLELVK  1226



>ref|XP_008372905.1| PREDICTED: uncharacterized protein LOC103436258 [Malus domestica]
Length=1222

 Score =   194 bits (492),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 155/597 (26%), Positives = 240/597 (40%), Gaps = 18/597 (3%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             RI  +L+GWK   LS AGR  L K+V+ AIP Y M     P  VC E++    RF WG  
Sbjct  616   RILGKLQGWKQSALSRAGREVLIKAVVQAIPAYPMCIFKFPXVVCXELDALVARFWWGSH  675

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
              +  + K+  V+ +++   K  GGLG RN    N A + K  WRL TEPN+LWA+ +  +
Sbjct  676   GZ--BRKIHWVSKZVLGLPKDMGGLGFRNFXEFNXALLAKQCWRLLTEPNSLWARVIKAR  733

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y     S     +    S AW  + + RE L SG    +  G+  R W+D WL + P   
Sbjct  734   YFXHC-SFWEAKKGAXASWAWSSLLSGRELLASGSHWQIMGGEXVRVWVDRWLPSLPSGH  792

Query  1423  KLRGTLGLPELYATVNEYWD-KVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWS  1247
              +            V+   D   R W ++ ++ +L   +   +    + +    D   W+
Sbjct  793   PMPLXXVSXXSNLRVSSLIDSSSRQWDFDFLRXFLSLADQRAIQETIIGDSRWKDRLIWA  852

Query  1246  PDPRGCFSVKSAYGWAD-----------NAARQEADKVWGLIWSLRVPARISMFIWLVKH  1100
              +  G +SVKS Y W                R  +  +W  IW L VP +I  F+W+  H
Sbjct  853   VNRNGKYSVKSGYRWLQVRYIDVRDHRMPVVRSISKTLWKCIWQLAVPQKIRHFLWVSLH  912

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
               + T      R ++    C  C    E ++H+F RC  V  +W         ++     
Sbjct  913   LGLPTGKALCTRRLSPFPSCPLCQSADETVEHVFLRCSWVAAVWFGGALNYKVDAAGIDS  972

Query  919   WNSWLTMNLKGDRQQGFEEGWPERFGT-RLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCD  743
             W  WL      +        W + + +   W++WK R + VFN+  +   + +  L    
Sbjct  973   WARWLQTVFSSNWGSSTNRQWFQAYVSFSCWFIWKARCDFVFNQVPINPSKVIFSLSTAF  1032

Query  742   SETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGS-CTSDGQASCGGVLRDTH  566
                  A               E  + W  P   ++K+N D S   S      G V R   
Sbjct  1033  GNFLLAVSSLGIARPVSVSQEEVVVRWCPPASPFVKINVDASWSKSSWMGFAGVVARQDG  1092

Query  565   GNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK-ETGQ  389
             G +       +   +S VAE++ +L+G  +    G   ++IE DS   +  L G  E G 
Sbjct  1093  GRFRAAVRSSVLAPSSLVAESFAILRGCELGASMGFSSVIIESDSLQAISYLNGSLENGS  1152

Query  388   EQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEF  218
              +   I+ R  +    F    +  + R  N  AD LA   LT        + PP   
Sbjct  1153  WEAFPILARAQRLGSAFQNCRWSWVPRSANLAADVLASAGLTEMCDFVWVDRPPSSL  1209



>ref|XP_010666820.1| PREDICTED: uncharacterized protein LOC104883940 [Beta vulgaris 
subsp. vulgaris]
Length=1288

 Score =   193 bits (490),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 156/574 (27%), Positives = 247/574 (43%), Gaps = 28/574 (5%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             LLDR+  +L GWK K LS AG+  L K+V+ A+P Y M    +P  +  EI     RF W
Sbjct  705   LLDRMWKKLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVYKIPMAIIKEIHTAMARFWW  764

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   +    KM  ++W+ +   K  GG+G ++L   N A + +  WRL    N+L ++ +
Sbjct  765   G--GKGAERKMHWLSWEKMCKPKCMGGMGFKDLGVFNDALLGRQVWRLLHYKNSLLSRVM  822

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
             + KY+   G         S S +W  I + +  ++ GL   V +G+S   W D WL  + 
Sbjct  823   SAKYYPH-GDIFQARLGYSNSYSWSSIWSAKSLVKEGLIWKVGDGQSINLWQDPWLCDED  881

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
                 L   +   EL   + +  D  + WK + I+      + + + ++ L+     D   
Sbjct  882   GRFVLSNRVEGLELVGDLID--DDRKEWKTDVIETLFEERDQKCILAIPLSSRCVQDELT  939

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYER  1073
             W+    G +SVK+AY        ++  K WG++WSL V  ++  F+W     RV TN   
Sbjct  940   WAYSKDGTYSVKTAYMLGKGGNLEDVHKAWGILWSLEVSPKVRHFLW-----RVCTNSLP  994

Query  1072  TR-----RHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSW  908
              R     RH+   + C  C    E + H    C     +W    +   +  +  ++    
Sbjct  995   VRAVLRARHLVEQDECPWCLNGVETIHHSLFTCVRWRPVWG---ELGCQAMVAGVEGE--  1049

Query  907   LTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWL-RRCDSETA  731
              TM     R    +    +R     W +W  RN+ VF     P+   +  + R+CD   +
Sbjct  1050  -TMCETVVRWSELDAKMVQRGSFLAWNVWTERNKLVFEGQGQPVPVIVQRVSRQCDEFNS  1108

Query  730   AAFEERHWPLQRHNRGGE-ERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGNWC  554
                     P     RGG      W  P  G +KLNTD     +G    G V RD  G  C
Sbjct  1109  YTTRIYGGP----KRGGSVSSTKWCTPPRGMIKLNTDAYLGEEGWIGLGIVARDCQGKVC  1164

Query  553   RGYTYRIGRC-TSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNN  377
                  R   C  + +AE   +    RMAK +G   I+IE DS+++   L  +       +
Sbjct  1165  FSAVRRTRACWPAAIAECKAIYMAARMAKAHGLANIIIESDSQVVTNRLTNETLYFADLD  1224

Query  376   NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
             NI+   +     F +V FLH+ R+ N +A  LA+
Sbjct  1225  NILGDVLSLCNVFESVKFLHVKRDGNVVAHHLAR  1258



>ref|XP_008351723.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=678

 Score =   189 bits (480),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 142/465 (31%), Positives = 203/465 (44%), Gaps = 58/465 (12%)
 Frame = -1

Query  1870  IYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLH  1691
             +Y MQT  LP   C  I+   R+F+WG  E    +K  LV W  +   K +GGLGL+ + 
Sbjct  261   VYVMQTTKLPISTCDLIDGLNRKFLWGSXEV--KSKTCLVRWSSVCLQKNKGGLGLKRMK  318

Query  1690  TMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHLVT-TRRRSISNAWKGISAERET  1514
              MN   + K  WRL    + LWA T   KY     S ++     R  S++W+ +    + 
Sbjct  319   YMNAXLLAKSSWRLLQRDDDLWASTFRGKYLSGVNSDILKWPTGRVASSSWRAVVYGGQL  378

Query  1513  LESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTLGLPELYATVNEYWDKVRG--WKWE  1340
             LE+GL   V +G +  FW D+WL    L  K    L   ++ A   +  D   G  W   
Sbjct  379   LENGLIWRVGSGANISFWFDAWLDDGILTNKALIPL---DVSAKAVKVIDFCYGNCWNVS  435

Query  1339  KIQRYLPTEELERLASLCL-TEENTPDGWGWSPDPRGCFSVKSAYGWADNAARQEADKVW  1163
               +  L  E + +++++ +   +   D   W     G FSVKSAY  A        D  W
Sbjct  436   AXRAVLXEEYVWKISAIPIGLNDGDSDCIIWKHSNDGNFSVKSAY-LASIDDEDFVDWSW  494

Query  1162  GLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHD  983
               IW L++P R+  F+WL  HGR+L N +R +R IT N YC  C G  E +DH+ RRC  
Sbjct  495   SDIWKLKLPPRVLHFLWLTLHGRLLCNEQRAKRXITDNSYCDFCDGCVESIDHILRRCD-  553

Query  982   VDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEA  803
                        R +   +NL W  W                    F    WWLWK RN +
Sbjct  554   -----------RAKLLCQNLHW--W------------------GVFAFACWWLWKLRNLS  582

Query  802   VFNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEER-----LSWEKPDEGWL  638
             +F  + +   Q    + +   E         W  +  N G +       L+W+ P   ++
Sbjct  583   IFASDFIFPSQPYILIFKAAKE---------W-FEVQNFGAKPVKSRIFLAWDPPSPNYV  632

Query  637   KLNTDGSCTS-DGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAE  506
             KLN DGS  S  G +S GG+LR     W  G+T  IG  +   AE
Sbjct  633   KLNADGSRKSGKGCSSAGGILRAAACVWIAGFTINIGVGSVLNAE  677



>ref|XP_008357937.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1048

 Score =   192 bits (488),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 173/633 (27%), Positives = 257/633 (41%), Gaps = 56/633 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L D+  A+L GWK K LS+AGRV L +SV  ++ +++      P  +   + +  R FIW
Sbjct  440   LADKAKAKLTGWKGKLLSMAGRVQLTQSVFQSMLLHSFSVYKWPSSLLRPLSRCARNFIW  499

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D  S   K   V+W  I   K  GGLGLR+L ++N   ++KLGW + T  ++ W+  L
Sbjct  500   SGDVTS--KKSVTVSWRQICAPKNEGGLGLRDLGSLNTTALLKLGWLIITT-DSPWSIYL  556

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               ++      +  + +R SI   W GI +    L      V+ NG +T  W+D WL  KP
Sbjct  557   RERFKLHGRLYSCSYKRSSI---WPGIKSILHILFQNCRWVIGNGSTTSLWVDKWLD-KP  612

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             + + +  T   P L  T      ++  W    I      +  + +  + L  +   D   
Sbjct  613   IVDVVGATEIAPSLSXTKVSNIIRMGKWVIPSIFSSTFPDLTKEILEMPLPIDEDKDVLI  672

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEADKVWG-LIWSLRVPARISMFIWLVKHGRVLTNYE  1076
             W     G FS    Y   +        K W  +IW   +P R S+ +W +   ++ T  +
Sbjct  673   WEVSTSGVFSFSDGY---EIVRHXFPVKSWASIIWRPFIPPRYSILVWKILFNKLPTEDQ  729

Query  1075  RTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR-HSLQRRTEESMRNLDWNSWLTM  899
               RR I     C  C    E +DHLF  C      WR  + Q  T         + WL  
Sbjct  730   LQRRGIPLAPICQLCHKNSESIDHLFSSCEFAQCAWRWLATQFGTXIPPTGSJSDLWLVF  789

Query  898   NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFE  719
              L           W       L  +WK RN+  F       E K     R    T+A   
Sbjct  790   -LSKXFSPHLXNVWIASGFFLLMAIWKMRNKXKF-------EGKPPSXSRLCRSTSAWIR  841

Query  718   ERHWPLQRHNRGGEER--------------------LSWEKPDEGWLKLNTDGSCTSD-G  602
             +       H RG  +R                    + W  P   W+K+NTDG    + G
Sbjct  842   QVGALTPGHVRGILDRQLLVSLGISPNSCKAPSIVPVXWHPPLFSWVKVNTDGLAKGNPG  901

Query  601   QASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKML  422
              A+CGGV RD+ G +  G++  +G  TS  AE   V+  + +    G + + +E DS  +
Sbjct  902   PAACGGVFRDSAGYFLGGFSLSLGHRTSFYAELHAVILAVELTHARGWQNLWLESDSSSV  961

Query  421   VEALKGKETG-----QEQNNNIVRRCIKEAENFLAVVFL--HIYREQNKLADKLAKWALT  263
             +              Q + NN    C    +N   +VF   HI+RE N +ADKLA   L 
Sbjct  962   ISCFASGSFSPPWSLQTRWNN----CTLHLQN---MVFXCSHIFREXNVVADKLANLGLL  1014

Query  262   TQGGLHIFEVPPGEFEVRMALDRLGASSPRRVS  164
             +   L     PP E    +  D LG  + R VS
Sbjct  1015  SS-SLVWHSTPPIEILPPLHSDFLGMPTYRFVS  1046



>ref|XP_007031938.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOY02864.1| Ribonuclease H protein [Theobroma cacao]
Length=660

 Score =   189 bits (479),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 125/440 (28%), Positives = 202/440 (46%), Gaps = 10/440 (2%)
 Frame = -1

Query  1465  FWMDSWLTAKPLYEKLRGTLGLPEL-YATVNEYWDKVRGWKWEKIQRYLPTEE-LERLAS  1292
             F  D WL+ K L + +   +  P L    V E+ +    W ++K+   LP E  L+ + +
Sbjct  221   FKRDKWLSDKTLAD-ITCRVANPALDKVVVREFLNPNGHWDYDKLSYCLPNEVVLQVVQT  279

Query  1291  LCLTEENTPDGWGWSPDPRGCFSVKSAYGWA---DNAARQEADKVWGLIWSLRVPARISM  1121
             +  T     D   W     G F+V S Y +     + A+     +W   W  +   R+  
Sbjct  280   MPPTVIIAQDMPYWGESASGQFTVASVYDYLRQLSSPAKARPSGIWQGAWKWQGSQRVRT  339

Query  1120  FIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTE  941
             F++   HGR+LTN ER  R +T++  C  C  + E + H+ R C     +W   + +  +
Sbjct  340   FLFQCLHGRLLTNRERLHRQLTTDSLCPQCRMEDETVTHVLRDCMVATSLWVKIIPQHEQ  399

Query  940   ESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
                       WL  NL+  +Q      W   FG   W LWKWRN  VF     P  +++ 
Sbjct  400   NDFFTFPLREWLVSNLQ-KQQLILGNPWSVVFGLACWCLWKWRNGVVFYAAFNPTRKRIS  458

Query  760   WLRRCDSETAAAFEERHWPLQRHNRGGEERL-SWEKPDEGWLKLNTDGSCT-SDGQASCG  587
              ++   + T A   +    +Q   R  EE L  W  P  GW+ LNTD +   S  +AS G
Sbjct  459   MIKSMATATIATSADFD-GVQVERRKKEEVLIGWRTPQVGWVCLNTDEAYKRSIEEASTG  517

Query  586   GVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALK  407
             GV+R+  G+W   +  ++G+C++  AE WGVL GLR+A + G +++ ++ D+KM+V A+ 
Sbjct  518   GVIRNAEGDWQAEFLAKLGKCSAYRAELWGVLHGLRLAWDSGFKKVQVQVDNKMVVPAVS  577

Query  406   GKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPP  227
               +     N +++R      +    V F+H Y E N + D LA +A   +    + E  P
Sbjct  578   TNKLIPGANTDLIRAIKDVLQKEWEVSFMHTYCEGNMVTDYLASYAFVLEKSYIVLEQAP  637

Query  226   GEFEVRMALDRLGASSPRRV  167
                   +  D LG   PR +
Sbjct  638   TGARKLLMYDMLGVCLPRMI  657



>ref|XP_010513002.1| PREDICTED: uncharacterized protein LOC104788940 [Camelina sativa]
Length=1347

 Score =   192 bits (489),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 164/618 (27%), Positives = 272/618 (44%), Gaps = 70/618 (11%)
 Frame = -1

Query  1960  ISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDE  1781
             +  + +GW+ + L+ AG+ TL KSV  A+P+Y+M    LPK +CSE++    RF WG  +
Sbjct  745   VKQKTDGWQTRFLNTAGKETLIKSVAFAMPVYSMNCFELPKKLCSELDSLIARFWWGSTQ  804

Query  1780  QSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKY  1601
             +    K+S VAW  + T K  GGLG R+ H  N+A +    W++   P+ L  + L  +Y
Sbjct  805   E--KKKISWVAWKKLVTSKNEGGLGFRDFHLFNQALLANQAWKILQRPDNLIYRLLKARY  862

Query  1600  HHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP----  1433
               R  S    +     S +W  +   RE L+SG+ + + +G+ T+  +D WL   P    
Sbjct  863   -FRDTSFFSASWGTKPSYSWNSLRFGRELLKSGIQYSIGDGRLTKLGVDPWLPTNPPRPP  921

Query  1432  -LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
              L       + +  +   V+ +WD++      ++QR++   +   +    L +    D +
Sbjct  922   LLIRAEDAEMPVSTIIDPVSFHWDEL------QVQRFIDPRDHHLIYKTYLPQIPALDSY  975

Query  1255  GWSPDPRGCFSVKSAYGWADNAARQEADKVWGL---------IWSLRVPARISMFIW-LV  1106
              WS    G ++VKS Y  A +  R +   V  L         IW L +  ++  F+W L 
Sbjct  976   IWSGTKHGMYTVKSGYWKALSLDRDDDAPVAPLKSNPDIAAQIWRLNITPKLQHFLWRLA  1035

Query  1105  KHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR---------HSLQ  953
              H   + +  R RR+I    YC  C    E  DH F  C  V  IWR             
Sbjct  1036  SHAIGVADNLR-RRNINVYPYCSRCCMSFESSDHTFFFCPQVIPIWRLIGIPTTLIGDPH  1094

Query  952   RRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPL-  776
                E+ +R L         L  D   G    +   +   +W +WK RN+ VFN  L+ + 
Sbjct  1095  ITIEDKLRYL-------FQLHQDNTIGLIHRYAPFW--LMWRIWKSRNDLVFNYRLIEIT  1145

Query  775   ----------EQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNT  626
                       E+ L+ +   +  +A     +  P  R       R+ W+KP++GW+K N 
Sbjct  1146  DIAKNALTDTEEWLNCMVTEEQPSAGQSTGQQCPRPR-------RIQWKKPNDGWVKCNY  1198

Query  625   DGS-CTSDGQASCGGVLRDTHGNWCRGYTYRI-GRCTSTVAEAWGVLQGLRMAKEYGARR  452
             D S    D  +  G ++R+T+G +  G   +  GR T   AE   ++  ++ A   G R 
Sbjct  1199  DVSHYEGDRHSGLGWLIRNTNGIFLDGGMGKYQGRATIEEAECTALIWAIQSAWGLGYRS  1258

Query  451   IMIECDSKMLVEALK--GKETGQEQNNNIVRR-CIKEAENFLAVVFLHIYREQNKLADKL  281
             +  E D++++ + +   G  +  +     +R  C K    F  + F    RE N  AD L
Sbjct  1259  VEFEGDNEVVNKIINNHGSYSRLQHYLETIRGWCTK----FTNIRFTFQRREHNICADLL  1314

Query  280   AKWALTTQGGLHIFEVPP  227
             AK A+T+     ++   P
Sbjct  1315  AKTAITSSHMYALYHSCP  1332



>ref|XP_007225095.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica]
 gb|EMJ26294.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica]
Length=925

 Score =   191 bits (484),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 163/640 (25%), Positives = 267/640 (42%), Gaps = 79/640 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +R+  +L+GW+ +TLS+AG+  L K V  +IP+Y M    LP+G+C EIE+   RF W
Sbjct  337   LKERVWKKLQGWREQTLSIAGKEVLLKVVAQSIPLYVMNCFLLPQGLCHEIEQMMARFWW  396

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +Q  N K+  + W+ +   KT GG+G R L   N A + K GWRL   P++L ++ L
Sbjct  397   G--QQGENRKIHWMRWERLCKAKTEGGMGFRCLQAFNMAMLAKQGWRLVHNPHSLASRLL  454

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY   +     T   R  S  WK I   R+ LE G    + +GKS R W D W+    
Sbjct  455   KAKYFPHTNFWEATLGSRP-SCVWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPA  513

Query  1432  LYEKLRGTL-GLPELYATVNEYWDKVRGWKWEKIQR-YLPTEELERLASLCLTEENTPDG  1259
              +  +   L G+     +     +    W  +K+   +LP + ++    + L+    PD 
Sbjct  514   AFVVITSPLDGMENTKVSELICNEGSPQWDLQKLNNLFLPVDVVD-FVRIPLSIRAPPDR  572

Query  1258  WGWSPDPRGCFSVKSAYGWA----------DNAARQEADKVWGLIWSLRVPARISMFIWL  1109
               W+ D  G F+VKSAY  A           +++  +   +W  IW+  VP ++ +F W 
Sbjct  573   IVWNYDKHGLFTVKSAYRVALRVTSGDEDESSSSNSDTSMLWRHIWNATVPTKLKIFAWR  632

Query  1108  VKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS-LQRRTEESM  932
             V H  + T     ++ +   + C  C    E   H+   C      W  S L R   + +
Sbjct  633   VAHDILPTKANLIKKGVDMQDMCMFCGDITESALHVLAMCPFAVATWNISLLTRHAHQGV  692

Query  931   RNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLR  752
             +    +             GF + +   F T                             
Sbjct  693   QRSPHDV-----------VGFAQQYVHEFITA----------------------------  713

Query  751   RCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSC-TSDGQASCGGVLR  575
                ++T +   +R            + + W  P  G LK N DG+   + G+ + G V R
Sbjct  714   ---NDTPSKVTDR----------VRDPVRWAAPSSGRLKFNFDGAFDPTSGRGAVGVVAR  760

Query  574   DTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKE  398
             D  G +       +G   S   AE     +G+ +A   G    + E DS ++V A+  K 
Sbjct  761   DADGGFVAAVAKSVGEVLSAEHAEILAAREGVALALSLGTASPIFEGDSAVVVSAV--KR  818

Query  397   TGQEQNN--NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPG  224
              GQ+ +N   IV       + F + +F    RE N +  +LA++ L        FEVPP 
Sbjct  819   AGQDYSNIGTIVEDVKHLQQQFPSSLFQFTPREANGVVHRLARFGLYNVDNFIWFEVPPD  878

Query  223   EFEVRMALDRLGASSPRRVSH*GPLFLVSGVSPSSMIQKK  104
               +  +  D L     R  +H  P+ ++  ++  S++  +
Sbjct  879   LIQDALLYDVLS----RGQAHCPPVVILRFINKVSLVPSR  914



>emb|CCA66140.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   192 bits (488),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 161/624 (26%), Positives = 263/624 (42%), Gaps = 63/624 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++ +IS RL  WK K LS+ GR+TL KS L ++P+Y M    +P+ V ++I    R+F+W
Sbjct  764   IIAKISRRLATWKCKMLSIGGRLTLIKSSLISLPVYFMSIYPMPQDVVNKIIGLARQFLW  823

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                +  G N M LVAW ++   K+ GG+G+ N+   N+A + K  WRL  EP+ LW K +
Sbjct  824   AGSD--GKNAMPLVAWSVLQLPKSLGGMGIGNIKHKNQALLFKWIWRLFDEPSQLWCKII  881

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAE-------RETLESGLTHVVRNGKSTRFWMD  1454
               KY + +   +   +  +    W+ I A        ++    G+   V+NG  + FW D
Sbjct  882   RAKYKYPNTLTISDIKIPNAGGPWRSICASYLRNQDVKDMAIKGVRKNVKNGHDSLFWHD  941

Query  1453  SWL---TAKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWE-------KIQRYLPTEELE  1304
              W+   T K L+ +L      P        +WD +  W W        + Q  +    L+
Sbjct  942   VWIGEATLKSLFPRLFTIAMSPNGSVASYGFWDGL-AWVWSFSWRRMLRPQDLIEKTHLD  1000

Query  1303  RLASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARIS  1124
              L           D   W+    G FS KS     D  +          +W   VP RI 
Sbjct  1001  SLLQQAHVAYEKKDQLIWAYSSSGKFSTKSFSLEVDKLSPPPHHDAINGVWRGLVPHRIE  1060

Query  1123  MFIWLVKHGRVLTNYERTRRHIT--SNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQR  950
             +F+W+   G++ T ++  +  I    ++ C  C+   E  DHL   C+    +W      
Sbjct  1061  IFVWMALLGKISTKHKLAKIGIIPKDDDICILCSNSSETSDHLLLHCNFARSLWHWWF--  1118

Query  949   RTEESMRNLDWNSWLTMNLKGDRQQG------FEEGWPERFGTRLWWLWKWRNEAVFNRN  788
                 S+ N+ W    T+    D+ Q       F++ W   F   +W +WK RN  +F ++
Sbjct  1119  ----SLWNIQWVFPHTLREAFDQWQTRSRCVFFKKAWLTIFFIIVWSVWKERNSRIFEKS  1174

Query  787   LLPLE--QKLDWLRR-------CDSETAAAFEERHWP----------LQRHNRGGEERLS  665
                ++  Q L  LR        CD    +  +    P          L ++ +     + 
Sbjct  1175  ESSVKDIQDLILLRLGWWIKGWCDEFPYSPNDVLRSPSCLIWNGANSLMQYPKLQPCPIV  1234

Query  664   WEKPDEGWLKLNTDGSCTS-DGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQ  488
             W  P E +LK N D S       ++ GGVLR++ GN+   ++  I       AE  G+ +
Sbjct  1235  WTPPIENFLKWNVDASANPLLSTSAMGGVLRNSQGNFMCLFSSPIPFMEINCAEILGIYR  1294

Query  487   GLRMAKEYGA---RRIMIECDSKMLVEALKGKETGQEQNN---NIVRRCIKEAENFLAVV  326
              ++++        + ++IE DS   V      E G    N   N +R   K+    L + 
Sbjct  1295  AVKISISSDCIKEKNLIIESDSANAVSWCNQDEGGPWNMNFQLNFIRNARKKN---LRLT  1351

Query  325   FLHIYREQNKLADKLAKWALTTQG  254
               H  R  N +AD +AK  +  Q 
Sbjct  1352  ITHERRSANFVADSMAKQGIHRQS  1375



>ref|XP_004306275.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=727

 Score =   188 bits (478),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 159/612 (26%), Positives = 259/612 (42%), Gaps = 99/612 (16%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ +IS +L GWK  TLS AGRVTL K+ L  +P + M      K     ++  +R F+W
Sbjct  199   LILKISNKLAGWKKNTLSHAGRVTLIKTNLAGMPNHVMSCFNCDKRTTKAVDTESRSFLW  258

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                   G++K   VAW+ + T K+ GGLG+R     N+A + KLGW++  + +  W + +
Sbjct  259   ------GDSKNPPVAWEQVCTPKSIGGLGIRPSAYFNKAAVAKLGWKIIMDHSNWWVQIV  312

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  ++ S   T ++ S S AWKGI   R+ +  G+   +  GK  +FW  +W+   P
Sbjct  313   KNKY-LKNHSFFETKKKSSDSVAWKGILDSRDLITKGMRWTIGTGKEVKFWTFNWIFDFP  371

Query  1432  LYEKLRGTLGLPELYATVNEYWDK-----VRG--WKWEKIQRYLPTEELERLASLCLTEE  1274
             L   L       +  AT+N  WD      + G  W  EK+ + L  E ++++  + +   
Sbjct  372   LINLLND-----QQKATIN--WDANVSNFIAGNSWDKEKLLQVLDWEIVKQIMGIPIPIN  424

Query  1273  NTPDGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGR  1094
             N  D   W P     FS+K+A                                W+     
Sbjct  425   NQNDRCVWGPAANDKFSIKTA-------------------------------TWI-----  448

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR----HSLQRRTEESMRN  926
                 Y  T  H+                   F  C     +WR    H L   ++  +  
Sbjct  449   ---QYNETLDHL-------------------FGDCTIATNVWRKACLHDLIHGSDTFLNK  486

Query  925   LDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF-NRNLLPLEQKLDWLRR  749
             L  N +L       R++ + +   E+  T  W +WK RN+A F N +  PL      +  
Sbjct  487   L--NLFL-------RKRNYNKNDFEKILTICWMIWKARNDASFRNISTSPLT-----IIS  532

Query  748   CDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDT  569
               +     F+E +   +  +      + W+ P     K+N DGS TS   A+CG ++R++
Sbjct  533   VAASIEKGFKENNMNCRVGSFKTPSAIKWQPPPASTFKVNFDGSVTS-SSAACGTIIRNS  591

Query  568   HGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQ  389
              G      +  IG+ +    EA  +   + +AK  G  RI++E DSK++++ + GK +  
Sbjct  592   EGVPIITSSKNIGKASVPTTEATALRDSILIAKNRGLTRIIVEGDSKIIIDVVNGKISTP  651

Query  388   EQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVR  209
              +   I+      A+ F  + F HIYRE N  AD       +  G    F+  P      
Sbjct  652   WRLQQIIEDIKNLAQEFQEICFNHIYREANFAADATESLGHSITGRRDWFQPLPRSIGRM  711

Query  208   MALDRLGASSPR  173
             +  D++G   PR
Sbjct  712   ILFDQIGEGCPR  723



>emb|CCA66188.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   191 bits (486),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 172/628 (27%), Positives = 270/628 (43%), Gaps = 77/628 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++ +I  +L  WK + LS+AGR+TL K+ ++++P+Y M     P+GV   I K  R F+W
Sbjct  764   IIKKIEGKLASWKGRMLSIAGRITLIKASISSLPLYYMSLFPAPRGVIEAINKLQRNFLW  823

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               + +  +  ++LVAW+ +   K  GGL   NL   N + + K  WRL  +P +LW K +
Sbjct  824   SGELRKSS--LALVAWNQVVLPKESGGLNCGNLLNRNISLLFKWIWRLSHDPESLWQKVI  881

Query  1612  TTKYHHRSGSHLVTTRRRSI---SNAWKGISAE-------RETLESGLTHVVRNGKSTRF  1463
               KY +   SH  T     I   S  W+ I A        R  +++ L   V NG  T F
Sbjct  882   KEKYGY---SHTTTVHDLCIPKGSGPWRFICASILNHPSARSFVKTKLRKAVGNGVKTLF  938

Query  1462  WMDSWLTAKPL---YEKLRGTLGLPELYATVNEYW---DKVRGWKWEKIQRYLPTEELER  1301
             W+D+WL   PL   + +L   +  P  Y      W   + V  + W ++ R    EE E 
Sbjct  939   WLDTWLGDSPLKLRFPRLFTIVDNPMAYIASCGSWCGREWVWNFSWSRVFRPRDAEEWEE  998

Query  1300  ----LASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWADNAARQEADK--VWGLIWSLRV  1139
                 L S+CL+  +T D   W+P   G FSVKS      N A +   K  +WG +W   +
Sbjct  999   LQGLLGSVCLS-PSTDDRLIWTPHKSGAFSVKSCSKELTNTALKPQSKIRIWGRLWRGLI  1057

Query  1138  PARISMFIWLVKHGRVLTNYERTRRHITS--NEYCYNCAGQREDLDHLFRRCHDVDRIWR  965
             P RI +F W+   G++ +  +    +I    +  C  C G  E  DHL   C     IW 
Sbjct  1058  PPRIEVFSWVALLGKLNSRQKLATLNIIPPDDAVCIMCNGAPETSDHLLLHCPFASSIWL  1117

Query  964   HSLQRRTEESMRNLDWNSWLTMNLKGDRQQ--------GFEEGWPERFGTRLWWLWKWRN  809
               L       + N+ W      NL    +Q         F + W   F   +W +WK RN
Sbjct  1118  WWL------GIWNVSWV--FPKNLFEAFEQWYCHKKNPFFRKVWCSIFSIIIWTIWKERN  1169

Query  808   EAVFNRNLLPLEQKLD---------WLRRCDSETAAAFEE--RH-----WPLQRHNRGGE  677
               +F R +     KL          W++        +  E  RH     W   +      
Sbjct  1170  ARIF-RGISCSSNKLQDLVIIRLMWWIKGWGEAFPYSIVEVLRHPQCLSWDYLKAAPAAT  1228

Query  676   ----ERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVA  509
                 + + W  P++G +K N D S  + G+++ GGVLR++ G +   ++  I       A
Sbjct  1229  AVSVDGMLWSPPNDGVMKWNVDASVNA-GRSAIGGVLRNSQGIFVCVFSCPIPSIEINSA  1287

Query  508   EAWGVLQGLRMAKEYGARR---IMIECDSKMLVEALKGKETGQEQNN---NIVRRCIKEA  347
             E   + + +++   +   +   +++E DS   V      E G    N   N +R   K  
Sbjct  1288  EIIAIYRAMQICYSFEFLKRAPLVLESDSANAVMWSNENEGGPWNLNFQLNFIRNARKAG  1347

Query  346   ENFLAVVFLHIYREQNKLADKLAKWALT  263
              N   +  +H  R  N +AD LAK  L+
Sbjct  1348  LN---ISIVHKKRSSNAVADALAKQGLS  1372



>gb|AEL30350.1| RNA-directed DNA polymerase [Arachis hypogaea]
Length=673

 Score =   187 bits (476),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 161/598 (27%), Positives = 257/598 (43%), Gaps = 35/598 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +LD+I +RL  WK   L+ AGR+ L  SV  AIP Y MQ +  PKG+ S++E   R F+W
Sbjct  101   VLDKIRSRLASWKGSLLNRAGRLCLVNSVAAAIPTYQMQVSIFPKGIISKLESMMRNFLW  160

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                 Q     ++LV+W ++ T K  GGLG+R+ + +N A + KL W    +PN LW + L
Sbjct  161   --KGQVDGRGLNLVSWKVLVTPKKYGGLGIRDPYCVNIALLGKLVWTFFQQPNKLWVQLL  218

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY   S     +  +   S  W+ +    + L+ G    + +  +  FW  SW     
Sbjct  219   DAKYRS-SLYDCFSYPKNKDSPIWRCLCKAWKVLKDGFAWCIGD-LNQNFWFSSWRREGR  276

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPD-GW  1256
             L  ++   + + +    + + W   R W  + +   L     + + S    E+  P+ GW
Sbjct  277   LSNEM-DYVHISDSNLRIQDIWSVGR-WHLDTLYSPLSQNLKDNILSYNPDEQAGPEVGW  334

Query  1255  GWSPDPRGCFSVKSAYGW-ADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
              WS      +  ++ Y W        E  + W  +W   VP +     WL     + T  
Sbjct  335   YWSGSAAKVYDSRNGYLWLCKQLFGWEERENWLWLWCQLVPEKHKFLAWLCLKEALPTAS  394

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTM  899
              R RR ++S++ C  C   +E + H  R C     +W     +R +     LD  +W   
Sbjct  395   FRFRRGMSSSDRCPRCLSSQESVIHCIRDCPKAQLVW-----QRLDIPCHPLDLKNWF--  447

Query  898   NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFN-RNLLPLEQKLDWLRRCDSETAAAF  722
              L   R+       P +F + LWW+W+ RN  +FN     P E+ +      + E    F
Sbjct  448   -LYHSREH------PFKFFSGLWWIWRARNNDIFNPHETWPPEKVICLALTSEKELRNIF  500

Query  721   EERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQA-SCGGVLRDTHGNWCRGY  545
             E     LQR +        W  P  G  K+N D S    G +     V+RD +G+W RG 
Sbjct  501   E-----LQRMSLPSTLNGFWNPPSIGTFKINCDASYFGSGDSVGFACVIRDCNGSWQRGC  555

Query  544   TYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALK-GKETGQEQNNNIV  368
                I   +    E + + +G  +  + G R ++ E D    VEA     + G    + +V
Sbjct  556   LGMIESNSILQGELFAIWRGYLLVWDVGQRDVICETDC---VEAFNLVTQDGFRFIDPLV  612

Query  367   RRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDR  194
              +          V F  I R+ N +AD +AK A+  Q   H+  + P E E + +L R
Sbjct  613   LKIRDIMHWNWRVDFRLIMRDANTVADTMAKMAMKLQLS-HVELLSPWE-EFKSSLKR  668



>ref|XP_009120305.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/309 (37%), Positives = 154/309 (50%), Gaps = 4/309 (1%)
 Frame = -1

Query  1090  LTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNS  911
             +TN ER RRH++  + C  C G  E + H+ R C  ++ IW   +     ++  ++    
Sbjct  1     MTNAERYRRHLSGTDVCQVCKGGVETILHVLRDCPAMEGIWSRFVPSTKRQAFFSMPLLE  60

Query  910   WLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETA  731
             WL  NL  +  Q  E  W   F   +WW WKWR   VF  N L    ++ +LR    +  
Sbjct  61    WLYRNLYDNDAQN-EIPWATTFALGVWWGWKWRCGNVFGDNRL-WRDRVKFLRNLARKVM  118

Query  730   AAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHGNWC  554
              A +       R  R  E  + W  P  GW+KLNTDG+   + G AS GGVLRD  G WC
Sbjct  119   RAKKTEEESRARVQRV-EIMVGWTPPRGGWMKLNTDGASHGNPGLASAGGVLRDGEGEWC  177

Query  553   RGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNN  374
              G+   IGRC++ +AE WGV  GL +A E G RR+ +E DSKM+V  L          + 
Sbjct  178   GGFALNIGRCSAPLAELWGVYYGLVIAWEKGIRRLEVEVDSKMVVGFLTTGIEDTHPLSF  237

Query  373   IVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDR  194
             +VR C         V  +H+YRE N+LAD LA  A +   G H F+V P EF   +  D 
Sbjct  238   LVRLCHGFLTRDWLVRIVHVYREANRLADGLANLAFSLPFGFHRFDVVPLEFVSLIREDV  297

Query  193   LGASSPRRV  167
              G   PR+V
Sbjct  298   DGLLQPRQV  306



>ref|XP_008345353.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=953

 Score =   190 bits (482),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 173/596 (29%), Positives = 272/596 (46%), Gaps = 41/596 (7%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW-G  1790
             D++ ARL GW  + LS AG+  L K+V  A+P Y M    LP GVC +IEK  R+F W G
Sbjct  340   DKVEARLAGWTEQFLSQAGKEVLIKAVAMALPNYAMSCFKLPXGVCRDIEKAIRKFWWKG  399

Query  1789  RDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
              D++ G   +  V+W+ I+  K  GGLG +++   N A + K+G RL    ++L A  L 
Sbjct  400   DDKRKG---IHWVSWERISKQKKSGGLGFKDIQCFNLAFLAKIGXRLSLNSSSLLATVLR  456

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
              KYH    S     R ++ S  WKGI   R+ L++G+   V NG+      D W   KP 
Sbjct  457   DKYHP-GKSFKEAGRGKNTSWGWKGIFEGRKVLQNGIRWRVGNGECINIREDXWF-PKPS  514

Query  1429  YEKLRGTLGLPELYATVNEYWDK-VRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
               ++R  + L  +   V +  D     WK   I+     E+ + + S+ L+     D   
Sbjct  515   TFRVRPXVDLDAI--MVCDLIDSGSNSWKSNIIRAGFHREDADTILSIPLSYFGCDDKKV  572

Query  1252  WSPDPRGCFSVKSAYGWA----DNAA-----------RQEADKVWGLIWSLRVPARISMF  1118
             W     G +SVKS YG A    +N A           +Q+ + VW  IW LRV  +I +F
Sbjct  573   WHYTANGDYSVKSGYGVAMDLMENGALGKKGRGAPSEQQQRNNVWVKIWRLRVXNKIKLF  632

Query  1117  IWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEE  938
             I       +       RRH+  +  C  C    E  +HLF RC+     W          
Sbjct  633   IXRCCSNALAVRRNLQRRHLRVDNVCGVCNAPDEXENHLFFRCNFSHLFWFCXPXHLNSV  692

Query  937   SMRNLDW-NSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF---NRNLLPLEQ  770
              +  +D+ +SW   + K  + +   +   + F   LW LWK RN+ VF   +R  L +  
Sbjct  693   ELAGVDFLDSWAKFH-KCVKDRVNADEICQEFAFGLWRLWKNRNDVVFKGLHRQPLAV--  749

Query  769   KLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLS-----WEKPDEGWLKLNTDGSCTSD  605
              LD  R+  +E   A +     ++    G     +     W++P  G +K+NTD +   D
Sbjct  750   -LDLWRKNINEFREAADRVDGDVKXKAEGFHPATARTTPHWQRPXFGTIKINTDAAWXKD  808

Query  604   G-QASCGGVLRDTHGNW-CRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDS  431
               +A  G V RD  G     G +  I   ++  AE   +   L    ++G   +++E D+
Sbjct  809   SRRAGVGWVGRDFAGVLQAAGGSGTILCQSAAAAEVIAIRTALSACIKHGFNHVIVESDA  868

Query  430   KMLVEALKGKETGQEQNNNIVRRCIKE-AENFLAVVFLHIYREQNKLADKLAKWAL  266
             + ++  ++ KE  ++ N + +   IK  A  F +V F  + RE N+ A  +AK+ L
Sbjct  869   QKIIHMIR-KEVSEDFNLDCILGDIKILARMFTSVTFAFVPRESNQAAHLVAKYVL  923



>ref|XP_007023195.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY25817.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=874

 Score =   189 bits (479),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 119/406 (29%), Positives = 193/406 (48%), Gaps = 15/406 (4%)
 Frame = -1

Query  1552  SNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTLGLPELYATVNE  1373
             SN WK +S         +   + +G    FW+D+W+   PL   +     +  L A V +
Sbjct  452   SNVWKSMSRLWGEFTKHVRWSIGDGALVNFWIDTWVGEVPLINVVVDMGFMLNLRARVRD  511

Query  1372  YWDKVRGWKWEKIQRYLPTEELERLASLCL-TEENTPDGWGWSPDPRGCFSVKSAY---G  1205
             Y      W  E++   LP E + ++  +   T   + D   W+  P G F++ S Y   G
Sbjct  512   YIMPNGDWDKERLTSILPIEVVNQILYIIPPTLSASLDMPYWALSPSGYFTISSTYEHLG  571

Query  1204  WADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAG  1025
                ++ R+E +K+W L+W  + P R+ +F++   H R+LTN ER RR ++S+  C +C G
Sbjct  572   SLADSTREENNKMWHLVWDWKGPHRVCLFLFFCLHKRILTNAERVRRKMSSDASCPHCYG  631

Query  1024  QREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERF  845
               E   H+ R C   + +WR  L          +    WL+ NL       F+  W   F
Sbjct  632   VEETCLHVLRDCLASETLWRRILPESGINQFFQIPLIDWLSSNLNLKNLYVFDVPWNIVF  691

Query  844   GTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGG---EE  674
             GT  W+ WK  N  +F    L +E +L+ +R     + A      W   R   GG   +E
Sbjct  692   GTTCWYTWKRSNLFIFEGRELSVEGRLNIIR-----SMAVDSHNTWSTYRIISGGMRHQE  746

Query  673   RL--SWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEA  503
             ++   W  P E W+ +N DG+  S  +  + GGVLRD HG W  GY  ++   +   AE 
Sbjct  747   KILVGWSPPPEDWITVNLDGAFKSAARTTAAGGVLRDAHGTWIVGYACKLETSSVFRAEL  806

Query  502   WGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVR  365
             WGV +GL++A E G R++ ++ D+K +V+A+         N +++R
Sbjct  807   WGVYKGLQLAWERGFRKVKLQSDNKAVVQAISFSSVHPCSNLDLIR  852



>ref|XP_006584399.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=470

 Score =   184 bits (466),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 131/468 (28%), Positives = 209/468 (45%), Gaps = 12/468 (3%)
 Frame = -1

Query  1552  SNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTLG-LPELYAT--  1382
             S+ WK I A    L  G    V    S   W D W++A  +  KL   +  +P+  A   
Sbjct  7     SSLWKAIVALWPYLVDGEYWAVGKSDSVSVWYDRWISADII--KLSNVMQVIPDHVANYK  64

Query  1381  VNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG-WSPDPRGCFSVKSAYG  1205
             VN+   +   W +E +   +P + ++ + ++    +N  D    W+ +  G + V S Y 
Sbjct  65    VNDMVKQDGQWDFELLSLLIPQDIIKCIKAIIPPRDNADDDRRLWTGNKLGEYFVASGYN  124

Query  1204  WADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAG  1025
               +         +W  IW ++ P RI +FIW V H R+LTN     R       C++C  
Sbjct  125   QVNGFQNLSQSHIWNKIWKIKAPERIKVFIWQVTHERLLTNSCIAHRG-NGQASCHHCVI  183

Query  1024  QREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERF  845
               E++ H+ R C   + +W H L +    +    D   W+ MNL  D     ++ W   +
Sbjct  184   LEENILHVLRDCPLANLVWLHLLDQSNVANFFYPDLMEWIDMNLSRDLNATSKDDWQSVW  243

Query  844   GTRLWWLWKWRNEAVFNRNLL-PLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERL  668
                 ++LW WRN+ V N + + P       L+ C +         H    +     +  +
Sbjct  244   AQGCYFLWYWRNQQVHNSSFVRPFRLWESILQNCRNYKILMV---HMDSSQVVSKKQIMI  300

Query  667   SWEKPDEGWLKLNTDG-SCTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVL  491
              W  PD+ W KLN+DG      G    GG++RD +G W  G+   +G  ++ VA++WGVL
Sbjct  301   KWMPPDQRWYKLNSDGLKVGDSGGTGYGGLIRDENGRWVVGFVRNLGIASAYVAKSWGVL  360

Query  490   QGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIY  311
             +G+ +A++ G   + I  DSK++V+ LKG + G  +   IV    K       V   HIY
Sbjct  361   EGVTLARQRGIDFLEINVDSKVVVDGLKGDKQGCLEGWTIVGAIRKMVSGLEQVKISHIY  420

Query  310   REQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDRLGASSPRRV  167
             RE N+ AD     A T +  L I E P G     + +D  G  +P  V
Sbjct  421   REANQCADLHVNHARTQEEDLMILEHPIGLLTQLLLMDSCGVETPHVV  468



>ref|XP_010039376.1| PREDICTED: uncharacterized protein LOC104428079 [Eucalyptus grandis]
Length=1343

 Score =   190 bits (483),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 156/604 (26%), Positives = 263/604 (44%), Gaps = 68/604 (11%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L R++ +L GWK K LS AG+  L K+V+ A+P Y M    +P  +C  IEKR   F W
Sbjct  734   ILARVNMKLAGWKEKYLSKAGKEILVKTVVQALPQYAMSIFKIPVSICKAIEKRIAAFWW  793

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
              +++      M    W+ + + K RGGLG ++L + N A + K  WRL   P+ LW++ L
Sbjct  794   RQND--AKKSMHWKNWETLKSRKDRGGLGFKDLISFNVAMLGKQAWRLSQSPSALWSQLL  851

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
                Y  + G      R    S  W+ +   R+ +   L   V +GKS     D WL+   
Sbjct  852   KGLYFPQ-GDLWKANRGPRPSWGWQSVLRGRDAILPDLKWTVGDGKSIHIRQDHWLS---  907

Query  1432  LYEKLRGTLGLPELYATVNEYWDKV----RGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
                  +G LG PE     +   D +    + W    + +    + +  + +L +  +   
Sbjct  908   -----QGILGGPENRNDPHLVADLIDQERKEWNVPLLNQLFDQKIVNEILTLPIVHQQKD  962

Query  1264  DGWGWSPDPRGCFSVKSAYGWADN-----------AARQEADKVWGLIWSLRVPARISMF  1118
             D   W+ +  G ++VKS Y   ++           ++ Q    +W  +W + +P ++ +F
Sbjct  963   DKLIWTGNHSGQYTVKSGYNMINDVSLPQECNRASSSYQPPRSLWTKLWHMSIPPKLRIF  1022

Query  1117  IWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW---RHSLQRR  947
             +W +    + T  +  +R I  +  C  C+   E ++H+F  C  V +IW   R ++   
Sbjct  1023  LWSLCQDALPTKEKLHQRKILPDPLCPLCSKYPETVEHIFLHCQQVKKIWSDPRLNISHV  1082

Query  946   TEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQK  767
             T  + R    + W+   L    Q       PE     LW +WK RN  +F +     +  
Sbjct  1083  TSSATR---MDKWVAEYLLVKTQASD----PELIVEVLWQIWKNRNNFIFRKTHGQPQAL  1135

Query  766   LDWLRRCDSETAAA---FEERHWPLQRHNRGGEERL--SWEKPDEGWLKLNTDGS-CTSD  605
             +D        TA A     +R  P +     G E L  +W+ P    LKLN D S   +D
Sbjct  1136  ID--------TALAQNRVSQRWIPTKSSKSKGNEHLPVTWKAPKTPDLKLNVDSSWIATD  1187

Query  604   GQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGA----------R  455
                S  G+LRD++G+   G+   +   +   AE   +  GL+  +E+            R
Sbjct  1188  SACSVAGLLRDSNGSVIDGFAEEVHAASPLQAETLALFHGLKKLEEWKTTHVGQTPELNR  1247

Query  454   RIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLA----VVFLHIYREQNKLAD  287
              +  E D + LV+ +     G+E+ +  V+  ++E +N LA    V      RE N+  D
Sbjct  1248  TLTCESDCRQLVDFV----LGREEASWAVQLQVQECQNILAQLPLVTISFCPREANQAVD  1303

Query  286   KLAK  275
              +AK
Sbjct  1304  WVAK  1307



>ref|XP_009140270.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=866

 Score =   188 bits (477),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 156/587 (27%), Positives = 265/587 (45%), Gaps = 33/587 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             + +++  + +GW+ K LS  G+  L KSV +A  +Y M T  LPK VC EI      F W
Sbjct  268   VTEKVKTKTQGWQNKFLSPGGKEVLIKSVASATSVYPMNTFKLPKSVCEEINNILATFWW  327

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G+D+  G+  M   AW+ ++  K  GG+G R++   N A + K  WR+ T+PN+L A+ +
Sbjct  328   GKDD--GSKGMHWFAWNRMSLPKKEGGMGFRDIEKFNDALLGKQAWRILTKPNSLMARVM  385

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y   S S L     R  S  W+ I   ++ L  G+  V+ NG +   W D WL   P
Sbjct  386   KGRY-FPSTSILNARETRQNSYIWRSILHGKDLLTKGVRCVIGNGNTIDTWTDPWLPTNP  444

Query  1432  LYEKLRGTLGLPELY--ATVNEYWDK-VRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
                  R  + + + +  + V+++  + ++ W  E I+  +   + E + ++ L   +  D
Sbjct  445   ----PRAPVPIFDQHGNSKVSDFMHRGLKEWNEELIRNTMNQADAEEILAIKLCSSDEDD  500

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEA-------DKVWGLIWSLRVPARISMFIWLVK  1103
                W  +  G ++VKS Y  A +    +         ++  LIW L    ++  F+W + 
Sbjct  501   QLVWHYNKTGDYTVKSGYWLATHTPNNQQVIPPPGDTQLKQLIWKLNTAPKVKQFMWKMI  560

Query  1102  HGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNL  923
                +       RRHIT++  C +C  Q E  DHLF  C +   IWR S    +      +
Sbjct  561   TLSLPLGKNLQRRHITNSVKCPHCY-QEETADHLFFDCINAQCIWRASGYPNSGLLRSQV  619

Query  922   DWNSWLTMNLKGDRQQGFEEGWPERFGTRLWW----LWKWRNEAVFNRNLLPLEQKLDWL  755
                + L++ L  D         P+      WW    +WK RN+ +F + L      L   
Sbjct  620   TLEAKLSLLLNQD------ATIPDHLKQLPWWILWRIWKDRNKMIFQQKLTHWRYLLQAA  673

Query  754   RRCDSE--TAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTS-DGQASCGG  584
              +   E   A  F E   P Q       +R  W++P+ G++K N DGS  + +  A  G 
Sbjct  674   YQDTKEWMEAQQFTEEVQPGQPRRSPNSKRNEWKRPEMGFVKCNYDGSFYNINTPAQAGW  733

Query  583   VLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALK  407
             ++RD+ G +     ++  +  + + +E   +L  + +    G  +++ E D+  ++  LK
Sbjct  734   LIRDSTGLFKGAGQFKTRKPHNALESELQALLGAMMICWSQGYTKVIFEGDNINVINLLK  793

Query  406   GKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
              K T      N +R   K  + F ++ +    RE N  AD LAK  L
Sbjct  794   -KRTKNINVVNWLRDIWKWEQKFESLQYTWTNRESNSCADLLAKQQL  839



>ref|XP_008234850.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=1009

 Score =   189 bits (480),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 162/594 (27%), Positives = 253/594 (43%), Gaps = 30/594 (5%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             ++  +L GW  + LS AG+  L K+V  A+P YTM    LP  +C EIE    RF W   
Sbjct  403   KLDGKLHGWAEQFLSPAGKEVLIKAVAMAMPCYTMSCFKLPVTLCKEIEAAMARFWW--K  460

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
               +  N +   +W  ++  K  GGLG R+L   N A + K+GWR+   P++L A  L  K
Sbjct  461   SHTDKNGIHWASWTKLSQLKKAGGLGFRDLQCFNMALLAKIGWRILLNPSSLLACLLHDK  520

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y     S L  T ++S S  WKGI   R  LESGL   + +G + +   D WL     + 
Sbjct  521   Y-FVGASFLTATSQKSSSWGWKGILLGRRLLESGLRWRIGDGTTVQVRNDPWLPTPYTFR  579

Query  1423  KLRGTLGLPELYATVNEYWDK-VRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWS  1247
              L   L LP +   V+E  D  ++ WK + I R    EE   + S+ +     PD   W 
Sbjct  580   TLSRHLDLPSM---VHELIDPLLKTWKKDVINRCFVPEEASHILSIPINRWGCPDKLIWH  636

Query  1246  PDPRGCFSVKSAY---------------GWADNAARQEADKVWGLIWSLRVPARISMFIW  1112
                 G ++V+S Y               G  + ++      VW  +W +  P ++  FIW
Sbjct  637   FSMHGRYTVRSGYELALHLQRNGELGRKGAGEASSSSSQSAVWKSVWHVDAPPKLKAFIW  696

Query  1111  LVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESM  932
                   +   +   RR +     C  C  Q E   H+F  C      W  S  +     +
Sbjct  697   RGCSNFLAVRHNLRRRRVPCTGECGFCGFQDETQAHIFFECDFARAFWFASPLQLDVSKL  756

Query  931   RNLDW-NSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFN-RNLLPLEQKLDW  758
                D+ ++W  M    +  +   E   + F   LW +WK RN AVF+     P+E  L  
Sbjct  757   AGDDFISTWQHMMTTLNSSEHAAEAI-QWFVFGLWRIWKARNLAVFDGVQADPIEAVLLL  815

Query  757   LRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGV  581
             L++  SE   A ++   P           LSW KP  G LK+N D + ++       G V
Sbjct  816   LKQV-SEFRTAKQDLQ-PQALQPVSSPAPLSWCKPPPGLLKVNCDAAWSAQRLGGGVGWV  873

Query  580   LRDTHG-NWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKG  404
             +RD+ G   C G    +   ++ + E   +   L     +    I++E DS+  +  L G
Sbjct  874   IRDSFGLLLCAGGQGDLHGSSALMMELLAIRHALSECANFHLTDIIVESDSQKGIFMLNG  933

Query  403   KETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHI  242
             + +       IV    +   +   V F+   R  N+ A  +A + ++ QGG ++
Sbjct  934   RVSVDSDLEGIVFDIRQLVASLSRVSFVFAPRSCNRAAHSVAGF-VSKQGGNYV  986



>emb|CCA66040.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1362

 Score =   190 bits (482),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 167/605 (28%), Positives = 249/605 (41%), Gaps = 28/605 (5%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +RI  +L+GWK K LS  G+  L KSV  AIP Y M   +LP G+  EI     RF WG 
Sbjct  773   ERIWKKLQGWKEKLLSRPGKEVLIKSVAQAIPTYMMSVFSLPSGLIDEIHSLLARFWWGS  832

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
              +   N KM   +WD +   K+ GGLG R+LH  N++ + K  WRL T   TL  + L  
Sbjct  833   SDT--NRKMHWHSWDTLCYPKSMGGLGFRDLHCFNQSLLAKQAWRLCTGDQTLLYRLLQA  890

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             +Y  +S   L   R  + S  W+ I   +  L  GL   V +G+  R W D+W+  +  +
Sbjct  891   RY-FKSSELLEARRGYNPSFTWRSIWGSKSLLLEGLKWCVGSGERIRVWEDAWILGEGAH  949

Query  1426  EKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENTPDGWGW  1250
               +        L   V +  D  RG W  E +Q+    EE E + S+ L+     D   W
Sbjct  950   -MVPTPQADSNLDLKVCDLIDVARGAWNIESVQQTFVEEEWELVLSIPLSRFLPDDHRYW  1008

Query  1249  SPDPRGCFSVKSAY---------GWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHG  1097
              P   G FSV+S Y          W      +E + +W  +W L+ P ++S F+W    G
Sbjct  1009  WPSRNGIFSVRSCYWLGRLGPVRTWQLQHGERETE-LWRRVWQLQGPPKLSHFLWRACKG  1067

Query  1096  RVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDW  917
              +        RHI+ +  C  C    E ++H    C     IW+ S        M N   
Sbjct  1068  SLAVKGRLFSRHISVDATCSVCGDPDESINHALFDCTFARAIWQVS---GFASLMMNAPL  1124

Query  916   NSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNL--LPLEQKLDWLRRCD  743
             +S+ +  L+   +   +E +     + +W  W  RN+ +F   L   PL  K     R  
Sbjct  1125  SSF-SERLEWLAKHATKEEF-RTMCSFMWAGWFCRNKLIFENELSDAPLVAK-----RFS  1177

Query  742   SETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHG  563
                A   E      +    G      W  P  G  K+N D   + +G+   G V+R   G
Sbjct  1178  KLVADYCEYAGSVFRGSGGGCGSSALWSPPPTGMFKVNFDAHLSPNGEVGLGVVIRANDG  1237

Query  562   NWCRGYTYRI-GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQE  386
                     R+  R T+ +AEA   L  + +A   G  RI++E D+ M++ A+K K  G  
Sbjct  1238  GIKMLGVKRVAARWTAVMAEAMAALFAVEVAHRLGFGRIVLEGDAMMVINAVKHKCEGVA  1297

Query  385   QNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRM  206
                 I                 H+ R  N +A  LA+W       +   +  P       
Sbjct  1298  PMFRIFNDISSLGACLDVFSVSHVRRAGNTVAHLLARWCCDCNSEIVWLDSFPQSISTLA  1357

Query  205   ALDRL  191
              LD +
Sbjct  1358  ELDLI  1362



>ref|XP_006483194.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=765

 Score =   187 bits (474),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 145/585 (25%), Positives = 256/585 (44%), Gaps = 41/585 (7%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             ++++++  W  K  S  G+  L K+V  A+P Y M    LPKG+C +I+K   RF WG  
Sbjct  178   KVTSKISSWHHKLFSAGGKEILIKAVAQAVPAYAMSVFKLPKGLCEDIQKEIARFWWG--  235

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
              +   + +    WD ++  K RGGLG R+L + N+A + K GWRL   PN+L A+ +  +
Sbjct  236   TKKDKHGIHWARWDSMSKAKRRGGLGFRDLPSFNQALVAKQGWRLVRYPNSLMARVMKAR  295

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y+  S +        + S  W+ I    + ++ G+   + +GK    + D W+     ++
Sbjct  296   YYKNS-TFWNAKVGSNPSFIWRSILWGSQVIKKGVRWRIGDGKKVLVYKDKWIPRPATFQ  354

Query  1423  KLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSP  1244
              +     LP     V +  D    W+ ++++++   E++E +  + L      D   W  
Sbjct  355   PISPK-TLPH-ETVVADLIDSENKWRVDRLEQHFMKEDIEAILKILLPSGKEEDEVLWHF  412

Query  1243  DPRGCFSVKSAYGWADN-------AARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLT  1085
             D +G +SVKS Y  A N        +   + ++W + W L +P ++ +F+W      + T
Sbjct  413   DKKGEYSVKSGYQLALNQNFPNEPESSNSSSRLWKIPWMLDLPEKVKIFMWRALKNILPT  472

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWL  905
                  +R       C  C  Q E + H+   C    +IW  +          N D+ S  
Sbjct  473   AENLWKRRSLQEPICQRCKLQVETVSHVLIECKAARKIWDLAPLIVQPSKDHNQDFFS--  530

Query  904   TMNLKGDRQQGFEEGW-------PERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRC  746
                         +E W        E      W +W  RN+ +F       +    +L   
Sbjct  531   ----------AIQEMWSRSSTAEAELMIVYCWVIWSARNKFIFEGK----KSDSRFLAAK  576

Query  745   DSETAAAFEERHWPLQRH---NRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVL  578
                   A++    P   H   +RG +++  W+ P +  LKLN D + ++  Q    G ++
Sbjct  577   ADSVLKAYQRVSKPGNVHGAKDRGIDQQ-KWKPPSQNVLKLNVDAAVSTKXQKVGLGAIV  635

Query  577   RDTHGN-WCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK  401
             RD  G     G      R   ++AEA  +  GL++A +  +  +++E D K +VE L   
Sbjct  636   RDAEGKILAVGIKQAQFRERVSLAEAEAIHWGLQVANQISSSSLIVESDCKEVVELLNNT  695

Query  400   ETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
             +  + + + I+    +E+++F  V F  I R  N  A  LAK+AL
Sbjct  696   KGSRTEIHWILSDVRRESKDFKQVQFSFIPRTCNTYAHALAKFAL  740



>ref|XP_008391838.1| PREDICTED: uncharacterized protein LOC103454030 [Malus domestica]
Length=1374

 Score =   189 bits (480),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 175/608 (29%), Positives = 260/608 (43%), Gaps = 50/608 (8%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW-G  1790
             D+I ARL GW  + LS AG+  + K+V  A+P Y M    LP GVC ++EK  R + W G
Sbjct  701   DKIEARLAGWSEQFLSQAGKEVMIKAVAMALPNYAMSCFKLPIGVCRDVEKAVRSYWWRG  760

Query  1789  RDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
               ++ G +  S   WD +   K+ GG+G +++   N A + K+GWRL   P +L A  L 
Sbjct  761   NTQKRGCHWTS---WDRLMKQKSAGGMGFKDIQCFNLAFLAKIGWRLIQNPTSLLATVLK  817

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLT----  1442
              KY +         + R+ S  WKGI      L+ G+   V +G+S     D WL     
Sbjct  818   DKY-YPGKCFKDAGKGRNTSWGWKGIFEGHMVLQHGVRWRVGDGESINIQKDPWLPTPTT  876

Query  1441  --AKPLYEKLRGTLGLPELYATVNEYWDKV-RGWKWEKIQRYLPTEELERLASLCLTEEN  1271
               AKPL + L  T         V +  D + + WK E I      +E  ++ S+ L++  
Sbjct  877   FLAKPL-DSLEET--------KVRDLIDPISKSWKEEVILAGFNRDEARKILSIPLSKSG  927

Query  1270  TPDGWGWSPDPRGCFSVKSAYGWADNAARQEA---------------DKVWGLIWSLRVP  1136
               D   W     G +SVK+ YG   N     A               +  W  IW L+ P
Sbjct  928   CIDRLVWHYTVNGDYSVKTGYGVVMNLMENGALGKKGRGAPSEHRKNNLTWKRIWKLQAP  987

Query  1135  ARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSL  956
              +I  FIW   +  +   +   RR I     C  C    E  +HLF +C    R W  S 
Sbjct  988   NKIKFFIWKCCNKALAVRHNLQRRQIRVENICGVCNTFDESENHLFFQCEFSHRFWFGSP  1047

Query  955   QRRTEESMRNLDW-NSWLTMNLKGDRQQGFEEGWPE-RFGTRLWWLWKWRNEAVFN-RNL  785
                    +  +D+  SW  +       +  EE   E  FG  LW LWK RN+ VFN  + 
Sbjct  1048  LHINSHELAGVDFLESWDKICTSTKNMEKAEEILQEVAFG--LWRLWKNRNDVVFNGVHR  1105

Query  784   LPLEQKLDWLRRCDSETAAAF-----EERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDG  620
               LE  + W R+  SE   A       + +   +        +L W KP  G +K+NTD 
Sbjct  1106  QHLEVMMLW-RKNISEYREAMPLNLKSDCYLISKTLKTVQRPKLHWTKPKFGIIKVNTDA  1164

Query  619   S-CTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVA-EAWGVLQGLRMAKEYGARRIM  446
             + C S  +   G V RD  G          G C S  A EA  +   L    + G  +++
Sbjct  1165  AWCGSSLRTGVGWVGRDFAGLLQFAGGSGTGICHSAAAVEACAIRSALMACIDNGFDKVI  1224

Query  445   IECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
             I+ D+ ++++ L            I+       +  ++V F  + RE N  A  +AK+AL
Sbjct  1225  IDSDALVIIKMLSKVSPHDYSIECILGDIEVLVQRLMSVTFSFVPRESNLAAHSVAKFAL  1284

Query  265   TTQGGLHI  242
               QGG ++
Sbjct  1285  -QQGGDYV  1291



>ref|XP_008387750.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=670

 Score =   185 bits (469),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 159/578 (28%), Positives = 244/578 (42%), Gaps = 53/578 (9%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             D+I AR+ GW  + LS AG+  L KSV  A+P Y M    LP GVC ++E+  R + W  
Sbjct  42    DKIEARMSGWAEQYLSQAGKEILVKSVAMALPNYAMSCFRLPIGVCRDVERAIRNYXWRG  101

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
             +EQ     +  V+WD +   K  GG+G +++  +N A + K+GWR+   P +L A  L  
Sbjct  102   NEQ--RKGIHWVSWDRLMKQKKAGGMGFKDIQCVNLALLAKIGWRITQNPLSLLASVLXD  159

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             KY     S     + ++ S  WKG+   R+ L+ GL   V NGKS     D WL     Y
Sbjct  160   KYFP-GKSFGEALKGKNTSWGWKGLFEARKVLKLGLRWRVGNGKSINIRKDPWLPXPSTY  218

Query  1426  EKLRGTLGLPELYAT-VNEYWDKV-RGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             + +      P L  T V +  D V   W  + I+     E++  + S+ L+     D   
Sbjct  219   KXIPK----PILEGTMVCDLIDPVTNSWXTDLIELGFQREDVLPILSIPLSHAGIDDRLV  274

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEA---------------DKVWGLIWSLRVPARISMF  1118
             W       FSVK+ Y  A     + A               + VW  IWSL+VP +I  F
Sbjct  275   WHYTTNXIFSVKTGYSLALKLMEEXALGRKGRGAPSESNNLNLVWNNIWSLQVPNKIKCF  334

Query  1117  IWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEE  938
             IW   +  +       RRH+  +  C  C    E  +HLF  C      W  S       
Sbjct  335   IWXCCNNALAVXXNLKRRHMRIDNVCGVCNAINETENHLFFXCEFSHVFWFCSPLHLNSH  394

Query  937   SMRNLDW-NSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
             ++   D+  SW     +       ++   + F   LW LWK RN+ +F        Q LD
Sbjct  395   ALEGSDFLXSWSNFXAQVKDXNNADD-IRQEFXFGLWRLWKNRNDVIFKG---IYRQPLD  450

Query  760   WL---RRCDSETAAAF---EERHWP-LQRHNRGGEERLS-WEKPDEGWLKLNTDGSCTSD  605
              L   R+  SE        E  + P L +  +      + W+KP  G +K+N+D +   D
Sbjct  451   ILEAWRKSTSEYKDCLAREEXDNRPRLPKXIKASXSXCTKWQKPRFGTIKINSDAAWCKD  510

Query  604   ---------GQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARR  452
                      G    G  L    G    G+ +     ++  AE   +   L    E+G   
Sbjct  511   TMXMGLGWLGXXFAG--LLQAAGGIGSGFCH-----SAAAAEVSAIRYALLACIEHGFND  563

Query  451   IMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENF  338
             I+IE D+ ++++ LK +  G    +++ +   KE  +F
Sbjct  564   IIIESDASLVIKMLKKEIEGNRAAHSVAKYAFKEGRSF  601



>gb|ABA97040.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1913

 Score =   189 bits (479),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 158/574 (28%), Positives = 257/574 (45%), Gaps = 72/574 (13%)
 Frame = -1

Query  1951  RLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSG  1772
             R+  W    LS  G+  + K V+ AIP+Y M    LP+ VC ++ K  R F WG D+  G
Sbjct  1350  RIILWGENYLSSGGKEIMLKVVIQAIPVYVMSIFRLPESVCEDLNKLARNFWWGADK--G  1407

Query  1771  NNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHR  1592
               K    AW  +T  K  GGL  R+    N+A + +  WRL  +P++L A+ +  KY+  
Sbjct  1408  KRKTHWRAWSCLTKPKHNGGLAFRDFRLFNQALLARQAWRLLDKPDSLCARVMKAKYYP-  1466

Query  1591  SGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----TAKPLYE  1424
             +GS + T    + S  W+ I      L+ G+   + NG+S R W D W+    + +P+  
Sbjct  1467  NGSLVDTAFGGNASPGWRAIEHGLALLKKGIVWRIGNGRSVRIWRDPWIPRDHSCRPITT  1526

Query  1423  KLRGTLGLPELYATVNEYWDKVRGWKWEKIQR-YLP--TEELERLASLCLTEENTPDGWG  1253
             K    +        V++   +   W  +K+ R +LP   +E+ ++ +    EE   D   
Sbjct  1527  KRNCRVKW------VSDLLGQDGSWDVQKVSRVFLPIDADEILKIRTSVRLEE---DFLS  1577

Query  1252  WSPDPRGCFSVKSAY------GWADNAAR---QEADKVWGLIWSLRVPARISMFIWLVKH  1100
             W PD  G FSV+SAY       +AD ++    Q   K+W LIW   VP ++ +F W   +
Sbjct  1578  WHPDRLGQFSVRSAYKLAISLDYADESSSSSGQNPQKIWDLIWKCNVPQKVKVFCWRAAN  1637

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
               +     + +R++  +E C  C  + ED+ H   RC     +W         E+M+   
Sbjct  1638  NCLANQENKKKRNLERSEICCICGNETEDVSHALSRCPHAVHLW---------EAMKAA-  1687

Query  919   WNSWLTMNLKGDRQQG---FE--EGWP--ER--FGTRLWWLWKWRNEAVFNRNLLPLEQK  767
                 L++N+ G+   G   F+  E  P  ER      LW +W  RNE    +   P+   
Sbjct  1688  --GSLSLNVAGNATGGSWFFDQIENTPAEERMMLCMMLWRIWFVRNELYHGKVPPPIAVS  1745

Query  766   LDWLRRCDSETAAAFEERHWP----------LQRHNRGGEER--------LSWEKPDEGW  641
               +L   +S  ++  E +  P          +Q+  R   E           WEKP  GW
Sbjct  1746  KRFL---ESYCSSLLEIKQHPHADVVRGKHVVQQPTRMRSEANHLRRVVPARWEKPQMGW  1802

Query  640   LKLNTDGSCTSD-GQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKE  467
             +KLN DGS  S+  +   G VLRD+ G         + RC+S + +E     +G+ +A +
Sbjct  1803  MKLNVDGSYDSNSSKGGIGVVLRDSVGTVIFSACGFLERCSSPLESELLACKEGINLALQ  1862

Query  466   YGARRIMIECDSKMLVEALKGKETGQEQNNNIVR  365
             +    I++E D  + V  ++  +    Q   +VR
Sbjct  1863  WTLLPIILESDCLIAVNMIQSVKKEMSQLAYLVR  1896



>ref|XP_004959141.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Setaria 
italica]
Length=950

 Score =   186 bits (473),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 171/601 (28%), Positives = 262/601 (44%), Gaps = 61/601 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L DR+  R+ GWK K LS AG+ TL K+V  AIP Y M    + K V  EI     RF W
Sbjct  343   LKDRVWKRIHGWKEKLLSKAGKETLIKAVAQAIPSYAMACFDITKSVSDEISTMICRFWW  402

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
              + E+   NK+  V+W+I+++ K  GGLG RNLH  N A + K  WR+   P +L A+ L
Sbjct  403   AQMEK--ENKVHWVSWEILSSRKDEGGLGYRNLHLFNLAMLAKQAWRILQNPESLCARLL  460

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSW----L  1445
             T +Y   SG  L  +    IS  W+ I    + L++GL   + +G   R W D W    +
Sbjct  461   TAQYCP-SGDLLQVSEGSGISYTWRSIVRGFKALKNGLIWRIGDGSQVRIWDDPWIPTGI  519

Query  1444  TAKPLYEKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENT  1268
             + +P     RG++    L + V E  D + G W  + ++     E++  + S+ +     
Sbjct  520   SRQP--RTPRGSV----LLSKVEELIDPITGTWDSQLVREIFWEEDVPNILSIPV-RIGR  572

Query  1267  PDGWGWSPDPRGCFSVKSAYGW-ADNAARQ-------------EAD---KVWGLIWSLRV  1139
              D   W  D +G FSV+SAY    D   RQ             E D   + W  +W L  
Sbjct  573   DDVIAWHHDRKGMFSVRSAYHMLVDEERRQRKYQQGESSVCCREGDHETQKWKKLWKLPC  632

Query  1138  PARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR--  965
             P ++  FIW + H  +       RR +  +  C  C    ED  H F +C  + R WR  
Sbjct  633   PPKVRHFIWRLAHNSLPLKQNIKRRGVFLDTRCPVCMRFDEDGGHCFLKCKLIKRCWRIL  692

Query  964   ----HSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF  797
                   L   + +S ++  WN               E+    +    LW  W  RN+   
Sbjct  693   EMEQTRLALLSSKSSKDFVWNVL-----------QLEQSLACKVSLLLWKWWDVRNKVNA  741

Query  796   NRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGS  617
                +    Q +  +     E A   E    P  +       +  W +P +G LK+NTDG+
Sbjct  742   GDPI----QNIQNVCHSVLEMAGLLE---LPTIKIRPTARLQQRWLRPPQGVLKINTDGA  794

Query  616   -CTSDGQASCGGVLRD-THGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMI  443
                +    + G ++RD T  +   G         + +AEA+G L+ L  A+ YG   + +
Sbjct  795   FVKATKHGAWGFIIRDYTGAHVLAGAGNANLLHDALMAEAFGCLKALETAELYGISHVQL  854

Query  442   ECDSKMLVEALKGKETGQEQNNNIVRRCIKE--AENFLAVVFLHIYREQNKLADKLAKWA  269
             E DS +L EA+   +T    +  ++ R I+   A  F+ +    I R  N  A +LA+  
Sbjct  855   EVDSSVLKEAITC-DTHDRGHCGVIFRDIRNLLANEFVCLAVSLIPRCTNSSAHELARLG  913

Query  268   L  266
             L
Sbjct  914   L  914



>ref|XP_008222990.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=346

 Score =   177 bits (450),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/339 (29%), Positives = 161/339 (47%), Gaps = 6/339 (2%)
 Frame = -1

Query  1177  ADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLF  998
             +D  W  +W LR+P ++ +F WLV  G++L+N +R RR ++ +  C +C    E + H+ 
Sbjct  9     SDVAWTFLWKLRIPPKLHIFFWLVFQGKILSNEQRVRRQLSLDASCGSCHWPMESILHIL  68

Query  997   RRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWK  818
             R C    ++W   L          +D+  WL +NL           W   F    W++WK
Sbjct  69    RNCVKAKKVWNALLNSSQSARFFTIDFQPWLRVNLMSKIVWADGIPWNLVFVFTCWYIWK  128

Query  817   WRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWL  638
             WRN  VF+R+    E   D ++   +     F+  +    +  +  E   +WE P  G  
Sbjct  129   WRNHYVFHRD---EELAFDSIQIITAAMKEWFKTSNVSSTKCAK-VEAWFAWEPPPAGVF  184

Query  637   KLNTDGS-CTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYG  461
             KLN DGS   + G    GG+LRD   +WC G+   +G+     AE WG+  GLRMA   G
Sbjct  185   KLNVDGSRKVAYGHIGAGGMLRDVSSDWCSGFAVNLGKGQILEAELWGLFFGLRMAVAKG  244

Query  460   ARRIMIECDSKMLVEALKGKET-GQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADK  284
                ++ E DS + ++ ++  ++       ++V  C +  +        HI+RE+N +AD+
Sbjct  245   FNNLIFEMDSVVAIQLVQQHDSLTLHPLASLVSSCWQLMQQLENCSLHHIFREKNSVADR  304

Query  283   LAKWALTTQGGLHIFEVPPGEFEVRMALDRLGASSPRRV  167
             LA W+     G+ +F+  P      +  D LG S PR +
Sbjct  305   LAAWSYNLDLGICVFDEAPSWIGTSLVDDLLGVSRPRLI  343



>ref|XP_010463404.1| PREDICTED: uncharacterized protein LOC104744076 [Camelina sativa]
Length=751

 Score =   184 bits (468),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 168/596 (28%), Positives = 265/596 (44%), Gaps = 51/596 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DRI  +   W ++ LS AG++T+ KSVL+A+P YTM    LP  +C  I+    RF W
Sbjct  176   IVDRIKQKALSWSSRFLSTAGKLTMLKSVLSAMPTYTMSCFHLPGLLCKRIQSALTRFWW  235

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D  +   KMS +AW  IT     GGLG+R++   N+A + KL WRL T+P+TL A+ L
Sbjct  236   --DTNTEKKKMSWIAWRKITKPTKFGGLGIRDIKHFNKALLAKLSWRLLTKPHTLLARVL  293

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL-TAK  1436
               KY  ++ S L      S S+ W+ I   R+ L+S L  V+ +G +T  W   WL T+ 
Sbjct  294   LGKY-CKNLSLLDCKIPSSASHGWRSIGMGRDLLKSKLGRVIGSGANTPIWRTPWLSTSS  352

Query  1435  PLYEKLRGTLGLP----ELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENT  1268
             PL       +G P    +     +      RGW  + I+  LP  E + L  L  + +  
Sbjct  353   PL-----APIGPPTEASQHLNVADLLLPNSRGWNVDLIKHILPAFEQDILL-LKPSFQGA  406

Query  1267  PDGWGWSPDPRGCFSVKSAYGWADN-----------AARQEADKVWGL-IWSLRVPARIS  1124
              D W W P   GC++ KS Y  + N               E    W   IW+L+   +  
Sbjct  407   EDIWAWLPTKDGCYTAKSGYFESTNHEPEPPVTNPIIPSSELQFDWQRNIWALKTSPKTK  466

Query  1123  MFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW-----RHS  959
             + +W      +        R I+ +  C  C  + E + HLF  C    +IW     + S
Sbjct  467   LLLWKASQNALPVGANLLHRAISESAKCPYC-DEEETITHLFFHCAFARKIWELLPVKTS  525

Query  958   LQRRTEESMRN-LDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLL  782
             +Q     S+R  ++ ++ L          G    W       LW +W  RN+ +F++  +
Sbjct  526   IQLNDVTSIRQGIEVSNRLICLPPTGVGTGPISPW------LLWSIWSSRNQLIFSKRRI  579

Query  781   PLEQKLD--WLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTS  608
               ++ L    +R  + + A     R  P Q+ +          +P+   L   TD +  +
Sbjct  580   SEDETLQIALVRAKEWQNAQVSCVRPDPPQKSHLNPPN----PRPN---LICFTDAAWRN  632

Query  607   DGQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIECDS  431
             D  A  G V +  +    +  +  +   +S + AEA   L  +R+A E     +    DS
Sbjct  633   D-VAGLGWVFKGPNDLVIKEGSASMNHVSSPLMAEALETLTAIRVALESNITELSFASDS  691

Query  430   KMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALT  263
              MLV+AL  K   +E +  +    +  + NF +  F  I R QN+ AD LAK AL+
Sbjct  692   LMLVQALNKKIQLKELHGTL-HDVLDLSSNFTSCSFNFISRSQNQQADCLAKEALS  746



>ref|XP_010670096.1| PREDICTED: uncharacterized protein LOC104887198 [Beta vulgaris 
subsp. vulgaris]
Length=1298

 Score =   187 bits (475),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 154/576 (27%), Positives = 254/576 (44%), Gaps = 22/576 (4%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +RI  +++GWK K+LS  G+  L K+V+ AI  Y M    +P+G+ +EI     RF W
Sbjct  734   LKERIWKKIQGWKEKSLSRPGKEVLLKAVVQAILTYMMSVFKIPEGLINEIHTLMARFWW  793

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +     KM   +W  +   K  GG+G  NLH  N+A + K  WRL T P +L  K L
Sbjct  794   GSTDT--QRKMHWSSWAELCKPKAMGGMGFCNLHVFNQALLAKKIWRLHTNPTSLLHKLL  851

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLT---  1442
               +Y  +    L   R    S +W+ +   +  L  GL   V +G +   W ++W+    
Sbjct  852   KARYF-KHDEVLNARRGFDPSYSWRSLWGAKSLLLEGLQWRVGDGVNISAWENAWVPGCR  910

Query  1441  AKPLYEKLRGTLGLPELYATVNEYWDKV-RGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
             A P+   +       EL   V +  +     WK   + +    E+ +R+    L+   T 
Sbjct  911   AAPIPRSMESK----ELIVNVADCIEPNGSTWKQHLVSQCFSDEDGQRILKTPLSIFPTN  966

Query  1264  DGWGWSPDPRGCFSVKSAYGWA---DNAARQEADKVWGLIWSLRVPARISMFIWLVKHGR  1094
             D   W     G ++VKS Y +    +    Q  ++VW ++W L  P ++S F+W V  G 
Sbjct  967   DIRYWGCTKDGVYTVKSGYWFGLLGEGVLPQTLNEVWKIVWKLGGPPKLSHFVWQVCKGN  1026

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN  914
             +       RRHI  +E C +C  + E ++H+   C  +  +W +    +  + +R     
Sbjct  1027  MAVKEVLFRRHIAQDEICMSCGIEVESINHVLFECEAIGDVWANC---KHGDIVRAAPSG  1083

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLL-PLEQKLDWLRRCDSE  737
             S+ +  L    +   EE       T  W +W  RN+ ++   +L P      +LR  D E
Sbjct  1084  SFASKLLWWVNEVSLEE--VREITTIAWAVWFCRNKLIYAHEVLHPQVMATKFLRMVD-E  1140

Query  736   TAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGNW  557
               +  +    P   ++  G    +W +P    +K+N D         S G V+RD+ G  
Sbjct  1141  YRSYSQHVFSPTSINSGNGGLVSTWIRPSLDVIKINVDAHILEGRYVSLGVVIRDSSGAV  1200

Query  556   CRGYTYRI-GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQN  380
                 T RI G   S++AEA     GL+MA+ +G  ++ +E D+  LV A      G    
Sbjct  1201  LLMATKRIVGSEESSMAEAEAARYGLQMARRFGYDKVWLESDALALVLASHHNVVGFSPL  1260

Query  379   NNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKW  272
               +       + +F++    HI R  N +A  +A+W
Sbjct  1261  YLLYDDIRVLSMSFISFRISHIRRVGNSVAHLVARW  1296



>ref|XP_009140200.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1086

 Score =   187 bits (474),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 170/595 (29%), Positives = 263/595 (44%), Gaps = 63/595 (11%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DRI  +  GW  K LS AG++ + KSVL  +P Y+M    LP+ +C  I+    RF W
Sbjct  517   IVDRIKVKSSGWSNKFLSTAGKMVMLKSVLTPVPSYSMTCFKLPRSLCKRIQSAVTRFWW  576

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D +SGN KM+ V+WD +T  K  GGLG R+  + N A + KLGWR+   P+ L ++ L
Sbjct  577   --DGRSGNRKMAWVSWDKMTKSKQDGGLGFRDFESFNDAYLAKLGWRIHNNPSGLLSRVL  634

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
             T KY   +   L    R + S+ W+G+   R+ + S     + NG+S   W D WL+   
Sbjct  635   TGKYCTDT-PFLQVAHRSAESHGWRGVLIGRDLMMSNAGWALGNGESINIWSDPWLSHS-  692

Query  1432  LYEKLRGTLGLPELYA--TVNEYW-DKVRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
               E+ R     PE +   TV +        W  E IQ+  P EE  R+ SL  ++ +  D
Sbjct  693   --EQARPMGPAPEQFIHWTVKKLMLPNGTDWNREIIQQVFPHEE-ARILSLKPSKTDVAD  749

Query  1261  GWGWSPDPRGCFSVKSAYGWA--------DNAARQEADKVWGLIWSLRVPARISMFIWLV  1106
                W     G ++ KS Y  A              E D   G IW+L+   +I +F+W +
Sbjct  750   KLIWLGTTSGEYTTKSGYLKALELNDTNPIPPTTVEVDWKKG-IWNLQTAPKIKLFLWKI  808

Query  1105  KHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRN  926
               G +        R+I S + C  C    E ++HLF  C     +WR +      ++   
Sbjct  809   FKGALPVGEALAVRNIGSAQTCALC-DSNESINHLFLHCDFAYNVWRLAPFSTCIDARGL  867

Query  925   LD----WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKL--  764
             LD    W   L ++L      G    W       LW LW  RN+ +FN      E+ +  
Sbjct  868   LDLSTAWLGLLGISL------GPLAPW------ILWALWLARNDRIFNNKGTTPEEVITK  915

Query  763   ------DWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDG  602
                   +WLR          E+ + P+ R+N   +  L        +  L +D +  SD 
Sbjct  916   ATAAAQEWLR----------EQGNEPIIRNNPPPQRPLD----TAHYACLQSDAAWRSDL  961

Query  601   Q-ASCGGVLRDTH-GNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSK  428
               A  G ++ + H  +    + + +   +  +AE   + + +      G R +  E DS 
Sbjct  962   HLAGLGWMVTEGHQASSLMSHCFYVS--SPLIAEGLALREAMFYCIAKGLRAVKCESDSL  1019

Query  427   MLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALT  263
              L+ AL  +ET   +   I+   +     F  V F+ I R +NK AD LAK AL+
Sbjct  1020  QLIRAL-NEETPISEIYGIIADILNLVVAFDYVSFVWIPRSENKAADALAKQALS  1073



>ref|XP_010693635.1| PREDICTED: uncharacterized protein LOC104906563 [Beta vulgaris 
subsp. vulgaris]
Length=1307

 Score =   187 bits (475),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 150/580 (26%), Positives = 261/580 (45%), Gaps = 31/580 (5%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++ R +++L  WKA +LS AGR  L ++ L     + MQ+  LPK   S ++K  R F W
Sbjct  728   VVSRANSQLTKWKANSLSQAGRAVLIQANLATKANFQMQSFFLPKTTLSRLDKIYRDFFW  787

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
              +D  S +   +L+ WD +   K  GG+G R     N A  MKL W+L  + N++W K +
Sbjct  788   NKDVSSKSP--NLIGWDRVCRPKVCGGIGFRKAGVNNVALQMKLLWKLVKDNNSMWVKLV  845

Query  1612  TTKYHHRSGSHLVTTRRRSISN-AWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK  1436
               KY       L   +  ++++  W+ +   RET + GL   + +G    FW D+W+  +
Sbjct  846   KNKYFKNKS--LFEYKPTAVASWQWRQLMRLRETFKKGLRWQLGSGSQISFWHDNWVF-Q  902

Query  1435  PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
              L + +      P  +   + + D  R W    ++  +P   +  ++SL +   +  +  
Sbjct  903   FLLKAVVHRASYPVNFKVSDCFLDN-RQWNVSLLRANVPEHMVTTISSLYIPMNDQQNKL  961

Query  1255  GWSPDPRGCFSVKSAYGWADNAARQEADKV-WGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
              W   P G +SVK+    A        ++V +  IW + VP +I +F+W + +  + T  
Sbjct  962   VWGLSPDGDYSVKTGALLAQGLLPSPPEEVEFRWIWKVDVPPKIKIFLWKLCNDGLPTKD  1021

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRR---TEESMRNLDWNSW  908
                + H+   + C  C    E   HLF  C     ++ H    +       + N+  +S 
Sbjct  1022  RLEKSHVFLPQQCVLCTSHCETATHLFCLCPFTSDVFLHLQASKGWPCLPGLANVSASSS  1081

Query  907   LTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAA  728
                 L+  +    ++   E   T  W++W +RN+ +FN      E+ +   R      A 
Sbjct  1082  FLDVLRLLKASLLKQDL-EMIVTVWWFIWFFRNKLIFN------EESVS-SRSASFAIAE  1133

Query  727   AFEERHWPLQRHN--------RGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRD  572
              + +   P  +          R G   L W  P  G  K+N DGS  S G A+ G V+RD
Sbjct  1134  IYAKALRPKSKEGGKGAKGSPRSGPSCL-WSPPPSGVAKINFDGSKLSSGHATLGFVIRD  1192

Query  571   THGNWCRGYTYRIGRCTSTV--AEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKE  398
               G+     +  +G C+ +V  AEAWG+L+ +R A+      ++IE D+  ++ A+    
Sbjct  1193  HLGDVLLAGSNSLG-CSLSVLQAEAWGLLEAVRGARSLDISNVVIEGDNLAVINAVNSVW  1251

Query  397   TGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLA  278
                 + +NI+    +E   F +V   H +RE N+ AD +A
Sbjct  1252  RTPWEIDNIICDIGQELRKFNSVTVKHCFREANRAADFMA  1291



>ref|XP_008367519.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=822

 Score =   184 bits (468),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 147/492 (30%), Positives = 219/492 (45%), Gaps = 32/492 (7%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW-G  1790
             +RI +R+ GW  + LS AG+  L K V  A+P + M    LP GVC +IEK  R + W G
Sbjct  270   ERIESRMTGWAEQFLSPAGKEILIKXVATAMPNHAMSCFKLPIGVCRDIEKAIRXYWWRG  329

Query  1789  RDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
              + + G +  S   WD +   K  GGLG ++    N A + K+GWRL   P++L A  + 
Sbjct  330   SEXRRGVHXTS---WDRLIQKKCLGGLGFKDFQCFNLAFLGKIGWRLIIFPDSLLASVMR  386

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
              KY+        T  R S S  WKGI   R+ LE GL   V +G++ +   D W      
Sbjct  387   DKYYPEKSFREATIGRGS-SWGWKGILEARKVLEKGLIWRVGDGETIKIREDPWFPMXST  445

Query  1429  YEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGW  1250
             + ++R  + L  LY + +    + + WK + I     +EE   + S+ ++   + D  GW
Sbjct  446   F-RIRPAVNLGALYVS-BLINQESKTWKADLISACFSSEEANTILSIPISXFGSCDRMGW  503

Query  1249  SPDPRGCFSVKSAYGWA---------------DNAARQEADKVWGLIWSLRVPARISMFI  1115
                  G +SVKS YG A                 + + + +K+W  IW L VP ++  FI
Sbjct  504   FHXXNGXYSVKSGYGIALELMXSGGLGKKGRGAPSXKTKYNKIWNAIWRLDVPRKMRFFI  563

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEES  935
                 +  +       RRH+  +  C  C    E  +H+F RC         S  +     
Sbjct  564   XKCXNHALAVRRNLKRRHMRVDNICGVCGXVDETENHIFFRCETSHLFXFCSPLQINSFD  623

Query  934   MRNLDW-NSWLTM-NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
             +   D+  SW+   N   D     E      FG  LW LWK RN+A+F+ + LP  + L+
Sbjct  624   LEGADFLQSWVNFCNRVADLANTNELLQEFVFG--LWRLWKNRNDAIFSGSFLPPTEILE  681

Query  760   WLRRCDSETAAAFEE----RHWPLQRHNRGGEER-LSWEKPDEGWLKLNTDGS-CTSDGQ  599
               +    E  AA E        P    + G   R + W KP  G +K+NTD + C    +
Sbjct  682   VWKXNVXEYRAANEXVDXGSKVPAXNGDLGVVRRQVXWXKPCFGMIKVNTDAAWCKESQK  741

Query  598   ASCGGVLRDTHG  563
             A  G V RD  G
Sbjct  742   AGLGWVARDFXG  753



>ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis]
Length=2303

 Score =   188 bits (477),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 156/590 (26%), Positives = 257/590 (44%), Gaps = 51/590 (9%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             R+ +++  W+ K  S  G+  L K+V  A+P Y M    LPKG+C EI+    +F WG  
Sbjct  748   RVLSKINNWQHKMFSSGGKEILIKAVAQAVPAYAMSVFKLPKGLCEEIQSEIAKFWWG--  805

Query  1783  EQSGNNKMSL--VAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
               S  +K  +    WD ++  K+RGGLG R+  + N+A + K GWRL   PN+L +K L 
Sbjct  806   --SKKDKRGIHWARWDKLSCAKSRGGLGFRDFISFNQAMVAKQGWRLIQFPNSLVSKVLR  863

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
              +Y  +S S L      + S  W+ I   R+ ++ G    + NG +   + D+W+  +P 
Sbjct  864   ARY-FKSCSFLDAKPGSNPSFIWRSILWGRQVIQKGARWRIGNGSNILVYKDNWI-PRPD  921

Query  1429  YEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGW  1250
               K      LP +  TV E  D    W   K+ ++   E+ E +  + L      D   W
Sbjct  922   TFKPISPPTLP-IDTTVGELMDDENNWNVAKLNQHFMQEDTEAILKIPLPRSQKVDEMMW  980

Query  1249  SPDPRGCFSVKSAYGWA------DNAARQEAD-KVWGLIWSLRVPARISMFIWLVKHGRV  1091
               D  G +SVKS Y  A      D  +   ++ K W  +WS+ +P ++ +F+W      +
Sbjct  981   HYDKHGEYSVKSGYQIALKLKAPDEPSNSGSNSKRWKAVWSMELPEKMKIFMWRAARNLL  1040

Query  1090  LTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD---  920
              T     +R    +  C  C  + E + H    C    +IW H+       + +N D   
Sbjct  1041  PTAENLWKRKCLKDPICQGCNREVETVRHALLDCKAARKIWYHATSSVQISNAQNQDILE  1100

Query  919   -----WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWL  755
                  W++W     K ++   F            W +W  RN+ +F       E K    
Sbjct  1101  FIYEVWSTW--GKTKAEQTIAF-----------CWAIWFARNKRIF-------EGKKSDP  1140

Query  754   RRCDSETAAAFEERHWPLQR-----HNRGGEERLSWEKPDEGWLKLNTDGSCTS-DGQAS  593
             R   ++  +  E  H   +      HN     +  WE P   +LK+N D +  + D  A 
Sbjct  1141  RASAAKAESLLEAYHRARKPDASHIHNVKRIVQKKWEPPPGNFLKVNVDAAINNRDQVAG  1200

Query  592   CGGVLRDTHGNWCRGYTYRIG-RCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVE  416
              G V++D  G      T ++  R   + AEA  +  GL++A+E     +++E D K +V+
Sbjct  1201  LGAVIKDPSGKIVAAGTKQVPLREGVSFAEAEAMEWGLQIARELSLSALIMETDCKEVVD  1260

Query  415   ALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
              L   +  +   + ++    ++  +F  V F HI R  N  A  LAK A+
Sbjct  1261  LLNNTKGSRTGISWVISDIQEQRRDFKEVKFRHIPRTCNTCAHSLAKLAV  1310



>ref|XP_008355389.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=883

 Score =   185 bits (469),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 174/626 (28%), Positives = 264/626 (42%), Gaps = 70/626 (11%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW-G  1790
             D++ ARL GW  + LS AG+  L K+V   +P + M    LP GVC ++EK  R + W G
Sbjct  270   DKMEARLAGWSEQFLSQAGKEVLIKAVAMXLPNFAMSCFKLPIGVCRDMEKAVRSYWWRG  329

Query  1789  RDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
               ++ G +  S   WD +   K+ GGLG +++   N A + K+GWRL   P +L A  L 
Sbjct  330   NSQKRGCHWAS---WDKLMKQKSAGGLGFKDIQCFNLAFLAKIGWRLIQNPTSLLANVLR  386

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLT----  1442
              KY +         + R+ S  WKGI   R  L+ G+   V +G+S     D WL     
Sbjct  387   DKY-YPGKCFKDAGKGRNTSWGWKGIFESRTVLQHGVRWRVGDGESINIRKDPWLPTPTT  445

Query  1441  --AKPLYEKLRGTLGLPELYATVNEYWDKV-RGWKWEKIQRYLPTEELERLASLCLTEEN  1271
               AKPL         L E+   V +  D + + WK   I      EE   + S+ L++  
Sbjct  446   FLAKPLDN-------LEEI--KVRDLIDPISKSWKEGVITEGFNREEARTILSIPLSKSG  496

Query  1270  TPDGWGWSPDPRGCFSVKSAYGWADNAARQEA---------------DKVWGLIWSLRVP  1136
               D   W     G +SVK+ YG A N     A               +  W  IW L+VP
Sbjct  497   CLDRLVWHYTVNGDYSVKTGYGVAMNXMENGALGKKGRGASSMLRKNNLTWKRIWKLQVP  556

Query  1135  ARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSL  956
              +I  F+W   +  +   +   RR I     C  C    E  +HLF +C    R W  S 
Sbjct  557   NKIKFFLWKCCNKALAVRHNLQRRQIRVENICGVCNTFDESENHLFFQCDFSHRFWFGSP  616

Query  955   QRRTEESMRNLDW-NSWLTMNLKGDRQQGFEEGWPE-RFGTRLWWLWKWRNEAVFN----  794
                    +   D+  +W  +          EE   E  FG  LW LWK RN+ VFN    
Sbjct  617   LHINSHELAGADFLENWDKICTSTKNMDKAEEILQEVAFG--LWRLWKNRNDVVFNGVHR  674

Query  793   ----------RNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEE--RLSWEKPD  650
                       +N+    + L    +C+ +           L  +N   E+  RL W KP 
Sbjct  675   QHLEVMMLWRKNIYEFREALSLSLKCEDQ-----------LISNNLKTEQSPRLHWTKPK  723

Query  649   EGWLKLNTDGS-CTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQ-GLRM  476
              G +K+NTD + C+S  +   G V RD  G            C S  A     ++  L  
Sbjct  724   FGTIKVNTDAAWCSSSLRTGVGWVGRDFAGLLQFAGGSGTSICHSAAAAEACAIRSALVS  783

Query  475   AKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNK  296
             + E G  +++IE D+  +++ L+ + +       I+       +   +V F  + RE N 
Sbjct  784   SIENGCDKVIIESDALGIIKMLRKESSHDYSIECILGDIEILVQRLTSVTFSFVPRESNH  843

Query  295   LADKLAKWALTTQGGLHIFEVPPGEF  218
              A  +A++AL  QGG ++++    +F
Sbjct  844   AAHSVARFAL-QQGGDYVWDCIGPKF  868



>ref|XP_006491472.1| PREDICTED: uncharacterized protein LOC102626455 [Citrus sinensis]
Length=1452

 Score =   187 bits (474),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 145/585 (25%), Positives = 256/585 (44%), Gaps = 41/585 (7%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             ++++++  W  K  S  G+  L K+V  A+P Y M    LPKG+C +I+K   RF WG  
Sbjct  865   KVTSKISSWHHKLFSAGGKEILIKAVAQAVPAYAMSVFKLPKGLCEDIQKEIARFWWG--  922

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
              +   + +    WD ++  K RGGLG R+L + N+A + K GWRL   PN+L A+ +  +
Sbjct  923   TKKDKHGIHWARWDSMSKAKRRGGLGFRDLPSFNQALVAKQGWRLVRYPNSLMARVMKAR  982

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y +++ +        + S  W+ I    + ++ G+   + +GK    + D W+     ++
Sbjct  983   Y-YKNSTFWNAKVGSNPSFIWRSILWGSQVIKKGVRWRIGDGKKVLVYKDKWIPRPATFQ  1041

Query  1423  KLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSP  1244
              +     LP     V +  D    W+ ++++++   E++E +  + L      D   W  
Sbjct  1042  PISPK-TLPH-ETVVADLIDSENKWRVDRLEQHFMKEDIEAILKILLPSGKEEDEVLWHF  1099

Query  1243  DPRGCFSVKSAYGWADN-------AARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLT  1085
             D +G +SVKS Y  A N        +   + ++W + W L +P ++ +F+W      + T
Sbjct  1100  DKKGEYSVKSGYQLALNQNFPNEPESSNSSSRLWKIPWMLDLPEKVKIFMWRALKNILPT  1159

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWL  905
                  +R       C  C  Q E + H+   C    +IW  +          N D+ S  
Sbjct  1160  AENLWKRRSLQEPICQRCKLQVETVSHVLIECKAARKIWDLAPLIVQPSKDHNQDFFS--  1217

Query  904   TMNLKGDRQQGFEEGW-------PERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRC  746
                         +E W        E      W +W  RN+ +F       +    +L   
Sbjct  1218  ----------AIQEMWSRSSTAEAELMIVYCWVIWSARNKFIFEGK----KSDSRFLAAK  1263

Query  745   DSETAAAFEERHWPLQRH---NRGGEERLSWEKPDEGWLKLNTDGSC-TSDGQASCGGVL  578
                   A++    P   H   +RG +++  W+ P +  LKLN D +  T D +   G ++
Sbjct  1264  ADSVLKAYQRVSKPGNVHGAKDRGIDQQ-KWKPPSQNVLKLNVDAAVSTKDQKVGLGAIV  1322

Query  577   RDTHGN-WCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK  401
             RD  G     G      R   ++AEA  +  GL++A +  +  +++E D K +VE L   
Sbjct  1323  RDAEGKILAVGIKQAQFRERVSLAEAEAIHWGLQVANQISSSSLIVESDCKEVVELLNNT  1382

Query  400   ETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
             +  + + + I+    +E++ F  V F  I R  N  A  LAK+AL
Sbjct  1383  KGSRTEIHWILSDVRRESKEFKQVQFSFIPRTCNTYAHALAKFAL  1427



>ref|XP_008375089.1| PREDICTED: uncharacterized protein LOC103438319 [Malus domestica]
Length=1384

 Score =   187 bits (474),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 172/633 (27%), Positives = 255/633 (40%), Gaps = 56/633 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L D+  A+L GWK K LS+AGRV L +SV  ++ +++      P  +   + +  R FIW
Sbjct  776   LADKAKAKLTGWKGKLLSMAGRVQLTQSVFQSMLLHSFSVYKWPSSLLRPLSRCARNFIW  835

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D  S   K   V+W  I   K  GGLGLR+L ++N   ++K GW + T  ++ W+  L
Sbjct  836   SGDVTS--KKSVTVSWRQICAPKNEGGLGLRDLGSLNTTXLLKJGWLIITT-DSPWSIYL  892

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               ++      +  + +  SI   W GI +    L      V+ NG +T  W+D WL  KP
Sbjct  893   RERFKLHGRLYSCSYKXSSI---WPGIKSILHILFQNCRWVIGNGSTTSLWVDKWLD-KP  948

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             + + +  T   P L  T      ++  W    I      +  + +  + L  +   D   
Sbjct  949   IVDVVGATEIAPSLSCTKVSNIIRMGKWVIPSIFSSTFPDLTKEILEMPLPIDEDKDVLI  1008

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEADKVWG-LIWSLRVPARISMFIWLVKHGRVLTNYE  1076
             W     G FS    Y   +    +   K W  +IW   +P R S+ +W +   ++ T   
Sbjct  1009  WEVSTSGVFSFSDGY---EIVRHRFPVKSWASIIWRPFIPPRYSILVWKILFNKLPTXDX  1065

Query  1075  RTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR-HSLQRRTEESMRNLDWNSWLTM  899
               RR I     C  C    E +DHLF  C      WR  + Q  T         + WL  
Sbjct  1066  LQRRGIPLAPICQLCHKNSESIDHLFSSCEFAQCAWRWLATQFGTIIPPTGSLSDLWLVF  1125

Query  898   NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFE  719
              L           W       L  +WK RN+  F       E K     R    T+A   
Sbjct  1126  -LSKRFSPHLXNVWIASGFFLLMAIWKMRNKVKF-------EGKPPSXSRLCRSTSAWIR  1177

Query  718   ERHWPLQRHNRGGEER--------------------LSWEKPDEGWLKLNTDGSCTSD-G  602
             +       H RG  +R                      W  P   W+K+NTDG    + G
Sbjct  1178  QVGAJXPGHVRGILDRQLLXSLGISPNSCKAPSIVPXLWHPPPFSWVKVNTDGLAKGNXG  1237

Query  601   QASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKML  422
              A+CGGV RD+ G +  G++  +G  TS  AE   V+  + +A   G + + +E DS  +
Sbjct  1238  PAACGGVFRDSAGYFLGGFSLSLGHRTSFYAELHAVILAVELAHARGWQNLWLENDSSSV  1297

Query  421   VEALKGKETG-----QEQNNNIVRRCIKEAENFLAVVF--LHIYREQNKLADKLAKWALT  263
             +              Q + NN    C    +N   +VF   HI+RE N +ADKLA   L 
Sbjct  1298  ISCFASGSFSPPWSLQTRWNN----CTLHLQN---MVFRCSHIFREGNVVADKLANLGLL  1350

Query  262   TQGGLHIFEVPPGEFEVRMALDRLGASSPRRVS  164
             +   L     PP E    +  D LG  + R VS
Sbjct  1351  SS-SLVWHSTPPIEILPLLHSDFLGMPTYRFVS  1382



>ref|XP_009140970.1| PREDICTED: uncharacterized protein LOC103864947 [Brassica rapa]
Length=1547

 Score =   187 bits (474),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 166/599 (28%), Positives = 271/599 (45%), Gaps = 42/599 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DRI  +   W  + LS AG++T+ KSVL+ IP + M    LP  +C  I+    RF W
Sbjct  973   IVDRIIQKGRSWSNRFLSKAGKLTMIKSVLSPIPSHAMTCFKLPLSLCKRIQAAVTRFWW  1032

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D++ G  KM+ V+WD +T  K  GGLG+R+    N A + KL WR+   P  L ++ L
Sbjct  1033  --DDKEGTKKMAWVSWDKMTQSKEVGGLGVRDFQAFNDAFLGKLSWRILNNPEILLSRVL  1090

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY   + S L  T + +IS+ W+G+   R+ L+  +   V NG S   W + WL+   
Sbjct  1091  LGKYSS-TESFLEVTEKSAISHGWRGVLIGRDLLKDNMGWSVGNGISISIWNEPWLS---  1146

Query  1432  LYEKLRGTLGLPELYA--TVNEYWDK-VRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
             L ++L  T    E  +  TV++ +++  R W    I+R LP  E + + ++  +    PD
Sbjct  1147  LSQQLSPTGPATEETSNFTVSDLFNEHERTWNVTTIKRVLPQWE-QNIINIKPSLSGAPD  1205

Query  1261  GWGWSPDPRGCFSVKSAYGWA-------DNAARQEADKVWGL-IWSLRVPARISMFIWLV  1106
                W     G ++ KS Y  A       D    + A   W   +W+L++  ++  F+W  
Sbjct  1206  KRIWLGTNNGIYTTKSGYHIALKRRRELDGIQTRNALFQWSKGVWNLQIAPKVKFFLWKT  1265

Query  1105  KHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRN  926
                 +        RHI ++  C  C G  E ++HLF  C+    +WR +      +  R 
Sbjct  1266  FQQALPVGEVLRHRHILTDNICKRC-GTPESINHLFLHCNFARDVWRAAPFAGAVDVSRL  1324

Query  925   LDW-NSWLTMNLKG-DRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLR  752
             +D  + WL +  K      G  EG    +   LW +W  RN+ VFN          +W  
Sbjct  1325  IDLKDVWLNLCEKTCLPPTGLAEGSLAPW--ILWQIWSARNQLVFNGK--------NWTA  1374

Query  751   RCDSETAAAFEERHWPLQRHNRGGEERLSW--EKPDEGWLKLNTDGSCTSDGQ-ASCGGV  581
               DS T A  + R W   +       + +     P    + ++TD +  +  Q A  G +
Sbjct  1375  E-DSLTKAIAQAREWNQSQVKPPSTAKKAQVAPPPPPDCITVHTDAAWKASSQTAGLGWI  1433

Query  580   LRDTHGNWCRGYTYR-IGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKG  404
             + +           R +G  ++  AEA  + + L   KE G +RI+ + DS  LV ++  
Sbjct  1434  ISNASSTSSFSKPARHVG--SALCAEALAMREALTKCKELGIKRILCKSDSSQLVSSINS  1491

Query  403   KETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPP  227
               +  E    I+   +  + +F  + F+ I RE+NK AD +AK  L    G+  F   P
Sbjct  1492  GVSNPEL-YGIISDVMDLSFHFDVISFMWISREKNKAADNVAKLCLV---GVEAFMAVP  1546



>ref|XP_004292002.1| PREDICTED: uncharacterized protein LOC101312896 [Fragaria vesca 
subsp. vesca]
Length=2277

 Score =   187 bits (475),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 162/600 (27%), Positives = 259/600 (43%), Gaps = 57/600 (10%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW-G  1790
             D ++ +L GW+ K LS+AGR  L K V  A+P+YTM    LP+G+  E+ +   +F W G
Sbjct  849   DNLTKKLTGWRTKLLSVAGREILIKVVAQAVPLYTMSNYLLPQGMIQELHQLCAKFWWGG  908

Query  1789  RDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
              DE+ G   M   AWD +   K +GG+G  +L   N A + K G RL   P++L  + L 
Sbjct  909   TDEKRG---MHWRAWDALCKPKAKGGMGFHHLFAFNLAMLAKQGRRLLQYPSSLPNQLLK  965

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
               Y     +       ++ S AW+ I   R+TL +G+  ++ +G ST  W D WL  + L
Sbjct  966   AIYFPHC-NFWKAELGKAPSYAWRSILEGRDTLRNGIQRLIGDGMSTNVWDDPWLMGENL  1024

Query  1429  YEKLRGTLGLPELYATVNEYWDKVRGWKWEKI---QRYLPTEELERLASLCLTEENTPDG  1259
                      LP    TV    D         +       P   + ++ +L ++  +  D 
Sbjct  1025  ---------LPFFSDTVTRVSDLFVSPGVGDVVLLSHLFPAHIVHKIQALPISSRSNSDK  1075

Query  1258  WGWSPDPRGCFSVKSAYGWADN-------AARQEADKVWGLIWSLRVPARISMFIWLVKH  1100
             W W+PD +G F VKSAY  A          A   + ++W  IW+  VP ++ + +W V  
Sbjct  1076  WIWAPDRKGLFMVKSAYHIARTRVLEDHVMALNPSAQLWNKIWNAPVPGKVKICVWKVAS  1135

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
               + +    ++R I  +  C  C  + E   H  R C         +  +  +  ++  D
Sbjct  1136  NILPSRSRLSQRGIDIDTQCPFCDEEVESPIHALRDCPHA-----AAFIQLVDVPIQLAD  1190

Query  919   WNS--WLTMNLKGDRQQGFEEGWPERFGTRL---WWLWKWRNEAVFNRNLLPLEQKLDWL  755
              N+  WL  +L         E  P  F T +   W +W+ +N+ V+N N     + +   
Sbjct  1191  TNALDWLVSSL---------ENSPSTFATLMMIIWSVWRNQNDHVWNNNAKQATEVVPLT  1241

Query  754   RRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSC-TSDGQASCGGVL  578
              R   E  +AF      ++R  R    R  W  P  G++KLN D +   +   AS GGV 
Sbjct  1242  LRWWEEFKSAF------VKRRGRNVSPRDRWITPSSGYIKLNVDAAYNNASCMASLGGVF  1295

Query  577   RDTHGNWCRGYTYRIGRCTSTVA---EAWGVLQGLRMAKEYGARRIMIECDSKMLVEALK  407
             RD H   C G  +  G  ++  A   E   +L G+++A  +    + IE D  +LV AL 
Sbjct  1296  RD-HTGSCLG-VFMQGLFSAHSAHHSELMALLVGVQVAIHHNLYPLSIETDCLVLVSALT  1353

Query  406   GKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPP  227
                        ++           A V   + R  N++A  +AK A +    L +F + P
Sbjct  1354  SGSLDDSDLGFLIEDLRASLSTITAPVRF-MRRSANRVAHVIAKEAFSGPANL-VFTIDP  1411



>ref|XP_009121302.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=530

 Score =   181 bits (458),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 116/325 (36%), Positives = 177/325 (54%), Gaps = 26/325 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L+++++RL GWK +TLSLAGRVTL K+VL++IP++ M T  LP     +++  +R F+W
Sbjct  212   VLEKVASRLSGWKKQTLSLAGRVTLTKAVLSSIPVHQMSTICLPASTLDKLDSLSRSFVW  271

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G    SG +   LV+WD I   K  GGLG+R    MN+A + K+GWRL  +  +LWA+ L
Sbjct  272   G----SGQH---LVSWDKICKPKADGGLGIRVSREMNKALIAKVGWRLLHDDKSLWARVL  324

Query  1612  TTKYHHRSGSHLVTTRR---RSISNAWKGIS-AERETLESGLTHVVRNGKSTRFWMDSWL  1445
               KY    G     T R   ++ S+ W+ +    RE +  G   V+ NG+  +FW D WL
Sbjct  325   RGKYV--VGDIQDPTWRVVGKTASSTWRSVVLGIREVVVKGHVWVIGNGRRIKFWTDRWL  382

Query  1444  TAKPLYEKLRGTLGLPELY--ATVNEYWDKVRGWKWEKIQRYLPT------EELERLASL  1289
             + + L E     + LPE +   TV E W    GW   +I  ++        E  ++LA++
Sbjct  383   SGQVLSEA--AIIDLPEGFENITVRELWVDGGGWDLTRISPFISDAPFISEETRQKLAAV  440

Query  1288  CL-TEENTPDGWGWSPDPRGCFSVKSAYGWA--DNAARQEADKVWGLIWSLRVPARISMF  1118
              + T     D  GW   P G FSV++AY     D+A R +    +  +W +    R+ MF
Sbjct  441   VVDTITGAQDRLGWRKTPNGEFSVRTAYNLITRDDAPRPQMRSFFKRMWRVVARERVKMF  500

Query  1117  IWLVKHGRVLTNYERTRRHITSNEY  1043
             +WLV +  ++TN ER RRH++   Y
Sbjct  501   LWLVGNQAIMTNAERFRRHLSIFRY  525



>ref|XP_007203452.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
 gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
Length=1755

 Score =   187 bits (474),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 161/610 (26%), Positives = 261/610 (43%), Gaps = 73/610 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +R+  +L+GW+ +TLS+AG+  L K V  +IP+Y M    LP+G+C EIE+   RF W
Sbjct  1186  LKERVWKKLQGWREQTLSIAGKEVLLKVVAQSIPLYVMSCFLLPQGLCHEIEQMMARFWW  1245

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +Q  N K+  + W+ +   KT GG+G R L   N A + K GWRL   P++L ++ L
Sbjct  1246  G--QQGENRKIHWMRWERLCKAKTEGGMGFRCLQAFNMAMLAKQGWRLVHNPHSLASRLL  1303

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  ++     T   R  S  WK I   R+ LE G    + +GKS R W D W+    
Sbjct  1304  KAKYFPQTNFWEATLGSRP-SCVWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPA  1362

Query  1432  LYEKLRGTL-GLPELYATVNEYWDKVRGWKWEKIQR-YLPTEELERLASLCLTEENTPDG  1259
              +  +   L G+     +     +    W  +K+   +LP + ++ +  + L+    PD 
Sbjct  1363  TFAVITSPLDGMENTKVSELICNEGSPQWDLQKLNNLFLPVDVVD-IVRIPLSIRAPPDR  1421

Query  1258  WGWSPDPRGCFSVKSAYGWA----------DNAARQEADKVWGLIWSLRVPARISMFIWL  1109
               W+ D  G F+VKSAY  A           +++  +   +W  IW+  VP ++ +F W 
Sbjct  1422  IVWNYDKHGLFTVKSAYRVALRVTSGDEDESSSSNSDTGMLWRHIWNATVPTKLKIFAWR  1481

Query  1108  VKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMR  929
             V H  + T     ++ +   + C            +F  C D+     H L      +M 
Sbjct  1482  VAHDILPTKANLIKKGVDMQDMC------------MF--CGDITESALHVL------AMC  1521

Query  928   NLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRR  749
                  +W    L     QG +    E  G    +  ++ +E +                 
Sbjct  1522  PFAVATWNISLLTRHAHQGVQRSPHEVVG----FAQQYVHEFI-----------------  1560

Query  748   CDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSC-TSDGQASCGGVLRD  572
               ++T +   +R            + + W  P  G LK N DG+   + G+ + G V RD
Sbjct  1561  TANDTPSKVTDR----------VRDPVRWAAPPSGRLKFNFDGAFDPTSGRGAVGVVARD  1610

Query  571   THGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKET  395
               G +       +G   S   AE     +G+ +A   G    + E DS ++V A+K    
Sbjct  1611  ADGGFVAAVAKSVGEVLSAEHAEILAAREGVALALSLGTASPIFEGDSAVVVSAIK--RA  1668

Query  394   GQEQNN--NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGE  221
             GQ+ +N   IV       + F + +F    RE N +A +LA++ L        FEVPP  
Sbjct  1669  GQDYSNIGTIVEDVKHLQQQFPSSLFQFTPREANGVAHRLARFGLHNVDNFIWFEVPPDL  1728

Query  220   FEVRMALDRL  191
              +  +  D L
Sbjct  1729  IQDALLCDVL  1738



>ref|XP_004299997.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=448

 Score =   179 bits (454),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 136/459 (30%), Positives = 209/459 (46%), Gaps = 29/459 (6%)
 Frame = -1

Query  1513  LESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTLGLPE----LYATVNEYWDKVRGWK  1346
             + S L+  + +GK  +FW D+W+ + PL +       LP     L +TV ++W    GW 
Sbjct  1     MRSNLSWRIGDGKMVKFWSDTWVLSVPLLQ-----FALPHAVINLSSTVCDFWCDT-GWN  54

Query  1345  WEKIQRYLPTEELERLASLCL-TEENTPDGWGWSPDPRGCFSVKSAYGWADNAARQEADK  1169
              E +   +P E + ++ S     E++  D   W     G FSVKSAY  + + A  +   
Sbjct  55    IEMLSDVVPPEVVNQIISFPTGFEDSGNDQLIWKATSNGVFSVKSAYISSFDMAEPQ-HH  113

Query  1168  VWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRC  989
              W ++W L    ++  F W V H ++LTN +R RR  T++  C  C    E L       
Sbjct  114   YWKVVWKLNCLPKLKTFFWTVLHKKILTNVQRVRRRFTTSAVCPICNSADESL-----HS  168

Query  988   HDVDRIWRH-SLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEG--WPERFGTRLWWLWK  818
               V  + R  +L       +  L W   + ++ +   Q   + G  W   F    W+LWK
Sbjct  169   ETVTGLKRFGNLFAPLLIFLTRLSWAGIIWISAQLFCQSKVKNGIKWCNLFVFVCWFLWK  228

Query  817   WRNEAVFNRN-LLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGW  641
             WRN+ VF+ + ++P +  L      +  T+A            N      LSW +P    
Sbjct  229   WRNKIVFDSSFVMPGDPALVIWNYVEEWTSAQSNP-----SSSNMFNVTYLSWLRPPANC  283

Query  640   LKLNTDGS-CTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEY  464
             LKLN DG+  +S G+   GGVLRD  GNW  G    +G      AEAWG+L GL++  ++
Sbjct  284   LKLNIDGTRSSSSGKIGAGGVLRDHAGNWIFGCQINLGVGEVLYAEAWGLLFGLKLVAKF  343

Query  463   GARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADK  284
                 + +E DS +LV+ ++ +        +++  C         V   HI+RE N +AD 
Sbjct  344   YCSDLEVESDSAVLVQLMQKRSFELHPLGSLLSACSSFMSKMPNVKLSHIFRECNMVADS  403

Query  283   LAKWALTTQGGLHIFEVPPGEFEVRMALDRL-GASSPRR  170
             LAK ++T   GL  F  PP    V+  LD L G    RR
Sbjct  404   LAKCSITHDLGLVTFNSPPVH-AVQAYLDDLDGVVRARR  441



>ref|XP_009114067.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=524

 Score =   181 bits (458),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 128/486 (26%), Positives = 213/486 (44%), Gaps = 28/486 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +++++ A  +GW  K LS  G+  L K+V  A+PI++M    LP+ +C EI     +F W
Sbjct  34    IINKVKAATQGWNKKFLSHGGKEVLLKAVALAMPIFSMNVFRLPRNICDEINSILAKFWW  93

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +++G   M   +W  ++  K  GGLG R+L   N+A + K  WR+   P  L A+ +
Sbjct  94    GSGDKTG---MHWYSWKRVSVPKREGGLGFRDLEKFNQALLGKQVWRIIQNPQCLMARII  150

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y         T +R+S S AWK +   R+ L+ G+  ++ +G +   W D WL   P
Sbjct  151   KARYFPDGNIFTATIKRKS-SYAWKSLIYGRDLLKRGMRFIIGDGSTVNMWADPWLPVHP  209

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
                  R   G   L +  N   +   GW  +K++  +  E++E + SL ++     D  G
Sbjct  210   P-RAPRSRNGTQALESVRNYMLEDGTGWNIDKLRDNVVPEDVEVILSLKISSNAQLDLLG  268

Query  1252  WSPDPRGCFSVKSAYGWADNAARQE-ADKVWG------LIWSLRVPARISMFIWLVKHGR  1094
             W     G ++VKS Y  + +    +  + +WG       +W +  P +I  F+W      
Sbjct  269   WHYTDDGIYTVKSGYWLSTHLPDNDIIEPIWGDPLIKQRVWKMNSPPKIKHFLWKTLSRS  328

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS--LQRRTEESMRNLD  920
             +       RRHIT  + C  C    E   H+   C    +IWR S         S   L+
Sbjct  329   LAVGSNLKRRHITRYDQCMRCCSAIETEQHMLFDCPYAQKIWRASGISSNIINGSYSTLE  388

Query  919   WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDS  740
                   +           +  P      LW +WK RN  +F       ++ + W      
Sbjct  389   EKIEACLTCNRSSSLTHIKDLPIYL---LWRIWKSRNMMMFQ------QRNIQWWSVIHQ  439

Query  739   ETAAAFEERHWPLQRHNRG----GEERLSWEKPDEGWLKLNTDGSCTSDG-QASCGGVLR  575
               A A E   +  +    G     ++ ++W++P EGW+K N DGS  +   Q+  G V+R
Sbjct  440   ANADAAEWSKYSQEEVCNGTRRVTKQSINWQRPREGWMKCNFDGSFYNTATQSRAGWVVR  499

Query  574   DTHGNW  557
             D  G++
Sbjct  500   DNFGSF  505



>ref|XP_006493122.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Citrus sinensis]
Length=765

 Score =   183 bits (464),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 151/585 (26%), Positives = 254/585 (43%), Gaps = 41/585 (7%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             RI  ++  W+A   S  G+  L K+V  A+P Y M    LP G+C +++K    F WG+ 
Sbjct  182   RIINKISNWQANFFSSGGKEILIKAVAQAVPAYAMSVFKLPLGLCEDMQKAIAGFWWGKK  241

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
              +  +   S   W+ +   K RGGLG R+L + N+A + K  WR+   P +L A+ +  K
Sbjct  242   REKRSIHWS--KWERLCQAKKRGGLGFRDLSSFNQALVAKQSWRIIQAPESLVARVMKEK  299

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y  R    +      + S  W+ I   RE +  GL   + +GK  + +   WL  +P   
Sbjct  300   Y-FRHSCFMEAQIGSNPSYIWRSILWGREVIRKGLRWRIGDGKLVKVYQSGWL-PRPETF  357

Query  1423  KLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSP  1244
             K      LP L  TV+   D+ + W+ + I+++   E+  ++  + L  + +PD   W  
Sbjct  358   KPISPPSLP-LDTTVSVLIDEDQCWRDDVIRQHFHQEDAAQILKIPLPRQLSPDQVLWHY  416

Query  1243  DPRGCFSVKSAYGWADN-------AARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLT  1085
             D +G +SVKS Y  A         ++ +E +  W  IW L++P ++ +F+W   +  + T
Sbjct  417   DKKGNYSVKSGYQLALQMKFPNRPSSSKEDNNSWNSIWYLQIPEKVKIFMWRATNDLLPT  476

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWL  905
             +    +R I    +C  C   RE + H    C    +IW+ +     EE ++ L     L
Sbjct  477   SENLWKRRILQTPWCQRCRSHRETIFHSLFDCKASRKIWKLT---TFEEEVKALKCKDVL  533

Query  904   TMNLK-GDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNR-------NLLPLEQKLDWLRR  749
             ++ L   DR+   E    E      W +W  RN  +F         ++   E  +   +R
Sbjct  534   SLLLALADRRSKTEM---ELIVAVCWSIWHSRNLFIFQNKKEDFQLSVAGAEAIVQSYKR  590

Query  748   CDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVLRD  572
                    AF ++     +H         W+ P  GW K+N D +   + Q    G V+R+
Sbjct  591   IQMPQLQAFSDQDLVSHKH---------WKCPPAGWFKVNVDAAIKLENQRVGLGIVIRN  641

Query  571   THGNWCRGYTYR---IGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK  401
             + G +          I R     AEA     GL +A+  G   +++E DSK + + +  +
Sbjct  642   SEGKFITAAIKPSKWIDRV--DYAEAEATRFGLEVAESAGCLPLIVETDSKEVTDLVSAR  699

Query  400   ETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
             ++ + +   IV       +    V   H  R  N  A  LAK AL
Sbjct  700   KSTKAEIFWIVSEVQDTMKRLKHVKLQHSPRACNGFAHTLAKLAL  744



>gb|EPS73861.1| hypothetical protein M569_00896, partial [Genlisea aurea]
Length=1651

 Score =   186 bits (472),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 151/582 (26%), Positives = 251/582 (43%), Gaps = 36/582 (6%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +++ A++  W ++ LS AGR  L K+VL  IP+YTM    LPK    ++     RF W  
Sbjct  1082  EKVEAKIMHWSSRMLSQAGRSVLIKAVLQVIPVYTMSCFLLPKSFLHKLMAAITRFWWS-  1140

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
                SG+ KM  +  + +T +   GGL  R+L   NRA + K  WRL + PN++ ++ +  
Sbjct  1141  --GSGSKKMHWLPREELTVNLAAGGLSFRDLLLFNRAMVAKQSWRLLSHPNSICSRLIKA  1198

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             KY+  S S L+    RS S  W+GI + RE L  GL   + NG S   W D W+   P  
Sbjct  1199  KYYPHS-SFLMAPLGRSPSYVWRGIHSSREVLLGGLRWRIGNGLSVDAWKDPWI---PNT  1254

Query  1426  EKLRGTLGLPELYATV---NEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
                + T   P+   ++   +       GW   ++++     +++ + S+ L + + PD  
Sbjct  1255  FAFKPTSAAPQGVGSILVKDFILSNHSGWNHTRLRQIFSPLDVKHILSIPLAKNSCPDRL  1314

Query  1255  GWSPDPRGCFSVKSAYGWA---DNAARQEADKV-------WGLIWSLRVPARISMFIWLV  1106
              W     G +SVK+ Y      ++  R  + +V       W  +W L++P RI  F W  
Sbjct  1315  IWHYTRHGEYSVKTGYQLLKGREDMLRPSSSQVNHDCILMWRALWKLQLPTRILTFGWRF  1374

Query  1105  KHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH---SLQRRTEES  935
                 +       RR + ++  C  C   RE   H F  C     +WR     +     E 
Sbjct  1375  AKNILPLKENLVRRRVGTDPTCPVCEMDRESWYHAFLTCPFSQAVWRLGGIPMDSVGREP  1434

Query  934   MRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWL  755
             +  +DW       L+ ++  G            LW +W+ R +   N+  L   +    +
Sbjct  1435  LFPVDWLIARFQQLRAEQFSGLL--------VTLWCIWRHRMDHRHNQVTLDPLRTHHLI  1486

Query  754   RRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLR  575
             R     + +AF E+   L         +  WE P  G++KLN D    +      GG++R
Sbjct  1487  RYYVDSSGSAFSEQ---LDPPLLPPLLQQRWECPPVGFVKLNFDSGRCTPSSTGLGGLIR  1543

Query  574   DTHGNWCRGYTYRIG-RCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKE  398
             D  G     ++Y++         EA    + L +A   G  R+++E D   +++AL  + 
Sbjct  1544  DDQGRCQAWFSYQLDTELDPEAGEALAARKILELALAMGFTRVIVEGDCLTVLQALADQA  1603

Query  397   -TGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
              T      N+++  ++  E F A    H  R+ N  A  LAK
Sbjct  1604  VTLFASLGNVLQDSLRLMEQFEACRLSHTRRQFNAAAHHLAK  1645



>ref|XP_009141427.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=554

 Score =   181 bits (458),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 160/561 (29%), Positives = 244/561 (43%), Gaps = 35/561 (6%)
 Frame = -1

Query  1906  VTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSGNNKMSLVAWDIITTD  1727
             + + KSVL+ IP + M    LP+ +C  I+    RF W  D++SGN K++ V+WD +T  
Sbjct  1     MIMLKSVLSPIPSHAMSCFKLPRSLCKRIQSAVTRFWW--DDRSGNRKIAWVSWDKMTNT  58

Query  1726  KTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHLVTTRRRSISN  1547
             K  GGLG R+  + N A + KL WRL   P+ L ++ L  KY    G+ L    R   S+
Sbjct  59    KGDGGLGFRDFESFNDAFLAKLSWRLIHNPSGLLSRVLMGKYGG-DGTFLEAGHRSVESH  117

Query  1546  AWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTLGLPELYATV---N  1376
              WKGI   R+ +       V +G+S   W D WL+   L    R     PE +A +   +
Sbjct  118   GWKGILIGRDLILQNAGWAVGDGESISVWADPWLS---LSAPRRPMGPTPERFANLKVKD  174

Query  1375  EYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWAD  1196
                     W  + IQ+ +P EE   L S+  +   TPD   W     G ++ KS Y  A 
Sbjct  175   LMLPNGSDWNRDLIQQIMPQEEATIL-SIKASRSGTPDKLIWLGTTSGEYTTKSGYLKAM  233

Query  1195  NAARQEADKVWGL-----IWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNC  1031
              ++         +     +W L V  +I +F+W +  G +        R+I++   C  C
Sbjct  234   ESSPTSPPPNRAIDWNKGVWQLEVAPKIKLFLWKIFQGALAIGDRLVTRNISTGTSCKTC  293

Query  1030  AGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN-SWLTMN-LKGDRQQGFEEGW  857
                 E ++HLF  C    ++W+ +      +S R LD N +W  ++ L      G   G 
Sbjct  294   -NNVESINHLFLHCDIAYKVWKLAPFSSCIDSRRLLDLNTAWQGLSKLVCLPPTGISTG-  351

Query  856   PERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGE  677
                    LW LW  RN  +FN  +   E+ +         TAAA E             +
Sbjct  352   -PLAPCILWSLWLARNNRLFNNKISTPEEIV------SRATAAAQEWLKEQRTEPPNTKD  404

Query  676   ERLSWEKPDEGWLKLNTDGSCTSDGQASCGG----VLRDTHGNWCRGYTYRIGRCTSTVA  509
              R+     +    +L TD +  +D Q  C G    ++          Y Y +   +  VA
Sbjct  405   TRVLGPPREMDSSRLQTDAAWRADLQ--CAGLGWTIIEKDQSTTHLSYCYFVS--SPLVA  460

Query  508   EAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAV  329
             EA  V   L   +  G  R+  + DS+ LV+AL  K+   E    IV   +  A +F ++
Sbjct  461   EALAVRDALAHCRALGILRLRCQTDSQQLVKALATKDPNPEI-YRIVSDTLVLASSFDSI  519

Query  328   VFLHIYREQNKLADKLAKWAL  266
              F  + R QN +AD LAK AL
Sbjct  520   SFEWLPRAQNNVADALAKQAL  540



>gb|EEE62189.1| hypothetical protein OsJ_16976 [Oryza sativa Japonica Group]
Length=653

 Score =   181 bits (460),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 156/621 (25%), Positives = 262/621 (42%), Gaps = 81/621 (13%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+DR+  RL  W  K LS+ G+  L KSV+ A+P Y M    LP G C +  K  R+F W
Sbjct  38    LMDRLMKRLSDWAEKFLSMGGKEVLIKSVIQALPTYVMNVFKLPSGFCEDYMKMIRKFWW  97

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E+    K    +W  +   K++GG+G ++L   N+A + +  WRL    ++L AK +
Sbjct  98    G--EEKNRRKTHWTSWQQLIKPKSKGGIGFKDLKIFNQALLARQAWRLIQFLDSLCAKLM  155

Query  1612  TTKYHHRSGSHLV-TTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK  1436
               +Y      HL+ T      S  W+GI    E L+ G+   +  G     W D+W+   
Sbjct  156   KARYF--PNGHLIDTVFPTDSSEVWRGICHGLELLKKGIIWRIGKGDQLHIWRDNWI---  210

Query  1435  PLYEKLRGTLG--------LPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLT  1280
             P   +LR T          + +L +  N+ WD+        I++      ++ +  + L 
Sbjct  211   PRDHQLRVTGKRTRTCLKWVADLVSPNNQEWDE------GLIRQIFYPPYVDEILKIKLP  264

Query  1279  EENTPDGWGWSPDPRGCFSVKSAY--GWADNAARQEA---------DKV-WGLIWSLRVP  1136
             E  T D   W P+  G F+V+SAY  G A+     EA         D+V W  IWS +VP
Sbjct  265   ESPTDDFLAWHPERLGVFTVRSAYKLGLAEEHRANEAGACSSNGNGDRVLWKNIWSAQVP  324

Query  1135  ARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRC-------HDVD  977
              ++ +F W +   R+ T + + +R+I  +  C  C   RED  H    C        ++ 
Sbjct  325   QKVCIFAWRLAVERLPTQHNKQKRNIVPSARCEVCGAPREDGFHATVVCTKAKALRDELR  384

Query  976   RIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAV-  800
               W    + +      +       T++++   Q              LW  W  RN +V 
Sbjct  385   AFWPIPPEDKFVRQGPDWLLLLLDTLDMRNKAQMLL----------MLWRAWHLRNNSVH  434

Query  799   ----------------FNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRG---GE  677
                             + + L P+ QK D   +C ++      +        N G    +
Sbjct  435   DTGTLTISGSIRFLQSYVQLLFPIRQKEDPKGKCAAQVPGRLNQ--------NPGVTKAD  486

Query  676   ERLSWEKPDEGWLKLNTDGSCT-SDGQASCGGVLRDTHGNWCRGYTYRIGRCT-STVAEA  503
                 WE P EGW K+N DG+ + +D     G + RD+ G         + RC  +   E 
Sbjct  487   CLQIWEPPPEGWAKINVDGAFSMTDNTGGIGVIARDSEGKALLSSWKYLHRCADAEQVEI  546

Query  502   WGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVF  323
                 +G+++A E+  + I++E D   ++  +  ++  + +   ++R       +   V  
Sbjct  547   LACYEGMKLAAEWIRKPIILESDCVTVIGRMTAEDEERSRWTFLIRSAKAVMRSLQEVRI  606

Query  322   LHIYREQNKLADKLAKWALTT  260
              H  RE N++A +LA+ A  T
Sbjct  607   QHRKRECNRVAHELAQLAKRT  627



>ref|XP_010495244.1| PREDICTED: uncharacterized protein LOC104772312 [Camelina sativa]
Length=1200

 Score =   185 bits (469),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 167/600 (28%), Positives = 262/600 (44%), Gaps = 58/600 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +++++  R +GW  K LS  G+  L K++  A+P+YTM    +PK +C EIE+    + W
Sbjct  595   IVEKVQNRTKGWNNKFLSHRGKEILLKAIALAMPVYTMNCFKIPKWICEEIERIIANYWW  654

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               + Q   N +  VAWD +   K  GGLG R++   N A + K  WR+   PN+L ++ L
Sbjct  655   --NTQQNGNAVHWVAWDRLKYMKKEGGLGFRDIEQFNEALLAKQAWRILQHPNSLMSRIL  712

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y   S   L  TR    S  W+ +   R+ L+ GL   V +  S + W D WL   P
Sbjct  713   KGRYFSDSNI-LDATRGTQPSFGWQSLLVGRDLLKKGLRFTVGDETSIKTWTDPWLPVHP  771

Query  1432  -----LYEKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEEN  1271
                  L + ++G        +TVN  +   R  W    ++  +  +++  +  +  +   
Sbjct  772   PRPPRLAKNIQGD------SSTVNTLFLPNRSSWNESLVRDKVYLDDVNHILLIKKSHWQ  825

Query  1270  TPDGWGWSPDPRGCFSVKSAYGWADNAARQEAD--------KVWGLIWSLRVPARISMFI  1115
               D  GW     G + VKS Y  A +   QE          ++   IW  ++P +   F+
Sbjct  826   NQDYLGWHYTENGIYPVKSGYWLATHLPEQEFQVRPPYGNPQLKTDIWKTKLPPKFKHFL  885

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEES  935
             W +    + T  E  RRHI++N +C  C    E  +HLF  C +  +IWR S        
Sbjct  886   WRMSFRTLATGDELERRHISTNPFCKRCVHVVETTEHLFFTCPNAMQIWRCS--------  937

Query  934   MRNLDWNSWLTMNLK-GDRQQGFEEGWPERFGTR---------LWWLWKWRNEAVFNRNL  785
               N+   S L  N    D+ +   E + +R             LW +W  RN+ +F + +
Sbjct  938   --NIPIRSLLNPNEHLEDKLKAILEFYKQRSHYDRLSLLPFWILWKIWTSRNKLIFQK-I  994

Query  784   LPLEQKLDWLRRCDSET-----AAAFEERHWPLQRHNRGGEERLS--WEKPDEGWLKLNT  626
                 Q+L  LR    ET           R  P    +    +R S  W+KP  GW+K N 
Sbjct  995   NHTWQRL--LREAKQETDEWLAIIPPPSRVNPQVPCSTISSKRNSSNWQKPPYGWVKCNY  1052

Query  625   DGS-CTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARR  452
             DGS    D QA+ G ++RD  G++         +  S   AE   ++  ++     G   
Sbjct  1053  DGSFLDEDRQATSGWIVRDDQGHFKEAGQVTGAKVKSAFEAECQSLIFAMQQTWRNGYTN  1112

Query  451   IMIECDSKMLVEALKGKETGQEQNNNIVRRCIKE-AENFLAVVFLHIYREQNKLADKLAK  275
             ++ E D + LV A+       +  N I  + IK  A  F  VVF    R+ N LAD+LAK
Sbjct  1113  VIFEGDCQSLVTAINNSSLCFDIYNWI--QEIKGWATRFNNVVFRWTSRQSNHLADQLAK  1170



>ref|XP_007046402.1| Uncharacterized protein TCM_011921 [Theobroma cacao]
 gb|EOY02234.1| Uncharacterized protein TCM_011921 [Theobroma cacao]
Length=926

 Score =   183 bits (464),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 176/626 (28%), Positives = 276/626 (44%), Gaps = 53/626 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ +I  R+ GW+ K LS  GR+TL +SVL+++P+Y +Q    P  V  +IE+    F+W
Sbjct  327   LISKIRDRISGWENKILSPGGRITLLRSVLSSLPMYLLQVLKPPAIVIEKIERLFNSFLW  386

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G D   G  +M   AW+ IT   + GGL +RNL  +  A  +KL WR  T  ++LW   L
Sbjct  387   G-DSNEG-KRMHWAAWNKITFPSSEGGLDIRNLKDVFDAFTLKLWWRFYT-CDSLWTHFL  443

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              TKY      H V  +  + S+ WK I+  R+         +  G+   FW D W+  +P
Sbjct  444   KTKYCLGRIPHYVQPKLHN-SSIWKRITGGRDVTIQNTRWKIGRGE-LFFWHDCWMGDQP  501

Query  1432  L---YEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
             L   +   R  + L      V++++ K   W  +K++ +LP   ++ +  L   +    D
Sbjct  502   LVISFPSFRNDMSL------VHKFY-KGDSWDVDKLRLFLPVNLVDEIL-LIPFDRTQQD  553

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTN  1082
                W     G FS +SA  W     RQ  + +  LIW   +P  IS FIW   +  +   
Sbjct  554   VAYWILTSNGEFSTRSA--WETIRKRQPHNTLGSLIWHRSIPLSISFFIWRALNNWIPVE  611

Query  1081  YERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR-----HSLQRRTEESMRNLDW  917
                  + I     C  C    E L H+        ++W        +     + + ++ W
Sbjct  612   LRMKEKGIHLASKCV-CCNSEESLMHVLWGNSVAKQVWAFFANFFQIYIFNPQHVSHILW  670

Query  916   NSWLTMNLKGDR-QQGFEEGWPERFGTRLWWLWKWRNEA-----------VFNRNLLPLE  773
              +W      GD  ++G        F    W+LW  RN+A           V  R +  L 
Sbjct  671   -AWF---YSGDYVKRGHIRTLLPIFIC--WFLWLERNDAKHRYSGLYTDRVVWRIMKLLR  724

Query  772   QKLD------WLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCT  611
             Q  D      W  + D++ AA ++   + LQ   R   + + W KP  G  KLN DGS  
Sbjct  725   QLHDGSLLQQWQWKGDTDIAAMWK---YNLQLKLRAPPQIVYWRKPSTGEYKLNVDGSSR  781

Query  610   SDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDS  431
                 A+ GGVLRD  G    G++  IG C S  AE   +L+GL + KE    ++ IE D+
Sbjct  782   HGQHAASGGVLRDHTGKLIFGFSENIGNCNSLQAELRALLRGLLLCKERHIEQLWIEMDA  841

Query  430   KMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGG  251
               +++ +   + G      ++   I++  N ++    HI RE N++AD L+      Q  
Sbjct  842   LAVIQLIPHSQKGSHDIRYLL-ESIRKCLNSISYRISHILREGNQVADFLSNEGHNHQ-N  899

Query  250   LHIFEVPPGEFEVRMALDRLGASSPR  173
             L +F    G+    + LDRL     R
Sbjct  900   LRVFTEAQGKLHGMLKLDRLNLPYVR  925



>ref|XP_010682492.1| PREDICTED: uncharacterized protein LOC104897331 [Beta vulgaris 
subsp. vulgaris]
Length=1212

 Score =   184 bits (467),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 167/604 (28%), Positives = 259/604 (43%), Gaps = 42/604 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +R+  +L+GWK K LS AG+  L K+V+ AIP Y M   A+P G+  +I     RF W
Sbjct  620   LKERVWKKLQGWKEKLLSKAGKEVLIKAVIQAIPTYMMSLFAIPDGILEDINSMCARFWW  679

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                  +   KM  ++W+     K+ GG+G R+L T N+A + K GWRL  +  +L  + +
Sbjct  680   RATGMA--RKMHWISWEKFCLPKSYGGMGFRDLKTFNQALLAKQGWRLMCDDGSLAHQIM  737

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----  1445
               +Y  ++   L   R    S  W+ I   +  L  GL   V NG S R W  +WL    
Sbjct  738   RARY-FKNVPFLDARRGYDPSFVWRSIWGAKSLLMEGLKWRVGNGASIRVWDMAWLPGDS  796

Query  1444  ---TAKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEE  1274
                   P  E  R  L + +L  +VN       GW    +  +L  E+      + L+E 
Sbjct  797   SSKVPTPNVES-REDLMVADLL-SVNG------GWDVAALAHHLTEEDAMLAREIPLSER  848

Query  1273  NTPDGWGWSPDPRGCFSVKSAY---------GWADNAARQEADKVWGLIWSLRVPARISM  1121
                D   W P   G FS KSAY         GW +       D  W +IW L    +++ 
Sbjct  849   YPIDVLYWWPAKDGIFSTKSAYWLGRLGHVRGWMNRFGGGHGD-AWSIIWKLGGLPKLAH  907

Query  1120  FIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS-LQRRT  944
             F+W    G + T      RHI ++  C +C GQ + + H   +C  V  IW  S  Q+  
Sbjct  908   FLWRACVGALATRGRLRDRHIIADGQCIHCVGQTDTIVHAVCKCSLVASIWAASPFQQLL  967

Query  943   EESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQ-K  767
              +   +   +  L +N K DR           F +  W  W +RN    +      +   
Sbjct  968   SDCNASSFVDLLLWLNSKLDRMDLLS------FASLAWAAWSFRNSVHHDEPWSNAQVGA  1021

Query  766   LDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCG  587
             L +LR      +        P  +   G   R SW  P EG +++NTD +   D     G
Sbjct  1022  LGFLRLVHDYKSYGGAVLARP--QGVLGVFSRASWIPPGEGAVRINTDAAILGDDGVGLG  1079

Query  586   GVLRDTHGNWCRGYTYRI-GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEAL  410
              V+RD+ G  C     R+  R  + +AEA     GL +++E G   + +E D+  LV+AL
Sbjct  1080  AVVRDSTGQVCAVAVRRVQARWPAGLAEAAAAKFGLLVSRELGYGHVELEVDALNLVKAL  1139

Query  409   KGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQG--GLHIFE  236
               +  G+     +        + F +  F H+ R  N +A  +A++ +   G   L++ +
Sbjct  1140  HVRSFGRAPIELLYEDISMLGDGFSSFTFSHVKRGGNSVAHLIARY-MPPNGYEQLYVDD  1198

Query  235   VPPG  224
              P G
Sbjct  1199  FPQG  1202



>ref|XP_009127063.1| PREDICTED: uncharacterized protein LOC103851935 [Brassica rapa]
Length=781

 Score =   181 bits (459),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 166/602 (28%), Positives = 272/602 (45%), Gaps = 54/602 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DR+  R   + ++ LS AG+ T+ ++VL++IP + M    LP  +C++I+    RF W
Sbjct  198   IVDRMRQRAVSYSSRFLSSAGKATMLQAVLSSIPSFAMTCFELPISLCNKIQSVLTRFWW  257

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D + G +K+  VAW+ +T  K+ GGLG R++   N+A + K+GWR+ T P+ L A+ L
Sbjct  258   --DAKDGVHKICWVAWNELTLPKSLGGLGFRDVQIFNQALLAKIGWRIITRPDCLLARIL  315

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK-  1436
               KY H+S S L T    +IS+ W+GI   R+ L S L  V+ NG+STR W DSW+  + 
Sbjct  316   LGKYCHKS-SFLNTIPASNISHGWRGILHGRDLLLSHLGRVIGNGESTRLWSDSWICPEK  374

Query  1435  ------PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEE  1274
                   P+ +K +  L + +L +   + W+K        ++  LP E    + S+  +  
Sbjct  375   NLKPIGPVQQKDQDLL-VSDLLSRETKEWNKAM------VENLLP-ELATLIYSIRPSIL  426

Query  1273  NTPDGWGWSPDPRGCFSVKSAY--GWADN------AARQEADKVWG---LIWSLRVPARI  1127
             +  D + WS    G +SVKS Y    AD        + Q  +  W     +W+  +  ++
Sbjct  427   DNQDSYIWSLQKSGDYSVKSGYYSKQADKNSSTLLPSAQRPEDTWNWKKHVWNPPLLPKL  486

Query  1126  SMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRR  947
               F+W +    + T     RR I +N  C  C G+ E L H+F  C     +W+  L   
Sbjct  487   KHFLWRIAKKALPTGENLQRRGINANVMCCRC-GEAETLPHIFFHCAFAKEVWK--LAPL  543

Query  946   TEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTR-----LWWLWKWRNEAVF-NRNL  785
               E    +D + W            ++   P  F +       W+LW  RN  +F NR  
Sbjct  544   ASE----VDTSLWTAFKPTLQASYSWKVLPPYGFTSNPMPWICWFLWISRNNLIFQNRAT  599

Query  784   LPLEQKLDWLRRCDS-ETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTS  608
              P E  L  ++     E+A   +     L R        L ++ P E  +   TD +  S
Sbjct  600   TPQEIILKSVKAIREWESAQPLKSPTTHLVRC-----PPLIYDCP-ESTILCYTDAAWRS  653

Query  607   DGQ-ASCGGVLRD-THGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECD  434
             D + A    +  D +     RG   +    ++ +AE   + + L+ A       I I  D
Sbjct  654   DSKSAGLAWIFTDLSSQELNRGSKAQDSVASALMAEGLAIREALQHAISLNFTHIWIRSD  713

Query  433   SKMLVEALKGKETGQEQNN---NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALT  263
             S++L++A+  +    E      +I          F    F  + R +N  ADKLAK  L+
Sbjct  714   SQVLIQAITTRRQSVELFGVLADIDSLAFSSLSPFSLCRFSFVSRSRNGAADKLAKACLS  773

Query  262   TQ  257
             T 
Sbjct  774   TH  775



>ref|XP_007022832.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
 gb|EOY25454.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
Length=2367

 Score =   184 bits (468),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 164/599 (27%), Positives = 258/599 (43%), Gaps = 67/599 (11%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ +I  R+ GW+ K LS  GR+TL KSVL ++PIY  Q    P  V   I +    F+W
Sbjct  1821  LVAKIEERITGWENKILSPGGRITLLKSVLTSLPIYLFQVLKPPVCVLERINRIFNSFLW  1880

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G    + + K+   +W  I+     GGL +R+L  +  A  MKL WR +T  ++LW + +
Sbjct  1881  GGS--AASKKIHWTSWAKISLPVKEGGLDIRSLAEVFEAFSMKLWWRFRTT-DSLWTRFM  1937

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  R    + T  +   S  WK + A     E  +   V  G +  FW D W+   P
Sbjct  1938  RMKY-CRGQLPMHTQPKLHDSQTWKRMVASSAITEQNMRWRVGQG-NLFFWHDCWMGETP  1995

Query  1432  LYEKLRGTLGLPELYATVNEYWDKV--RGWKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
             L           E   ++ +  D      W  EK++  L  E ++ +A + +   +  + 
Sbjct  1996  LISSNH------EFSLSMVQVCDFFMNNSWDIEKLKTVLQQEVVDEIAKIPIDAMSKDEA  2049

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
             + W+P P G FS KSA  W     R+  + V+  IW   +P   S F+W + H  +    
Sbjct  2050  Y-WAPTPNGEFSTKSA--WQLIRKREVVNPVFNFIWHKAIPLTTSFFLWRLLHDWIPVEL  2106

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTM  899
                 +       C  C                           R+EES+ ++ W++ + +
Sbjct  2107  RMKSKGFQLASRCRCC---------------------------RSEESIIHVMWDNPVAV  2139

Query  898   NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAA---  728
                   Q G        F   LW+LW  RN+A  +RNL   +Q L+W  + D + A    
Sbjct  2140  ------QPGHIRTLIPIF--TLWFLWVERNDAK-HRNL--GQQLLEWQWKGDKQIAQEWG  2188

Query  727   -AFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGNWCR  551
               F+ +  P  +          W KP  G  KLN DGS      A+ GGVLRD  G    
Sbjct  2189  ITFQAKSLPPPK-------VFCWHKPSNGEFKLNVDGSAKLSQNAAGGGVLRDHAGVMIF  2241

Query  550   GYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNI  371
             G++  +G   S  AE   + +GL + ++Y  RR+ IE D+  ++  L+G   G      +
Sbjct  2242  GFSENLGIQNSLKAELLALYRGLILCRDYNIRRLWIEMDATSVIRLLQGNHRGPHAIRYL  2301

Query  370   VRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDR  194
             +   I++  +  +    HI+RE N+ AD LA      Q  L +  V  G+    + LD+
Sbjct  2302  L-GSIRQLLSHFSFRLTHIFREGNQAADFLANRGHEHQ-SLQVITVAQGKLRGMLRLDQ  2358



>gb|EEE59920.1| hypothetical protein OsJ_12548 [Oryza sativa Japonica Group]
Length=1076

 Score =   183 bits (465),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 163/629 (26%), Positives = 263/629 (42%), Gaps = 75/629 (12%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             D++S R+  W  K +S   +  L KSV  A+P Y M    +    C +  +  R F WG 
Sbjct  463   DKLSKRMSDWNEKYMSSGAKEVLIKSVAQALPTYIMGVFKMTDKFCDDYTRMVRNFWWGH  522

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
             D  +G  K+  +AW+ I   K+ GGLG R++   N+A + +  WRL T P++L A+    
Sbjct  523   D--NGERKVHWIAWEKILYPKSHGGLGFRDMKCFNQALLARQAWRLLTSPDSLCARVFKA  580

Query  1606  KYHHRSGSHLVTTRRRSISNA-WKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
             KY+     +LV T   ++S++ WKGI    + L+ G    V NG + + W   W+     
Sbjct  581   KYY--PNGNLVDTAFPTVSSSVWKGIQHGLDLLKQGTIWRVGNGHNIKIWRHKWVPHGEH  638

Query  1429  YEKL--RGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
                L  +G   L  +   +NE   + R W    ++  L  E+   +  + L      D  
Sbjct  639   INVLEKKGRNRLIYVNELINE---ENRCWNETLVRHVLKEEDANEVLKIRLPNHQMDDFP  695

Query  1255  GWSPDPRGCFSVKSAYGWA------------DNAARQEADKVWGLIWSLRVPARISMFIW  1112
              W  +  G F+VKSAY  A             + A     K+W  +W+ +V A++ +FIW
Sbjct  696   AWHHEKSGLFTVKSAYKLAWNLSGKGVVQSSSSTATSGERKIWSRVWNAKVQAKVKIFIW  755

Query  1111  LVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESM  932
              +   ++ T   + RR I  N  C  C  + E+  H    C         +  R   E++
Sbjct  756   KLAQDKLPTWENKRRRKIEMNGTCPVCGTKGENSYHATVEC---------TKARALREAL  806

Query  931   RNLDWN------------SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAV----  800
             R + W+             WL + L      G  E         LW  W  RN+ +    
Sbjct  807   RAV-WHLPGEDKFLWTGPDWLLILL-----DGVNEEQRTHIMYMLWRAWYLRNDLIHGDG  860

Query  799   -------------FNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWE  659
                          +   LLP  Q  D ++      +   +E+H   ++ + G      W 
Sbjct  861   RCSIAGSVSFLTSYEEVLLPNRQMPDDIKGKKPMYSEGQKEKHMA-EKQSSG------WI  913

Query  658   KPDEGWLKLNTD-GSCTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTST-VAEAWGVLQG  485
              P +G  K+N D G     G+AS G V+RD  G         +  C+S   AEA   L+G
Sbjct  914   APPDGAAKINVDAGFRMETGEASAGIVIRDCRGLILLAACKTLHPCSSAEQAEALASLEG  973

Query  484   LRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYRE  305
             +R A ++    +++E D+  +V  LK K + +     ++       +   AV   HI R+
Sbjct  974   IRCALQWIHMPVILETDNAEVVARLKTKHSSRSVWEGVIMEAKAAMQGLQAVEVAHIKRD  1033

Query  304   QNKLADKLAKWALTTQGGLHIFEVPPGEF  218
              NK+A  LA+ AL++   L      P E 
Sbjct  1034  SNKVAHTLAQMALSSGNCLEWRLCAPAEI  1062



>gb|EAY96391.1| hypothetical protein OsI_18290 [Oryza sativa Indica Group]
Length=653

 Score =   180 bits (457),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 156/621 (25%), Positives = 261/621 (42%), Gaps = 81/621 (13%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+DR+  RL  W  K LS+ G+  L KSV+ A+P Y M    LP G C +  K  R+F W
Sbjct  38    LMDRLMKRLSDWAEKFLSMGGKEVLIKSVIQALPTYVMSVFKLPSGFCEDYMKMIRKFWW  97

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E+    K    +W  +   K++GG+G ++L   N+A + +  WRL    ++L AK +
Sbjct  98    G--EEKNRRKTHWTSWQQLIKPKSKGGIGFKDLKIFNQALLARQAWRLIQFLDSLCAKLM  155

Query  1612  TTKYHHRSGSHLV-TTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK  1436
               +Y      HL+ T      S  W+GI    E L+ G+   +  G     W D+W+   
Sbjct  156   KARYF--PNGHLIDTVFPTDSSEVWRGICHGLELLKKGIIWRIGKGDQLHIWRDNWI---  210

Query  1435  PLYEKLRGTLG--------LPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLT  1280
             P   +LR T          + +L    N+ WD+        I++      ++ +  + L 
Sbjct  211   PRDHQLRVTGKRTRTRLKWVADLVKPNNQEWDE------GLIRQIFCPPYVDEILKIKLP  264

Query  1279  EENTPDGWGWSPDPRGCFSVKSAY--GWADNAARQEA---------DKV-WGLIWSLRVP  1136
             E  T D   W P+  G F+V+SAY  G A+     EA         D+V W  IWS +VP
Sbjct  265   ESPTDDFLAWHPERLGVFTVRSAYKLGLAEEHRANEAGACSSNGNGDRVLWKNIWSAQVP  324

Query  1135  ARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRC-------HDVD  977
              ++ +F W +   R+ T + + +R+I  +  C  C   RED  H    C        ++ 
Sbjct  325   QKVCIFAWRLAVERLPTQHNKQKRNIVPSARCEVCGAPREDGFHATVVCTKAKALRDELR  384

Query  976   RIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAV-  800
               W    + +      +       T++++   Q              LW  W  RN +V 
Sbjct  385   AFWPIPPEDKFVRQGPDWLLLLLDTLDMRNKAQMLL----------MLWRAWHLRNNSVH  434

Query  799   ----------------FNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRG---GE  677
                             + + L P+ QK D   +C ++      +        N G    +
Sbjct  435   DTGTLTISGSIRFLQSYVQLLFPIRQKEDPKGKCAAQVPGRVNQ--------NPGVTKAD  486

Query  676   ERLSWEKPDEGWLKLNTDGSCT-SDGQASCGGVLRDTHGNWCRGYTYRIGRCT-STVAEA  503
                 WE P EGW K+N DG+ + +D     G + RD+ G         + RC  +   E 
Sbjct  487   CLQIWEPPPEGWAKINVDGAFSMTDNTGGIGVIARDSEGKALLSSWEYLHRCADAEQVEI  546

Query  502   WGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVF  323
                 +G+++A E+  + I++E D   ++  +  ++  + +   ++R       +   V  
Sbjct  547   LACYEGMKLAAEWIRKPIILESDCITVIGRMTAEDEERSRWTFLIRSAKAVMRSLQEVRI  606

Query  322   LHIYREQNKLADKLAKWALTT  260
              H  RE N++A +LA+ A  T
Sbjct  607   QHRKRECNRVAHELAQLAKRT  627



>ref|XP_009121250.1| PREDICTED: uncharacterized protein LOC103846083 [Brassica rapa]
Length=773

 Score =   181 bits (459),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 165/594 (28%), Positives = 259/594 (44%), Gaps = 46/594 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +++RI  +   W ++ LS AG++T+ KSVL A P Y+M    LP G+C+ I+    RF W
Sbjct  198   IVERIKIKAASWSSRRLSAAGKLTMLKSVLTATPTYSMSCFLLPVGLCNSIQSALTRFWW  257

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D      K+  V+WD ++T K   GLG R++   N A + KL WRL T+P+ L A+TL
Sbjct  258   --DADPSTRKICWVSWDTLSTSKDSCGLGFRDIQAFNIAMLGKLAWRLVTKPDCLLARTL  315

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY ++ GS L      S S+ W+GI A R+ L   L  V+ NG ST+ W DSWL++  
Sbjct  316   LGKYCYK-GSFLTVPCPSSTSHGWRGIIAGRDLLIRHLRKVIGNGNSTKVWSDSWLSSS-  373

Query  1432  LYEKLRGTLGLP-ELYATVNEYWDKVRG---WKWEKIQRYLPTEELERLASLC-LTEENT  1268
               E +R  LG P E+   +      +RG   W   KI+   P  ++  L  L   +  N 
Sbjct  374   --EDMR-ILGPPREIDRDLVVADLMIRGSNEWNHTKIEATCP--QVAHLIYLIRPSAHNM  428

Query  1267  PDGWGWSPDPRGCFSVKSAYGWADNAARQEADKV------WG-LIWSLRVPARISMFIWL  1109
              D + W     G +SV+S Y       R +A ++      W   IW++    ++ +F+W 
Sbjct  429   EDIFCWHGSKDGIYSVRSGYYSLIEDTRGQAHQLLMAPFNWSKAIWAVDTSPKLKLFLWK  488

Query  1108  VKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMR  929
             +  G +        R + SN  C +C G    + HL   C    ++W  +  +   + + 
Sbjct  489   LAQGALPLGANLQARGMMSNTNCPHCGGIETGV-HLIFECPFAQQVWALAPIKPNLDFIS  547

Query  928   NLDWNSWLTM--NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWL  755
             +   +S LT    L      G    +   F    W +W  RN  +F     P    +   
Sbjct  548   SASVHSALTAASRLVCLPPSGIASDF---FSWLCWNIWTARNRLLFENRTSPAISIV---  601

Query  754   RRCDSETAAAFEERHWPLQRHNR------GGEERLSWEKPDEGWLKLNTDGS-CTSDGQA  596
                   T A    R W L +  +            +   P E  L  N+D +  T+  +A
Sbjct  602   ------TNALCNAREWMLAQEKKPDSPPPASPYLPAISFPPETAL-CNSDAAWTTTTKRA  654

Query  595   SCGGVLRDTHGN-WCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLV  419
               G +L  T       G +      +  +AEA  + + +R A       + +  DS++LV
Sbjct  655   GLGWILGSTTTTPQVSGSSASPFVSSPLLAEALALREAIRAAHAANLPNVWMRSDSQVLV  714

Query  418   EALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQ  257
              A+  K+   E    ++         F+  +   I REQN  AD LAK AL  +
Sbjct  715   RAVNSKKFPMEL-YGVLMDIEYLFSRFMFFLLSFIPREQNSAADSLAKSALCIE  767



>gb|AAX94970.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA93330.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=816

 Score =   181 bits (459),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 156/621 (25%), Positives = 262/621 (42%), Gaps = 81/621 (13%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+DR+  RL  W  K LS+ G+  L KSV+ A+P Y M    LP G C +  K  R+F W
Sbjct  38    LMDRLMKRLSDWAEKFLSMGGKEVLIKSVIQALPTYVMNVFKLPSGFCEDYMKMIRKFWW  97

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E+    K    +W  +   K++GG+G ++L   N+A + +  WRL    ++L AK +
Sbjct  98    G--EEKNRRKTHWTSWQQLIKPKSKGGIGFKDLKIFNQALLARQAWRLIQFLDSLCAKLM  155

Query  1612  TTKYHHRSGSHLV-TTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK  1436
               +Y      HL+ T      S  W+GI    E L+ G+   +  G     W D+W+   
Sbjct  156   KARYF--PNGHLIDTVFPTDSSEVWRGICHGLELLKKGIIWRIGKGDQLHIWRDNWI---  210

Query  1435  PLYEKLRGTLG--------LPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLT  1280
             P   +LR T          + +L +  N+ WD+        I++      ++ +  + L 
Sbjct  211   PRDHQLRVTGKRTRTCLKWVADLVSPNNQEWDE------GLIRQIFYPPYVDEILKIKLP  264

Query  1279  EENTPDGWGWSPDPRGCFSVKSAY--GWADNAARQEA---------DKV-WGLIWSLRVP  1136
             E  T D   W P+  G F+V+SAY  G A+     EA         D+V W  IWS +VP
Sbjct  265   ESPTDDFLAWHPERLGVFTVRSAYKLGLAEEHRANEAGACSSNGNGDRVLWKNIWSAQVP  324

Query  1135  ARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRC-------HDVD  977
              ++ +F W +   R+ T + + +R+I  +  C  C   RED  H    C        ++ 
Sbjct  325   QKVCIFAWRLAVERLPTQHNKQKRNIVPSARCEVCGAPREDGFHATVVCTKAKALRDELR  384

Query  976   RIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAV-  800
               W    + +      +       T++++   Q              LW  W  RN +V 
Sbjct  385   AFWPIPPEDKFVRQGPDWLLLLLDTLDMRNKAQMLL----------MLWRAWHLRNNSVH  434

Query  799   ----------------FNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRG---GE  677
                             + + L P+ QK D   +C ++      +        N G    +
Sbjct  435   DTGTLTISGSIRFLQSYVQLLFPIRQKEDPKGKCAAQVPGRLNQ--------NPGVTKAD  486

Query  676   ERLSWEKPDEGWLKLNTDGSCT-SDGQASCGGVLRDTHGNWCRGYTYRIGRCT-STVAEA  503
                 WE P EGW K+N DG+ + +D     G + RD+ G         + RC  +   E 
Sbjct  487   CLQIWEPPPEGWAKINVDGAFSMTDNTGGIGVIARDSEGKALLSSWKYLHRCADAEQVEI  546

Query  502   WGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVF  323
                 +G+++A E+  + I++E D   ++  +  ++  + +   ++R       +   V  
Sbjct  547   LACYEGMKLAAEWIRKPIILESDCVTVIGRMTAEDEERSRWTFLIRSAKAVMRSLQEVRI  606

Query  322   LHIYREQNKLADKLAKWALTT  260
              H  RE N++A +LA+ A  T
Sbjct  607   QHRKRECNRVAHELAQLAKRT  627



>ref|XP_006493121.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Citrus sinensis]
Length=968

 Score =   182 bits (462),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 151/585 (26%), Positives = 254/585 (43%), Gaps = 41/585 (7%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             RI  ++  W+A   S  G+  L K+V  A+P Y M    LP G+C +++K    F WG+ 
Sbjct  385   RIINKISNWQANFFSSGGKEILIKAVAQAVPAYAMSVFKLPLGLCEDMQKAIAGFWWGKK  444

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
              +  +   S   W+ +   K RGGLG R+L + N+A + K  WR+   P +L A+ +  K
Sbjct  445   REKRSIHWS--KWERLCQAKKRGGLGFRDLSSFNQALVAKQSWRIIQAPESLVARVMKEK  502

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y  R    +      + S  W+ I   RE +  GL   + +GK  + +   WL  +P   
Sbjct  503   Y-FRHSCFMEAQIGSNPSYIWRSILWGREVIRKGLRWRIGDGKLVKVYQSGWL-PRPETF  560

Query  1423  KLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSP  1244
             K      LP L  TV+   D+ + W+ + I+++   E+  ++  + L  + +PD   W  
Sbjct  561   KPISPPSLP-LDTTVSVLIDEDQCWRDDVIRQHFHQEDAAQILKIPLPRQLSPDQVLWHY  619

Query  1243  DPRGCFSVKSAYGWADN-------AARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLT  1085
             D +G +SVKS Y  A         ++ +E +  W  IW L++P ++ +F+W   +  + T
Sbjct  620   DKKGNYSVKSGYQLALQMKFPNRPSSSKEDNNSWNSIWYLQIPEKVKIFMWRATNDLLPT  679

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWL  905
             +    +R I    +C  C   RE + H    C    +IW+ +     EE ++ L     L
Sbjct  680   SENLWKRRILQTPWCQRCRSHRETIFHSLFDCKASRKIWKLT---TFEEEVKALKCKDVL  736

Query  904   TMNLK-GDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNR-------NLLPLEQKLDWLRR  749
             ++ L   DR+   E    E      W +W  RN  +F         ++   E  +   +R
Sbjct  737   SLLLALADRRSKTEM---ELIVAVCWSIWHSRNLFIFQNKKEDFQLSVAGAEAIVQSYKR  793

Query  748   CDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVLRD  572
                    AF ++     +H         W+ P  GW K+N D +   + Q    G V+R+
Sbjct  794   IQMPQLQAFSDQDLVSHKH---------WKCPPAGWFKVNVDAAIKLENQRVGLGIVIRN  844

Query  571   THGNWCRGYTYR---IGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK  401
             + G +          I R     AEA     GL +A+  G   +++E DSK + + +  +
Sbjct  845   SEGKFITAAIKPSKWIDRV--DYAEAEATRFGLEVAESAGCLPLIVETDSKEVTDLVSAR  902

Query  400   ETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
             ++ + +   IV       +    V   H  R  N  A  LAK AL
Sbjct  903   KSTKAEIFWIVSEVQDTMKRLKHVKLQHSPRACNGFAHTLAKLAL  947



>ref|XP_008226782.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=963

 Score =   182 bits (462),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 150/542 (28%), Positives = 231/542 (43%), Gaps = 30/542 (6%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             DR+  ++EGWK  +LSLAG+  L K+V  AIP Y M     P  VCS+I     RF W  
Sbjct  351   DRVRRKIEGWKQSSLSLAGKEILLKAVATAIPAYPMSCFKFPASVCSDINGEMTRFWWKN  410

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
              E+   +K+   AW+ +   K  GGLG R+  + N A + K  WR+   PN  W + L  
Sbjct  411   GEE--GSKIHWKAWESLCKSKDEGGLGFRHFSSFNIALLAKQSWRILQNPNASWVRILKA  468

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             +Y+      L   +    S AW  +   R+ L       + +GK+T  W D WL   P +
Sbjct  469   RYYPDC-DFLKAKKGSRASWAWSSLLEGRDALIKDSRCQIFDGKNTNIWKDIWLP--PPH  525

Query  1426  E---KLRGTLGLPELYATVNEYWDK-VRGWKWEKIQRYLPTEELE--RLASLCLTEENTP  1265
             +   K+R  +  P     V E  +K    WK E I+ Y+    LE  R  ++  TE    
Sbjct  526   DGIIKVREIVP-PSAPQQVYEIMEKETHSWKLELIKPYVQPRTLEIIRCCTIANTERQDK  584

Query  1264  DGWGWSPDPRGCFSVKSAY-----------GWADNAARQEADKVWGLIWSLRVPARISMF  1118
               W W+ +  G +SVKS Y               + +     +VW  IW +    +I MF
Sbjct  585   MVWPWTTN--GAYSVKSRYRRIHSRCSYLIHATGSTSHSIPKEVWVCIWKIESLPKIKMF  642

Query  1117  IWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEE  938
             +W V    + T +   RR I  +  C  C  + E ++HL   C   + +W  +      +
Sbjct  643   LWRVLSNAISTRWNLYRRKILDSPVCPICGMEEETIEHLLFLCPWTNVVWFGAPLNYKVD  702

Query  937   SMRNLDWNSWL--TMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKL  764
                    + WL   +N +G  ++  +           W +WK R   +F  N +     +
Sbjct  703   LRGFSSVDRWLKGVINFQGVSKREVQFLL-TSISFICWEIWKTRCNFIFKSNHIDPRLTI  761

Query  763   DWLRRCDSETAAAFEERHWPLQRHNRGGEERLS-WEKPDEGWLKLNTDGSCTSDGQ-ASC  590
             D   +   E   A  + H P    +         W  P   ++K+N DG+   D   A  
Sbjct  762   DRAMQNCREFLDAKVKSHVPFGDASVVPNILAQGWRPPMSNYVKINFDGAWKKDSHLAGL  821

Query  589   GGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEAL  410
             G V RD  G++C G         + VAEA   L  L+ A  +    I++E +SK+LVE +
Sbjct  822   GVVARDAIGSFCGGLATPFHCNLALVAEAAAGLCALKFALNHNFTNIILETNSKILVEGV  881

Query  409   KG  404
             +G
Sbjct  882   RG  883



>gb|EEC76169.1| hypothetical protein OsI_13484 [Oryza sativa Indica Group]
Length=1874

 Score =   184 bits (466),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 164/620 (26%), Positives = 261/620 (42%), Gaps = 57/620 (9%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             D++S R+  W  K +S   +  L KSV  A+P Y M    +    C +  +  R F WG 
Sbjct  657   DKLSKRMSDWNEKYMSSGAKEVLIKSVAQALPTYIMGVFKMTDKFCDDYTRMVRNFWWGH  716

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
             D  +G  K+  +AW+ I   K+ GGLG R++   N+A + +  WRL T P++L A+    
Sbjct  717   D--NGERKVHWIAWEKILYPKSHGGLGFRDMKCFNQALLARQAWRLLTSPDSLCARVFKA  774

Query  1606  KYHHRSGSHLVTTRRRSISNA-WKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
             KY+     +LV T   ++S++ WKGI    + L+ G    V NG + + W   W+     
Sbjct  775   KYY--PNGNLVDTAFPTVSSSVWKGIQHGLDLLKQGTIWRVGNGHNIKIWRHKWVPHGEH  832

Query  1429  YEKL--RGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
                L  +G   L  +   +NE   + R W    ++  L  E+   +  + L      D  
Sbjct  833   INVLEKKGRNRLIYVNELINE---ENRCWNETLVRHVLKEEDANEVLKIRLPNHQMDDFP  889

Query  1255  GWSPDPRGCFSVKSAYGWA------------DNAARQEADKVWGLIWSLRVPARISMFIW  1112
              W  +  G F+VKSAY  A             + A     K+W  +W+ +V A++ +FIW
Sbjct  890   AWHHEKSGLFTVKSAYKLAWNLSGKGVVQSSSSTATSGERKIWSRVWNAKVQAKVKIFIW  949

Query  1111  LVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRR-TEES  935
              +   ++ T   + RR I  N  C  C  + E+  H    C    R  R +L+       
Sbjct  950   KLAQDKLPTWENKRRRKIEMNGTCPVCGTKGENSYHATVECTKA-RALREALRAVWHLPG  1008

Query  934   MRNLDWN--SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAV-------------  800
               N  W    WL + L      G  E         LW  W  RN+ +             
Sbjct  1009  EDNFLWTGPDWLLILL-----DGVNEEQRTHIMYMLWRAWYLRNDLIHGDGRCSIAGSVS  1063

Query  799   ----FNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKL  632
                 +   LLP  Q  D ++      +   +E+H   ++ + G      W  P +G  K+
Sbjct  1064  FLTSYEEVLLPNRQMPDDIKGKKPMYSEGQKEKHMA-EKQSSG------WIAPPDGAAKI  1116

Query  631   NTD-GSCTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTST-VAEAWGVLQGLRMAKEYGA  458
             N D G     G+AS G V+RD  G         +  C+S   AEA   L+G+R A ++  
Sbjct  1117  NVDAGFRMETGEASAGIVIRDCRGLILLAACKTLHPCSSAEQAEALASLEGIRCALQWIH  1176

Query  457   RRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLA  278
               +++E D+  +V  LK K + +     ++       +   AV   HI R+ NK+A  LA
Sbjct  1177  MPVILETDNAEVVARLKTKHSSRSVWEGVIMEAKAAMQGLQAVEVAHIKRDSNKVAHTLA  1236

Query  277   KWALTTQGGLHIFEVPPGEF  218
             + AL++   L      P E 
Sbjct  1237  QMALSSGNCLEWRLCAPAEI  1256



>ref|XP_007042183.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOX98014.1| Ribonuclease H protein [Theobroma cacao]
Length=528

 Score =   177 bits (450),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 124/467 (27%), Positives = 204/467 (44%), Gaps = 38/467 (8%)
 Frame = -1

Query  1474  STRFWMDSWLTAKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEE-LERL  1298
             S  FW D WL+ K L                V ++ +    W ++K+   LP E  L+ +
Sbjct  2     SVNFWRDKWLSDKTLANITCRVANSALDKVVVRDFLNPNGHWDYDKLSYCLPNEVVLQVV  61

Query  1297  ASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWA---DNAARQEADKVWGLIWSLRVPARI  1127
               +  T     D   W     G F++ SAY +     +  +     +W   W  +   R+
Sbjct  62    QIMPPTVTIAQDMPYWGKSASGQFTIASAYDYLRQLSSPTKARPSGIWQGAWKWQGSQRV  121

Query  1126  SMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRR  947
               F++   HGR+LTN +R  R +T++  C  C  + E + H+ R C     +W+  L   
Sbjct  122   RTFLFQCLHGRLLTNRKRLHRQLTADSLCPQCRMEDETVTHVLRDCMVATSLWKQQLI--  179

Query  946   TEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQK  767
                                          W   F    W+LWKWRN  VF+    P  ++
Sbjct  180   -------------------------LGNPWSIVFRLACWYLWKWRNGVVFDVAFNPTRKR  214

Query  766   LDWLRRCDSETAAAFEERHWPLQRHNRGGEERL-SWEKPDEGWLKLNTDGSCT-SDGQAS  593
             +  ++   + T A   +    +Q   R  EE L  W  P  GW+ LNTDG+   S  +AS
Sbjct  215   ISMIKSMATATIAPSADFD-GVQVERRKKEEVLIEWRAPQVGWVCLNTDGAYKRSIEEAS  273

Query  592   CGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEA  413
              GGV R+  G+W  G+  ++G+C++  AE WG+L GLR+A + G +++ ++ D+KM+V+A
Sbjct  274   AGGVKRNAEGDWQAGFVAKLGKCSAYRAELWGILHGLRLAWDSGFKKVQVQVDNKMVVQA  333

Query  412   LKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEV  233
             +   +     N +++       +    V F+H YRE N +AD LA +A   +    + E 
Sbjct  334   ISTDKLIPGANTDLISAIKNVLQKEWEVSFMHTYREGNMVADYLASYAFVLEESYVVLEQ  393

Query  232   PPGEFEVRMALDRLG----ASSPRRVSH*GPLFLVSGVSPSSMIQKK  104
              P      +  D LG    AS  R  +   P  + +G   + + +KK
Sbjct  394   APTGARKLLIYDMLGTMTNASQLRPAAASPPCDMQTGEFSALITRKK  440



>ref|XP_008232623.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
 ref|XP_008238689.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=965

 Score =   182 bits (461),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 158/590 (27%), Positives = 241/590 (41%), Gaps = 41/590 (7%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             DR+  ++ GW+ K LS AG+  L KSV  AIP Y+M    LP G+C EIE    +F W +
Sbjct  370   DRVWNKVNGWQGKLLSKAGKEVLIKSVCQAIPSYSMSVFRLPVGLCREIESIIAKFWWSK  429

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
             ++  G   +    W  +   K+ GGLG R L + N+A + K GWRL   P++L A+ L  
Sbjct  430   NDGRG---IHWKKWSFMCQHKSDGGLGFRELTSFNQALLCKQGWRLLEFPHSLIARMLKA  486

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             +Y   S   L  +     S  W+ +   R+ L  GL   + +G+    + D W+     Y
Sbjct  487   RYFPNS-DFLAASSGSLPSFTWQSLLWGRDLLRLGLRWRIGDGRLVNIYGDPWVP----Y  541

Query  1426  EKLRGTLGLPELYAT--VNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             ++      +P L AT  V + +    GW   K+       E E + S+ L  +N  D   
Sbjct  542   DRFFTIQSIPTLPATSRVCDLFTASGGWDVGKVFATFSFPEAEAILSIPLMGDNL-DRRI  600

Query  1252  WSPDPRGCFSVKSAYGWADNAARQE-------------ADKVWGLIWSLRVPARISMFIW  1112
             W+    G +SVKS Y  A    R E             + K W  +W L+VP +I   +W
Sbjct  601   WNFTKNGRYSVKSGYWAALEYKRLEELSAGTVAGPSSSSLKSWKHLWKLKVPQKILHLLW  660

Query  1111  LVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESM  932
              V    + +     RR IT  E C  C   RE   H    C    ++W      R     
Sbjct  661   RVAQDILPSKEVLFRRRITQGEVCCRCFAPRETTLHALVGCVVCLQVWEALDFPRDFLLP  720

Query  931   RNLDWNSWLTMN---LKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
                D  +W+      +  D+Q          F   +W LW  RN  +F     P    + 
Sbjct  721   TVADVGTWMDAAWSIIPPDKQ--------SLFAFTVWVLWNERNGVLFGSQPTPSGVLVQ  772

Query  760   WLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGG  584
               +  D+E        H  L    R     + W  P     KLN DG+   + G    G 
Sbjct  773   RAKDYDAEFKRYSAANHRSLSSLVRD----IKWRPPTGNCFKLNVDGATDMETGARGAGA  828

Query  583   VLRDTHGNWCRGYTYRIGRCTSTVA-EAWGVLQGLRMAKEYGARRIMIECDSKMLVEALK  407
             ++RD+HGN       R     S +A E + +  G+  A +     + IE DS   V  + 
Sbjct  829   IVRDSHGNLVGALAMRAPSRISVLATELYALKVGISFALDVSLLPLEIESDSLQAVSMVN  888

Query  406   GKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQ  257
              +E        +V    +      +    H+ R+ NK A ++A+++L  Q
Sbjct  889   SEEECLAAEGGLVDGVRRLLVRSASTAVRHVPRQANKAAHRIARFSLRDQ  938



>ref|XP_010688970.1| PREDICTED: uncharacterized protein LOC104902764 [Beta vulgaris 
subsp. vulgaris]
Length=1289

 Score =   182 bits (463),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 156/579 (27%), Positives = 248/579 (43%), Gaps = 38/579 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             LLDR+  +L GWK K LS AG+  L K+V+ A+P Y M    +P  +  EI     RF W
Sbjct  705   LLDRMWKKLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVHKIPTAIIKEIHSAMARFWW  764

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   +    KM  ++W+ +   K  GG+  ++L   N A + +  WRL    ++L ++ +
Sbjct  765   G--GKGVARKMHWLSWEKMCKPKCMGGMRFKDLGVFNDALLGRQVWRLLHYKSSLLSRVM  822

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
             + KY+   G         S S +W  I + +  ++ GL   V +GKS   W D WL+ + 
Sbjct  823   SAKYYPH-GDIFQARLGYSNSYSWSSIWSAKSLVKEGLIWKVGDGKSINLWSDPWLSDED  881

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
                 L   +   EL   + +  D  + WK + I+      + + + ++ L+     D   
Sbjct  882   GRFVLSNRVEGVELVGDLID--DDRKEWKMDVIENLFEERDQKCILAIPLSSRCLQDELT  939

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYER  1073
             W+    G +SVK+AY         +  K WG++WSL V  ++  F+W     RV TN   
Sbjct  940   WAYSKDGTYSVKTAYMLGKGGNLDDVHKAWGILWSLEVSPKVRHFLW-----RVCTNSLP  994

Query  1072  TRR-----HITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSW  908
              R      H+   + C  C    E + H    C      WR        ++M  +D    
Sbjct  995   VRAVLRACHLVDQDECPWCLNGAETIHHSLFTCAR----WRSVWGELGCQAM--VDGVEG  1048

Query  907   LTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWL-RRCDSETA  731
              TM     R    +    +R     W +W  RN+ VF     P+   +  + R+CD    
Sbjct  1049  ETMCEMVVRWSELDAKMVQRGSFFAWNVWTERNKMVFEGQRQPVPVIVQRVGRQCDEFN-  1107

Query  730   AAFEERHWPLQRHNRGGEERLS------WEKPDEGWLKLNTDGSCTSDGQASCGGVLRDT  569
              ++  R +       GG +R S      W     G +KLNTD     +G    G V RD 
Sbjct  1108  -SYTTRIY-------GGPKRGSCVSSAKWCASPRGTIKLNTDACLGEEGWIGLGLVARDF  1159

Query  568   HGNWCRGYTYRIGRC-TSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETG  392
              G  C     R   C  + +AE   +    RMAK +G   ++IE DS+++   L  +   
Sbjct  1160  QGKVCFSAVRRTRACWPAAIAECKAIYMAARMAKAHGLVDVIIESDSQVVTNRLSNETLY  1219

Query  391   QEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
                 +NI+   +     F +V FLH+ R+ N +A  LA+
Sbjct  1220  FADLDNILGDVLSLCNAFESVKFLHVKRDGNAVAHHLAR  1258



>ref|XP_009142123.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=774

 Score =   180 bits (456),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 166/599 (28%), Positives = 257/599 (43%), Gaps = 46/599 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DRI  +  GW  K LS AG++ + +SVL+ I +Y+M    LP  +C  I+    RF W
Sbjct  198   IVDRIKQKARGWSTKLLSSAGKMVMLQSVLSPISLYSMTCFKLPVSLCKRIQTVLMRFWW  257

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               +E +   KM+ VAWD IT  K+ GGLG+R+  + N A + K+GWRL   PN L  K L
Sbjct  258   DNNENA--KKMAWVAWDKITKPKSAGGLGMRDCQSFNDALLAKIGWRLLNNPNCLLGKLL  315

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTA--  1439
               KY     S L  T    +S+ W+ +   R+ L   L   V +G S   W D WL    
Sbjct  316   KGKYFDDC-SILQATEASVMSHGWRSVLIGRDLLLKNLGWTVGDGSSINIWQDPWLCLTK  374

Query  1438  --KPLYEKLRGTLGL--PELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEEN  1271
               +P+      ++ L   +L     ++WD+      +K+Q  LP  E E++  +  +   
Sbjct  375   QERPMGPSSEQSVDLCVADLLVDGGKHWDR------QKLQLLLPAYE-EKILCIKPSLTG  427

Query  1270  TPDGWGWSPDPRGCFSVKSAYGWA----DNAARQEADKVWGL-IWSLRVPARISMFIWLV  1106
               D   W     G +SVKS Y  A     +  R +A   W   +W+L    ++ +F W +
Sbjct  428   AQDKLIWLGTKGGEYSVKSGYYVAVEEEPDTRRNDAGFNWKRNVWALDCAPKVKLFAWKL  487

Query  1105  KHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRN  926
               G +        RHI  +  C  C G  E + HL  +C    ++W+ +      +S   
Sbjct  488   LKGAIPVGERLLERHIEVDPRCKRC-GDNESITHLLFQCQFAQKVWQLAPLLPGMDSSGM  546

Query  925   LD----WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF-NRNLLPLEQKLD  761
             LD    W S    N K     G   G        +W LWK RN  VF   + LP      
Sbjct  547   LDLMVVWPS--ICNQKSLPPAGIVNG--SVVPWVMWSLWKARNRLVFEGFSALPE-----  597

Query  760   WLRRCDSETAAAFEERHWPLQRHNRGGE--ERLSWEKPDEGWLKLNTDGS-CTSDGQASC  590
                  D+ + A    R W L+      +   R+       G   + +D +   S   A  
Sbjct  598   -----DTLSTAIRMAREWSLKSKPEKPDSRSRIPEMISPVGSRIVRSDAAWSASSLTAGA  652

Query  589   GGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEAL  410
             G V+  +  N            +  +AE   + + +   +    + I  E DS  L++ L
Sbjct  653   GWVILSSPQNMTFKQHLEF-VASPLMAEGLALREAVLTCQRLKLQHIRFESDSAQLIKCL  711

Query  409   KGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEV  233
                ET  E  +++V   +K +E F +V F+ + RE+N  AD LAK  L     L + E+
Sbjct  712   SSNETSAEL-HSVVFDILKLSECFDSVSFVWLPRERNVEADGLAKGTLALFEPLVVGEI  769



>ref|XP_010666306.1| PREDICTED: uncharacterized protein LOC104883473 [Beta vulgaris 
subsp. vulgaris]
Length=1322

 Score =   182 bits (463),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 163/591 (28%), Positives = 244/591 (41%), Gaps = 54/591 (9%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +RI  +L+GWK K LS  G+  L KSV  AIP Y M    LP G+  EI     RF WG 
Sbjct  733   ERIWKKLQGWKEKLLSRPGKEILIKSVAQAIPTYMMSVFCLPSGLIDEIHAMLARFWWGS  792

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
             +   G  KM   +WD +   K+ GGLG R+LH  N+A + K  WRL     TL ++ L  
Sbjct  793   N--GGERKMHWHSWDAMCLPKSMGGLGFRDLHCFNQALLAKQAWRLCQRDATLLSQVLQA  850

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             +Y +++   L   R  + S  W+ + + +  L  GL   V +G     W ++W+  +   
Sbjct  851   RY-YKNVEFLEARRGYNPSFTWRSVWSSKSLLLEGLKWCVGSGSRINVWTEAWILGE---  906

Query  1426  EKLRGTLGLP------ELYATVNEYWDKVR-GWKWEKIQRYLPTEELERLASLCLTEENT  1268
                 G+  +P       +   V +  D  R GW  E +Q+    EE   +  + L+    
Sbjct  907   ----GSHHVPTPRHDSNMELRVCDLIDVNRGGWNVEVVQQVFVEEEWRSILDIPLSRFWP  962

Query  1267  PDGWGWSPDPRGCFSVKSAY---------GWADNAARQEADKVWGLIWSLRVPARISMFI  1115
              D   W P   G FSV+S Y          W       E  ++W  +W +  P ++  FI
Sbjct  963   EDHRYWWPSRNGVFSVRSCYWLGRLGHDRTWRLQHGEGET-RLWKEVWRIGGPPKLGHFI  1021

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS-----LQR  950
             W    G +       RRHI  +  C  C    E + H    C     IW  S     L  
Sbjct  1022  WWACKGSLAVKESLARRHICESTVCAVCGASVESIHHALFECSFAKAIWEVSPFVALLNM  1081

Query  949   RTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQ  770
                 S   L    WL   L  D  +           +  W  W  RN+ +F       EQ
Sbjct  1082  APTSSFAEL--FIWLRDKLSSDDLR--------TVCSLAWASWYCRNKFIF-------EQ  1124

Query  769   KLDWLRRCDSETAAAFEERHWPLQRHNRGG----EERLSWEKPDEGWLKLNTDGSCTSDG  602
             +        S      ++     ++  RG        +SW++P  G +K N D   + +G
Sbjct  1125  QSVEASVVASNFVKLVDDYGLYAKKVLRGSTTMCTSEVSWQRPPAGLIKANFDAHVSPNG  1184

Query  601   QASCGGVLRDTHGNWCRGYTYRIGRC-TSTVAEAWGVLQGLRMAKEYGARRIMIECDSKM  425
             +   G V+RD+ G        R+     ++ AEA   L  + +A+ +G   +++E DS M
Sbjct  1185  EIGLGVVVRDSSGRIVVLGVRRMAASWDASTAEAMAALFAVELAQRFGYGNVVVEGDSLM  1244

Query  424   LVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKW  272
             ++ ALK K  G     NI     +   +F A  F HI R  N +A  LA+W
Sbjct  1245  VISALKNKLPGGSPIFNIFNDIGRLCVSFNAFSFSHIKRAGNVVAHLLARW  1295



>ref|XP_008374008.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=615

 Score =   179 bits (453),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 168/592 (28%), Positives = 263/592 (44%), Gaps = 62/592 (10%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +RI +R+ GW  + LS AG+  L K+V  A+P + M    LP GVC +IEK  R + W  
Sbjct  31    ERIESRMTGWAEQFLSPAGKEILIKAVATAMPNHAMSCFKLPIGVCRDIEKAIRSYWW--  88

Query  1786  DEQSGNNK-MSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
                SG ++ +   +W  +   K  GGLG ++    N A + K+GWRL   P++L AK + 
Sbjct  89    -RGSGVSRGVHWTSWVRLLQKKXXGGLGFKDFQGFNLAFLGKIGWRLIIFPDSLLAKVMR  147

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
              KY+        T  R S S  WKGI   R+ L+ GL   V +G++ +   D W   KP 
Sbjct  148   DKYYPEKTFREATIGRGS-SWGWKGILEARKVLDKGLIWRVEDGETIKIREDPWY-PKPS  205

Query  1429  YEKLRGTLGLPELYA--TVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
                +R  + L  LY    +N+   + + WK + I     +EE   + S+ +++  + D  
Sbjct  206   TFCIRPAVNLDALYVRDLINQ---ESKTWKADLISASFSSEEANTILSIPISKTGSCDRM  262

Query  1255  GWSPDPRGCFSVKSAYGWA---------------DNAARQEADKVWGLIWSLRVPARISM  1121
             GW     G +SVKS YG A                 + + + +K W  IWSL VP ++  
Sbjct  263   GWFHTANGVYSVKSGYGIAMELMESGGLRKKGRGATSDKTKHNKTWNAIWSLDVPRKMRF  322

Query  1120  FIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTE  941
             FIW   +  +       RRH+  +  C   +   E  D L        + W +   R  +
Sbjct  323   FIWKCCNHALAVRRNLKRRHMRVDNICGINSFDLEGTDFL--------QSWVNIYNRVAD  374

Query  940   ESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
              +                D+ +  +E     F   LW LWK +N+A+F  + LP  + L+
Sbjct  375   LA----------------DKNELLQE-----FVFGLWRLWKNQNDAIFRGSFLPPTEILE  413

Query  760   WLRRCDSETAAAFE--ERHWPLQRHNRG-GEE--RLSWEKPDEGWLKLNTDGSCTSDGQ-  599
               +R  +E   A E  E+  P   +NR  GEE  R+ W+KP  G +K+NTD +     Q 
Sbjct  414   VWKRNVAEYRNANERVEQGSPTPVYNRDMGEERRRVCWKKPCFGMIKVNTDVTWYKASQR  473

Query  598   ASCGGVLRDTHGNW-CRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKML  422
             A  G V RD  G     G T      ++  AEA  +   L      G   +++E D++ +
Sbjct  474   AGLGWVARDFAGVLQGAGGTGASSFHSAAAAEAAAIRGALEFCLLQGFVNVIVESDARAI  533

Query  421   VEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
             V  ++ + T   +   ++      A    AV F+   RE N  A  +AK+  
Sbjct  534   VLMIRKELTRDFRIGCLLGDIENLARRMQAVSFVFAPRESNTAAHSVAKFVF  585



>ref|XP_006464882.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=769

 Score =   180 bits (456),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 149/584 (26%), Positives = 253/584 (43%), Gaps = 39/584 (7%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             RI  ++  W+A   S  G+  L K+V  A+P Y M    LP G+C +++K    F WG+ 
Sbjct  182   RIINKISNWQANFFSSGGKEILIKAVAQAVPAYAMSVFKLPLGLCEDMQKAIAGFWWGKK  241

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
              +  +   S   W+ +   K RGGLG R+L + N+A + K  WR+   P +L A+ +  K
Sbjct  242   REKRSIHWS--KWERLCQAKKRGGLGFRDLSSFNQALVAKQSWRIIQAPESLVARVMKEK  299

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y  R    +      + S  W+ I   RE +  GL   + +GK  + +   WL  +P   
Sbjct  300   Y-FRHSCFMEAQIGSNPSYIWRSILWGREVIRKGLRWRIGDGKLVKVYQSGWL-PRPETF  357

Query  1423  KLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSP  1244
             K      LP L  TV+   D+ + W+ + I+++   E+  ++  + L  + +PD   W  
Sbjct  358   KPISPPSLP-LDTTVSVLIDEDQCWRDDVIRQHFHQEDAAQILKIPLPRQLSPDQVLWHY  416

Query  1243  DPRGCFSVKSAYGWADN-------AARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLT  1085
             D +G +SVKS Y  A         ++ +E +  W  IW L++P ++ +F+W   +  + T
Sbjct  417   DKKGNYSVKSGYQLALQMKFPNRPSSSKEDNNSWNSIWYLQIPEKVKIFMWRATNDLLPT  476

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWL  905
             +    +R I    +C  C   RE + H    C    +IW+ +     EE ++ L     L
Sbjct  477   SENLWKRRILQTPWCQRCRSHRETIFHSLFDCKASRKIWKLT---TFEEEVKALKCKDVL  533

Query  904   TMNLK-GDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNR-------NLLPLEQKLDWLRR  749
             ++ L   DR+   E    E      W +W  RN  +F         ++   E  +   +R
Sbjct  534   SLLLALADRRSKTEM---ELIVAVCWSIWHSRNLFIFQNKKEDFQLSVAGAEAIVQSYKR  590

Query  748   CDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVLRD  572
                    AF  +     +H         W+ P  GW K+N D +   + Q    G V+R+
Sbjct  591   IQMPQLQAFSNQDLVSHKH---------WKCPPAGWFKVNVDAAIKLENQRVGLGIVIRN  641

Query  571   THGNWCRGYTYRIGRCTSTV--AEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKE  398
             + G +      +  +    V  AEA     GL +A+  G   +++E DSK + + +  ++
Sbjct  642   SEGKFITA-AIKPSKWLDRVDYAEAEATRFGLEVAESAGCLPLIVETDSKEVTDLVSARK  700

Query  397   TGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
             + + +   IV       +    V   H  R  N  A  LAK  L
Sbjct  701   STKAEIFWIVSEVQDTMKRLKHVKIQHSPRTCNGFAHTLAKLVL  744



>ref|XP_008382787.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=801

 Score =   180 bits (456),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 155/610 (25%), Positives = 244/610 (40%), Gaps = 26/610 (4%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             RI  +++GWK  +LS AG+  L K+V+ AIP Y M     P  VC E++     F WG  
Sbjct  195   RILEKMQGWKQSSLSRAGKEVLIKAVVQAIPAYPMSIFKFPAIVCKELDTLVAAFWWGNK  254

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
             +  G  KM  V+ D++   K  G LG RN    N A + K  WRL ++PN+LWA+ +  +
Sbjct  255   D--GARKMHWVSXDVLGLPKDLGXLGFRNFQEFNDALLAKQCWRLVSDPNSLWARVIKAR  312

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y  R      T   R+ S AW  I   R+ L+ G    +  G+  R W+D WL + P+  
Sbjct  313   YFPRCNIWEATKGGRA-SWAWSSILTGRDLLKLGSHWQILGGQDVRVWVDKWLPSLPMGH  371

Query  1423  KLR-GTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWS  1247
              +  G++ +       +      R W    +  +L   + + +    + + +  D   W 
Sbjct  372   PMPLGSVPVTLNLRVSSLICPDSRRWDLNFLLPFLSDSDKQAIEDTPIGDLSRKDRIIWG  431

Query  1246  PDPRGCFSVKSAYGWAD-----------NAARQEADKVWGLIWSLRVPARISMFIWLVKH  1100
                 G +SVKS Y W             + AR+    +W  IW L VP ++  F+WL  H
Sbjct  432   SSKNGIYSVKSGYRWIQSXSLARRDCRLSXARRVPSVLWKAIWKLEVPPKLRHFLWLTLH  491

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
               + T     RR  + +  C  C    E ++HLF  C  V+ +W         +      
Sbjct  492   NCLPTCEALFRRRSSLSXTCPXCLSHDETIEHLFFTCPWVEPVWFGGALNYKIDRAAIHS  551

Query  919   WNSWLTMNLKGDRQQGFEEGWPERF-GTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCD  743
             W  WL               W   +     W +WK R + VFN+  +   + L  +    
Sbjct  552   WVEWLXAVWSSSLVPSNHADWMRSYIAYTCWVIWKTRCDFVFNKVPIYPSKVLFAI----  607

Query  742   SETAAAFEERHWPLQRHNRGGEERLS----WEKPDEGWLKLNTDGSCTSDGQASCGG-VL  578
             S    +F   +  L      G   +     W  P     K+N D S +   +    G V+
Sbjct  608   STAVGSFLAANVSLGVSRSAGAGGVDLGSRWCAPTSPLXKINVDASWSKVSKLGFAGVVI  667

Query  577   RDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK-  401
             R   G +     Y I   ++  AEA  +L+G  +    G   ++IE D +  V  L    
Sbjct  668   RAAEGRFVAAARYPISAPSAAAAEALALLRGCDLGVALGINEVIIESDCRDAVNCLSDSL  727

Query  400   ETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGE  221
             E G  +   ++ +  +  E F    +  + R  N +A +LA    T        E PP  
Sbjct  728   EMGSWEAFPVLAQVKQLREAFQFCRWSWVPRSANGVAHELASVGFTEMREFVWVERPPSS  787

Query  220   FEVRMALDRL  191
                 +  D L
Sbjct  788   LVFVLNNDGL  797



>ref|XP_009113843.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=896

 Score =   180 bits (456),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 160/622 (26%), Positives = 264/622 (42%), Gaps = 56/622 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++  + A+  GW  + LS  G+  L KS+ +A P+Y M    +PK VC +I     +F W
Sbjct  297   VVATVKAKTNGWHHRFLSPGGKEVLTKSIASATPVYPMNVFKMPKKVCDDINNTLAQFWW  356

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G+ +  G+  M   AW  ++  K  GG+G R+    N A + K  WR+  +PN+L A+ L
Sbjct  357   GKSD--GSKGMHWFAWQRMSLPKKEGGMGFRDFEKFNDALLAKQVWRILIKPNSLMARVL  414

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY   S      T+++S S  W  +   +  L+ GL  ++ NG+S   W D WL   P
Sbjct  415   KGKYFPNSNILKAGTKKQS-SYIWNSLLHGQALLKRGLRFIIGNGESVSLWADPWLPTSP  473

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVR-GWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
                 +      P     V+E   + + GW  E I+  +   + E + S+ L      D  
Sbjct  474   PRSPIPKDQSNP--MTKVSELMKQNQTGWNEELIRHTIVEADAEEILSMKLCAYADTDPL  531

Query  1255  GWSPDPRGCFSVKSAYGWADNAARQEADK-------VWGLIWSLRVPARISMFIWLVKHG  1097
              W  +  G +SVKS Y  A +  +    +       +  +IW L    ++  F+W +   
Sbjct  532   VWHYNKSGEYSVKSGYWLATHDPQDLPIEPPPGSIILKNMIWKLPTAPKLQHFLWKMVTS  591

Query  1096  RVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDW  917
              +       RRH+T++  C +C  Q E  +HLF  C    RIWR S          N+ +
Sbjct  592   SLPLGSNLQRRHVTTSVKCPHCQ-QEETTEHLFFECFYAQRIWRAS------GLPHNIFY  644

Query  916   NSWLTMNLKGDRQQGFEEGWPERFGTRLWW----LWKWRNEAVFNRNLLPLEQKLDWLRR  749
              +  T+  K           P+      WW    +WK RN+ +F       +  + W   
Sbjct  645   QAQSTLEDKLMALLQKIPNLPDHLRHLPWWILWRIWKCRNKMIFQ------QTSIHWRTT  698

Query  748   CDSETAAAFEERHWPLQRH-------NRGG------EERLSWEKPDEGWLKLNTDGSCTS  608
               S   A F+ + W L+ +       +R G       +R  W KP  G++K N DG+  +
Sbjct  699   LQS---AYFDTKEW-LEAYQSVDKDEDRQGLRRDMEHQRNKWTKPPTGFVKCNYDGAFNN  754

Query  607   DGQASCGG-VLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAK----EYGARRIMI  443
               + +  G ++RD  G + +G  +   +  +T  E  G LQ L +A       G + ++ 
Sbjct  755   IQRETKAGWIIRDDMGRF-KGAAHASNQQPTTALE--GELQALLLAMMNCWSKGYKHVIF  811

Query  442   ECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALT  263
             E D+  +++   G+ T  +  N I R   +    F  + F    R  N  AD LAK  + 
Sbjct  812   EGDNINVMKLANGESTNIDVTNWI-RDIWRWPAKFEEIKFCWTNRNSNLCADILAKQVIP  870

Query  262   TQGGLHIFEVPPGEFEVRMALD  197
              +   H +   P      M+ D
Sbjct  871   YRLSYHYYSYVPESIRDPMSND  892



>ref|XP_010054376.1| PREDICTED: uncharacterized protein LOC104442671 [Eucalyptus grandis]
Length=1509

 Score =   182 bits (461),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 147/585 (25%), Positives = 246/585 (42%), Gaps = 37/585 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L R+++++EGWK   +S  G+  L K+V+ AIP Y M    +P  +C  IEK+  RF W
Sbjct  905   ILGRVNSKMEGWKENLISKGGKEVLIKTVVQAIPQYVMSVFKIPISICKSIEKKIARFWW  964

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D +     +    WD++   K  GGLG R+L   N+A + K  WRL  +P++LW+K  
Sbjct  965   QNDCRKAG--IHWKQWDVLKYTKALGGLGFRDLVAFNKAMLGKQAWRLIQQPSSLWSKLF  1022

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
                Y             R  S  W+ + + RE +   L   V +GK+     D WL    
Sbjct  1023  KAIYFPAQDFRYAHKGVRP-SWGWQSLLSSREVILPNLQWSVGDGKNINIREDRWLP---  1078

Query  1432  LYEKLRGTLGLP---ELYATVNEYW-DKVRGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
                  RG +G P   E  + V E        W    +  +   +    +  + +    T 
Sbjct  1079  -----RGIVGGPANREEPSLVAELLVQNSNHWNLATLNNFYDEQTTAEILRIPVRRNLTQ  1133

Query  1264  DGWGWSPDPRGCFSVKSAYGWADNA-----------ARQEADKVWGLIWSLRVPARISMF  1118
             D   W+    G ++++SAY     A           + Q+  ++W  IWS+++P ++ +F
Sbjct  1134  DKLVWTETTNGQYTIRSAYHSVRKASICKLTRQASSSYQQPPQLWKCIWSVKLPPKLKVF  1193

Query  1117  IWLVKHGRVLTNYERTRRHITSNEYCYNCA-GQREDLDHLFRRCHDVDRIWRHSLQRRTE  941
              W V H  + T     RR IT +  C  C   Q E ++HLF  C     IW H       
Sbjct  1194  FWSVCHNALPTKENLFRRRITPDPICPLCTLNQPESIEHLFLLCPWTTAIWSHPTINIHI  1253

Query  940   ESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
             ++      + W+   +   + +       E F    W +WK RN A+F+++         
Sbjct  1254  DTTTVRRIDEWIVDRILHKKSKPDL----ELFIAVCWQVWKARNGAIFSKH---QPDPHF  1306

Query  760   WLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTS-DGQASCGG  584
              +    ++  +A    H  + +  +  +    W+ P  G L++N DG+ TS   + S   
Sbjct  1307  GVHAAFAQVRSAAICDHSLMTKPKQSVDLGHFWQPPAPGTLRINIDGAYTSGHTEGSIAF  1366

Query  583   VLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSK--MLVEAL  410
             + RD  G    G T  +   ++   EA  ++  L    + G     +E DS   +LV+AL
Sbjct  1367  ICRDKSGCLQEGLTRSVQAASALQTEAQALIFALCHLLQQGKMSTSLEIDSDCLLLVDAL  1426

Query  409   KGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
               ++    +   +V   +     FL +      RE N +AD  AK
Sbjct  1427  NNQQEPPWEIRPLVYEAVDLCRQFLNLNIRFCKRETNSVADWAAK  1471



>ref|XP_007207799.1| hypothetical protein PRUPE_ppa024472mg, partial [Prunus persica]
 gb|EMJ08998.1| hypothetical protein PRUPE_ppa024472mg, partial [Prunus persica]
Length=920

 Score =   180 bits (456),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 146/548 (27%), Positives = 241/548 (44%), Gaps = 68/548 (12%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +R+  ++ GWK  +LSLAG+  L K++  AIP + MQ     KG+C EI     +F WG+
Sbjct  351   ERVKDKILGWKQSSLSLAGKEVLIKAIATAIPTFPMQCFKFTKGLCDEINSEMAKFWWGK  410

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
                + + K+   +W  +   K+ GGLG R+L+T N A + K  WRL  EPN+ WAK +  
Sbjct  411   --PNSDTKIHWKSWSALCLPKSDGGLGFRDLNTFNLALLGKQAWRLIHEPNSYWAKLIKA  468

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP--  1433
                                     +   RE ++  + H V NG +T+ W D WL      
Sbjct  469   -----------------------SLLEGREVIKENIRHQVFNGHNTKIWEDRWLLPPHQG  505

Query  1432  -LYEKLRGTLGLPELYATVNEYWD-KVRGWKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
              +   +   L  P+L   V+E  D + R W  + + +Y+  + ++ +  + +   +  D 
Sbjct  506   YVVPLITVPLNAPQL---VSEILDGQTRTWNTQALAQYVSQDTIKLINEVPIGNLHREDR  562

Query  1258  WGWSPDPRGCFSVKSAY----------GWADNAARQEADKVWGLIWSLRVPARISMFIWL  1109
               W  +  G +SVKS Y          G  + ++      VW  IW+     ++  F+W 
Sbjct  563   IVWPWNKSGLYSVKSGYNLQVVSASYIGGYNRSSHVIERGVWKDIWASPTLPKVKFFLWR  622

Query  1108  VKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSL--QRRTEES  935
             +    + T     RR I S+ +C  C    E  +H    C     +W  S    R   +S
Sbjct  623   MMVRALPTKLNLYRRRIISSPFCPICNQYEESEEHAIFLCPWTQAVWFGSPLNYRVNPQS  682

Query  934   MRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWW-LWKWRNEAVFNRNLLPLEQKLDW  758
             +   D   W T  L        E  W     + + W +WK R + +F        + +  
Sbjct  683   ITTFD--RWFTGLLNSQMFSKSERVWVLSLVSFISWEIWKARCKFLF--------EDITI  732

Query  757   LRRCDSETAAAFEERHWPLQRH---NRGGEERLS-----WEKPDEGWLKLNTDGSCTSDG  602
               RC  E AA+  E    L+RH    R G    S     W+ P  G +K+N D +   + 
Sbjct  733   DPRCVVERAASAAEEFDVLRRHEISTRNGAGVFSQPTDIWKPPVNGAIKINFDAA-WKNH  791

Query  601   QASCGGVLRDTHGNWCRGYTYRIGRCTSTV--AEAWGVLQGLRMAKEYGARRIMIECDSK  428
             +A  G V+R+ + ++C G+  +  RC ++   AE    ++ LR A   G  +I +E DSK
Sbjct  792   EAGLGVVMRNHNKDFCYGFASK--RCCNSALNAETEAAIEALRCASLRGYSKIEMESDSK  849

Query  427   MLVEALKG  404
             +L++++KG
Sbjct  850   VLIDSIKG  857



>gb|EEC68711.1| hypothetical protein OsI_37193 [Oryza sativa Indica Group]
Length=1546

 Score =   181 bits (460),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 145/576 (25%), Positives = 256/576 (44%), Gaps = 33/576 (6%)
 Frame = -1

Query  1945  EGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSGNN  1766
             +GWK K LS+ G+  L KS+  A+P+Y M    +P  +C  I     ++ WG D  + + 
Sbjct  422   DGWKEKILSMGGKEILIKSIAQAVPVYAMMVFKIPNKICKGITDAISQYWWGDD--ADHR  479

Query  1765  KMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHRSG  1586
             ++    W  +   K +GG+G R+L + N A + K  WRL+++P++L A+ L  +Y +  G
Sbjct  480   RIHWQEWWKMCMPKGKGGMGFRDLQSFNLALLAKQVWRLQSDPDSLCARVLRARY-YLDG  538

Query  1585  SHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTL  1406
               L    +   S  W+ I A  +  + G    V +G   + W D+W+       K++   
Sbjct  539   KLLNARMKSGSSYTWQSILAGLQCFKQGYIWRVGDGTQIKIWEDNWIPGSH-NMKIQTNR  597

Query  1405  GLPELYATVNEYWDKVR-GWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSPDPRGC  1229
             G   L ATV+E  D +   W  + ++      ++ R+  + +      D   W  +  G 
Sbjct  598   G-NNLVATVDELIDPINFTWGGDLLKTIFWPIDVCRIMQIPI-RAGRDDLVAWQYNRSGT  655

Query  1228  FSVKSA------YGWADNAARQEA-----DKVWGLIWSLRVPARISMFIWLVKHGRVLTN  1082
             FSVKSA      Y + + +A+ +A      ++W  +W+L+VPA+I +F W    G V   
Sbjct  656   FSVKSAYHCQWDYKFGERSAQMQASTASRSRLWKRLWNLKVPAKIKIFGWRALKGLVPCR  715

Query  1081  YERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH-SLQRRTEESMRNLDWNSWL  905
                  RH+  +  C  C    ED+ H+   C    ++W    ++ R +         S +
Sbjct  716   AILANRHVGDSGGCPVCQNGPEDIKHMIFTCARAKQVWNSLGVEDRIQRLCMTERSGSVI  775

Query  904   T--MNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETA  731
                + ++ D+ Q  + G+ E   T  W++W  R + V    +          R   S  A
Sbjct  776   LEEILIREDQVQDLQVGFAELVITAAWYIWWERRQLVHGEAV---------QRPARSGMA  826

Query  730   AAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTD-GSCTSDGQASCGGVLRDTHGN-W  557
              A   +++ L    +    R  W+KP EG + +N D G     G  + G V+RD  G   
Sbjct  827   IAALTKNYKLAT-KKDSVLRQGWKKPPEGKVMVNVDAGFDEMGGCGTVGSVIRDCSGGVL  885

Query  556   CRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNN  377
                +++      + +AEA+ + +GL +A++ G  R++I+ D   +V+ +           
Sbjct  886   AAAHSFVPHLVDAPMAEAFALKEGLMLAQQIGCNRLIIQSDCMEVVQIMTDGGFTANSAA  945

Query  376   NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWA  269
              I   C      F  +   H  RE N++A  LA+ A
Sbjct  946   AIYEDCNILWSGFADITIEHCSREANQVAHNLARRA  981



>ref|XP_008366684.1| PREDICTED: uncharacterized protein LOC103430323 [Malus domestica]
Length=1380

 Score =   181 bits (460),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 162/629 (26%), Positives = 261/629 (41%), Gaps = 56/629 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+D+  ARL GWK K  S+AGR  L +SV  ++ +++     LP      +    R FIW
Sbjct  776   LVDKAKARLSGWKGKLXSMAGRFQLVQSVYQSLXLHSFSVYQLPSCXLKHLSACARNFIW  835

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D  S   K+  V W ++   K  GGLGLR+L  +N   ++  GW    +  +LW    
Sbjct  836   SGDLSS--RKLVTVDWSMVXGPKKEGGLGLRDLAXLNLTALLSFGWD-ALQSYSLWGSFA  892

Query  1612  TTKYHHRSGSHLVTTRRRSI---SNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLT  1442
               ++       L   R ++I   S+ W G+      L +    ++ +G+   FW D WL 
Sbjct  893   XQRF------PLSPYRNQNIYLRSSXWHGLKRALPILNNNSRWIIGDGRXVSFWFDKWLD  946

Query  1441  AKPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
                +   L   +  P++   V++  +  + W        L    ++++  L L      D
Sbjct  947   EPIISXSLFSVIS-PKVLPRVSDVIEA-QSWSLPDYFSNLFPSIVQQILRLPLPLNXXXD  1004

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKVWG-LIWSLRVPARISMFIWLVKHGRVLT  1085
                W P P G FS  S Y        + +D  W  +IW   +P R+S+  W + H ++ T
Sbjct  1005  KLIWEPSPTGKFSFSSGYHLIR---XRHSDCAWAKVIWQHFIPPRLSILAWRLFHDKLPT  1061

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR-HSLQRRTEESMRNLDWNSW  908
                  RR I+    C  C    E   HLF  C    ++WR    Q  T   + +     W
Sbjct  1062  EDALQRRGISLASICCLCHNSEESTAHLFFGCRISRQLWRWLXCQFGTSLPLPDSLVAFW  1121

Query  907   LTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAA  728
                  K   +Q     W       +  +WK RN+ +F        + + + R C S  +A
Sbjct  1122  DVYVRKPFSKQ-LHNLWIFAGLXTISAIWKARNKFIFE------GRPIYFHRLCMSINSA  1174

Query  727   AFEERHWPLQRHNRGGEERLS-------------------WEKPDEGWLKLNTDG-SCTS  608
                   + +  +++G + R+                    W  P   W+KLNTDG S  +
Sbjct  1175  IVHGGKF-IPGYSQGFDTRIIXSLGIQPIPRKAPTILPVLWSPPWFPWVKLNTDGLSKGN  1233

Query  607   DGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSK  428
              G A+CGGV R+ HG +  G+  RIG C S  AE   ++ G+  A + G   + +E DS 
Sbjct  1234  PGPAACGGVFRNCHGXFLGGFCQRIGHCNSFFAELSAIIIGIEFAYQRGWHCLWLESDSS  1293

Query  427   MLVEALKGKETGQ----EQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTT  260
              ++ AL+  +           +I    I++   + +    HIYRE N +AD  A   L++
Sbjct  1294  SVISALQSSDFDPPWPLHTQWSICLDRIRKMTFYAS----HIYREXNLVADNFANMGLSS  1349

Query  259   QGGLHIFEVPPGEFEVRMALDRLGASSPR  173
                L   + PP      +  D +G S  R
Sbjct  1350  P-SLTXHDSPPMAVRATLFSDYVGLSGYR  1377



>ref|XP_009130307.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=552

 Score =   176 bits (447),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 159/569 (28%), Positives = 240/569 (42%), Gaps = 47/569 (8%)
 Frame = -1

Query  1900  LAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSGNNKMSLVAWDIITTDKT  1721
             + KSVL+AIP + M    LP  +C  I+    RF W  D      KM +VAW  +T  K+
Sbjct  1     MLKSVLSAIPSHAMTCFLLPISLCIRIQSALTRFWW--DSSPEKKKMCMVAWSKLTKPKS  58

Query  1720  RGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHLVTTRRRSISNAW  1541
              GGLG+R++   N A + K  WR+ T+P+ L A+ L  KY   S   L     +++S+ W
Sbjct  59    MGGLGIRDIQAFNTALLAKQAWRIVTKPDFLLARVLKGKYCG-SAQFLHVQETKTMSHGW  117

Query  1540  KGISAERETLESGLTHVVRNGKSTRFWMDSWL-TAKPLYEKLRGTLGLPELYATVNEYWD  1364
             +GI A R+ L   L  V+ NG  TR W D WL T +P      G +   +    V++   
Sbjct  118   RGILAGRDLLIIKLGKVIGNGDDTRVWKDPWLSTEQPSIP--MGPVTESDQDLVVSDLIC  175

Query  1363  KVRG-WKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWADN--  1193
             +  G W   +I   LP   L ++  L  +    PD + W     G +SVKS Y  A +  
Sbjct  176   RGSGNWNIPRIMSSLPA-LLPQILQLRPSITGAPDSFAWLATKSGSYSVKSGYYVAASQG  234

Query  1192  ---------AARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYC  1040
                      A R     +   IW+ +V  ++ +F+W + HG +       +R + ++  C
Sbjct  235   NDEIRETTEAQRVVEQTLCKAIWTAKVSPKLQLFLWKITHGALPLGENLAKRGLLNHITC  294

Query  1039  YNCAGQREDLDHLFRRCHDVDRIWRHSL--QRRTEESMRNLDWNSWLTMNLKGDRQQGFE  866
              +C G+ E  +HLF  C    ++W  ++  Q     SM +       T  L      G +
Sbjct  295   RHC-GELETAEHLFLHCSFSRQVWAQNIWKQDFDPTSMSSFASAFLATSTLINLPPLGVK  353

Query  865   EGWPERFGTRLWWLWKWRNEAVF-NRNLLP-------LEQKLDWLRRCDSETAAAFEERH  710
             E     F    W +W  RN+ +F NR   P       +    +W    DS  +       
Sbjct  354   E---TIFPWVCWVIWTARNKRIFENRVFEPKDIFSKAISTAKEWNNAQDSLLSPPV----  406

Query  709   WPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGN-WCRGYTYRI  533
              P    NR     L+        L   TD + TS  +A CG  +    GN   +G     
Sbjct  407   -PRNLQNRQVHRPLT-------ELSCFTDAAWTSTNRAGCGWYIMSLEGNVLLKGSCVFE  458

Query  532   GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIK  353
                ++ +AEA  +   L  A E G  +I I+ D + L+ A+       E    I R    
Sbjct  459   FITSAMMAEALAIRSALVHASEAGISKICIKSDCQALIAAISSTCHSVEL-YGIFRDIEN  517

Query  352   EAENFLAVVFLHIYREQNKLADKLAKWAL  266
              +  F  + F  I R  N +AD LAK  L
Sbjct  518   LSLRFSCISFSFISRSLNCMADSLAKSVL  546



>ref|XP_010686872.1| PREDICTED: uncharacterized protein LOC104901027 [Beta vulgaris 
subsp. vulgaris]
Length=1273

 Score =   181 bits (459),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 165/617 (27%), Positives = 250/617 (41%), Gaps = 52/617 (8%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +RI  +L+GWK K LS  G+  L KSV  AIP Y M    LP G+  EI     RF WG 
Sbjct  684   ERIWKKLQGWKEKLLSRPGKEVLLKSVAQAIPTYMMSVFCLPSGLIDEIHAMFARFWWGS  743

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
             +      K+    WD +   K+ GGLG R+LH  N A + K  WRL  + ++   + L  
Sbjct  744   N--GVERKLHWHKWDSLCLPKSMGGLGFRDLHCFNMALLAKQAWRLSQDGHSFLHQVLKA  801

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             +Y+ R    L   R  + S  W+ I   +  L  GL   V NG+S R   D+W+  +   
Sbjct  802   RYYKRV-EFLDARRGYTPSFTWRSIWGSKALLLEGLKWRVGNGESIRVGEDAWIMGE---  857

Query  1426  EKLRGTLGLP------ELYATVNEYWD-KVRGWKWEKIQRYLPTEELERLASLCLTEENT  1268
                 G+  +P      ++   V+   D   RGW  E + +     E   + ++ L+    
Sbjct  858   ----GSHFVPTPQANSDMELKVSALLDYHTRGWNTELVHQIFQEAEWPLILNIPLSRFWP  913

Query  1267  PDGWGWSPDPRGCFSVKSAYGWADNAAR------QEAD---KVWGLIWSLRVPARISMFI  1115
              D   W P   G FSVKS Y W            Q  D   ++W  +W +  P ++  FI
Sbjct  914   NDRRFWWPSRNGLFSVKSCY-WLGKLGHLRTWRLQHGDGERQLWHNVWRVEGPPKLQHFI  972

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS--LQRRTE  941
             W    G +        RHI     C  C    E + H    C     +W+ S  +     
Sbjct  973   WRACKGSLGVKERLHWRHICGEAVCPVCGAPSESICHALFECTMAREVWQGSPFVALIAA  1032

Query  940   ESMRNLDWN-SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNR-NLLPLEQK  767
               M + +   SWL  N   +  +             +W +W  RN+ VF + +L+     
Sbjct  1033  APMESFEGTFSWLICNSTREEMRN--------VCALMWAVWYCRNKMVFEQEHLVAPSVA  1084

Query  766   LDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCG  587
             +++++    E    + +R    Q          SW  P     K N D   +  G++  G
Sbjct  1085  VNFVKLV--EEYCGYAKR--VFQPCGGLQVSAPSWCAPPAMVFKANFDAHISPRGESGLG  1140

Query  586   GVLRDTHGNWC-RGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEAL  410
              V+R+  G  C  G    +    +  AEA  +L  + +A   G   I+ E DS ++V AL
Sbjct  1141  VVIRNDVGEVCVMGVRRVVASWDAATAEAMALLYAVELATRLGYGNIIFEGDSLLVVNAL  1200

Query  409   KGKETGQ----EQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHI  242
             K +  G        N+I R C+    +F++  F H+ R  N +A  LA+W          
Sbjct  1201  KNQSEGGYPIFHIFNDIQRLCL----DFVSFSFSHVKRADNCVAHLLARWECAGNSEFVW  1256

Query  241   FEVPPGEFEVRMALDRL  191
             FE  P        LD L
Sbjct  1257  FESFPQSIATLAELDLL  1273



>gb|EMS67609.1| Alanyl-tRNA synthetase [Triticum urartu]
Length=1858

 Score =   181 bits (460),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 163/598 (27%), Positives = 255/598 (43%), Gaps = 63/598 (11%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +RI ++L+G   + +S AGR    K+V  AIPI+++    L K VC  +     ++ W  
Sbjct  1264  ERIRSKLQGGSERMISCAGREVRIKTVAQAIPIFSVSCFKLTKKVCKSLTSSFAKYWWS-  1322

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
                   N M   AW  + + K +GG+G RNL   N A + K GWRL T P++L A+ L  
Sbjct  1323  -SSLDRNSMHWKAWMALASPKEKGGMGFRNLELFNTALLGKHGWRLMTNPSSLCARVLKG  1381

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             +Y         T  R S S  W+ I A RE+L+ GL   + +G+S   W D W+      
Sbjct  1382  RYFPTCDFMQATVPRFS-SAMWRAIIAGRESLQVGLIKRIGDGRSISIWDDKWIP-----  1435

Query  1426  EKLRGTLGL-PELYA------TVNEYWDKVR-GWKWEKIQRYLPTEELERLASLCLTEEN  1271
                 GTL + P + +      TV++  D V   WK + + +   T + + + ++ L    
Sbjct  1436  ----GTLSMTPTVRSTNTQLQTVSDLIDTVNWSWKADVVCQNFITPDADAILNILLMRGG  1491

Query  1270  TPDGWGWSPDPRGCFSVKSAYGWA----DNAARQEA---------DKVWGLIWSLRVPAR  1130
               D   W+ +  GC+S+KSAY       ++ A +E           ++W  +W L+V  R
Sbjct  1492  GDDVVAWAHERSGCYSIKSAYRALMTRNEHLALEEGTITETSSTDKQLWSRLWKLKVLPR  1551

Query  1129  ISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQ-  953
             + +F W V HG +        RHIT+   C  C    ED+ H    C    R W  +   
Sbjct  1552  VRVFWWRVLHGILPAESTLMHRHITTIGTCKLCLHAEEDMKHALLDCTHARRFWNAAPDW  1611

Query  952   ---RRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLL  782
                +R E  +  L W+  +  +        F E    +  T +W +W  RN A  ++  L
Sbjct  1612  LDIKRPE--LHPLTWSRDVLCD------PMFSESERAKLVTVMWAIWTSRNNATHDKKEL  1663

Query  781   PLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDG  602
                Q +        +T  A      P + H R       W   D GW+K+NTD S   + 
Sbjct  1664  DPIQSM-------KKTQEALTVLELP-RDHARILPGH-GWRPSDLGWIKINTDVSVAMEA  1714

Query  601   -QASCGGVLRDTHGN----WCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIEC  437
              +   GGV R TH +    WC+ Y    G     +AEA  +  G+  A   G   ++ E 
Sbjct  1715  RRGGAGGVAR-THSSFLAAWCKPYP---GITDPLIAEALALRNGVLFAHLRGYSEVVFES  1770

Query  436   DSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALT  263
             ++  +V     +   +     I+    +    F + V  H+ R  N LA   AK A T
Sbjct  1771  NNLDIVNLWNSRHNVRAIVAPILFEIREHVIYFKSFVIQHVGRSANVLAHLCAKQAST  1828



>ref|XP_010692841.1| PREDICTED: uncharacterized protein LOC104905886 [Beta vulgaris 
subsp. vulgaris]
Length=978

 Score =   180 bits (456),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 106/289 (37%), Positives = 153/289 (53%), Gaps = 7/289 (2%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             + ++I  +L GWK K LSLAGR+TLAKS L  +  Y+MQ+A LP+ VC +++KR  RF+W
Sbjct  689   ICEKIDRKLAGWKTKYLSLAGRITLAKSTLTTMANYSMQSAKLPRSVCDDVDKRVCRFLW  748

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E+     + L++W+ +   + +GGL + +    N A M KLGWRL  EPN LWA+ L
Sbjct  749   GGTEE--KRAIHLISWETLQKPQGQGGLAIPSSRQANVAFMTKLGWRLLVEPNALWARVL  806

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY        + + +  +SN W GI+   + L  G    V +GK+T FW   W T   
Sbjct  807   RAKYCRGRCDIDMFSPKPGMSNVWNGITENAKLLCEGAQVAVNDGKTTLFWDHKWATNST  866

Query  1432  LYEKLRGTLGLPE--LYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCL-TEENTPD  1262
             L      T  +P+  L ATVNE WD   GW+WE    YLP   L+ + S  +   E   D
Sbjct  867   L--SYLATQPIPDEILGATVNEMWDPNLGWRWEIFADYLPQNILKIIQSFEVRVSEEQGD  924

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFI  1115
                W    +G F+++S+     N +    D+ W L+WS   P   S F+
Sbjct  925   LLYWHHGKQGKFTIRSSLCLMQNISDAIDDECWKLVWSAPRPTTYSCFL  973



>gb|AFP55557.1| non-ltr retroelement reverse transcriptase [Rosa rugosa]
Length=1747

 Score =   181 bits (460),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 160/598 (27%), Positives = 253/598 (42%), Gaps = 50/598 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L DR+  R+ GW+ K LS AG+  L K+V  AIP YTM    LP G    I K   RF W
Sbjct  1056  LPDRVWNRVHGWEGKLLSKAGKEVLIKTVAQAIPNYTMSVFQLPAGTSDAINKCVARFWW  1115

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G++   G   +    W  +   K  GGLG R+L   N+A + K GWRL   P++L A+ L
Sbjct  1116  GKE---GGKGIHWRRWSDLCFSKKDGGLGFRDLSLFNQALLGKQGWRLMMYPDSLVARML  1172

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY       +      S S  W+     RE L  G+   + +GK  R ++D W+   P
Sbjct  1173  KAKYFPWD-DFMEAELGSSPSYLWRSFLWGRELLRKGVRWRIGDGKEVRVFIDPWVPGLP  1231

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
              +  +    G P L+  V++      GW  E +  +   +E E ++S+ +     PD + 
Sbjct  1232  SFRPILRQ-GAP-LFLRVSDLLHNNGGWNMEALNYWFTDDECEAISSITVGATRRPDVYM  1289

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEADKV-------WGLIWSLRVPARISMFIWLVKHGR  1094
             W+    G ++VKS Y  A    R+EA  +       W  +W L++P +I+ F+W    G 
Sbjct  1290  WNYCKNGRYTVKSGYWLACEENREEAINIVLAPRNFWKHLWKLKLPPKINHFLWRCSMGF  1349

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS-----LQRRTEESMR  929
             +        +HI  +  C+ C   RE   H    C     ++  +     L      S  
Sbjct  1350  IPCMEVLLWKHIAHSASCFRCQQGRESPVHATWGCSCCVAVFERAGFYSKLSSGQFPSFI  1409

Query  928   NLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLP----LEQKLD  761
             +L  +++ T+    D+++       + F   LW  W  RN       ++P     E  + 
Sbjct  1410  HLLHHAFSTL----DKEE------LQLFAVLLWLNWHERNNCYHKGAVVPSDIIYENGVK  1459

Query  760   WLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGG-  584
             +L +C  E                  G  R  W+ P  G LK+N DG+     +   GG 
Sbjct  1460  FL-KCFKEALGCRAGVEVKAVEEVVPGSLR-RWQAPSSGQLKVNCDGAANFKDRCFGGGT  1517

Query  583   VLRDTHGNWC----RGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVE  416
             ++RD  G+      + + + +   +S VAE   +  GL +  E   R IM+E D    + 
Sbjct  1518  IIRDEFGSLIVAGGKNFQHPV---SSLVAELLAIKVGLDLVVERRLRNIMVESDCLEAIH  1574

Query  415   ALKGKETGQEQNNNIVRRCIKEAENFLAVV----FLHIYREQNKLADKLAKWALTTQG  254
              L  KE        +V    ++ +N +A+V      H+ RE N  A  +AK+     G
Sbjct  1575  LLNSKERCLAPEGGLV----EDIQNTMALVNISSIYHVRREGNTAAHAIAKFVARNNG  1628



>ref|XP_009375083.1| PREDICTED: uncharacterized protein LOC103963932 [Pyrus x bretschneideri]
Length=1815

 Score =   181 bits (459),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 152/607 (25%), Positives = 247/607 (41%), Gaps = 20/607 (3%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             R+  +L+GWK  TLS AG+  L K+V+ AIP Y M     P  VC E++     F WG  
Sbjct  1209  RVMEKLQGWKQNTLSRAGKEVLIKAVIQAIPAYPMCIFKFPGAVCKELDALVAGFWWGCK  1268

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
             E  G +K+  V+  ++   K  GGLG RN    N A + K  WRL TEP++LWAK +  +
Sbjct  1269  E--GAHKIHWVSKGVLGLPKDMGGLGFRNFQEFNEALLAKQCWRLITEPDSLWAKVIKAR  1326

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL-Y  1427
             Y   S         R+ S AW  +   R  +  G    +  G+  R W D WL + PL +
Sbjct  1327  YFPHSSIWDAKKGGRA-SWAWSSLICGRGLVREGSHWQILGGQEVRVWQDRWLPSLPLGH  1385

Query  1426  EKLRGTLGL-PELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGW  1250
              +  G + + P L  +     +  R W    +Q ++  E ++ +    L + +  D   W
Sbjct  1386  PEPVGQVAVTPSLRVSALICPESGR-WNINFLQPFISEEAMQAIEETPLGDLSRKDRLIW  1444

Query  1249  SPDPRGCFSVKSAYGWADN-----------AARQEADKVWGLIWSLRVPARISMFIWLVK  1103
                  G +SVKS Y W              + R      W  IW L VP ++  F+WL  
Sbjct  1445  DTSKNGAYSVKSGYRWLQGRSLVRRDLRRPSVRGVPKAFWKGIWKLEVPPKLRHFLWLTV  1504

Query  1102  HGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNL  923
             H  + T     RR  +    C  C    E ++H+F  C  V+ IW         +     
Sbjct  1505  HNCLPTRDALFRRRSSQTSTCPICCCHDETIEHIFLSCSWVEPIWFGGALGYKMDRPSLP  1564

Query  922   DWNSWLTMNLKGDRQQGFEEGWPERFGT-RLWWLWKWRNEAVFNRNLLPLEQKLDWLRRC  746
              W+ W+      +     +  W + +     W +WK R + VF    +   + L  +   
Sbjct  1565  SWSDWIQGVFSPNLCNSGDIMWRQSYIVFTCWCIWKARCDFVFKEVPINPLKVLAAISEA  1624

Query  745   DSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGS-CTSDGQASCGGVLRDT  569
                  +A  +         R   +   W  P   ++K+N D S   +      G ++RD 
Sbjct  1625  VRSFISAKAKDGERGGGEGRRNSQVTRWCAPTYPFVKINVDASWSKASKMGFVGVIVRDM  1684

Query  568   HGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK-ETG  392
                +     + I   ++  AEA+ +L G R+  E G R +++E DS   ++ L      G
Sbjct  1685  ESKFVAAARHPINAPSAAAAEAYALLHGCRLGAELGVRYVILESDSLDAIKCLSSSLSMG  1744

Query  391   QEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEV  212
               +   ++ R  +   +F+   +  + R  N +A K+A    +    +     PP     
Sbjct  1745  SWEAYPVLARVKQLGGDFIDCRWSWVPRSANGVAHKIASIGFSEMSDIVWVVRPPSSLVY  1804

Query  211   RMALDRL  191
              +  D L
Sbjct  1805  VLNNDGL  1811



>ref|XP_008237273.1| PREDICTED: uncharacterized protein LOC103336015 [Prunus mume]
Length=1765

 Score =   181 bits (458),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 158/590 (27%), Positives = 241/590 (41%), Gaps = 41/590 (7%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             DR+  ++ GW+ K LS AG+  L KSV  AIP Y+M    LP G+C EIE    +F W +
Sbjct  1170  DRVWNKVNGWQGKLLSKAGKEVLIKSVCQAIPSYSMSVFRLPVGLCREIESIIAKFWWSK  1229

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
             ++  G   +    W  +   K+ GGLG R L + N+A + K GWRL   P++L A+ L  
Sbjct  1230  NDGRG---IHWKKWSFMCQHKSDGGLGFRELTSFNQALLCKQGWRLLEFPHSLIARMLKA  1286

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             +Y   S   L  +     S  W+ +   R+ L  GL   + +G+    + D W+     Y
Sbjct  1287  RYFPNS-DFLAASSGSLPSFTWQSLLWGRDLLRLGLRWRIGDGRLVNIYGDPWVP----Y  1341

Query  1426  EKLRGTLGLPELYAT--VNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             ++      +P L AT  V + +    GW   K+       E E + S+ L  +N  D   
Sbjct  1342  DRFFTIQSIPTLPATSRVCDLFTASGGWDVGKVFATFSFPEAEAILSIPLMGDNL-DRRI  1400

Query  1252  WSPDPRGCFSVKSAYGWADNAARQE-------------ADKVWGLIWSLRVPARISMFIW  1112
             W+    G +SVKS Y  A    R E             + K W  +W L+VP +I   +W
Sbjct  1401  WNFTKNGRYSVKSGYWAALEYKRLEELSAGTVAGPSSSSLKSWKHLWKLKVPQKILHLLW  1460

Query  1111  LVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESM  932
              V    + +     RR IT  E C  C   RE   H    C    ++W      R     
Sbjct  1461  RVAQDILPSKEVLFRRRITQGEVCCRCFAPRETTLHALVGCVVCLQVWEALDFPRDFLLP  1520

Query  931   RNLDWNSWLTMN---LKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
                D  +W+      +  D+Q          F   +W LW  RN  +F     P    + 
Sbjct  1521  TVADVGTWMDAAWSIIPPDKQS--------LFAFTVWVLWNERNGVLFGSQPTPSGVLVQ  1572

Query  760   WLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGG  584
               +  D+E        H  L    R     + W  P     KLN DG+   + G    G 
Sbjct  1573  RAKDYDAEFKRYSAANHRSLSSLVRD----IKWRPPTGNCFKLNVDGATDMETGARGAGA  1628

Query  583   VLRDTHGNWCRGYTYRIGRCTSTVA-EAWGVLQGLRMAKEYGARRIMIECDSKMLVEALK  407
             ++RD+HGN       R     S +A E + +  G+  A +     + IE DS   V  + 
Sbjct  1629  IVRDSHGNLVGALAMRAPSRISVLATELYALKVGISFALDVSLLPLEIEYDSLQAVSMVN  1688

Query  406   GKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQ  257
              +E        +V    +      +    H+ R+ NK A ++A+++L  Q
Sbjct  1689  SEEECLAAEGGLVDGVRRLLVRSASTAVRHVPRQANKAAHRIARFSLRDQ  1738



>ref|XP_009147282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score =   169 bits (429),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 110/313 (35%), Positives = 155/313 (50%), Gaps = 12/313 (4%)
 Frame = -1

Query  1090  LTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNS  911
             +TN ER RRH+  N  C  C    E + H+ R C     +W   +     +   NL    
Sbjct  1     MTNMERKRRHLCDNGVCQLCKNGDETILHVLRDCSAAAGLWVKIVPLSKRQRFLNLPLLE  60

Query  910   WLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETA  731
             WL  NL  D  +  E+ W   F   +WW WKWR   VF         ++ +++    E  
Sbjct  61    WLYENLIKDASKN-EDPWAILFALTVWWCWKWRCGYVFGETG-KCRDRVKFVKDKAHEVV  118

Query  730   AAFEERHWPLQRHNRGG---EERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHG  563
              A ++    L+ H   G   E+R+SW +P   W K+NTDG+   + G A+ GGVLRD +G
Sbjct  119   LANKK----LKHHLAVGVRVEKRISWIRPANSWCKMNTDGASRGNPGLATAGGVLRDEYG  174

Query  562   NWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQ  383
              W  G+   IG C++++AE WGV  GL +A + G RR+ +E DS  +V+ L+        
Sbjct  175   EWKGGFAVNIGICSASLAELWGVYYGLCIAWDRGIRRLEVEVDSASVVDFLRTGIHDSHP  234

Query  382   NNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMA  203
              + +VR C         V F H+YRE N LAD LA +A +   GLH FE  P E  V + 
Sbjct  235   LSFLVRLCYGFISRDWLVKFSHVYREANHLADGLATYAFSLPFGLHYFETIP-EVVVPIL  293

Query  202   LDRL-GASSPRRV  167
             L+ L G S PR V
Sbjct  294   LEDLSGVSRPRHV  306



>gb|ABA98491.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1621

 Score =   180 bits (457),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 170/620 (27%), Positives = 260/620 (42%), Gaps = 73/620 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +RI  R++GWK K LS AG+  L K+V  AIP + M    L K +C +I K   ++ W
Sbjct  1024  LKERIWQRIQGWKEKLLSRAGKEILIKAVAQAIPTFAMGCFELTKDLCDQISKMIAKYWW  1083

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                E+  +NKM  ++W+ +T  K  GGLG R+++  N A + K GWRL  +P++L ++ L
Sbjct  1084  SNQEK--DNKMHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVL  1141

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----  1445
               KY    G      +  ++S  W+ I      L++G+   V +G     W D W+    
Sbjct  1142  RAKYFPL-GDCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRVGDGSKINIWADPWIPRGW  1200

Query  1444  TAKPLYEKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENT  1268
             + KP+    RG      L   V E  D   G W  + + +    E++  + S+ +  E  
Sbjct  1201  SRKPMTP--RGA----NLVTKVEELIDPYTGTWDEDLLSQTFWEEDVAAIKSIPVHVE-M  1253

Query  1267  PDGWGWSPDPRGCFSVKSAYGWADNAARQEA--------------DKVWGLIWSLRVPAR  1130
              D   W  D RGCF+VKSAY       R+ +              D  W  +W L VP +
Sbjct  1254  EDVLAWHFDARGCFTVKSAYKVQREMERRASRNGCPGVSNWESGDDDFWKKLWKLGVPGK  1313

Query  1129  ISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQR  950
             I  F+W + H  +        R +  +  C  C    ED  HLF +C  V ++W    Q 
Sbjct  1314  IKHFLWRMCHNTLALRANLHHRGMDVDTRCVMCGRYNEDAGHLFFKCKPVKKVW----QA  1369

Query  949   RTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTR----LWWLWKWRNEAVFNRNLL  782
                E +R++     L     G          PE   T     LW  WK RNE        
Sbjct  1370  LNLEELRSM-----LEQQTSGKNVLQSIYCRPENERTSAIVCLWQWWKERNEV-------  1417

Query  781   PLEQKLDWLRRCDSETAAAFEERHWPLQRHN------RGGEERLSWEKPDEGWLKLNTDG  620
                 +   + R  +E +     +     R N      R GE  + W +P   ++K+NTDG
Sbjct  1418  ----REGGIPRSPAELSHLIMSQAGEFVRMNVKEKSPRTGECAV-WRRPPLNFVKINTDG  1472

Query  619   SCTSD-GQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIM  446
             + +S+  Q   G V++D  G   +              AE       ++ A E G  RI 
Sbjct  1473  AYSSNMKQGGWGFVIKDQTGAVLQAGAGPAAYLQDAFHAEVVACAAAIKTASERGMSRIE  1532

Query  445   IECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIY------REQNKLADK  284
             +E DS ML  A++        N + +   I E ++ +   F H +      R  NK+A +
Sbjct  1533  LETDSMMLRYAIQDNSF----NLSSLGGVILEIKHIILSCF-HSFSVSYSPRSCNKVAHE  1587

Query  283   LAKWALTTQGGLHIFEVPPG  224
             LA +    Q        PPG
Sbjct  1588  LAAYGCNLQTVSSWAGCPPG  1607



>gb|EAZ03196.1| hypothetical protein OsI_25347 [Oryza sativa Indica Group]
Length=858

 Score =   178 bits (451),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 153/591 (26%), Positives = 246/591 (42%), Gaps = 74/591 (13%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L D+I  R+  W    LS  G+  L K+VL AIP+Y M    LP  +C ++ K TR F W
Sbjct  289   LQDKIWKRIIQWGENFLSSGGKEILIKAVLQAIPVYVMGLFKLPDSMCEDLMKATRNFWW  348

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G ++  G       +WD +   K  GG+G R++   N+A + +  W L   P++L A+ L
Sbjct  349   GANK--GKQTTHWRSWDCLMKSKQSGGMGFRDMKLFNQALLARQAWHLLDSPDSLCARVL  406

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY + +GS + T    + S  WKGI    E L+ G+   V NG S R W D W+    
Sbjct  407   KAKY-YPNGSIIDTCFTGNSSPGWKGIEHGLELLKKGIIWRVGNGHSIRIWRDPWIPRNF  465

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
               + + G       +  V++  D    W   +++ +    + E +  +  +     D   
Sbjct  466   SRKAISGKGSCRLRW--VSDLLDSDGLWDEHRVRHFFLPIDAEVILGIRTSRGRDEDFVA  523

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYER  1073
             W PD  G FSVK                               +F W      +     +
Sbjct  524   WHPDKFGSFSVK-------------------------------IFAWKAITNSLAIMLNK  552

Query  1072  TRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMNL  893
              +R++  +  C  C  + ED+ H   RC     +W   L  R    +  +    W   + 
Sbjct  553   KKRNLEQSSTCTICGIEEEDVAHALCRCPQAKFLW---LALRNSNDIGFVPDGRWTGSDW  609

Query  892   KGDRQQGFEEGWPER--FGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFE  719
               ++ +   E  P+R  F   LW  W  RNE V  ++  P+E      R   S   +  E
Sbjct  610   ILNQLEILVE--PDRVMFLLLLWRAWHIRNEVVHGKHAPPIEAS---HRFIVSYHTSLLE  664

Query  718   ERHWPLQ-----------------RHNRGGEE-RLSWEKPDEGWLKLNTDGSCTS-DGQA  596
              + +P                   RH R  E    +W+KPD GW+KLN DGS    DG  
Sbjct  665   IKQFPKADLTKGKHVIGQMVGHSGRHQRQPETLPYTWKKPDTGWMKLNVDGSFQEHDGSG  724

Query  595   SCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIECDSKMLV  419
               G +LR++ G         + RC   + AE      GL +  ++    I+IE D    +
Sbjct  725   GIGAILRNSAGEVVFASCGSMNRCGGALEAELLACRDGLTLVLQWTLLPIVIESDCLQAI  784

Query  418   EALKGKETGQEQNNNIVRRCIKEAENFLA----VVFLHIYREQNKLADKLA  278
             + ++ KE   E+ +++    I+E ++ +A    +V + I+R QN ++  LA
Sbjct  785   QLIQSKE---EERSDLA-FLIREIKHLMAGNRDIVIMKIHRNQNSVSHALA  831



>ref|XP_009122881.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=744

 Score =   177 bits (448),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 148/553 (27%), Positives = 232/553 (42%), Gaps = 65/553 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DRI  +  GW  + LS AG++ + KSVL+A+P Y+M    LP  +   I+    RF W
Sbjct  173   IVDRIRQKAIGWTTRFLSAAGKLVMLKSVLSAMPTYSMSCFKLPMSLIKRIQSTLTRFWW  232

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D    + KMS ++W  IT  K  GGLG+R+L   N A + KL WR+ T PN L A+ L
Sbjct  233   DSDHD--HKKMSWISWAKITRSKHDGGLGIRDLQCFNDALLGKLSWRILTNPNGLLARIL  290

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
             T KY  +  S L +    S S+ W+GI   R+ +   L   V NG+S + W D WL    
Sbjct  291   TGKY-CKDSSFLDSHAPASCSHGWRGILIGRDLIVKHLGWAVGNGESIQLWNDPWLDTNK  349

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             L   +       +     + + +  R W  EKI+  LP+    ++  +  ++E  PD   
Sbjct  350   LERPMGPATEQTKDDLVKSLFQENSRSWDKEKIEATLPSAA-PQIYGIKPSKEGAPDKRI  408

Query  1252  WSPDPRGCFSVKSAYGWA------DNAARQEADKVWG-LIWSLRVPARISMFIWLVKHGR  1094
             W     G +S K+ Y  A      +   R+E    W   IW ++ P ++ + IW  KH  
Sbjct  409   WLKHSSGVYSTKTGYQAAVEGKTEEPTPREEGSYQWMRKIWDIKSPMKLKLLIWKAKHRG  468

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN  914
             +  N     R+I  +  C  C G+ E ++H+F +C     +WR +             + 
Sbjct  469   LPVNESLAVRNIIPSGVCVRC-GEIETIEHVFFKCQFAQDVWRKA------------PFK  515

Query  913   SWLTMNLKGDRQQGFEEGW----------PERFGT------RLWWLWKWRNEAVFNRNLL  782
               + ++  GD    F  GW          P    T       +W +W  RN  +F   + 
Sbjct  516   DSVVLDDVGD----FTAGWERVQQASCLPPVGLKTCNIAAWIVWTIWIARNHKIFREKVF  571

Query  781   PLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDG  602
               ++ +         T A  E + W   +      E    ++ +E  L    D  C SD 
Sbjct  572   SEQEVI---------TKALVEAKEWEAAQIQPKATETGRVKRMEEQRL----DIVCKSDA  618

Query  601   -------QASCGGVLRDTHGNWCRGYTYRIGRCTST-VAEAWGVLQGLRMAKEYGARRIM  446
                     A          G   R  +       S  VAE   +L  +  A  +  ++I 
Sbjct  619   AWNEEKMAAGAAWFFTTQSGGQVRSDSEIFTHVKSPLVAEGLAMLTAMEQALLWDYKQIS  678

Query  445   IECDSKMLVEALK  407
              E DSK+LV A++
Sbjct  679   FESDSKILVTAIQ  691



>ref|XP_004301440.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=786

 Score =   177 bits (449),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 149/565 (26%), Positives = 235/565 (42%), Gaps = 65/565 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DR+  +L GWK ++LS AG+  L KSV  AIP Y M     PKGVC  I      F W
Sbjct  207   IVDRVQRKLVGWKQRSLSWAGKEILIKSVATAIPAYPMACFKFPKGVCDTINSALSNFWW  266

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G    S  N++   +W+++   K  GGLG R+LH  N + + K  WRL  EPN+LWA  L
Sbjct  267   G--STSTGNRIHWKSWELLGKTKEEGGLGFRDLHQFNMSLLAKQCWRLVEEPNSLWASVL  324

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y    G  L  T+    S +W  +   R+ +  G    V NGKS + W DSW+    
Sbjct  325   KARYFPNCG-FLEATKGYRASWSWASLIEARDLVFQGCCWQVVNGKSIQIWHDSWIPPPS  383

Query  1432  LYEKLRGTLGLPELYATVNEY---WDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
             +   +     LP     + +    WD    W+ + +   L  E  +R+  + + EE+  D
Sbjct  384   MGGGILIDGALPPSSPQLVDSLIDWD-THTWRLDGVANVLSREAEDRIRCIPIGEEDGND  442

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEAD-------------KVWGLIWSLRVPARISM  1121
                W     G F+VKS Y W    +   A              K+W L+W +    ++ +
Sbjct  443   RLLWPWSKNGSFTVKSGYHWLHQQSSMNASPLVITGTSHRVGKKMWRLLWGMPTLPKVKL  502

Query  1120  FIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTE  941
             F W V  G         +R +TS+  C  C  + E  +HL   C  V  IW  S      
Sbjct  503   FFWQVMGGVGPNFSNLYKRKLTSSPMCPLCGLEDETFEHLLLLCSWVSPIWFGSPMGLRI  562

Query  940   ESMRNLDWNSWLT---MNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQ  770
             +  +    +SW      ++ G +Q+ F   +        W +WK R   ++    +P+  
Sbjct  563   DKQQITMVDSWFINSYSSIVGTKQKEF---FLTMSSMICWMIWKARCNYLYKG--IPVSP  617

Query  769   KLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASC  590
             +                  H  +          L+ E  +    +L T  S         
Sbjct  618   Q---------------STLHLAIN---------LAMEFMEAKATQLQTTDS---------  644

Query  589   GGVLRDTHGNWCRGYTYRIGRCTST-VAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEA  413
               ++RD  G    G + RI RC+S  +AEA  +L G   A     R++++E DS+ ++E 
Sbjct  645   --LIRDHSGALVGGASMRI-RCSSPKIAEAEAILLGASTAASNRWRKVVLESDSQAIIEE  701

Query  412   LKGKETGQEQNNNIVRRCIKEAENF  338
              + ++    +   I+ R  K    F
Sbjct  702   CRNRKNKNWKIYPIISRIRKLCSRF  726



>ref|XP_010671205.1| PREDICTED: uncharacterized protein LOC104888072 [Beta vulgaris 
subsp. vulgaris]
Length=1592

 Score =   180 bits (456),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 162/624 (26%), Positives = 262/624 (42%), Gaps = 71/624 (11%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +++++S +L  WK + LS+ GR+TL KS L+ +PIY M    +P GV  +I K TR+F+W
Sbjct  975   IINKVSKKLATWKGRMLSIGGRLTLIKSSLSNLPIYYMSIFPIPTGVIKKINKITRQFLW  1034

Query  1792  GRDEQSGNNK---MSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWA  1622
                  SGN +   +SLV+W+I+   KT GGLG+ ++   N A + K  WRL  +P  LW+
Sbjct  1035  -----SGNMEKRSLSLVSWEIVQLPKTMGGLGIGSILHKNIAMLSKWFWRLLQDPTPLWS  1089

Query  1621  KTLTTKYHHRSGSHLVTTRRRSISNAWKGISAE-------RETLESGLTHVVRNGKSTRF  1463
             + +  KY + S   +           W+ I A        +E +  G+   + NG  TRF
Sbjct  1090  QVICDKYRYSSAPSISDIVIPKSGGPWRKICAAILHQADVKEIISKGIRKNIGNGSQTRF  1149

Query  1462  WMDSWLTAKPL---YEKLRGTLGLPELYATVNEYWDKVR---GWKWEKIQRYLPTEELER  1301
             W + WL + PL   + +L      P +      +W+ +     + W++  R     E +R
Sbjct  1150  WHEPWLASSPLKREFPRLFSISIDPNVTVAAQGFWEGMNWVWTFSWKRALRPQDCVEKKR  1209

Query  1300  LASLCL---TEENTPDGWGWSPDPRGCFSVKSAYGWADNA-ARQEADKVWGLIWSLRVPA  1133
             L  + L     +   D   W  +  G FS KS     D        D V G IW   VP 
Sbjct  1210  LDEMLLQVCPSQKAHDSIIWVYNKSGIFSTKSVTMELDKIRPPSHQDAVRG-IWRGLVPH  1268

Query  1132  RISMFIWLVKHGRVLTNYERTRRHITS--NEYCYNCAGQREDLDHLFRRCHDVDRIW---  968
             RI +F+WL   G++ T  +     I S  N  C  C+ + E  DHL   C    ++W   
Sbjct  1269  RIEVFVWLALLGKLNTRCKLASLGIISVENSLCPLCSQESETSDHLLLHCSFASQLWSWW  1328

Query  967   ------RHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNE  806
                        R   E+     W           +   F++ W   F    W LWK RN+
Sbjct  1329  LNMWQVSWCFPRTLREAFTQWQW---------PKKAPFFKKVWVTVFFIITWTLWKERNQ  1379

Query  805   AVFNRNLLPLEQKLD--------WLRRCDSETAAAFEE-------RHWPLQRHNRGGEER  671
              +F+ +   ++   D        W+     E   +  +         W  + +    +  
Sbjct  1380  RIFSDSNSSMKDLKDLVLLRLGWWISSWKEEFPYSPMDITRNPACLQWNCKTNLSWSDST  1439

Query  670   L----SWEKPDEGWLKLNTDGSCTS-DGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAE  506
             L    +W  P     K N D S    + +++ GGVLR+  GN+   ++  I       AE
Sbjct  1440  LKRVATWSPPPSHTFKWNVDASMHPIESRSAIGGVLRNHLGNFISLFSSPIPFMEINSAE  1499

Query  505   AWGVLQGLRM---AKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEA-ENF  338
                + + +++   ++     +++IE DS   V+     E G   N N     I+ A    
Sbjct  1500  ILAIHRAVKISLSSEVLKGVKLIIESDSANAVQWCNS-ENGGPWNLNFHLNYIRNARRGG  1558

Query  337   LAVVFLHIYREQNKLADKLAKWAL  266
               +  +H  R  N +AD +AK  L
Sbjct  1559  PEISIVHKGRSANFVADSMAKQGL  1582



>ref|XP_007017131.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
 gb|EOY14356.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
Length=2251

 Score =   180 bits (457),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 160/615 (26%), Positives = 264/615 (43%), Gaps = 45/615 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ +I  R+ GW+ K LS  GR+TL +SVL ++PIY +Q    P  V   + +    F+W
Sbjct  1651  LVAKIEERITGWENKILSPGGRITLLRSVLASLPIYLLQVLKPPVCVLERVNRLFNSFLW  1710

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G    + + ++   +W  I    T GGL +R+L  +  A  MKL WR +T  ++LW + +
Sbjct  1711  GGS--AASKRIHWASWAKIALPVTEGGLDIRSLAEVFEAFSMKLWWRFRTT-DSLWTRFM  1767

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  R    + T  +   S  WK +       E  +   V  G +  FW D W+   P
Sbjct  1768  RMKY-CRGQLPMQTQPKLHDSQTWKRMLTSSTITEQHMRWRVGQG-NVFFWHDCWMGEAP  1825

Query  1432  LYEKLRGTLGLPELYATVNEYWDKV--RGWKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
             L    +      E  +++ +  D      W  EK++  L  E ++ +A + +   N  + 
Sbjct  1826  LISSNQ------EFTSSMVQVCDFFTNNSWNIEKLKTVLQQEVVDEIAKIPIDTMNKDEA  1879

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
             + W+P P G FS KSA  W     R+  + V+  IW   VP   S F+W + H  +    
Sbjct  1880  Y-WTPTPNGDFSTKSA--WQLIRKRKVVNPVFNFIWHKTVPLTTSFFLWRLLHDWIPVEL  1936

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTM  899
             +   + +     C  C    E + H+        ++W +  +       + L  N     
Sbjct  1937  KMKSKGLQLASRC-RCCKSEESIMHVMWDNPVAMQVWNYFAKL-----FQILIINPCTIN  1990

Query  898   NLKGDRQQGFEEGWPERFGTR-----LWWLWKWRNEAVFNRNLLPLEQKLDW-LRRCDSE  737
              + G      +   P    T      LW+LW  RN+A  +RNL     ++ W + +   +
Sbjct  1991  QIIGAWFYSGDYCKPGHIRTLVPLFILWFLWVERNDAK-HRNLGMYPNRVVWRVLKLIQQ  2049

Query  736   TAAAFEERHWP--------------LQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ  599
              +   +   W                Q  +    +  SW KP  G  KLN DGS      
Sbjct  2050  LSLGQQLLKWQWKGDKQIAQEWGIIFQAESLAPPKVFSWHKPSLGEFKLNVDGSAKQSHN  2109

Query  598   ASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLV  419
             A+ GG+LRD  G    G++  +G   S  AE   + +GL + ++Y  RR+ IE D+  ++
Sbjct  2110  AAGGGILRDHAGEMVFGFSENLGTQNSLQAELLALYRGLILCRDYNIRRLWIEMDAISVI  2169

Query  418   EALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIF  239
               L+G   G      ++   +++  +  +  F HI+RE N+ AD LA      Q  L +F
Sbjct  2170  RLLQGNHRGPHAIRYLM-VSLRQLLSHFSFRFSHIFREGNQAADFLANRGHEHQ-NLQVF  2227

Query  238   EVPPGEFEVRMALDR  194
              V  G+    + LD+
Sbjct  2228  TVAQGKLRGMLCLDQ  2242



>ref|XP_008340459.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=536

 Score =   174 bits (442),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 115/349 (33%), Positives = 159/349 (46%), Gaps = 15/349 (4%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L DR+  RL+ W+ K LS AG+  L K+V  AIP Y+M    LPK  C E+ K    + W
Sbjct  173   LKDRLWKRLKSWQGKLLSAAGKEVLVKAVAQAIPNYSMSCFLLPKLFCDELNKMVASYWW  232

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               DE  G  KM   +W+ +   K  GGLG R L+  N   + K GWRL   P +L A  L
Sbjct  233   SGDE--GEKKMHWCSWERLCNPKMEGGLGFRFLYAFNLGMLAKQGWRLLANPQSLVATVL  290

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY   S S +    +   S  WK I   R  L  GL   V  G S R W D W+   P
Sbjct  291   KEKYFPTS-SFMEAPLKPGASYVWKSIYIARNVLSLGLRWQVDTGHSIRIWEDPWIPI-P  348

Query  1432  LYEKLRGTLGLPELYATVNEYWDKV-RGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
             L  +      +      VNE  D V + WK + +Q     EE+  +  + L+  N+PD  
Sbjct  349   LRFRPYSPKPMGCTLTMVNELIDHVAKCWKIDVLQSLFSAEEVNLIRKIPLSVRNSPDHL  408

Query  1255  GWSPDPRGCFSVKSAYGWADN----------AARQEADKVWGLIWSLRVPARISMFIWLV  1106
              W  +  G F+V+SAY  A N          ++  +  KVW  +W+ +VP ++ + +W +
Sbjct  409   LWHHERHGRFTVRSAYHVARNWLHPTNCGASSSNGDGAKVWAKVWNAQVPTKVKICVWRL  468

Query  1105  KHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS  959
              +  V T      RHIT +  C  C    E   HL + CH     W  S
Sbjct  469   ANELVPTRANLVARHITMDVECVLCGAYGESTIHLMKDCHYARCAWMSS  517



>gb|EEE50824.1| hypothetical protein OsJ_31232 [Oryza sativa Japonica Group]
Length=1594

 Score =   180 bits (456),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 170/620 (27%), Positives = 260/620 (42%), Gaps = 73/620 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +RI  R++GWK K LS AG+  L K+V  AIP + M    L K +C +I K   ++ W
Sbjct  997   LKERIWQRIQGWKEKLLSRAGKEILIKAVAQAIPTFAMGCFELTKDLCDQISKMIAKYWW  1056

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                E+  +NKM  ++W+ +T  K  GGLG R+++  N A + K GWRL  +P++L ++ L
Sbjct  1057  SNQEK--DNKMHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVL  1114

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----  1445
               KY    G      +  ++S  W+ I      L++G+   + +G     W D W+    
Sbjct  1115  RAKYFPL-GDCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRMGDGSKINIWADPWIPRGW  1173

Query  1444  TAKPLYEKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENT  1268
             + KP+    RG      L   V E  D   G W  + + +    E++  + S+ +  E  
Sbjct  1174  SRKPMTP--RGA----NLVTKVEELIDPYTGTWDEDLLSQTFWEEDVAAIKSIPVHVE-M  1226

Query  1267  PDGWGWSPDPRGCFSVKSAYGWADNAARQEA--------------DKVWGLIWSLRVPAR  1130
              D   W  D RGCF+VKSAY       R+ +              D  W  +W L VP +
Sbjct  1227  EDVLAWHFDARGCFTVKSAYKVQREMERRASRNGCPGVSNWESGDDDFWKKLWKLGVPGK  1286

Query  1129  ISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQR  950
             I  F+W + H  +        R +  +  C  C    ED  HLF +C  V ++W    Q 
Sbjct  1287  IKHFLWRMCHNTLALRANLQHRGMDVDTRCVMCGRYNEDAGHLFFKCKPVKKVW----QA  1342

Query  949   RTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTR----LWWLWKWRNEAVFNRNLL  782
                E +R++     L     G          PE   T     LW  WK RNE        
Sbjct  1343  LNLEELRSM-----LEQQTSGKNVLQSIYCRPEIERTSAIVCLWQWWKERNEV-------  1390

Query  781   PLEQKLDWLRRCDSETAAAFEERHWPLQRHN------RGGEERLSWEKPDEGWLKLNTDG  620
                 +   + R  +E +     +     R N      R GE  + W +P   ++K+NTDG
Sbjct  1391  ----REGGIPRSPAELSHLIMSQAGEFVRMNVKEKSPRTGECAV-WRRPPLNFVKINTDG  1445

Query  619   SCTSD-GQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIM  446
             + +S+  Q   G V+RD  G   +              AE       ++ A E G  RI 
Sbjct  1446  AYSSNMKQGGWGFVIRDQTGAVLQAGAGPAAYLQDAFHAEVVACAAAIKTASERGMSRIE  1505

Query  445   IECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIY------REQNKLADK  284
             +E DS ML  A++        N + +   I E ++ +   F H +      R  NK+A +
Sbjct  1506  LETDSMMLRYAIQDNSF----NLSSLGGVILEIKHIILSCF-HSFSVSYSPRSCNKVAHE  1560

Query  283   LAKWALTTQGGLHIFEVPPG  224
             LA +    Q        PPG
Sbjct  1561  LAAYGCNLQTVSSWAGCPPG  1580



>ref|XP_010666276.1| PREDICTED: uncharacterized protein LOC104883442 [Beta vulgaris 
subsp. vulgaris]
Length=1944

 Score =   179 bits (455),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 157/575 (27%), Positives = 255/575 (44%), Gaps = 39/575 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +++++  +L  WK+K LS AGR+ L +S LN IP Y MQ   LP    +++++    F+W
Sbjct  1276  IVEKVRKKLANWKSKFLSRAGRLVLIQSTLNTIPNYYMQANFLPIATLNDLDRICNNFLW  1335

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E  G +K+ LV+ ++  + KT GGLG+R+   +N   M KLGW++      L  + +
Sbjct  1336  G--EVEGKSKLHLVSKEVSFSPKTLGGLGIRSHRNLNTILMSKLGWKMCHGNPNLAQQCI  1393

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              +KY H S      T+    S+ W+ I    E L    T V+ NGK T FW D+WL    
Sbjct  1394  QSKYVHSS----YITKFTKGSHIWQDIGRGWELLSRHCTWVLGNGKDTLFWEDNWLGLGS  1449

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             L  +L G L   E   TV++    +  W ++ +   LP E  +++  L   E   PD   
Sbjct  1450  LRSQLYGPLNKNEDKITVSQ-CRVLNDWNFDILSFQLPVEIRDKIVGLVWVETEEPDYPC  1508

Query  1252  WSPDPRGCFSVKSAY-GWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYE  1076
              S      FS+K AY    D +  +  +     +W    P ++  F+WL+   R+ TN  
Sbjct  1509  SSFVSDNQFSLKKAYLALFDYSTTEHMN-----VWRNPSPPKLRFFLWLLWKDRLPTNKM  1563

Query  1075  RTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDW----NSW  908
                R I     C  C  Q E   H  + C     +W        E +   + W    + W
Sbjct  1564  LWSRKIVPFPVCPLCNRQEESSYHAIKDCDHAQCVW--------ECAAPPIVWKDNDHVW  1615

Query  907   LTMNLKGDRQ-QGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETA  731
             +  N+   ++ Q  E  W   F    + +WK RN  +F +  +P  Q L  LR+      
Sbjct  1616  VRENVLCYKESQNIE--WATLFPFICYEIWKNRNLFIFEKQNVP--QPLCTLRK------  1665

Query  730   AAFEERHW--PLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQAS-CGGVLRDTHGN  560
             A +  R +    +  N    +  +    D     ++ D S  +    +   GVLR+  G 
Sbjct  1666  AIYAARDFLTSYKIVNLEPTQPGNIIFNDPTCFYIHVDASFLAKSYLTGIAGVLRNHKGE  1725

Query  559   WCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQN  380
             W  G+   I      +AE   +L+GLR A +     I I  D+K  +  +    T ++  
Sbjct  1726  WLGGFQKSIYAKDVLMAELLAILEGLRFAHKEYLNNITIISDNKQAITLMNMDYTSRDFY  1785

Query  379   NNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
              ++V  C +  + F    F+ + RE N +AD++AK
Sbjct  1786  CHVVNECREWQKRFQTSQFVFVRREHNGVADEMAK  1820



>ref|XP_010686122.1| PREDICTED: uncharacterized protein LOC104900404 [Beta vulgaris 
subsp. vulgaris]
Length=1546

 Score =   179 bits (454),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 151/581 (26%), Positives = 243/581 (42%), Gaps = 42/581 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             LLDR+  +L GWK K LS AG+  L K+V+ ++P Y M     P  +  EI     RF W
Sbjct  963   LLDRVWKKLRGWKEKLLSRAGKEVLIKAVIQSLPTYLMGVYKFPVVIIQEIHSAMARFWW  1022

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   +    KM  V+W+ ++  K  GG+G ++L   N A + +  WRL    N+L ++ L
Sbjct  1023  G--GKGMERKMHWVSWEKMSKPKCLGGMGFKDLSVFNDALLGRQVWRLLHYKNSLLSRVL  1080

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
             + KY+   G  L      S S +W+ I + +  ++ GL   V  G++   W D W+  + 
Sbjct  1081  SAKYYP-DGDVLQARLGFSNSFSWRSIWSAKSLVQEGLMWRVGGGRNINIWSDPWVGDE-  1138

Query  1432  LYEKLRGTLGLPELYATVNEYWDKV----RGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
                  RG   L      +N   D +    + WK+E I+++    + + + S+ L+   T 
Sbjct  1139  -----RGRFILSNRAEGLNTVSDLIDDTTKEWKFEAIEQHFGERDQQCILSIPLSSRETE  1193

Query  1264  DGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLT  1085
             D   W+    G +SVK+AY        ++  K W ++W L V  ++  F+W      + T
Sbjct  1194  DVLTWAYSKDGLYSVKTAYMIGKGGNLEDFHKAWVVLWGLDVSPKVRHFLWRYCTSSLPT  1253

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW-RHSLQR-----RTEESMRNL  923
                   RH+     C  C  + E   H    C  + R+W  H  +      R E     L
Sbjct  1254  RATLMARHLLEEGGCPWCPSELETSQHAIFSCARIRRLWVDHGCEAMVGDGRVEGGCEML  1313

Query  922   D-WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPL---EQKLDWL  755
             + WN+              ++   ++     W +W  RN  VF     PL    Q++   
Sbjct  1314  ERWNA-------------LDKKMVQKGCFLAWNIWAERNRFVFENTCQPLSIISQRVS--  1358

Query  754   RRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLR  575
             R+ D            P             W  P EG +KLNTD     +G  S   V R
Sbjct  1359  RQVDDHNEYTTRIYGQPACVRPVSSSH---WCAPPEGVIKLNTDAHIEGNGWVSVATVAR  1415

Query  574   DTHGNWCRGYTYRI-GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKE  398
             +T G        R        +AE   +L  +RMAK  G + +M+E D+ +++  L    
Sbjct  1416  NTCGQVLFAAVRRQRAYWPPDIAECKAILFAVRMAKARGLQNVMVESDALVVISRLSKAA  1475

Query  397   TGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
                   + I+      +  F A+ F H+ R+ N +A  LA+
Sbjct  1476  LFYSDLDAIMGDVFSLSVYFNAISFNHVKRDGNAVAHHLAR  1516



>ref|XP_010687489.1| PREDICTED: uncharacterized protein LOC104901596 [Beta vulgaris 
subsp. vulgaris]
Length=1102

 Score =   178 bits (452),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 156/573 (27%), Positives = 243/573 (42%), Gaps = 42/573 (7%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +RI  +L+GWK K LS  G+  L K+V+ AIP Y M    LP G+  EI     RF WG 
Sbjct  492   ERIWKKLQGWKEKLLSHPGKEVLIKAVVQAIPTYMMSVFCLPSGLVDEIHSLIARFWWGS  551

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
              E  G  KM    W+ +   K+ GGLG R+LH  N+A + K  WRL     +L A  L  
Sbjct  552   KE--GERKMHWYKWETLCMPKSMGGLGFRDLHCFNQALLAKQAWRLTKNSYSLLALVLKA  609

Query  1606  KYHHRSGSHLVTTRR-RSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
             +YH +     V  RR  + S  W+ I   +  L  GL   V +G+S R W D+WL  +  
Sbjct  610   RYHKK--VEFVDARRGYNPSFTWRSIWGSKSLLLEGLKWCVGSGRSIRVWEDAWLLGEGA  667

Query  1429  YEKLRGTLGLP-ELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             +     ++    EL  +    +D+  GW  + +Q+    EE + +  + L+     D   
Sbjct  668   HFTPTPSMNSDMELRVSALLDYDE-GGWNVDMVQQTFVEEEWDMILKIPLSRYWPDDHLY  726

Query  1252  WSPDPRGCFSVKSAY---------GWADNAARQEADKVWGLIWSLRVPARISMFIWLVKH  1100
             W P   G FSV+S Y          W      +E   VW  +WS++ P ++  FIW    
Sbjct  727   WWPTKDGLFSVRSCYWLARLGHIRTWQLYHGEREL-AVWRRVWSIKGPPKMVHFIWRACR  785

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS-LQRRTEESMRN-  926
             G +        RHI  +     C   +E + H    C     IW+ S      ++  R  
Sbjct  786   GCLGVQERLFYRHIRDSPSSSLCDEPQETICHALYDCTHAKAIWQVSDFSPLIDDVPRTS  845

Query  925   -LDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFN----RNLLPLEQKLD  761
              ++   WL   +              +    LW +W  RN ++F     R +      + 
Sbjct  846   FVESFEWLVSKVSNTELS--------KLCALLWAVWYCRNMSIFESQTLRGVEVASSFVK  897

Query  760   WLRRCDSETAAAFEERHWPLQRHNRGGEER-LSWEKPDEGWLKLNTDGSCTSDGQASCGG  584
              +   D+  A+ F        R  R G+    SW  P  G++K N D   +++G+   G 
Sbjct  898   LVEEYDTYAASVF--------RSVRCGDPSPTSWNPPATGFVKANFDAHVSANGEIGMGV  949

Query  583   VLRDTHGNWCRGYTYRIG-RCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALK  407
             VLRD HG      T R+G R  + +AEA      + +A   G   ++ E D+ ++V  +K
Sbjct  950   VLRDCHGVVKLMATKRVGARWDAALAEAMAARFAVEVALRLGFVNVLFEGDALVVVNVVK  1009

Query  406   GKETGQEQNNNIVRRCIKEAENFLAVVFLHIYR  308
              +  G      +     +   +F +  F+H+ R
Sbjct  1010  NRADGVAPIFRVFNDIHRLLSSFESFSFMHVKR  1042



>ref|XP_007040950.1| Uncharacterized protein TCM_016759 [Theobroma cacao]
 gb|EOY25451.1| Uncharacterized protein TCM_016759 [Theobroma cacao]
Length=879

 Score =   177 bits (449),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 171/626 (27%), Positives = 273/626 (44%), Gaps = 53/626 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ +I  R+ GW+ K LS  GR+TL +SVL+++P+Y +Q    P  V  +IE+    F+W
Sbjct  279   LITKIRDRISGWENKILSPGGRITLLRSVLSSLPMYLLQVLKPPAIVIEKIERLFNSFLW  338

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G D   G  +M   AW+ IT   + GGL +RNL+ +  A  +KL WR +T  ++LW   L
Sbjct  339   G-DSNEG-KRMHWAAWNKITFPCSEGGLDIRNLNDVFEAFTLKLWWRFQT-CDSLWTHFL  395

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              TKY      H V  +    S  WK +   RE     +   +  G    FW D W+  +P
Sbjct  396   KTKYCLGRIPHYVHPKLHD-SLVWKRMIRGREVAFRNIRWKIGKG-DLFFWHDCWMGNQP  453

Query  1432  L---YEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
             L   +  LR  + L      V+ +++    W  +K++ YLP   ++ +  L        D
Sbjct  454   LVMSFPSLRNDMSL------VHNFYNG-DTWDVDKLKAYLPMNLIDEIL-LIPFNRTQQD  505

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTN  1082
                W+    G F+  SA  W     R+ ++ +   IW   +P  IS F+W   +  +   
Sbjct  506   VAYWTLTSNGEFATWSA--WETIRQRKSSNALCSFIWHRSIPLSISFFLWRALNNWIPVE  563

Query  1081  YERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR-----HSLQRRTEESMRNLDW  917
                  + I     C  C    E L H+        ++W        +     + +  + W
Sbjct  564   LRMKEKGIQLASKCV-CCNSEESLMHVLWGNSVAKQVWAFFGKFFQIYVLNPQHVSQILW  622

Query  916   NSWLTMNLKGDR-QQGFEEGWPERFGTRLWWLWKWRNEA-----------VFNRNLLPLE  773
              +W      GD  ++G        F    W+LW  RN+A           V  R +  L 
Sbjct  623   -AWF---FSGDYVKKGHIRSLLPIFIC--WFLWLERNDAKHRHTRLNPDRVVWRIMKLLR  676

Query  772   QKLD------WLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCT  611
             Q LD      W  + D++ A+ +       Q  +R   + + W KP  G  KLN DGS  
Sbjct  677   QLLDGSLLHQWQWKGDTDIASMWGH---TFQSKHRAPPQIIYWRKPFTGEYKLNVDGSSR  733

Query  610   SDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDS  431
             +   A+ GG+LRD  G    G++  IG C S  AE   +L+GL + KE     + IE D+
Sbjct  734   NGHLAASGGILRDHTGKLIFGFSENIGLCNSLQAELRALLRGLLLCKERHIENLWIEMDA  793

Query  430   KMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGG  251
               +++ ++  + G      ++   I++  + ++    HI+RE N+ AD LA    + Q  
Sbjct  794   LAVIQLIQHSQKGSHDIRYLL-ESIRKCLSCISYRISHIFREGNQAADYLANEGHSHQ-N  851

Query  250   LHIFEVPPGEFEVRMALDRLGASSPR  173
             L +     GE    + LDRL     R
Sbjct  852   LCVITEAQGELHGMLKLDRLNLPYVR  877



>ref|XP_008377870.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=591

 Score =   174 bits (442),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 164/616 (27%), Positives = 250/616 (41%), Gaps = 58/616 (9%)
 Frame = -1

Query  1918  LAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSGNNKMSLVAWDI  1739
             +AGRV L +SV  ++ +++      P  +   + +  R FIW  D  S   K+  V+W  
Sbjct  1     MAGRVQLTQSVFQSMLLHSFSVYKWPSSLLRSLSRCARNFIWSGDVTS--KKLVTVSWHQ  58

Query  1738  ITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHLVTTRRR  1559
             I   K  GGLGLR+L ++N   ++KLGW + T  ++ W+  +  ++      +  +  R 
Sbjct  59    ICAPKNEGGLGLRDLGSLNXTALLKLGWLIITT-DSPWSIYIRKRFKLHGRLYSCSYMRS  117

Query  1558  SISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTLGLPELYATV  1379
             SI   W GI +    L      V+ NG +T  W+D WL  KP+ + +  T   P L  T 
Sbjct  118   SI---WPGIKSILHILFQNCRWVIGNGSTTSLWVDKWLD-KPIVDVVGATEIAPSLSRTK  173

Query  1378  NEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWA  1199
                  ++  W    I      +  + +  + L  +   D   W     G FS    Y   
Sbjct  174   VSNIIRMGQWVIPSIFSSTFPDLTKEILEMPLPIDEDKDVLIWEASTSGGFSFSDGY---  230

Query  1198  DNAARQEADKVWG-LIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQ  1022
             +    +   K W  +IW   +P R S+ +W +   ++ T  +  RR I     C  C   
Sbjct  231   EIVRHRFPVKSWASIIWRPFIPPRYSILVWXILFNKLPTEDQLQRRGIPLAPICQLCHKN  290

Query  1021  REDLDHLFRRCHDVDRIWR-HSLQRRT-EESMRNLDWNSWLTMNLKGDRQQGFEEGWPER  848
              E +DHLF  C      WR  + Q  T  + M +L  + WL   L           W   
Sbjct  291   SESIDHLFSSCDFAQCAWRWLATQFGTIIQPMGSLS-DLWLDF-LSKRFSPHLRNVWLAS  348

Query  847   FGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEER-  671
                 L  +WK RN+  F       E K     R    T+    +       H RG  +R 
Sbjct  349   GFFLLMAIWKMRNKVKF-------EGKPPSFSRLCRSTSXWIRQVGALTPGHVRGTLDRQ  401

Query  670   -------------------LSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHGNWCR  551
                                + W  P   W+K+NTDG    + G A+CGGV RD+ G +  
Sbjct  402   LLVSLGISPNPCKAPSIVPVLWHPPPSSWVKVNTDGLAKGNPGPAACGGVFRDSAGYFLG  461

Query  550   GYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETG-----QE  386
             G++  +G  TS  AE   V+  + +A   G + + +E DS  ++              Q 
Sbjct  462   GFSLSLGHRTSFYAELHAVILAVELAHARGWQNLWLESDSSSVISCFASGSFSPPWSLQT  521

Query  385   QNNNIVRRCIKEAENFLAVVF--LHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEV  212
             + NN    C    +N   +VF   HI+RE N +ADKLA   L +   L     PP E   
Sbjct  522   RWNN----CTLLLQN---MVFRCSHIFREGNAVADKLANLGLLSS-SLVWHSTPPIEILP  573

Query  211   RMALDRLGASSPRRVS  164
              +  D LG  + R VS
Sbjct  574   PLHSDFLGMPTYRFVS  589



>ref|XP_008385092.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=715

 Score =   176 bits (445),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 168/635 (26%), Positives = 255/635 (40%), Gaps = 60/635 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L D+  A+L GW  K LS+AGRV L +SV  ++ +++      P  +   + +  R FIW
Sbjct  107   LADKAKAKLTGWXGKLLSMAGRVQLTQSVFQSMLLHSFSVYKWPSSLLRPLSRCARNFIW  166

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D  S   K   V+W  I   K  GGLGLR+L ++N   ++KLG  + T  ++ W+  L
Sbjct  167   SGDVTS--KKSVTVSWRQICAPKNEGGLGLRDLGSLNTTALLKLGXLIITX-DSPWSIYL  223

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               ++      +  + +  SI   W GI +    L      V+ NG +T  W+D WL  KP
Sbjct  224   RERFKLHGRLYSCSYKXSSI---WPGIKSILHILFQNCRWVIGNGSTTSLWVDKWLD-KP  279

Query  1432  LYEKLRGTLGLPELYATVN--EYWDKVRGWKWEKIQRYLPTEEL--ERLASLCLTEENTP  1265
             + +     +G  E+  +++  +  + +R  KW     +  T       +  + L  +   
Sbjct  280   IXD----VVGATEIAXSLSRTKVSNIIRMXKWVIPSXFSSTFXXLTXEILEMPLPIDEDK  335

Query  1264  DGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWG-LIWSLRVPARISMFIWLVKHGRVL  1088
             D   W     G FS    Y   +    +   K W   IW   +P R S+ +W +   ++ 
Sbjct  336   DVLIWEVSTSGVFSFSDGY---EIVRHRFPVKSWASXIWRPFIPPRYSILVWKILFNKLP  392

Query  1087  TNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR-HSLQRRTEESMRNLDWNS  911
             T  +  RR I     C  C    E +DHLF  C      WR  + Q  T         + 
Sbjct  393   TEDQLQRRGIPLAPICQLCHKNSESIDHLFSXCEFAQCAWRWLATQFGTIIPPTGSLSDL  452

Query  910   WLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETA  731
             WL   L           W       L  +WK RN+  F       E K     R    T 
Sbjct  453   WLXF-LSKXFSPHLRNVWJASGFFLLMAIWKMRNKVKF-------EGKPPSFSRLCRSTX  504

Query  730   AAFEERHWPLQRHNRGGEER--------------------LSWEKPDEGWLKLNTDGSCT  611
             A   +       H RG  +R                    + W  P   W+K+NTDG   
Sbjct  505   AWIRQVGALTPGHVRGILDRQLLVSLGISPNSCKAPSIVPVLWHPPXFSWVKVNTDGLAK  564

Query  610   SD-GQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECD  434
              + G A+CGGV RD+ G +  G++  +G  TS  AE   V+  + +A   G + + +E D
Sbjct  565   GNXGPAACGGVFRDSAGYFLGGFSLSLGHRTSFYAELHAVILAVELAHARGWQNLWLESD  624

Query  433   SKMLVEALKGKETG-----QEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWA  269
             S  ++              Q + NN    C    +N +     HI+R  N +ADKLA   
Sbjct  625   SSSVISCFAXGSFSPPWSLQTRXNN----CTLHLQN-MXFRCSHIFRXGNVVADKLANLG  679

Query  268   LTTQGGLHIFEVPPGEFEVRMALDRLGASSPRRVS  164
             L +   L     PP E    +  D LG  + R VS
Sbjct  680   LLSS-SLVWHSTPPIEILPPLHSDFLGMPTYRFVS  713



>ref|XP_008367096.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=924

 Score =   177 bits (449),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 149/589 (25%), Positives = 242/589 (41%), Gaps = 40/589 (7%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             DR+  +++GWK  TLS AG+  L K+V+ AIP Y M     P   C+E++     F WG 
Sbjct  317   DRVLEKVQGWKQSTLSSAGKEVLIKAVIQAIPAYPMNIFKFPANFCNELDSIISNFWWGH  376

Query  1786  DEQSGNN-KMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
             +   GN  ++  V+ +I+   K  GGLG R+    N A + K  WRL  + ++LWA+ + 
Sbjct  377   N---GNKRRIHWVSKNIMGLPKAEGGLGFRSFRDFNDALLAKQCWRLLHDKHSLWARVMK  433

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
              +Y     S L   R    S AW  + + R+ L       + NGK  R W+D WL   P+
Sbjct  434   ARYFPHC-SFLDAKRGGRASWAWSSLLSGRDLLLBESHWQIFNGKXVRVWLDRWLPTLPV  492

Query  1429  YEKL-RGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
                L RG + +            +  GW  + ++ ++   E   +    +      D   
Sbjct  493   GHPLPRGDVQVSRNTPVSXLLSPEXDGWDIDFLKPFISAXEFVAIQETQIGVPCLDDRLV  552

Query  1252  WSPDPRGCFSVKSAY-----------GWADNAARQEADKVWGLIWSLRVPARISMFIWLV  1106
             W  D  G ++VKS Y            +  +++     K+W  IW+L  P ++ +F+W  
Sbjct  553   WPFDRXGLYTVKSGYHCVHAKREQRVNFGSSSSVTVPGKLWKAIWNLNTPPKLRVFLWKT  612

Query  1105  KHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW-----RHSLQRRTE  941
              H  + T     RR +  +  C  C    E ++HLF  C  V+ IW      H + R + 
Sbjct  613   VHNALATLAGLFRRLVAPSPLCPICQIHEETIEHLFLLCPWVEVIWFGGMLSHRIIRSSI  672

Query  940   ESMRNLDWNSWL------TMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLP  779
              S     W +WL      T+N K +  +              W +WK R   +F    + 
Sbjct  673   SS-----WVNWLVNITNTTLNSKAEMXRVL-----SYVAFTCWHIWKSRCNFLFQNGSIN  722

Query  778   LEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ  599
                 L  +    S  + A   +       N   +    W  P   ++K+N D S      
Sbjct  723   PRNVLAAIDTSVSAFSEASRNKVIRPSMPNPAAQVPARWCLPPPPFVKINVDASWEXGTX  782

Query  598   ASCGG-VLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKML  422
             +   G V+RD+ G +           ++ V EA  +  G  +    G   I+IE DS+  
Sbjct  783   SGFSGVVVRDSAGTFIAARRGCFAAHSAAVXEAIAIRHGCELGVAMGFNLIVIESDSQDS  842

Query  421   VEALKGKET-GQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLA  278
             +  L GK + G+ +   ++ +C     +F    +  I R  N  AD LA
Sbjct  843   ISYLMGKTSNGRWEAFPVLTKCKLIGNSFQDCRWSWIPRSANLAADCLA  891



>ref|XP_008341112.1| PREDICTED: uncharacterized protein LOC103404034 [Malus domestica]
Length=1332

 Score =   178 bits (452),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 165/595 (28%), Positives = 247/595 (42%), Gaps = 39/595 (7%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             D+I AR+ GW  + LS AG+  L KSV  A+P Y M    LP GVC ++E+  R + W  
Sbjct  719   DKIEARMSGWAEQYLSQAGKEILVKSVAMALPNYAMSCFRLPIGVCRDVERAIRNYXWRG  778

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
             +EQ     +  V+WD +   K  GG+G +++  +N A + K+G  +   P +L A  L  
Sbjct  779   NEQ--RKGIHWVSWDRLMKQKKAGGMGFKDIQCVNLALLAKIGXXITQNPLSLLASVLXD  836

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             KY     S     + ++ S  WKG+   R+ L+ GL   V NGKS     D WL     Y
Sbjct  837   KYFP-GKSFGEALKGKNTSWGWKGLFEXRKVLKLGLRWRVGNGKSINIRKDPWLPXPSTY  895

Query  1426  EKLRGTLGLPELYAT-VNEYWDKV-RGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             + +      P L  T V +  D V   W  + I+     E++  + S+ L+     D   
Sbjct  896   KXIPK----PILEGTMVCDLIDPVTNSWXTDLIELGFQREDVLPILSIPLSHAGIDDRLV  951

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEA---------------DKVWGLIWSLRVPARISMF  1118
             W       FSVK+ Y  A     + A               + VW  IWSL+VP +I  F
Sbjct  952   WHYTTNXIFSVKTGYSLALKLMEEXALGRKGRGAPSESNNLNLVWNNIWSLQVPNKIKCF  1011

Query  1117  IWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEE  938
             IW   +  +       RRH+  +  C  C    E  +HLF  C      W  S       
Sbjct  1012  IWXCCNNALAVXXNLKRRHMRIDNVCGVCNAINETENHLFFXCEFSHVFWFCSPLHLNSH  1071

Query  937   SMRNLDW-NSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
             ++   D+  SW     +       ++   E F   LW LWK RN+ +F        Q LD
Sbjct  1072  ALEGSDFLXSWSNFXAQVKDXNNADDIRQE-FXFGLWRLWKNRNDVIFKG---IYRQPLD  1127

Query  760   WL---RRCDSETAAAF---EERHWP-LQRHNRGGEERLS-WEKPDEGWLKLNTDGS-CTS  608
              L   R+  SE        E  + P L +  +      + W+KP  G +K+N+D + C  
Sbjct  1128  ILEAWRKSTSEYKDCLAREEXDNRPRLPKXIKASXSXCTKWQKPRFGTIKINSDAAWCKD  1187

Query  607   DGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQ-GLRMAKEYGARRIMIECDS  431
                   G + RD  G          G C S  A     ++  L    E+G   I+IE D+
Sbjct  1188  TMXMGLGWLGRDFAGLLQAAGGIGSGFCXSXAAAEASAIRYALLACIEHGFNDIIIESDA  1247

Query  430   KMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
              ++++ LK +         I+            V F  + RE N+ A  +AK+A 
Sbjct  1248  SLVIKMLKKEVLVDFSIECILGDIEVLVHKLRTVSFAFVPREGNRAAHSVAKYAF  1302



>ref|XP_009130450.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=635

 Score =   174 bits (442),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 155/593 (26%), Positives = 246/593 (41%), Gaps = 36/593 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DR+  +   W  + LS AG+ T+ +SVL+ IP + M    LP  +C  I+    RF W
Sbjct  56    IVDRMKQKSLSWTTQFLSTAGKATMLQSVLSPIPNFAMTCFQLPVSLCKRIQSVLTRFWW  115

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D + G  K+  ++WD +T  K+ GGLG R++ T N A + K+ WR+ T+P+ L A+ L
Sbjct  116   --DSKEGERKICWISWDKLTQPKSIGGLGFRDIQTFNHALLAKISWRIITKPDCLLARVL  173

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY H+  S L T    SIS+ W+GI   R+ L   L   V NG S   W D+W+    
Sbjct  174   LGKYCHKV-SFLKTNPSSSISHGWRGILLGRDLLIKHLGKAVGNGDSINVWSDNWIEPAS  232

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
               +     L         +    + R W   KI   LP E   ++ S+  +     D + 
Sbjct  233   NIKPFGPVLAQDMDLIVSDLLSRETREWNKAKIDCLLP-ELSSQILSIRPSILGIQDTYV  291

Query  1252  WSPDPRGCFSVKSAY------GWADNAARQEADKVWG---LIWSLRVPARISMFIWLVKH  1100
             W     G ++ KS Y      G    ++       W     IWS  +  ++  F+W V  
Sbjct  292   WPLQKSGQYTAKSGYFSMHTQGDTSISSPGMRPDTWNWKKNIWSPPLLPKLKFFLWKVAL  351

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
               + T     +R +  N  C  C G+ E +DH+   C     +W           +  ++
Sbjct  352   NALPTGDNLQKRGLLINTNCARC-GETESIDHILVHCTFAKEVWEVGPWLHQPNPLHFVN  410

Query  919   WNSWLT-----MNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF-NRNLLPLEQKLDW  758
             +   L      +NL      G    W        W LW  RN+ +F NR   P       
Sbjct  411   FKELLQASHTWINLPPYGILGNFIPW------LCWTLWISRNQLLFENRTCTPQAVVTKA  464

Query  757   LRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVL  578
             +  C    +A   ER  P   H+   +  +     D   +  NTD +  SD +A+  G +
Sbjct  465   ISLCREWESAQTPERSAP-HTHSLPLQSSVI----DSSTVICNTDAAWRSDQKAAGLGWI  519

Query  577   RDTHGNWCRGYTYRIGRCTST--VAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKG  404
                  +       R+    S+  +AEA  + + L  A      +I +  DS++LV A+  
Sbjct  520   FSDQDSVELNRASRLHHHVSSACMAEALAIREALLHASSLNINQICLRTDSQVLVRAISS  579

Query  403   KETGQEQN---NNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQG  254
             +    + +   ++I       + +F    F  I R QN  AD LAK  L + G
Sbjct  580   RSRTMDLHGVLSDIDSLAFSPSSSFSNCFFQFIPRAQNGPADSLAKSCLFSLG  632



>ref|XP_006356603.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum 
tuberosum]
Length=885

 Score =   177 bits (448),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 156/606 (26%), Positives = 268/606 (44%), Gaps = 64/606 (11%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ ++  R+  W+ + LS  GR  L  +VL ++PIY +     P  V +++ +   +F W
Sbjct  262   LIKKVMKRISSWQNRLLSFGGRYVLIANVLQSLPIYVVSAMNPPACVITQLHRIFAKFFW  321

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                  +G      V WD +   +  GG+G R+LH +++A   KL W  +T  NTLWA  +
Sbjct  322   A--NTAGAKNKHWVGWDKMCYPRGEGGMGWRSLHDISKALFAKLWWNFRTSTNTLWASFM  379

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  +   H +  +    S+ W+ + + RE +E  +   ++ G S+ FW D+W     
Sbjct  380   WNKYCKK--HHPIIAQGYGSSHVWRRMISIREEVEHEIWWQIKAGNSS-FWFDNWTKQGA  436

Query  1432  LYE--KLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
             LY   +      +        E WDK      EK+ + L  E  + +    ++  NT  G
Sbjct  437   LYHIEENAKEEEVEVKEFCTGEGWDK------EKLLQNLSLEMTDHIME-NISPPNTLFG  489

Query  1258  ----WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRV  1091
                 W W  + +G F+VKSA  W     +QE  +   +IW+  +P +I+ F+W V   R+
Sbjct  490   NDVVW-WMANAQGIFTVKSA--WQITRNKQEVRRDCEVIWNKELPFKINFFMWRVWKRRI  546

Query  1090  LTNYERTRRHITSNEYCYNCAGQRED-LDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN  914
              T+    +  I     C+ C  ++E+ + HLF       ++WR+        +  N+D  
Sbjct  547   ATDDNLKKMRINIVSRCWCCDRKKEETMTHLFPTAPITYKLWRYF----AHFAGINIDGM  602

Query  913   SWLTMNLK------GDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLL---PLEQKLD  761
                 + +         + QG  +  P      +W LWK RN    + ++     +E  ++
Sbjct  603   HLQQLIISWWKHEATPKLQGIYKAIP---AIIMWTLWKRRNALKHDSSISWERMVEMVIE  659

Query  760   WLRRCDSETAAAFEERHWP----LQRHNRGGEE----RLSWEKPDEGWLKLNTDGSCTSD  605
              +R+         +   W     +QR N+   +    R++W+ PD+ ++K NTDG+C  +
Sbjct  660   VVRKMVKSQFPWIKNMRWTWQAIIQRLNQYKRKIHVLRVTWKPPDDHYVKSNTDGACRGN  719

Query  604   -GQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSK  428
              G +S G  +RD  G+        IG  T+  AE   +L  LR       ++++IE DS 
Sbjct  720   PGLSSFGFCIRDDKGDLIYAKAKGIGIATNMEAETVAILTALRECSNRKMQKVIIETDSL  779

Query  427   MLVEAL--------KGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKW  272
              L + +        K  E  +E         I+E    +     HI+RE N LAD LA  
Sbjct  780   SLKKIIQQTWRVPWKIAEKVEE---------IREIMEKIKAKITHIFREGNSLADSLANI  830

Query  271   ALTTQG  254
             A+ +Q 
Sbjct  831   AIESQA  836



>ref|XP_008372934.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=961

 Score =   177 bits (449),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 170/608 (28%), Positives = 257/608 (42%), Gaps = 65/608 (11%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +RI +R+ GW  + LS AG+  L K+V  A+P Y M    LP GVC +IEK  R + W  
Sbjct  348   ERIESRMVGWAEQFLSQAGKEILIKAVAMAMPNYAMSCFKLPIGVCKDIEKAVRNYWW--  405

Query  1786  DEQSGNNK-MSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
                SG+ K +  VAW+ I + K  GGLG +++   N A + K+GWR+  +P++L A  L 
Sbjct  406   -RGSGDRKGIHWVAWEKIRSQKRNGGLGFKDIQCFNLALLAKIGWRITLQPBSLJANVLR  464

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL  1430
              KY     +    +  R  S  WKGI   R+ L+ G+   V +G       D W   KP 
Sbjct  465   EKYFP-GKTFREASGGRGTSWGWKGIFEARKVLDKGIRWRVGDGNCINIREDPWF-PKPS  522

Query  1429  YEKLRGTLGLPELYATVNEYWDK-VRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
               K R   GL  +   V +  D   R WK + ++     +++  + S+ L+     D   
Sbjct  523   TFKARVXEGLQAI--MVRDLIDPGSREWKTDMVKGGFLEKDVTSILSIPLSRYGMSDXLI  580

Query  1252  WSPDPRGCFSVKSAYGWADN---------------AARQEADKVWGLIWSLRVPARISMF  1118
             W     G ++V++ YG A                 ++      VW  IW+L VP ++  F
Sbjct  581   WHHXRNGEYTVRTGYGVALGLMENGDMGKKGRGMPSSAPSLSHVWNKIWNLEVPNKMKFF  640

Query  1117  IWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS-LQRRTE  941
             +W   +  +       RR +    +C  C    E  +HLF RC      W  S LQ  + 
Sbjct  641   VWKCCNNALAVRRNLKRRXLRVXNFCEGCMQPDETENHLFFRCEISHIFWFCSPLQINSL  700

Query  940   ESMRNLDWNSWLTM--NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF-NRNLLPLEQ  770
             E   N    SW +    +KG      E    + F   LW LWK RN+ +F      PL+ 
Sbjct  701   ELEGNDFLASWGSFCGRVKGKEN---EXELMQEFVFGLWHLWKNRNDLIFKGVTHQPLDI  757

Query  769   KLDWLRRCDSETAAAFEERHWPLQRHN---------------RGGEERLSWEKPDEGWLK  635
                W+R  D       E R   LQR N               R G+    W+KP  G +K
Sbjct  758   LGLWMRNLD-------EYREAGLQRTNDDQPTVGLASPAPAGRTGQ----WKKPGFGTIK  806

Query  634   LNTDGSCTSDGQASCGG---VLRDTHG--NWCRGYTYRIGRCTSTVAEAWGVLQGLRMAK  470
             +NTD +     + SC G   V RD  G      G   R+   ++  AE   +   L    
Sbjct  807   VNTDAAWRK--ETSCAGVGWVARDFAGLLQAAGGTGGRLCH-SADAAEMLAIRSALDFCV  863

Query  469   EYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLA  290
               G + + IE D+K +++ ++ + T        +      A    +V F  + RE N+ A
Sbjct  864   RLGFKSVAIESDAKNIIQMIRNETTLDCSLECTLGDIATLARGLESVTFDFVSRESNRAA  923

Query  289   DKLAKWAL  266
               +AK+  
Sbjct  924   HSVAKYVF  931



>ref|XP_008370907.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=899

 Score =   176 bits (447),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 165/631 (26%), Positives = 249/631 (39%), Gaps = 52/631 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L D+  A+L GWK K LS+ GRV L +SV  ++ +++      P  +   + +  R FIW
Sbjct  291   LADKAKAKLTGWKGKLLSMXGRVQLTQSVFQSMLLHSFSVYKWPSSLLRPLSRCARNFIW  350

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D      K   V+W  I   K   GLGLR+L ++N   ++KLGW + T  ++ W+  L
Sbjct  351   SGDVTX--KKXVTVSWRQICAXKNEXGLGLRDLGSLNTXALLKLGWLIITT-DSPWSIYL  407

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               ++      +  + +R SI   W GI +    L      V+ NG +T  W+D WL   P
Sbjct  408   RERFKLHGRLYSCSYKRSSI---WPGIKSILHILFQNCRWVIGNGSTTSLWVDKWLDX-P  463

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             + + +  T   P L  T      ++  W    I      +    +  + L  +   D   
Sbjct  464   IVDVVGATEIAPSLSRTKVSNIIRMXKWVIPSIFSSTFPDLTXEILEMPLPIDEDKDVLI  523

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEADKVWG-LIWSLRVPARISMFIWLVKHGRVLTNYE  1076
             W     G FS    Y   +    +   K W  +IW   +P R S+ +W +   ++ T  +
Sbjct  524   WEVSTSGVFSFSDGY---EIVRHRFPVKSWASIIWRPFIPPRYSILVWKILFNKLPTEDQ  580

Query  1075  RTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR-HSLQRRTEESMRNLDWNSWLTM  899
               RR I     C  C    E +DHLF  C      WR  + Q  T         + WL  
Sbjct  581   LQRRGIPLAPICQLCHKNSESIDHLFSSCXFAQCAWRWLATQFGTIIPPTGSLSDLWLDF  640

Query  898   NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFE  719
              L           W       L  +WK RN+  F       E K          T+A   
Sbjct  641   -LSKRFSPHLRNVWLASGFFLLMAIWKMRNKVKF-------EGKPPSFSXLCRSTSAWIR  692

Query  718   ERHWPLQRHNRGGEER--------------------LSWEKPDEGWLKLNTDGSCTSD-G  602
             +       H RG  +R                    + W  P   W+K+NTDG    + G
Sbjct  693   QVGALTXGHVRGILDRQLLVSLXISPNSCKAPSIVPVLWHPPHFSWVKVNTDGLAKGNXG  752

Query  601   QASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKML  422
              A+CGGV RD+ G +   ++  +G  TS  AE   V+  + +A   G + + +E DS  +
Sbjct  753   PAACGGVFRDSAGYFLGXFSLSLGHRTSFYAELHAVILAVELAHARGWQNLWLESDSSSV  812

Query  421   VEALKGKETG-----QEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQ  257
             +              Q + NN    C    +N +     HI+R  N +ADKLA   L + 
Sbjct  813   ISCFASGSFSPPWSLQTRXNN----CTLHLQN-MXFRCSHIFRXGNVVADKLANLGLLSS  867

Query  256   GGLHIFEVPPGEFEVRMALDRLGASSPRRVS  164
               L     PP E    +  D LG  + R VS
Sbjct  868   -SLVWHSTPPIEILPPLHSDFLGMPTYRFVS  897



>ref|XP_007046404.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
 gb|EOY02236.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
Length=1954

 Score =   178 bits (452),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 174/620 (28%), Positives = 275/620 (44%), Gaps = 51/620 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ +I  R+ GW+ KTLS  GR+TL +SVL+++P+Y +Q    P  V  +IE+    F+W
Sbjct  1354  LITKIRDRISGWENKTLSPGGRITLLRSVLSSLPLYLLQVLKPPVVVIEKIERLFNSFLW  1413

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  + + + ++   AW  +T   + GGL +R L  M  A  +KL WR  T    LW K L
Sbjct  1414  G--DSTNDKRIHWAAWHKLTFPCSEGGLDIRRLTDMFDAFSLKLWWRFST-CEGLWTKFL  1470

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              TKY      H V  +    S  WK +   RE         +  G S  FW D W+  +P
Sbjct  1471  KTKYCMGQIPHYVHPKLHD-SQVWKRMVRGREVAIQNTRWRIGKG-SLFFWHDCWMGDQP  1528

Query  1432  L---YEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
             L   +   R  +      +TV+ +++    W  +K+  YLP   ++ +  + + + +  D
Sbjct  1529  LVTSFPHFRNDM------STVHNFFNG-HNWDVDKLNLYLPMNLVDEILQIPI-DRSQDD  1580

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTN  1082
                WS    G FS +SA  W     R+  + +  L+W   +P  IS F+W V H  +  +
Sbjct  1581  VAYWSLTSNGEFSTRSA--WEAIRLRKSPNVLCSLLWHKSIPLSISFFLWRVFHNWIPVD  1638

Query  1081  YERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR---HSLQRRTEESMRNLDWNS  911
                  +       C  C    E L H+        ++W    +S Q    +  +N+    
Sbjct  1639  IRLKEKGFHLASKCI-CCNSEESLIHVLWDNPIAKQVWNFFANSFQIYISKP-QNVSQIL  1696

Query  910   WLTMNLKGDR-QQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDW-----LRR  749
             W T  L GD  ++G        F    W+LW  RN+A  +R+L     ++ W     LR+
Sbjct  1697  W-TWYLSGDYVRKGHIRILIPLFIC--WFLWLERNDAK-HRHLGMYSDRVVWKIMKLLRQ  1752

Query  748   C-------------DSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTS  608
                           D + A  +     P     R   + L W KP  G  KLN DGS   
Sbjct  1753  LQDGYLLKSWQWKGDKDFATMWGLFSPP---KTRAAPQILHWVKPVPGEHKLNVDGSSRQ  1809

Query  607   DGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSK  428
             +  A+ GGVLRD  G     ++  IG   S  AE   +L+GL + KE    ++ +E D+ 
Sbjct  1810  NQTAAIGGVLRDHTGTLVFDFSENIGPSNSLQAELRALLRGLLLCKERNIEKLWVEMDAL  1869

Query  427   MLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGL  248
             + ++ ++  + G      ++   I++  NF +    HI+RE N+ AD L+    T Q  L
Sbjct  1870  VAIQMIQQSQKGSHDIRYLL-ASIRKYLNFFSFRISHIFREGNQAADFLSNKGHTHQ-SL  1927

Query  247   HIFEVPPGEFEVRMALDRLG  188
             H+F    G+    + LDRL 
Sbjct  1928  HVFTEAQGKLYGMLKLDRLN  1947



>ref|XP_007020288.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
 gb|EOY17513.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
Length=2215

 Score =   178 bits (452),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 164/623 (26%), Positives = 276/623 (44%), Gaps = 46/623 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ +I  R+ GW+ KTLS  GR+TL +S L+++PIY +Q    P  V   I +    F+W
Sbjct  1614  LVAKIEERITGWENKTLSPGGRITLLRSTLSSLPIYLLQVLKPPVIVLERINRLLNNFLW  1673

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G    + + ++   +W  I      GGL +RN+  +  A  MKL WR +T  N+LW + +
Sbjct  1674  GGS--TASKRIHWASWGKIALPIAEGGLDIRNVEDVCEAFSMKLWWRFRTT-NSLWTQFM  1730

Query  1612  TTKYHHRSGSHLVTTRRRSI--SNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTA  1439
               KY    G  L T  +  +  S  WK +       E  +   + +G+   FW D W+  
Sbjct  1731  RAKY---CGGQLPTDVQPKLHDSQTWKRMVTISSITEQNIRWRIGHGE-LFFWHDCWMGE  1786

Query  1438  KPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
             +PL  +           A V++++     W  EK++  L  E +E +  + + + ++ D 
Sbjct  1787  EPLVNR---NQAFASSMAQVSDFFLN-NSWNVEKLKTVLQQEVVEEIVKIPI-DTSSNDK  1841

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
               W+  P G FS KSA+    N  R+  + V+  IW   VP   S F+W + H  +    
Sbjct  1842  AYWTTTPNGDFSTKSAWQLIRN--RKVENPVFNFIWHKSVPLTTSFFLWRLLHDWIPVEL  1899

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTM  899
             +   +       C  C    E L H+  +    +++W +  +    + +     N  +  
Sbjct  1900  KMKTKGFQLASRC-RCCKSEESLMHVMWKNPVANQVWSYFAKVFQIQIINPCTINQIICA  1958

Query  898   -NLKGD-RQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDW-LRRCDSETAA  728
                 GD  + G        F   LW+LW  RN+A  +RNL     ++ W + +   +   
Sbjct  1959  WFYSGDYSKPGHIRTLVPLF--TLWFLWVERNDAK-HRNLGMYPNRVVWKILKLLHQLFQ  2015

Query  727   AFEERHWPLQRHNRGGEE--------------RLSWEKPDEGWLKLNTDGSCTSDGQ-AS  593
               + + W  Q   +  +E               L W KP  G LKLN DGSC  + Q A+
Sbjct  2016  GKQLQKWQWQGDKQIAQEWGIILKADAPSPPKLLFWLKPSIGELKLNVDGSCKHNPQSAA  2075

Query  592   CGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEA  413
              GG+LRD  G+   G++   G   S  AE   + +GL +  E+   R+ IE D+K+ V+ 
Sbjct  2076  GGGLLRDHTGSMIFGFSENFGPQDSLQAELMALHRGLLLCIEHNISRLWIEMDAKVAVQM  2135

Query  412   LKGKETGQEQNNNI---VRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHI  242
             +K    G  +   +   + RC+    + ++    HI+RE N+ AD L+    T Q  L +
Sbjct  2136  IKEGHQGSSRTRYLLASIHRCL----SGISFRISHIFREGNQAADHLSNQGHTHQ-NLQV  2190

Query  241   FEVPPGEFEVRMALDRLGASSPR  173
                  G+    + L+++  +  R
Sbjct  2191  ISQAEGQLRGILRLEKINLAYVR  2213



>ref|XP_007008704.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
 gb|EOY17514.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
Length=2249

 Score =   178 bits (452),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 164/615 (27%), Positives = 263/615 (43%), Gaps = 45/615 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ +I  R+ GW+ K LS  GR+TL +SVL ++PIY +Q    P  V   + +    F+W
Sbjct  1649  LVAKIEERITGWENKILSPGGRITLLRSVLASLPIYLLQVLKPPICVLERVNRIFNSFLW  1708

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G    + + K+   +W  I+     GGL +RNL  +  A  MKL WR +T  ++LW + +
Sbjct  1709  GGS--AASKKIHWASWAKISLPIKEGGLDIRNLAEVFEAFSMKLWWRFRT-IDSLWTRFM  1765

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  R    + T  +   S  WK + A     E  +   V  GK   FW D W+   P
Sbjct  1766  RMKY-CRGQLPMHTQPKLHDSQTWKRMVANSAITEQNMRWRVGQGK-LFFWHDCWMGETP  1823

Query  1432  LYEKLRGTLGLPELYATVNEYWDKV--RGWKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
             L      T    EL  ++ +  D      W  EK++  L  E ++ +A + +   +  + 
Sbjct  1824  L------TSSNQELSLSMVQVCDFFMNNSWDIEKLKTVLQQEVVDEIAKIPIDAMSKDEA  1877

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
             + W+P P G FS KSA  W     R+  + V+  IW   VP  IS F+W + H  +    
Sbjct  1878  Y-WAPTPNGEFSTKSA--WQLIRKREVVNPVFNFIWHKTVPLTISFFLWRLLHDWIPVEL  1934

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTM  899
             +   +       C  C    E + H+        ++W +       +  + L  N     
Sbjct  1935  KMKSKGFQLASRC-RCCKSEESIMHVMWDNPVATQVWNY-----FSKFFQILVINPCTIN  1988

Query  898   NLKGDRQQGFEEGWPERFGT-----RLWWLWKWRNEAVFNRNLLPLEQKLDW-LRRCDSE  737
              + G      +   P    T      LW+LW  RN+A  +RNL     ++ W + +   +
Sbjct  1989  QILGAWFYSGDYCKPGHIRTLVPIFTLWFLWVERNDAK-HRNLGMYPNRIVWRILKLIQQ  2047

Query  736   TAAAFEERHW--------------PLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ  599
              +   +   W                Q  +    +   W KP  G  KLN DGS      
Sbjct  2048  LSLGQQLLKWQWKGDKQIAQEWGITFQAESLPPPKVFPWHKPSIGEFKLNVDGSAKLSQN  2107

Query  598   ASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLV  419
             A+ GGVLRD  G    G++  +G   S  AE   + +GL + ++Y  RR+ IE D+  ++
Sbjct  2108  AAGGGVLRDHAGVMVFGFSENLGIQNSLQAELLALYRGLILCRDYNIRRLWIEMDAASVI  2167

Query  418   EALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIF  239
               L+G + G      ++   I++  +  +    HI+RE N+ AD LA      Q  L + 
Sbjct  2168  RLLQGNQRGPHAIRYLL-VSIRQLLSHFSFRLSHIFREGNQAADFLANRGHEHQ-SLQVV  2225

Query  238   EVPPGEFEVRMALDR  194
              V  G+    + LD+
Sbjct  2226  TVAQGKLRGMLRLDQ  2240



>ref|XP_008388177.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=586

 Score =   173 bits (439),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 153/578 (26%), Positives = 245/578 (42%), Gaps = 71/578 (12%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             R+  +++GWK  T+S AGR  L K+V  A+P Y M     PK  C++++    +F WG++
Sbjct  31    RLLGKIQGWKRSTISQAGREVLIKAVAQAVPAYPMNLFKFPKTFCNDLDALISKFWWGQN  90

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
             +  G N++  V+ + +   K  GGLGLR     N A + K  WRL +EPN+LWA  +  +
Sbjct  91    D--GENRIHWVSKEQMGKSKEEGGLGLRCFTEFNNALLAKQCWRLLSEPNSLWASVIKGR  148

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL-Y  1427
             Y     S     R    S AW  +   RE +  G    + NGK  R W+D WL + P  +
Sbjct  149   YFPNC-SFFDAKRGGRASWAWSSLLVGREIIRGGAHWQIMNGKDVRVWVDKWLPSIPSGH  207

Query  1426  EKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENTPDGWGW  1250
                 G++ +  L   VN       G W+ + ++ +L  EE++ +      + ++ D   W
Sbjct  208   PSPLGSVPV-SLNLRVNSLLSTDYGSWEIDFLKPFLVEEEIKAIYETHSGDPSSNDRLVW  266

Query  1249  SPDPRGCFSVKSAYGWADNAARQE-----------ADKVWGLIWSLRVPARISMFIWLVK  1103
                  G +SVKS Y WA     Q+             +VW  +W L V  +I  F W   
Sbjct  267   PFVKNGIYSVKSGYHWAMTRNIQQRIGNPHRSALIPKQVWKCVWKLEVQPKIRSFXW---  323

Query  1102  HGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNL  923
                      R+ +   +    +   G R     L R            L+R    S    
Sbjct  324   ---------RSLQEAVATXEVW--IGXR-----LIR-----------GLRRDAVTS----  352

Query  922   DWNSWL-TMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRC  746
              W  WL ++    + Q G          T  W++WK R   +FN+  +   Q +  +   
Sbjct  353   -WAXWLGSIVGLANGQSGVRNDMLSYVATTCWFIWKARCXFLFNQQPIVPRQIIAVI---  408

Query  745   DSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVL-RDT  569
               ++ AAF+E              + +W  P  G++K+N D S    G     GV+ RD 
Sbjct  409   -XQSVAAFKE------------YXQATWSPPCVGFIKINVDASWLRSGAPGFVGVVARDD  455

Query  568   HGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKET-G  392
              G +      R+   +  VAEA  VL G  + +  G   +++E DS+  +  ++  +T G
Sbjct  456   EGRFMAAIRRRVTASSVAVAEALAVLHGCELGRSMGWNFVIVESDSQESISCIRDSDTRG  515

Query  391   QEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLA  278
               +   I+ RC +  E F    +    R  N  AD+LA
Sbjct  516   SWEAFPILARCKRMGEAFNDCRWSWTPRSANMAADRLA  553



>ref|XP_010668235.1| PREDICTED: uncharacterized protein LOC104885230 [Beta vulgaris 
subsp. vulgaris]
Length=1607

 Score =   177 bits (450),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 165/595 (28%), Positives = 257/595 (43%), Gaps = 43/595 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D++ ARL  WK+K LS AGR+ L  S L+ IP Y MQ  +LP    S+++     F+W
Sbjct  1027  IVDKVRARLATWKSKFLSRAGRLCLISSTLSTIPAYYMQAISLPISTLSDLDSICNNFLW  1086

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  E+    KM LV   +    K +GGLG+R+   MN+A M KLGW+L  +  +L  + +
Sbjct  1087  G--EEGEKKKMHLVNKQMTFLPKNKGGLGIRSQRIMNKAYMAKLGWKLAQDQPSLAQQCI  1144

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              +KY   +      T+ R+ S  WK I    + ++   +  + +GK   FW D WL   P
Sbjct  1145  RSKYLQNNR----VTKFRNGSVIWKSIGQGWDLIQDNSSWFLGDGKIISFWHDDWLGIGP  1200

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             L   ++G + + E    V+      R W    +  ++P++   R+ +   T   TP+   
Sbjct  1201  LRGWVQGPMSMDENTRKVHSLSHHGR-WDLTPLTIHIPSDLRNRILN---TSPPTPESQA  1256

Query  1252  --WSP---DPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVL  1088
                 P   D RG F +  AY      +    D  W  IW  +   ++  FIWL  H R+ 
Sbjct  1257  DLLIPNFVDHRG-FMLHRAYIAQIPHSPNHDDLSW--IWKGKCEPKLHFFIWLTWHDRLP  1313

Query  1087  TNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSW  908
                    R +  +  C  C    E   H+ R CH  +R+W H             D+  W
Sbjct  1314  HRNLLASRGLIVDTSCPRCHQHIEHSAHILRDCHISERVWDHVGMTLGPHD----DFRLW  1369

Query  907   LTMNLKGDRQQGFEE-GWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETA  731
             +  NL  + +  F +  W   F      +WK RN+ VF        Q +  LR       
Sbjct  1370  IRENLHSNGK--FRDLPWASVFPYICHEIWKDRNQCVFKNQKASSPQAI-CLR-------  1419

Query  730   AAFEERHWPLQRHN-RGGEERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVLRDTHGNW  557
             A    R + L      G      +  P+E +L ++ D S     Q A  GGV+R   G W
Sbjct  1420  AMGRVREFILATETITGNVIHPVFAHPNE-FLMIHVDASFIDILQGAGIGGVVRKPSGQW  1478

Query  556   CRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQN-  380
               G+  +I    S VAE   + + LR+A        +I  D K  +  L G  + Q  N 
Sbjct  1479  IGGFGKKIFTNNSFVAELTAIAEALRLAVLNSLPTAIIYSDCKDAINLLTGGHSDQYLNL  1538

Query  379   NNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGG---LHIFEVPPG  224
              N+ R+ + +  + L + + +  R+ N +ADK+AK      G      +F  PP 
Sbjct  1539  TNMCRQWLTQRPD-LQIKYCN--RQFNLVADKMAKSCRIMDGDSAVTRLFPTPPS  1590



>gb|ABK28199.1| unknown [Arabidopsis thaliana]
Length=315

 Score =   167 bits (423),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 105/310 (34%), Positives = 150/310 (48%), Gaps = 3/310 (1%)
 Frame = -1

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN  914
             ++TN ER RRH++ ++ C  C G  + + H+ R C  ++ IW   +              
Sbjct  5     LMTNAERRRRHLSDSDICQICKGAEKTIIHILRDCXAMEGIWIRLVPAGKRREFFTQSLL  64

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSET  734
              WL  NL GDR++  E  W   F   +WW WKWR   +F         ++ +L+    ET
Sbjct  65    EWLFANL-GDRRKTCESTWSTLFALSIWWAWKWRCGNIFGVQD-KCRDRVRFLKDLARET  122

Query  733   AAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHGNW  557
             + A          H    E  ++W KP+EGW KLNTDG+   + G AS GGVLRD  G W
Sbjct  123   SMAHVIVRTLSGGHGERVERLIAWSKPEEGWWKLNTDGASRGNPGLASAGGVLRDEEGAW  182

Query  556   CRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNN  377
               G+   IG C++ +AE WGV  GL +A E    R+ IE DS+++V  LK         +
Sbjct  183   RGGFALNIGVCSAPLAELWGVYYGLYIAWERRVTRLEIEVDSEIVVGFLKIGINEVHPLS  242

Query  376   NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALD  197
              +VR C         V   H+YRE N+LAD LA +A +   G H   + P      +  D
Sbjct  243   FLVRLCHDFISRDWRVRISHVYREANRLADGLANYAFSLPLGFHSLSLVPDSLRFILLDD  302

Query  196   RLGASSPRRV  167
               GA+  R+V
Sbjct  303   TSGATVSRQV  312



>gb|AAD21515.1| putative reverse transcriptase [Arabidopsis thaliana]
 gb|AAM15081.1| putative reverse transcriptase [Arabidopsis thaliana]
Length=314

 Score =   167 bits (423),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 105/310 (34%), Positives = 150/310 (48%), Gaps = 3/310 (1%)
 Frame = -1

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN  914
             ++TN ER RRH++ ++ C  C G  + + H+ R C  ++ IW   +              
Sbjct  5     LMTNAERRRRHLSDSDICQICKGAEKTIIHILRDCPAMEGIWIRLVPAGKRREFFTQSLL  64

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSET  734
              WL  NL GDR++  E  W   F   +WW WKWR   +F         ++ +L+    ET
Sbjct  65    EWLFANL-GDRRKTCESTWSTLFALSIWWAWKWRCGNIFGVQD-KCRDRVRFLKDLARET  122

Query  733   AAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHGNW  557
             + A          H    E  ++W KP+EGW KLNTDG+   + G AS GGVLRD  G W
Sbjct  123   SMAHVIVRTLSGGHGERVERLIAWSKPEEGWWKLNTDGASRGNPGLASAGGVLRDEEGAW  182

Query  556   CRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNN  377
               G+   IG C++ +AE WGV  GL +A E    R+ IE DS+++V  LK         +
Sbjct  183   RGGFALNIGVCSAPLAELWGVYYGLYIAWERRVTRLEIEVDSEIVVGFLKIGINEVHPLS  242

Query  376   NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALD  197
              +VR C         V   H+YRE N+LAD LA +A +   G H   + P      +  D
Sbjct  243   FLVRLCHDFISRDWRVRISHVYREANRLADGLANYAFSLPLGFHSLSLVPDSLRFILLDD  302

Query  196   RLGASSPRRV  167
               GA+  R+V
Sbjct  303   TSGATVSRQV  312



>gb|ABE65462.1| hypothetical protein At2g27870 [Arabidopsis thaliana]
Length=314

 Score =   167 bits (423),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 105/310 (34%), Positives = 150/310 (48%), Gaps = 3/310 (1%)
 Frame = -1

Query  1093  VLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWN  914
             ++TN ER RRH++ ++ C  C G  + + H+ R C  ++ IW   +              
Sbjct  5     LMTNAERRRRHLSDSDICQICKGAEKTIIHILRDCPAMEGIWIRLVPAGKRREFFTQSLL  64

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSET  734
              WL  NL GDR++  E  W   F   +WW WKWR   +F         ++ +L+    ET
Sbjct  65    EWLFANL-GDRRKTCESTWSTLFALSIWWAWKWRCGNIFGVQD-KCRDRVRFLKDLARET  122

Query  733   AAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-GQASCGGVLRDTHGNW  557
             + A          H    E  ++W KP+EGW KLNTDG+   + G AS GGVLRD  G W
Sbjct  123   SMAHVIVRTLSGGHGERVERLIAWSKPEEGWWKLNTDGASRGNPGLASAGGVLRDEEGAW  182

Query  556   CRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNN  377
               G+   IG C++ +AE WGV  GL +A E    R+ IE DS+++V  LK         +
Sbjct  183   RGGFALNIGVCSAPLAELWGVYYGLYIAWERRVTRLEIEVDSEIVVGFLKIXINEVHPLS  242

Query  376   NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALD  197
              +VR C         V   H+YRE N+LAD LA +A +   G H   + P      +  D
Sbjct  243   FLVRLCHDFISRDWRVRISHVYREANRLADGLANYAFSLPLGFHSLSLVPDSLRFILLDD  302

Query  196   RLGASSPRRV  167
               GA+  R+V
Sbjct  303   TSGATVSRQV  312



>ref|XP_009361334.1| PREDICTED: uncharacterized protein LOC103951630 [Pyrus x bretschneideri]
Length=1297

 Score =   176 bits (447),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 154/579 (27%), Positives = 239/579 (41%), Gaps = 20/579 (3%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +RI A+++GWK  TLS AG+  + K+V+ AIP Y M     P  +CS+ +     F WG+
Sbjct  690   ERILAKVQGWKQYTLSQAGKEIMIKAVIQAIPAYPMHLFKFPTTLCSDFDALIAEFWWGK  749

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
                 G   +  V+  I+   K   G+G RN    N A + K  WRL  +PN+LWA+ L  
Sbjct  750   --SGGQKGIHWVSRGILGYPKQEEGMGFRNFQAFNDALLAKQCWRLIHDPNSLWAQLLKA  807

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             +Y     S L  +     S  W  +   RE L  G    + NG+S R W D W+ + P  
Sbjct  808   RYFPHC-SFLDDSLGGRASWGWSSLLVGREILLRGAHWQIMNGRSIRLWHDRWVPSIPAG  866

Query  1426  EKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENTPDGWGW  1250
             +              VN   + V G W  E I+ ++  E+ E +    + +    D   W
Sbjct  867   KPTAVGGVRVSRNMRVNTLINDVSGTWNIEAIRPFISLEDFEAILDTSIGDGLRDDRLIW  926

Query  1249  SPDPRGCFSVKSAYGW-----ADNAARQEADK------VWGLIWSLRVPARISMFIWLVK  1103
                  G +SVKS Y W     +    R  A        VW  IW L+ P ++  F+W   
Sbjct  927   PATRNGVYSVKSGYHWKHANSSSMIGRPSASSSVIPGNVWKCIWHLKTPPKVRNFMWRAL  986

Query  1102  HGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNL  923
                + T     +R  + +  C  C  Q E ++H+   C  V+ IW              L
Sbjct  987   SRALATMENLFKRRCSPSPCCPICLVQDESVEHMLLLCLWVEPIWFGGPLNYRVNRANIL  1046

Query  922   DWNSWLTMNLKGDRQQGFEEG-WPERFGTRLWWLWKWRNEAVF-NRNLLPLEQKLDWLRR  749
             ++ +W+  +L  D     E            W++WK R   V+ NR + P +  L   + 
Sbjct  1047  NFPAWVLSSLGSDLGSKDEIARILMNVAFTCWFIWKTRCSFVYDNRGIYPNQVILSISKS  1106

Query  748   CDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGG-VLRD  572
              +    A+      P QR+    +    W  P   +LK+N D S  +  ++   G V+RD
Sbjct  1107  VNGFLEASVASEGHP-QRNLSRPDPPACWGPPGHPFLKVNVDASWEASSKSGFAGVVIRD  1165

Query  571   THGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEAL-KGKET  395
               G +       IG      AEA  +L G  +AK      I++E DSK  +  L +G   
Sbjct  1166  HAGKFVAARRGWIGASNVAAAEAAAILLGCELAKALELACIIVESDSKENILCLAQGCSR  1225

Query  394   GQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLA  278
             G  +   I+ + ++    F    +  + R  N  A  LA
Sbjct  1226  GSWEAFPIISKALRLGGLFQDCRWSWVPRSANLAAHVLA  1264



>gb|EEE52627.1| hypothetical protein OsJ_34967 [Oryza sativa Japonica Group]
Length=1395

 Score =   176 bits (447),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 144/573 (25%), Positives = 253/573 (44%), Gaps = 33/573 (6%)
 Frame = -1

Query  1936  KAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSGNNKMS  1757
             K K LS+ G+  L KS+  A+P+Y M    +P  +C  I     ++ WG D  + + ++ 
Sbjct  274   KEKILSMGGKEILIKSIAQAVPVYAMMVFKIPNKICKGITDAISQYWWGDD--ADHRRIH  331

Query  1756  LVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHL  1577
                W  +   K +GG+G R+L + N A + K  WRL ++P++L A+ L  +Y+ R G  L
Sbjct  332   WQEWWKMCMPKGKGGMGFRDLQSFNLALLAKQVWRLLSDPDSLCARVLRARYY-RDGKLL  390

Query  1576  VTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTLGLP  1397
                 +   S  W+ I A  +  + G    V +G   + W D+W+       K++   G  
Sbjct  391   NARMKSGSSYTWQSILAGLQCFKQGYIWRVGDGTQIKIWEDNWIPGSH-NMKIQTNRG-N  448

Query  1396  ELYATVNEYWDKVR-GWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSPDPRGCFSV  1220
              L ATV+E  D +   W  + ++      ++ R+  + +      D   W  +  G FSV
Sbjct  449   NLVATVDELIDPINFTWGGDLLKTIFWPIDVCRIMQIPI-RAGRDDLVAWQYNRSGTFSV  507

Query  1219  KSAY------GWADNAARQEAD-----KVWGLIWSLRVPARISMFIWLVKHGRVLTNYER  1073
             KSAY       + + +A+ +A      ++W  +W+L+VPA+I +F W    G V      
Sbjct  508   KSAYHCQWDYKFGERSAQMQASTASRSRLWKRLWNLKVPAKIKIFGWRALKGLVPCRAIL  567

Query  1072  TRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH-SLQRRTEESMRNLDWNSWLT--  902
               RH+  +  C  C    ED+ H+   C    ++W    ++ R +         S +   
Sbjct  568   ANRHVGDSGGCPVCQNGPEDIKHMIFTCARAKQVWNSLGVEDRIQRLCMTERSGSVILEE  627

Query  901   MNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAF  722
             + ++ D+ Q  + G+ E   T  W++W  R + V    +          R   S  A A 
Sbjct  628   ILIREDQVQDLQVGFAELVITAAWYIWWERRQLVHGEAV---------QRPARSGMAIAA  678

Query  721   EERHWPLQRHNRGGEERLSWEKPDEGWLKLNTD-GSCTSDGQASCGGVLRDTHGN-WCRG  548
               +++ L    +    R  W+KP EG + +N D G     G  + G V+RD  G      
Sbjct  679   LTKNYKLAT-KKDSVLRQGWKKPPEGKVMVNVDAGFDEMGGCGTVGSVIRDCSGGVLAAA  737

Query  547   YTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIV  368
             +++      + +AEA+ + +GL +A++ G  R++I+ D   +V+ +            I 
Sbjct  738   HSFVPHLVDAPMAEAFALKEGLMLAQQIGCNRLIIQSDCMEVVQIMTDGGFTANSAAAIY  797

Query  367   RRCIKEAENFLAVVFLHIYREQNKLADKLAKWA  269
               C      F  +   H  RE N++A  LA+ A
Sbjct  798   EDCNILWSGFADITIEHCSREANQVAHNLARRA  830



>ref|XP_010039097.1| PREDICTED: uncharacterized protein LOC104427753 [Eucalyptus grandis]
Length=1506

 Score =   176 bits (447),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 136/540 (25%), Positives = 234/540 (43%), Gaps = 30/540 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +L + +A+L+GWK + LS +G+  L KSV+ A+P Y M    LP  +C  IEK+   F W
Sbjct  904   ILAKANAKLDGWKERLLSKSGKEILLKSVVQALPQYAMSIFKLPLSLCRLIEKKISVFWW  963

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               +  +G   +    W  +   K  GG+G R+L + N+A + K  W L  +PN LW++  
Sbjct  964   SNN--NGKTGIHWQNWTSLKLSKDSGGMGFRDLVSFNKAMLGKQAWHLFQQPNALWSQLF  1021

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
                Y   S         R++   W+ I   RE +   L  +V +G   +   D+WL    
Sbjct  1022  KGLYFRNSSFQCAQAGNRTLW-GWQSILKGREAILPRLRWLVGDGSKIKIREDNWLPMG-  1079

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
                 L GT+   E     +   +    W    I     ++  E +  + +      D   
Sbjct  1080  ---TLGGTVAQGEPVLVADLIDNSHHTWNSTLISNLFDSQVSEEILKIPINPLLLTDQLV  1136

Query  1252  WSPDPRGCFSVKSAYGW----------ADNAARQEADKVWGLIWSLRVPARISMFIWLVK  1103
             W+    G +SVKS+Y              + + Q   K+W  IW ++   +I +F+WL  
Sbjct  1137  WTATSSGVYSVKSSYHLLSSHLNTQLNVPSTSYQNPIKLWRTIWHMKTAPKIRVFMWLAC  1196

Query  1102  HGRVLTNYERTRRHITSNEYCYNCA-GQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRN  926
             H  + T      RHI+ +  C  C     E ++HLF  C    +IW H   R        
Sbjct  1197  HNALATKANLFHRHISPSPVCSLCTQNMPETVEHLFFFCTWTSKIWAHPHIRVQILPTSV  1256

Query  925   LDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF-NRNLLPLEQKLDWLRR  749
               +++W+    +    + F E   E     LW +W+ RN  ++ N++  P++   D L +
Sbjct  1257  QRFDAWVAA--RATDSKAFHEF--EVITNLLWQIWRQRNNFIYRNQSPDPIQAVEDALAQ  1312

Query  748   CDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDG-QASCGGVLRD  572
                          +P+   +   ++R  W+ PD+G LK N DG+  S+G Q S   + R+
Sbjct  1313  SRIYKVVDPTPHRFPIS--SLSPDQR--WKPPDKGSLKCNIDGAFQSEGLQGSMACICRN  1368

Query  571   THGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYG--ARRIMIECDSKMLVEALKGKE  398
               G     +T      ++  AE + ++  ++   ++G    R+++E D   LVE +  K+
Sbjct  1369  HKGILTDVFTRSFSAQSAFQAELYALIFFIQHLIQHGRHQERLIVESDCLQLVEMVAEKK  1428



>ref|XP_010674085.1| PREDICTED: uncharacterized protein LOC104890338 [Beta vulgaris 
subsp. vulgaris]
Length=1568

 Score =   176 bits (447),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 164/613 (27%), Positives = 252/613 (41%), Gaps = 49/613 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D+IS +L  WK K LS+ GR+TL KS L  +P+Y M   ++PKGV  ++ K TR+F+W
Sbjct  951   IIDKISHKLASWKGKMLSIGGRITLIKSSLANLPLYYMSLFSIPKGVVEKMNKITRQFLW  1010

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                 +     + LVAW+II   K+ GGL + N+   N A + K  WR   +P+  W   +
Sbjct  1011  SGSME--KRSLPLVAWNIIQLPKSLGGLSIGNIIHKNIAMLSKWIWRFLQDPSPFWCAVI  1068

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISA-------ERETLESGLTHVVRNGKSTRFWMD  1454
               KY +     ++          W+ I A        +  L +G+   +  G  TRFW+D
Sbjct  1069  REKYKYAPNISILDLDVPKFGGPWRHICAAILHHTNAKSILCNGIRKNIGRGSQTRFWLD  1128

Query  1453  SWLTAKPLYEKLRGTLGLP-ELYATVNEY--WDKVR-GWKWEKIQRYLPTEELE------  1304
              WL++ PL         +     ATV+ Y  W+     W +   + + P +  E      
Sbjct  1129  PWLSSTPLKSDFPRLFAISINPNATVDSYGFWEGFNWVWTFSWKREFRPQDRSEKKRLDM  1188

Query  1303  RLASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARIS  1124
             RL  +  ++E   D   W+    G FS KS     D             +W   VP RI 
Sbjct  1189  RLQQVHPSQE-ARDQLVWAHTKAGNFSTKSITLELDKMHPPVIHDAIKGVWKGLVPHRIE  1247

Query  1123  MFIWLVKHGRVLTNYERTRRHITS--NEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQR  950
             +F+WL   G++ T  +     I +  N  C  C  + E  DHL   C    ++W   L  
Sbjct  1248  VFVWLALMGKINTRSKLAGIGIINAENNLCPLCLMEPETSDHLLLHCSVSSKLWSWWLNL  1307

Query  949   RTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQ  770
                + +         T      +   F + W   F   LW +WK RN+ VF+     ++ 
Sbjct  1308  WQVKWVFPSSLREAFTQWYWPKKVSFFSKVWSTIFFIMLWSIWKERNKRVFSNTASSIKD  1367

Query  769   -------KLDW----------LRRCD-SETAAAFEER-HWPLQRHNRGGEERLSWEKPDE  647
                    +L W             CD     A+ + R +     H    +E + W+ P  
Sbjct  1368  MKELVLLRLGWWISGWKEKFPYSPCDIMRNPASLQWRGNQMTDSHKLSSKEDIIWQPPSS  1427

Query  646   GWLKLNTDGSCTSDG-QASCGGVLRDTHGN----WCRGYTYRIGRCTSTVAEAWGVLQGL  482
                K N D S    G +++ GGVLR+  GN    +     Y    C   +A    ++  L
Sbjct  1428  HVFKWNVDASVQPFGSRSAIGGVLRNQKGNFRCLFSSPIPYMEINCAEILAIHKAIMISL  1487

Query  481   RMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEA-ENFLAVVFLHIYRE  305
                   GA+ I+ E DS   V      + G   N N     I+ A +N L +  +H  R 
Sbjct  1488  SSDMVKGAKLIL-ESDSANAV-LWSNDDKGGPWNMNFHLNFIRNARKNGLDITIVHRGRG  1545

Query  304   QNKLADKLAKWAL  266
              N +AD LAK  L
Sbjct  1546  ANYVADSLAKQGL  1558



>ref|XP_007026458.1| Uncharacterized protein TCM_021522 [Theobroma cacao]
 gb|EOY06960.1| Uncharacterized protein TCM_021522 [Theobroma cacao]
Length=3503

 Score =   177 bits (448),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 165/623 (26%), Positives = 269/623 (43%), Gaps = 46/623 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ +I  R+ GW+ K LS  GR+TL +S L+++PIY +Q    P  V   I +    F+W
Sbjct  2902  LVAKIEERITGWENKILSPGGRITLLRSTLSSLPIYLLQVLKPPIIVLERINRLFNNFLW  2961

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G    S   ++   +W  I      GGL +RNL  + +A  MKL WR +T  N+LW + +
Sbjct  2962  GGSASS--KRIHWASWGKIALPIAEGGLDIRNLEDVFKAFSMKLWWRFRTT-NSLWMQFM  3018

Query  1612  TTKYHHRSGSHLVTTRRRSI--SNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTA  1439
               KY    G  L T  +  +  S  WK +       E  +   V +GK   FW D W+  
Sbjct  3019  RAKY---CGGQLPTHVQPKLHDSQTWKRMVTISSITEQNIRWRVGHGK-LFFWHDCWMGE  3074

Query  1438  KPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
             +PL  +           A V++++     W  EK++  L  E +E +A + +   +    
Sbjct  3075  EPLVIR---NQEFASSMAQVSDFFLN-NSWDIEKLKSVLQQEVVEEIAKIPINASSNDRA  3130

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
             + W+P P G FS KSA  W  +  R+  +  +  IW   VP   S F+W + H  V    
Sbjct  3131  Y-WTPTPNGDFSTKSA--WQLSRERKVVNPTYNYIWHKSVPLTTSFFLWRLLHDWVPVEL  3187

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTM  899
             +   +       C  C    E L H+       +++W +  +      +     N  ++ 
Sbjct  3188  KMKSKGFQLASRC-RCCKSEESLMHVMWDNPVANQVWSYFAKVFQIHIINPCTINHIISA  3246

Query  898   -NLKGD-RQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDW-LRRCDSETAA  728
                 GD  + G        F   LW+LW  RN+A  +RNL     ++ W + +   +   
Sbjct  3247  WFYSGDYSKPGHIRTLVPLF--ILWFLWVERNDAK-HRNLGMYPNRIVWKILKLIHQLFQ  3303

Query  727   AFEERHWPLQRHNRGGEE--------------RLSWEKPDEGWLKLNTDGSCTSDGQ-AS  593
               + + W  Q   +  +E               L W KP  G  KLN DGS   + Q A+
Sbjct  3304  GKQLQKWQWQGDKQIAQEWGIILKAVAPSPPKLLFWNKPSIGEFKLNVDGSSKYNLQTAA  3363

Query  592   CGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEA  413
              GG+LRD  G+   G++   G   S  AE   + +GL +  ++   R+ IE D+K+ V+ 
Sbjct  3364  GGGLLRDHTGSMIFGFSENFGSQDSLQAELMALHRGLLLCIDHNVTRLWIEMDAKVAVQM  3423

Query  412   LKGKETGQEQNNNI---VRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHI  242
             +     G  +   +   + RC+      ++    HI+RE N+ AD L+    T Q  L +
Sbjct  3424  INEGHQGSSRTRYLLASIHRCLSG----ISFRISHIFREGNQAADHLSNQGYTHQ-NLQV  3478

Query  241   FEVPPGEFEVRMALDRLGASSPR  173
                  G+    + LD++  +  R
Sbjct  3479  ISQAEGQLRGILRLDKINLAYVR  3501


 Score =   157 bits (397),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 163/603 (27%), Positives = 259/603 (43%), Gaps = 60/603 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ +I  R+ GW+ K LS  GR+TL +SVL++ P+Y +Q    P  V  +IE+    F+W
Sbjct  1108  LISKIRDRISGWENKILSPGGRITLLRSVLSSQPMYLLQVLKPPVTVIEKIERLFNSFLW  1167

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +     K+   AW  IT   + GGL +RNL  +  A  +KL WR +T  N+LW + L
Sbjct  1168  G--DSCDGKKLHWTAWSKITFPVSEGGLDIRNLRDVFEAFSLKLWWRFQT-CNSLWTRFL  1224

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              TKY      HLV  +    S  WK +   R+     +   +  G+   FW D W+  +P
Sbjct  1225  RTKYCLGRIPHLVQPKLHD-SQVWKRMIVGRDVALQNIRWRIGKGE-LFFWHDCWMGDQP  1282

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWE--KIQRYLPTEELERLASLCLTEENTPDG  1259
             L      TL  P  +  ++       G +W+  K+  YLPT  ++ +  +   + +  D 
Sbjct  1283  L-----ATL-FPSFHNDMSHVHKFYNGDEWDIVKLNSYLPTSLVDEILQIPF-DRSQEDV  1335

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
               W+    G FS  SA  W     RQ  + +    W   +P  IS F+W V +  +    
Sbjct  1336  AYWALTSNGEFSFWSA--WEIIRQRQTPNALLSFNWHRSIPLSISFFLWRVLNNWIPVEL  1393

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR-----HSLQRRTEESMRNLDWN  914
                 + I     C  C  + E L H+        ++W        +     + +  + W 
Sbjct  1394  RMKDKGIHLASKCVCCRSE-ESLIHVLWENPVAKQVWNFFAKSFQIYVSKPKHISQIIW-  1451

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRL---WWLWKWRNEAVF-------NRNLLPLEQKL  764
             +W      GD    +      R    L   W+LW  RN+A         NR +  + + L
Sbjct  1452  AWF---FSGD----YTRNGHIRILIPLFICWFLWLERNDAKHRHMGMYPNRVIWRIMKLL  1504

Query  763   DWLR----------RCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSC  614
             + L           + D++ A  +  ++ P    +    + +SW KP  G  KLN DGS 
Sbjct  1505  NQLHAGSLLKQWQWKGDTDIATMWGFKYPPKYCQS---PQIISWIKPFIGEYKLNVDGSS  1561

Query  613   TSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECD  434
              S   A+ GGVLRD  G     ++  +G   S  AE   +L+GL + KE     + IE D
Sbjct  1562  KSSQNAAGGGVLRDHTGKLAFAFSENLGPLPSLQAELHALLRGLLLCKERNITNLWIEMD  1621

Query  433   SKMLVEALKGKETGQEQNNNI---VRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALT  263
             + + V+ ++  + G      +   +R C++      +    HIYRE N+ AD L+    T
Sbjct  1622  ALVAVQMVQQSQKGSHDIRYLLESIRLCLRS----FSYRISHIYREGNQAADFLSNKGQT  1677

Query  262   TQG  254
              Q 
Sbjct  1678  HQS  1680



>ref|XP_007039706.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY24207.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=391

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/382 (29%), Positives = 176/382 (46%), Gaps = 21/382 (5%)
 Frame = -1

Query  1390  YATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCL-TEENTPDGWGWSPDPRGCFSVKS  1214
             Y   N  WDK      E++   LP E + ++  +   T   + D   W+  P   F++ S
Sbjct  14    YIMPNGDWDK------ERLTFILPIEVVNQILYIIPPTLSASLDMPYWALSPSRYFTISS  67

Query  1213  AYG--WA-DNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEY  1043
              Y   W+  ++ R++ +K+W L+W  R P R+ +F++   H R+LTN E  R  ++S+  
Sbjct  68    TYEHLWSLADSTREDNNKMWRLVWDWRGPHRVCLFLFFCLHKRILTNAEGVRHKMSSDAS  127

Query  1042  CYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEE  863
             C +  G +E   H+ R C     +WR+ L +             WL+ NL       F+ 
Sbjct  128   CPHYYGAKETCLHVLRDCPASKTLWRNILPQSGINQFFQTPLIDWLSSNLNLKNLYVFDV  187

Query  862   GWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRG  683
              W   FG   W+ WKWRN  +F    L +E +L  ++     + A      W       G
Sbjct  188   PWNIVFGIACWYTWKWRNLFIFEGRELSVEGRLSIIK-----SMAVNSHNTWSTPSIISG  242

Query  682   G-----EERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVLRDTHGNWCRGYTYRIGRCT  521
             G     E  + W  P + W+ +N+DG   S  + A+ GGVLRD HG W  GY  ++   +
Sbjct  243   GMRHQEEILVGWSPPPKDWIAVNSDGVFKSAARTAAAGGVLRDAHGTWIVGYACKLETSS  302

Query  520   STVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAEN  341
                 E WG  +GL++A E G R++ ++ D+K +V+A+         N +++R        
Sbjct  303   GLRVELWGFYKGLQLAWERGFRKVKLQSDNKAMVQAISFSSVHPCSNLDLIRAIKGMLGR  362

Query  340   FLAVVFLHIYREQNKLADKLAK  275
                V   HIYRE N  AD ++ 
Sbjct  363   HWEVNISHIYREANTTADFMSN  384



>ref|XP_010673150.1| PREDICTED: uncharacterized protein LOC104889591 [Beta vulgaris 
subsp. vulgaris]
Length=1295

 Score =   176 bits (446),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 161/619 (26%), Positives = 257/619 (42%), Gaps = 57/619 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++ RI  +L  WK + LS+AGR+TL K+ ++++PIY M     PKGV   I    RRF+W
Sbjct  676   VIKRIENKLATWKGRFLSIAGRITLIKASISSLPIYFMSLFPAPKGVIERINMLQRRFLW  735

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D    +  ++LVAWD I   K  GGL   NL+  N A + K  WR   EP+ LW   +
Sbjct  736   SGDPNKSS--LALVAWDRIILPKQMGGLNCGNLYHRNLALLFKWVWRFLKEPDALWRVII  793

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAE-------RETLESGLTHVVRNGKSTRFWMD  1454
               KY++ S               W+ I           E L + +  VV NG  T FW+D
Sbjct  794   AEKYNYPSSFSAYDLMVPKFGGLWRNICVSLINHPITNEALRTKIRSVVGNGLDTNFWLD  853

Query  1453  SWLTAKPL---YEKLRGTLGLPE-----LYATVNEYWDKVRGWKWEKIQRYLPTE-----  1313
              WL   PL   + +L      P+     L + V E W     W +E ++ +   E     
Sbjct  854   LWLGPIPLKRAFPRLYSIAADPQANIASLGSWVGESWQ----WAFEWLRPFRVREAAEWG  909

Query  1312  ELERLASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWADNAARQEADK--VWGLIWSLRV  1139
             +L+ +        ++ D + W+    G F VKS      + + Q   +  +W  +W   +
Sbjct  910   KLQEILKNVFLSPSSDDYYAWTAHKSGVFQVKSLSLELASQSHQHLARAHIWKRLWRGLI  969

Query  1138  PARISMFIWLVKHGRVLTNYERTRRHIT--SNEYCYNCAGQREDLDHLFRRCHDVDRIWR  965
             P R+ +F WL   G++ T  +  +  I   + E C  C    E  DHL   C     IW 
Sbjct  970   PPRVEVFAWLAMQGKINTRQKLAKLKIIPPNEEVCILCNTSPESSDHLLLHCAFSHGIWC  1029

Query  964   HSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNL  785
               L+    + +  L         +   +   F + W   F   LW +WK RN  VF    
Sbjct  1030  WWLKIWDVQWVFPLSLIDAFEQWMNHIKDAQFGKIWCAIFCIILWTIWKERNARVFRGVS  1089

Query  784   LPLEQKLD--------WLRRCDSETAAAFEE--RHWPL----------QRHNRGGEERLS  665
                EQ  +        W +   +    + +E  RH P+          +      ++ ++
Sbjct  1090  CSKEQIHELILTRLGWWTKGWGASPPYSVDEIIRH-PICLAWWSKPAGKLAPPILQKDVN  1148

Query  664   WEKPDEGWLKLNTDGSCT-SDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQ  488
             W  P    +K N D S   +  +++ GGVLR+  GN+   ++  I       AE   + +
Sbjct  1149  WYPPSLNNIKWNVDASVAMNQSKSAIGGVLRNWQGNFMCVFSSPIPPIEINSAEILAIFR  1208

Query  487   GLRMAKEYGARR---IMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEA-ENFLAVVFL  320
              ++++  +   +   I IE DS   V+     + G   N N     I+ A  ++L +   
Sbjct  1209  AVQISLSFSTIKDLPIAIESDSANAVKWCNENQGG-PWNMNFQLNFIRNARRSWLNLSIH  1267

Query  319   HIYREQNKLADKLAKWALT  263
             +  R  N +AD LAK  L 
Sbjct  1268  YKGRSSNIVADALAKQGLA  1286



>ref|XP_008364703.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=749

 Score =   173 bits (439),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 151/608 (25%), Positives = 242/608 (40%), Gaps = 20/608 (3%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             RI+ +L+GWK  TLS AG+  L K+V+ AIP Y M     P  VC +++     F     
Sbjct  126   RIAGKLQGWKQSTLSKAGKEVLIKAVVQAIPAYPMNIFKFPAVVCDDLDALVAGFW--WG  183

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
             +  G  K+  V+ +++   K  GG+G ++    N A + K  WRL  EPN+LWA+ +  +
Sbjct  184   KAGGGGKIHWVSKEVLGLPKNIGGMGFKSFKEFNDALLAKQCWRLICEPNSLWARVIKAR  243

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y     S L  ++    S AW  + + R+ +  G    +  G+  R W+D WL +  L  
Sbjct  244   YFPHC-SFLEASKGGRASWAWSSLLSGRDVILQGTHWQILGGEDVRVWVDRWLPSLXLGH  302

Query  1423  KLR-GTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWS  1247
              +  G + +         +    R W    +Q +    E E + +  + + +  D   W+
Sbjct  303   PVPLGGVAVXRNLRVCKLFCPLSREWDLNFLQPFXTDVEXETIRATPIGDSSRRDRLIWA  362

Query  1246  PDPRGCFSVKSAYGWADN-----------AARQEADKVWGLIWSLRVPARISMFIWLVKH  1100
                 G +SVKS Y W  +            AR   +++W  +W + VP +I  F+W   H
Sbjct  363   ASKNGRYSVKSGYRWIQSRSLCLRDSRLPHARSVPEELWKCLWKIEVPPKIRHFLWSSLH  422

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
               + TN    +R  +++  C  C    E   H+F  C  V  +W   +     +      
Sbjct  423   NALATNMNLFKRRASNSPICPICLCDDESTVHIFLLCPWVKHVWFGGVLSYKVDGSAISS  482

Query  919   WNSWLTMNLKGDRQQGFEEGWPER-FGTRLWWLWKWRNEAVFNR-NLLPLEQKLDWLRRC  746
             W  WL      +     +  W         W++WK R + VFN   ++P           
Sbjct  483   WFLWLQAIFSSNFGAPDDGMWVRSCVAFTCWFIWKARCDFVFNXVKIIPSRVVXAISSAM  542

Query  745   DSETAAAFEERHWPLQRH-NRGGEERLSWEKPDEGWLKLNTDGS-CTSDGQASCGGVLRD  572
             DS  AA        L+    +     + W  PD  + K+N D S C        G V+R 
Sbjct  543   DSFLAAGRSXEVCGLRXGVGQASXPVVCWTPPDPPFSKINVDASWCRMSLVGFVGVVVRS  602

Query  571   THGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK-ET  395
               G +     Y I    +  AEA  +L G ++    G   ++IE DS   V  L    E 
Sbjct  603   AEGQFIAAARYSIKASNAAAAEALALLHGCKLGVTLGLSEVIIESDSLEAVSCLSNSLED  662

Query  394   GQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFE  215
             G  +    +    K  E F    +  + R  N  AD L+    T    +   + PP    
Sbjct  663   GSXEAFPFLAMVKKIGETFQXCRWSWVPRTANMAADVLSSRVCTEMCDVVWVDRPPSSLV  722

Query  214   VRMALDRL  191
               +  D L
Sbjct  723   FVLNNDGL  730



>ref|XP_007212995.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica]
 gb|EMJ14194.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica]
Length=887

 Score =   174 bits (442),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 160/598 (27%), Positives = 252/598 (42%), Gaps = 88/598 (15%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +RI  RL GWK K LS AG+  L K+V+ AIP+Y+M    LP+G   ++ K    F W
Sbjct  349   LKERIMKRLHGWKGKLLSGAGKEILLKAVVQAIPLYSMSYFLLPRGFYDDLNKLMAGFWW  408

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               +  +G+ K+  ++W+ +   K  GG+G R+L+  N A + K GWR+ T P ++ +K L
Sbjct  409   --NNSNGDRKIHWISWEKLCKPKDEGGMGFRHLYAFNLAMLAKQGWRILTMPTSMASKLL  466

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY   S S L  +     S  WK + A R+ LE G    V +G +   W D W+    
Sbjct  467   QAKYFPTS-SFLNASVSSHDSAVWKSLCAARKVLEGGTRWQVSDGNNIDIWHDRWIPQP-  524

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
                                            + + Y P   +E + S+ L+ ++  D   
Sbjct  525   ------------------------------RQFKIYSPAPPVELIHSIPLSIQHPLDQLI  554

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYER  1073
             W  D +G FSV+SAY             +W  +W   + A++ +F W V    + T+   
Sbjct  555   WHYDRKGQFSVRSAY----------HSILWRTLWKANILAKVKVFWWCVCLNILPTHDNL  604

Query  1072  TRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQ--RRTEESMRNL-DWNSWLT  902
              ++ +  N+ C +C    E   H+ R C+     W  S     R  E M ++ DW S   
Sbjct  605   AQKKVPINDGCVHCGLMPETTLHVLRDCN-----WLSSSLGCLRDLEGMPSVKDWVSHCF  659

Query  901   MNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAF  722
              +L      GF       F    W LW+ RN        LP   K      C S      
Sbjct  660   RSLT-PTDLGF-------FFMMGWSLWEQRNG-------LPWNNK----SSCPSLVGHIA  700

Query  721   EERHWPLQRHNRGGEERLS-------WEKPDEGWLKLNTDGSCTSDGQA-SCGGVLRDTH  566
               R     + NR G    S       W KP    LK+N DG+  +  ++   G V+RD+ 
Sbjct  701   HNRLLEYLQVNRPGGTPCSNQDQVQRWTKPPMRHLKINVDGAWNAITKSGGVGVVIRDSA  760

Query  565   GNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQ  389
             G +  G   +     S +  EA    +G+ +A E G   I  E DS  +V AL       
Sbjct  761   GAFIAGRARKFDNVFSALQIEALAAREGVVLAVERGLTNICFESDSLQIVTALGCSSL--  818

Query  388   EQNNNIVRRCIKEAENFLAVV----FLHIYREQNKLADKLAKWALTTQGGLHIFEVPP  227
               + + +   +++++  L  +    F H+ R  N+   ++A++AL  +  +  FE PP
Sbjct  819   --DRSFIGPILEDSKFLLLQITGEGFAHVCRTANEATHRIARFALHLETPISWFEGPP  874



>ref|XP_009118875.1| PREDICTED: uncharacterized protein LOC103843847 [Brassica rapa]
Length=1319

 Score =   176 bits (445),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 163/596 (27%), Positives = 249/596 (42%), Gaps = 48/596 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DRI  + +GW  + LS AG++T+ KSVL+ +P + M    LP  +C  I+    RF W
Sbjct  744   IIDRIKQKAKGWSNRFLSTAGKMTMLKSVLSLVPSHAMSCFQLPVSLCKRIQSTLTRFWW  803

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D+  G  KMS +AW+ +   K +GGL  R++ + N A + KL WR+   P+ L  + L
Sbjct  804   --DDSMGRKKMSWIAWNKLIRPKDQGGLDFRDIQSFNEAYLAKLAWRIINNPDKLIGRIL  861

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY H     L    +  IS+ W+G+   R+ + S  +  V NG+S   W   WL+ + 
Sbjct  862   LGKYCHNE-PFLAVDVKVEISHGWRGVLIGRDIVMSNASWEVGNGESINIWTKPWLSCE-  919

Query  1432  LYEKLRGTLGLPELYATVNEYW-DKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
             + E   G   L  L  TV++++    R W  + I+  LP EE +++ ++  +    PD  
Sbjct  920   VQESPMGPAPLQYLNLTVSDFFLPNSREWNVDMIRLVLPMEE-QKILAIKPSVTGAPDKL  978

Query  1255  GWSPDPRGCFSVKSAYGWA-----DNAARQEADKVWG---LIWSLRVPARISMFIWLVKH  1100
              W     G ++ KS Y  A     D      AD+ +     +W+L+   +  +F+W   H
Sbjct  979   SWLGAKSGSYTTKSGYATALSTRTDPMDTSIADQSFDWKKAVWTLKTSPKTKLFVWKALH  1038

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH-----SLQRRTEES  935
             G +        R I  +  C  C    E +DHLF  C    ++W       S++      
Sbjct  1039  GAIPAGEALRARQINVDGKCKRC-NLPETIDHLFFHCPFAKQVWTSAPVFPSIEYNGSIV  1097

Query  934   MRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWL  755
             +RN   N     NL     +G    W       LW +W  RN  VFN  L    + L   
Sbjct  1098  LRNQWINLISRKNLPPTGVEGQLAPW------ILWGIWTARNNLVFNDKLTSATETLSKA  1151

Query  754   RRCDSE-----TAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLK-LNTDGSC-TSDGQA  596
                  E     T ++      P Q H           K D  W + LN  G     +GQ 
Sbjct  1152  ISLAREWGTCQTISSPLPAVPPTQAH---ASPNCIVVKSDAAWNETLNVAGLGWVMEGQN  1208

Query  595   SCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVE  416
                      H       T       +     W         +E G  RI  E DS +LV+
Sbjct  1209  RTSSFSLPAH----HVRTPLAAEALALREAIWK-------CRELGFTRIRCESDSAVLVK  1257

Query  415   ALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGL  248
             ALK ++T       I+      A +F  + F  I R++N  AD LAK  L+ +  L
Sbjct  1258  ALK-EDTFLTGLYGILIDIQALASSFECISFNWISRKKNVEADVLAKQILSVELAL  1312



>ref|XP_008233465.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=547

 Score =   171 bits (432),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 131/472 (28%), Positives = 193/472 (41%), Gaps = 49/472 (10%)
 Frame = -1

Query  1570  TRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTLGLPEL  1391
             T +   S  WKG+    E L  G+   V  G +T+FW DSWL  KPL  K  G L + ++
Sbjct  117   TAKEDCSTTWKGVMYGVELLRQGIGWRVGKGDTTKFWKDSWLIDKPLL-KHDGVLHIEDI  175

Query  1390  YATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSPDPRGCFSVKSA  1211
                                                    +  D   W     G FSVK+A
Sbjct  176   ---------------------------------------DCSDCHIWKGTANGVFSVKTA  196

Query  1210  YGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNC  1031
             Y           D  +  +W L++P ++ +F WL   G++L+N +R RR +  N  C  C
Sbjct  197   YNLFFKGPSW-PDYSFSSLWKLKIPLKLQIFAWLTAQGKILSNEQRVRRQLIFNASCGVC  255

Query  1030  AGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPE  851
                 E   H+ R C+    IW   L          +D+  W   NL           W  
Sbjct  256   EWPIETTLHILRDCYKARGIWNTVLMPSHHGHFFQMDFLPWFQTNLLSQAVWCSNIPWSP  315

Query  850   RFGTRLWWLWKWRNEAVFNRNL-LPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEE  674
              F    W++WKWRN  VF  +  +P + K   +R         F+  H  L +HN   + 
Sbjct  316   VFIFTCWYVWKWRNHQVFQGDEDVPFDPKQLIVR----AVHEWFKASH-VLSKHNHKVQV  370

Query  673   RLSWEKPDEGWLKLNTDGSC-TSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWG  497
              L WE    G  KLN DGS     G    GGV+R++ G+W  G+   +GR     AE WG
Sbjct  371   DLKWEPLISGQFKLNVDGSKRNGSGHVGVGGVIRNSSGDWISGFAVNLGRGQILEAEIWG  430

Query  496   VLQGLRMAKEYGARRIMIECDSKMLVEAL-KGKETGQEQNNNIVRRCIKEAENFLAVVFL  320
             +  GL++A +     +++E DS ++V+ + K   T       +V  C +           
Sbjct  431   LFFGLKLAVDKEINNLVVEMDSALVVQLIQKQGLTDVHPFAALVASCWELMHKINCCSVC  490

Query  319   HIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDRLGASSPRRVS  164
             H+Y E+N +A+ LA W+     GL+IF   P      +  D LG +  R VS
Sbjct  491   HVYIERNSIANCLATWSYNLDLGLYIFVDAPAWVGPSLIDDLLGITRSRLVS  542



>ref|XP_009149305.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=963

 Score =   174 bits (441),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 163/620 (26%), Positives = 252/620 (41%), Gaps = 77/620 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++  +  ++  W  + L  AG+  L KSVL A P+Y M    LPK VC +I  +   F W
Sbjct  370   VVSIVKNQISPWYNQFLLSAGKEVLIKSVLQAKPVYPMSCFLLPKSVCDDINSQLSGFWW  429

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             GR++  G  K S ++W  +   K  GG+G  +LH  N A + K  W+++  P +L ++  
Sbjct  430   GRND--GKRKFSWISWQRLCLPKNEGGMGFCDLHGFNVALLAKQAWKIEQNPTSLLSRIY  487

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y++ S + L +T   S S  WK I   ++ L+ GL   + NG++T  W D WL    
Sbjct  488   KGRYYN-SSTFLQSTSLTSSSYGWKSIQVGKDLLKKGLVMQIGNGQNTNVWNDQWLQTS-  545

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
             L  KL      P +   V+E  ++    W    ++     E++  +  + L+  N  D +
Sbjct  546   LPRKLISPCLYPNM--KVSELINQSSASWNEAILEELFVPEDIIEIKKIRLSRFNQCDRY  603

Query  1255  GWSPDPRGC-FSVKSAYGWADNAARQEADKVW---------GLIWSLRVPARISMFIWLV  1106
              W P    C +SVKS Y W +     E D +            IW L +  +I  F W  
Sbjct  604   VW-PFTSDCKYSVKSGY-WTNTHVFSEDDPIEPPPGSFQLKNQIWDLEILPKIQHFFWKA  661

Query  1105  KHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRN  926
               G + T  +   R I  N  C  C  + E ++H+   C      WR S           
Sbjct  662   VTGALATFAQLCSRGININPICQRCGLEEETINHVLFLCPHALATWRCS-----------  710

Query  925   LDWNSWLTMNLKGDRQQGFEEGWPERFGT----------------RLWWLWKWRNEAVF-  797
                     + L G +    E    E F                   LW++WK RNE +  
Sbjct  711   -------GLPLNGIQSHDLERNIAELFFLLHRRDTPSAVSKLTFWLLWYIWKSRNEFLLA  763

Query  796   NRNLLPLEQ-------KLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLS-WEKPDEGW  641
              RN+ P+E         ++W    +S   +A         + N G + R S WE P  GW
Sbjct  764   QRNVHPMEDVKRAVEGNVEW----NSNFVSA---------KANGGRQVRNSKWEPPPLGW  810

Query  640   LKLNTDGSCTSDGQ-ASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKE  467
             LK N D S   +   A  G ++RD +G++ +         TS + AEA   L  L+    
Sbjct  811   LKCNFDSSFRKETMTAGIGWIVRDENGHFLKAGMVIQENVTSPLQAEALAFLYALQQVWI  870

Query  466   YGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLAD  287
              G RR+  E DS  L   +   E       NI+                 ++RE N  AD
Sbjct  871   NGWRRVWFEGDSSELARIINTMEQDHVSLGNILYDIRHWMSKLTWCSLESVHREHNMAAD  930

Query  286   KLAKWALTTQGGLHIFEVPP  227
              L+K  +     + +   PP
Sbjct  931   VLSKNIMRLNVSVVVLNSPP  950



>emb|CCA66180.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1383

 Score =   175 bits (443),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 164/622 (26%), Positives = 269/622 (43%), Gaps = 72/622 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D++  +L  WK K LSL GR+TL K+ L+ +P+Y M    +PKGV  +I K  R F+W
Sbjct  765   IIDKLEKKLASWKGKLLSLGGRLTLIKASLSNLPLYYMSLFPVPKGVIEKINKLMRAFLW  824

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D   G    S+V+W I+   KT GGLG+ N+   N + + K  WRL   P+++W   +
Sbjct  825   CGD--FGKRPFSMVSWSIVQQPKTSGGLGIGNILHKNLSLLFKWIWRLFENPSSMWGSII  882

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISA-------ERETLESGLTHVVRNGKSTRFWMD  1454
              +KY++ S   +   ++      WK I A        R    +G+   V NG S+ FW D
Sbjct  883   RSKYNYSSTCSISDLKKPVSGGPWKSICAAVLGHEGARLIAVNGMRKNVGNGISSLFWHD  942

Query  1453  SWLTAKPLYEKLRGTLGLPELYAT------------VNEYWDKVRGWKWEKI---QRYLP  1319
             +WL  +PL          P L++             V E ++ V  + W+++   Q  + 
Sbjct  943   TWLCEQPLKRI------APRLFSIAINKNSSIASYGVWEGFNWVWVFSWKRVLRPQDLVE  996

Query  1318  TEELERLASLCLTEENTPDGWGWSPDPRGCFSVKS-AYGWADNAARQEADKVWGLIWSLR  1142
                L+ L      + N  D   W+P+  G FS KS +   +       +D V G +W   
Sbjct  997   KAHLDELLKSVRLDPNADDQLIWAPEKSGRFSTKSFSKELSKMTPPTHSDAVKG-VWRGL  1055

Query  1141  VPARISMFIWLVKHGRVLTNYERTRRHITSNE--YCYNCAGQREDLDHLFRRCHDVDRIW  968
             VP RI +F+W+   G++ + ++     I S E   C  C    E  DHL   C +  ++W
Sbjct  1056  VPHRIEVFVWIALLGKINSRHKLAAFGIISEEEDICPLCDEGSETSDHLLLHCVEAQKLW  1115

Query  967   RHSLQ----RRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAV  800
                L     +    S     ++ W  +  K +    F++ W   F   +W +WK RN  +
Sbjct  1116  AWWLDIWKVKWVFPSSLLDAFSQWKCIKKKSN---FFKKVWAASFFVIIWTIWKERNLRI  1172

Query  799   FNR---NLLPLEQKLDWLR--------RCDSETAAAFEERH-----WPLQRHN----RGG  680
             F+    N + L Q L  LR         C    +    +R+     W  QR      +  
Sbjct  1173  FHNSSSNAMNL-QDLVLLRLGWWIGAWDCRFPYSPTDIQRNPLCLEWSDQRVCAQLLKQQ  1231

Query  679   EERLSWEKPDEGWLKLNTDGSCT-SDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEA  503
              E  SW  P    LK N D S   S+  ++ GG+LR+  G +   ++  +       AE 
Sbjct  1232  PENDSWVPPPPQVLKWNVDASVINSNSCSAIGGILRNHKGEFMCVFSSPVPYIEINCAEI  1291

Query  502   WGVLQGLRMAKEYGARR---IMIECDSKMLVEALKGKETGQEQNN---NIVRRCIKEAEN  341
               + + ++++ +    +   +++E DS   V     +  G    N   N +R   K+  N
Sbjct  1292  LAIHRAIQISLQSDKTKNANLLLESDSANAVMWCNSESGGPWNMNFQLNFIRSMRKKGLN  1351

Query  340   FLAVVFLHIYREQNKLADKLAK  275
                +   +  R  N +AD LAK
Sbjct  1352  ---ISITYKGRSSNVVADSLAK  1370



>ref|XP_007031313.1| Uncharacterized protein TCM_016763 [Theobroma cacao]
 gb|EOY02239.1| Uncharacterized protein TCM_016763 [Theobroma cacao]
Length=2127

 Score =   175 bits (444),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 170/625 (27%), Positives = 267/625 (43%), Gaps = 63/625 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ +I  R+ GW+ K LS  GR+TL +SVL+++P+Y +Q    P  V   I++    F+W
Sbjct  1528  LISKIRDRISGWENKILSPGGRITLLRSVLSSLPMYLLQVLKPPVTVIERIDRLFNSFLW  1587

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   +    KM    W  I+     GGLG+R L  +  A  +KL WR +T  N+LW + L
Sbjct  1588  GDSTEC--KKMHWAEWAKISFPCAEGGLGIRKLEDVCAAFTLKLWWRFQTG-NSLWTQFL  1644

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              TKY      H +  +    S+ WK + + RE     +   +  G    FW D W+  KP
Sbjct  1645  RTKYCLGRIPHHIQPKLHD-SHVWKRMISGREMALQNIRWKIGKG-DLFFWHDCWMGDKP  1702

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRG--WKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
             L          PE    ++  +    G  W  +K++ +LPT  +E +  +   +++  D 
Sbjct  1703  L------AASFPEFQNDMSHGYHFYNGDTWDVDKLRSFLPTILVEEILQVPF-DKSREDV  1755

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
               W+    G FS +SA  W     RQ ++ +   IW   +P  IS F+W   H  +    
Sbjct  1756  AYWTLTSNGDFSTRSA--WEMIRQRQTSNALCSFIWHRSIPLSISFFLWKTLHNWIPVEL  1813

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRR-----TEESMRNLDWN  914
                 + I     C  C    E L H+        ++W    Q           +  + W 
Sbjct  1814  RMKEKGIQLASKCV-CCNSEESLIHVLWENPVAKQVWNFFAQLFQIYIWNPRHVSQIIW-  1871

Query  913   SWLTMNLKGD--RQQGFEEGWPERFGTRLWWLWKWRNEA---------------------  803
             +W    + GD  R+  F    P       W+LW  RN+A                     
Sbjct  1872  AWY---VSGDYVRKGHFRVLLPLFI---CWFLWLERNDAKHRHTGLYADRVIWRTMKHCR  1925

Query  802   -VFNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNT  626
              +++ +LL   Q+  W    D  T   F   H   ++H     + + W+KP  G  KLN 
Sbjct  1926  QLYDGSLL---QQWQWKGDTDIATMLGFSFTH---KQH--APPQIIYWKKPSIGEYKLNV  1977

Query  625   DGSCTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIM  446
             DGS  +   A+ GGVLRD  G    G++  IG C S  AE   +L+GL + KE    ++ 
Sbjct  1978  DGSSRNGLHAATGGVLRDHTGKLIFGFSENIGPCNSLQAELRALLRGLLLCKERHIEKLW  2037

Query  445   IECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
             IE D+ + ++ ++  + G   N   +   I+   +  +    HI RE N+ AD L+    
Sbjct  2038  IEMDALVAIQLIQPSKKG-PYNLRYLLESIRMCLSSFSYRLSHILREGNQAADYLSNEGH  2096

Query  265   TTQGGLHIFEVPPGEFEVRMALDRL  191
               Q  L +F    G+    + LDRL
Sbjct  2097  KHQ-NLCVFTEAQGQLHGMLKLDRL  2120



>ref|XP_010668002.1| PREDICTED: uncharacterized protein LOC104884990 [Beta vulgaris 
subsp. vulgaris]
Length=1509

 Score =   175 bits (443),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 173/628 (28%), Positives = 253/628 (40%), Gaps = 77/628 (12%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++ +I  +L  WK   LS+ GRVTL KS L ++P+Y M    +PKGV  +I +  R F+W
Sbjct  892   VIAKIEKKLASWKGNLLSIGGRVTLIKSCLASLPLYYMSLLPMPKGVIEKIIQLQRNFLW  951

Query  1792  -GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKT  1616
              G  E+     + LV+W+++   K  GGL + NLH  N A + K  WR   EPN+LW + 
Sbjct  952   RGSLEKKA---LPLVSWNVLELPKQYGGLSIGNLHNKNTALLFKWLWRFIHEPNSLWRQI  1008

Query  1615  LTTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGL---THVVR----NGKSTRFWM  1457
             +  KY       +           W+GI    ++        TH++R    +G ST FW 
Sbjct  1009  VQAKYDIGPTFTIRDLTTPPHGGPWRGICNLIQSSSHAYQIATHMIRKNIGDGSSTMFWH  1068

Query  1456  DSWLTAKPLYEKLRGTLGL---PELYATVNEYWDKVRGWKWE-------KIQRYLPTEEL  1307
             D W+   PL E       L   P    +   +WD  + W W        + Q     E L
Sbjct  1069  DVWVGEHPLKEVCPRLFLLSLSPNALVSSCGFWDG-QIWHWSLHWKRNLRPQDRCERESL  1127

Query  1306  ERLASLCLTEENTPDGWGWSPDPRGCFSVKS-AYGWADNAARQEADKVWGLIWSLRVPAR  1130
             + L    +  ++  D   W+P   G FSVKS     A     Q  D   G  W   VP R
Sbjct  1128  QVLLDRAVLYQDGHDQTIWTPAKSGKFSVKSFTLELAKKDVPQNFDASKGF-WKGLVPFR  1186

Query  1129  ISMFIWLVKHGRVLTNYERTRRHIT--SNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSL  956
             I +F+W V  GR+ T  +  R  I   S + C  C    E ++HLF  C     +W   L
Sbjct  1187  IEIFVWFVLLGRLNTKEKLWRLGIVPESEKNCVLCNIHPESVNHLFMGCTVASELWLWWL  1246

Query  955   Q--------RRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAV  800
                        T +S+ N  W++         R    ++ W   F   LW +WK RN  +
Sbjct  1247  SIWGVSWVFPSTLKSLHN-QWHAPF-------RGSIIKKSWQAIFFIILWTIWKERNGRI  1298

Query  799   FNRNLLPLEQKLD--------WLR-----------------RCDSETAAAFEERHWPLQR  695
             F      + Q  D        WL+                 +C    +      H P   
Sbjct  1299  FENKECSMSQLKDLILLRLSWWLKGWGDFFPYSSTDLLRNPQCLLWNSKPCPSNHLP---  1355

Query  694   HNRGGEERLSWEKPDEGWLKLNTDG-SCTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTS  518
                      SW  P  G LK N D    +    +S GGVLRD +GN+   ++  I     
Sbjct  1356  ---SATAVESWSPPPFGSLKWNVDASCSSIFESSSIGGVLRDHNGNFICMFSRPIPFMEI  1412

Query  517   TVAEAWGVLQGLRMA---KEYGARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEA  347
               AE   + + L+++   +      IMIE DS   V+  K  + G    N I+     E+
Sbjct  1413  NNAEVLAIHRALKISASCERLMNLPIMIESDSVNAVKWCKQDKGGPWNMNFILNFIRGES  1472

Query  346   ENFLAVVFLHIYREQNKLADKLAKWALT  263
                  +   +  R  N +AD LAK  L+
Sbjct  1473  RKSPGMSITYKGRASNMVADALAKQGLS  1500



>gb|EEC83406.1| hypothetical protein OsI_28856 [Oryza sativa Indica Group]
Length=1143

 Score =   174 bits (441),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 138/515 (27%), Positives = 214/515 (42%), Gaps = 77/515 (15%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L  +I  R+  W    LS  G+  L K+V+ AIP+Y M    LP  +C ++ + TR F W
Sbjct  669   LQAKICKRVIQWGENYLSSGGKEILIKAVIQAIPVYVMGIFKLPDSICEDLTRLTRNFWW  728

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G D  +G  K    AW+ +T  K   GLG +++   N+A + +  WRL    ++L AK L
Sbjct  729   GAD--NGQRKTHWRAWESLTKPKRNCGLGFKDIRLFNQALLARQAWRLIEFSDSLCAKVL  786

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK-  1436
               KY    GS + TT   + S AW+G+    + L+ G+   + NG + R W D WL    
Sbjct  787   KAKYFPH-GSLIDTTFGPNASPAWQGMEHGIDILKKGIIWRIGNGNAVRIWRDPWLPRDH  845

Query  1435  ---PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
                P+  K    L         ++  D+   W  EKI RY    + + +  +C +     
Sbjct  846   SRWPIILKRNCRLKW------FSDLLDQDGSWNAEKINRYFLKVDADVIYKICTSPRVEC  899

Query  1264  DGWGWSPDPRGCFSVKSAYGWADNAARQE---------ADKVWGLIWSLRVPARISMFIW  1112
             D   W PD  G FSV+SAY  A N A  E          +K W LIW   VP ++ +F W
Sbjct  900   DFLAWHPDKTGQFSVRSAYALAANLANMEVPSSSSTATVNKAWDLIWKCNVPQKVRIFAW  959

Query  1111  LVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESM  932
                   + T  ++ +R++   + C  C  ++ED  H   RC                   
Sbjct  960   KAASNSLPTMVKKKKRNLEKTDMCPICDREKEDAGHALCRC-------------------  1000

Query  931   RNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLR  752
                                G  +     F   LW  W  RNE   ++ + P+E    +++
Sbjct  1001  ----------------IHAGLSDYDRALFLMTLWRNWHVRNEITHDKVVPPVEASQRFIQ  1044

Query  751   RCDSETAAAFEERHWPLQRHNRGG----------------EERLSWEKPDEGWLKLNTDG  620
                S     F+ R  P+ +  +G                 + +  WE+P  GW+KLN DG
Sbjct  1045  ---SYVDTMFQIRQDPVAKLAKGKLVLKVGNVKQHTQTTCKPQPRWERPSNGWMKLNIDG  1101

Query  619   SCTSDGQ-ASCGGVLRDTHGNWCRGYTYRIGRCTS  518
             S  S  +    G +LRD+ G         + +C++
Sbjct  1102  SFDSKTENGGIGAILRDSSGKPIFACCKPLQKCSA  1136



>ref|XP_010694802.1| PREDICTED: uncharacterized protein LOC104907559 [Beta vulgaris 
subsp. vulgaris]
Length=1336

 Score =   174 bits (442),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 155/583 (27%), Positives = 252/583 (43%), Gaps = 36/583 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +R+  +L+GWK K LS AG+  L K+++ +IP Y M   A+P  + +EI     RF W
Sbjct  745   LKERVWKKLQGWKEKLLSRAGKEVLLKAIIQSIPTYMMSLFAVPDCILNEINAMCSRFWW  804

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   +    KM  V+W+ +   K+ GG+G R+L   N+A + K GWRL  + N+L    +
Sbjct  805   G--ARGTERKMHWVSWEKLCLPKSYGGMGFRDLKVFNQALLAKQGWRLLCDTNSLAHLVM  862

Query  1612  TTKYHHRSGSHLVTTRRRSI--SNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTA  1439
               +Y  R+   L T+ RR    S  W+ I   +  L  GL   V +G S   W DSWL  
Sbjct  863   KARYFPRT---LFTSARRGFDPSYVWRSIWGAKALLLEGLKWRVGDGNSINVWEDSWLPG  919

Query  1438  KPLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
                       +  P     V++  D+   W    +  +  + +   + ++ ++     D 
Sbjct  920   DSCSVVPTPNIESPA-DLQVSDLIDRGGTWNELALSTHFTSNDAALIRTIHISRRMPEDI  978

Query  1258  WGWSPDPRGCFSVKSAYGWADN-------AARQEADK--VWGLIWSLRVPARISMFIWLV  1106
               W P   G +S KS Y W           AR   D    W  IW+L  P ++  F+W  
Sbjct  979   QYWWPASNGEYSTKSGY-WLGRLGHLRRWVARFGGDHGVAWKAIWNLDGPPKLRHFVWRA  1037

Query  1105  KHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS--LQRRTEESM  932
               G + T      RH+ ++E C  C G+RE + H    C  V  IWR+S  L    +  +
Sbjct  1038  CTGALATKGRLCDRHVINDEACTFCHGERESVLHALFHCSLVAPIWRNSPFLNYVVDGPV  1097

Query  931   RN-LDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQ-KLDW  758
              + ++   W+   L       F            W  W +RN  VF      +E   + +
Sbjct  1098  SSFMESFIWIRSKLASSELLSFL--------ALAWAAWTYRNSVVFEEPWKNIEVWAVGF  1149

Query  757   LRRC-DSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGV  581
             L+   D ++ A    R   +         R +W  P  GW KLN+D +   + +   G V
Sbjct  1150  LKLVNDYKSYATLVHRAVSVSPF----PSRSAWIPPTVGWYKLNSDAAMLGEEEIGVGVV  1205

Query  580   LRDTHGNWCRGYTYRI-GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKG  404
             +RD HG        R   R    +AEA   L GL++A+++G   + +ECD++ L +A+  
Sbjct  1206  VRDVHGVVVMLAVKRFQARWPVALAEAMAALYGLQVARDFGFVSVELECDAQNLSQAIFL  1265

Query  403   KETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
             +  G+   + ++        +       H+ R  N +A  +A+
Sbjct  1266  QNFGRSSLDLVIEDICLLGASLDNFSISHVKRGGNTVAHSMAR  1308



>ref|XP_007031312.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
 gb|EOY02238.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
Length=2214

 Score =   175 bits (443),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 172/623 (28%), Positives = 275/623 (44%), Gaps = 59/623 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+ +I  R+ GW+ K LS   R+TL +SVL+++P+Y +Q    P  V  +IE+    F+W
Sbjct  1615  LISKIRDRISGWENKILSPGSRITLLRSVLSSLPMYLLQVLKPPAIVIEKIERLFNSFLW  1674

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G D   G  +M   AW+ I    + GGL +RNL  +  A  +KL WR  T  ++LW   L
Sbjct  1675  G-DSNEG-KRMHWAAWNKINFPCSEGGLDIRNLKDVFDAFTLKLWWRFYT-CDSLWTLFL  1731

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              TKY      H V  +  S S+ WK I+  R+         +  G+   FW D W+  +P
Sbjct  1732  KTKYCLGRIPHYVQPKIHS-SSIWKRITGGRDVTIQNTRWKIGRGE-LFFWHDCWMGDQP  1789

Query  1432  L---YEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
             L   +   R  +        V++++ K   W  +K++ +LP   +  +  L   +    D
Sbjct  1790  LVISFPSFRNDMSF------VHKFY-KGDSWDVDKLRLFLPVNLIYEIL-LIPFDRTQQD  1841

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTN  1082
                W+    G FS KSA  W     +Q  + +  LIW   +P  IS FIW   +  +   
Sbjct  1842  VAYWTLTSNGEFSTKSA--WETIRQQQSHNTLGSLIWHRSIPLSISFFIWRALNNWIPVE  1899

Query  1081  YERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR-----HSLQRRTEESMRNLDW  917
                  + I     C  C    E L H+        ++W        +     + + ++ W
Sbjct  1900  LRMKGKGIHLASKCV-CCNSEESLMHVLWGNSVAKQVWAFFAKFFQIYVLNPKHVSHILW  1958

Query  916   NSWLTMNLKGDR-QQGFEEGWPERFGTRLWWLWKWRNEAVFNRN----------LLPLEQ  770
              +W      GD  ++G        F    W+LW  RN+A +  +          ++ L +
Sbjct  1959  -AWF---YSGDYVKRGHIRTLLPIF--ICWFLWLERNDAKYRHSGLNTDRIVWRIMKLLR  2012

Query  769   KL-------DWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCT  611
             +L        W  + D++ AA ++   +  Q   R   + + W KP  G  KLN DGS  
Sbjct  2013  QLKDGSLLQQWQWKGDTDIAAMWQ---YNFQLKLRAPPQIVYWRKPSTGEYKLNVDGSSR  2069

Query  610   SDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDS  431
                 A+ GGVLRD  G    G++  IG C S  AE   +L+GL + KE    ++ IE D+
Sbjct  2070  HGQHAASGGVLRDHTGKLIFGFSENIGTCNSLQAELRALLRGLLLCKERHIEKLWIEMDA  2129

Query  430   KMLVEALKGKETGQEQNNNI---VRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTT  260
                ++ L   + G      +   +R+C+    N ++    HI+RE N++AD L+      
Sbjct  2130  LAAIQLLPHSQKGSHDIRYLLESIRKCL----NSISYRISHIHREGNQVADFLSNEGHNH  2185

Query  259   QGGLHIFEVPPGEFEVRMALDRL  191
             Q  LH+F    G+    + LDRL
Sbjct  2186  Q-NLHVFTEAQGKLHGMLKLDRL  2207



>ref|XP_008785084.1| PREDICTED: putative ribonuclease H protein At1g65750 [Phoenix 
dactylifera]
Length=861

 Score =   172 bits (436),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 151/592 (26%), Positives = 248/592 (42%), Gaps = 47/592 (8%)
 Frame = -1

Query  1960  ISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDE  1781
             +  R+EGW+  +LS+ GRVTLA+SVL++IPIY +  A +P  V   IE+  R FIWGR  
Sbjct  292   VRQRMEGWQLHSLSMMGRVTLARSVLSSIPIYLLSHAFIPVSVLRSIEQLVRNFIWGR--  349

Query  1780  QSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKY  1601
             Q G   + L+AW+++      GGLG+++L     A + +   R   EP+++W+  +  KY
Sbjct  350   QGGRGGIHLLAWEVVCQPTRYGGLGVQSLLVRREALVARHAARYVLEPDSMWSSLMRAKY  409

Query  1600  HHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEK  1421
                +    V   RR  S  W+ + A    +   +   + +G+S     D W+TA P+   
Sbjct  410   GALAAG--VRAGRRH-SFVWREMCARAGEVLPEIRWAIGDGRSVDVLEDCWVTAVPISR-  465

Query  1420  LRGTLGLPELYAT-------VNEYWDK-VRGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
                   +P L  +       V++  D  V GW+   ++     +    +  L +  +   
Sbjct  466   ------MPTLVDSVRLAGRRVSDLLDPDVGGWREGLVREVFRAQLAAMILGLPVPFQGES  519

Query  1264  DGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLT  1085
             D   W P  R     +  Y      + +  +  W  IW +R+  R+++FIW V  G + T
Sbjct  520   DRLVWVPSGRSQVRARDLYALFSRESPRRMEGGW--IWRMRIHPRVALFIWKVAWGCLPT  577

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWL  905
                  RR +   + C  C    E + H+  +C     IWR S            D+   L
Sbjct  578   RSVLVRRGMRVPQECVVCPDIEETIQHVLLQCPRAREIWRSSPAPIPHSVGSTQDFIQLL  637

Query  904   TMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAA  725
               +++  R    EEG    +    + +W  RN  +F    +      +       E  + 
Sbjct  638   RTSVRSPRL--VEEGIIRAYLA--YHIWLDRNARLFEGRRISARMVAERAVLQAGEVLSC  693

Query  724   FEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGNWCRGY  545
             F E           G  R  W+        +      T       G V+RD  G+     
Sbjct  694   FGESSL--------GMTRDIWDTRS----AVLAPSVATDRRSGGAGFVIRDHFGSLVAAG  741

Query  544   TYRIGRCTSTVAEAWGVLQGLRMAKEY-GARRIMIECDSKMLVEALKGKETGQEQNNNI-  371
              +     T   AE W    G+  A++  GA R+ +E DS ++++ ++G +   + +  I 
Sbjct  742   GWGTTGLTVVGAELWAAWAGMSYARQVLGASRLYLEGDSSIVIDWIRGADRYGDGHPLIR  801

Query  370   -VRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLH---IFEVPP  227
               RR   E + F AV   HI+RE N+ AD +A       G LH     E+PP
Sbjct  802   ETRRLAMEMDEFQAV---HIFREANRAADWVASHVARHSGELHWTSTVELPP  850



>gb|ABA96203.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1378

 Score =   174 bits (440),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 141/569 (25%), Positives = 249/569 (44%), Gaps = 33/569 (6%)
 Frame = -1

Query  1936  KAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRDEQSGNNKMS  1757
             K K LS+ G+  L KS+  A+P+Y M    +P  +C  I     ++ WG D  + + ++ 
Sbjct  244   KEKILSMGGKEILIKSIAQAVPVYAMMVFKIPNKICKGITDAISQYWWGDD--ADHRRIH  301

Query  1756  LVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHL  1577
                W  +   K +GG+G R+L + N A + K  WRL ++P++L A+ L  +Y+ R G  L
Sbjct  302   WQEWWKMCMPKGKGGMGFRDLQSFNLALLAKQVWRLLSDPDSLCARVLRARYY-RDGKLL  360

Query  1576  VTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYEKLRGTLGLP  1397
                 +   S  W+ I A  +  + G    V +G   + W D+W+       K++   G  
Sbjct  361   NARMKSGSSYTWQSILAGLQCFKQGYIWRVGDGTQIKIWEDNWIPGSH-NMKIQTNRG-N  418

Query  1396  ELYATVNEYWDKVR-GWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSPDPRGCFSV  1220
              L ATV+E  D +   W  + ++      ++ R+  + +      D   W  +  G FSV
Sbjct  419   NLVATVDELIDPINFTWGGDLLKTIFWPIDVCRIMQIPI-RAGRDDLVAWQYNRSGTFSV  477

Query  1219  KSAY------GWADNAARQEAD-----KVWGLIWSLRVPARISMFIWLVKHGRVLTNYER  1073
             KSAY       + + +A+ +A      ++W  +W+L+VPA+I +F W    G V      
Sbjct  478   KSAYHCQWDYKFGERSAQMQASTASRSRLWKRLWNLKVPAKIKIFGWRALKGLVPCRAIL  537

Query  1072  TRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH-SLQRRTEESMRNLDWNSWLT--  902
               RH+  +  C  C    ED+ H+   C    ++W    ++ R +         S +   
Sbjct  538   ANRHVGDSGGCPVCQNGPEDIKHMIFTCARAKQVWNSLGVEDRIQRLCMTERSGSVILEE  597

Query  901   MNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAF  722
             + ++ D+ Q  + G+ E   T  W++W  R + V    +          R   S  A A 
Sbjct  598   ILIREDQVQDLQVGFAELVITAAWYIWWERRQLVHGEAV---------QRPARSGMAIAA  648

Query  721   EERHWPLQRHNRGGEERLSWEKPDEGWLKLNTD-GSCTSDGQASCGGVLRDTHGN-WCRG  548
               +++ L    +    R  W+KP EG + +N D G     G  + G V+RD  G      
Sbjct  649   LTKNYKLAT-KKDSVLRQGWKKPPEGKVMVNVDAGFDEMGGCGTVGSVIRDCSGGVLAAA  707

Query  547   YTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNNIV  368
             +++      + +AEA+ + +GL +A++ G  R++I+ D   +V+ +            I 
Sbjct  708   HSFVPHLVDAPMAEAFALKEGLMLAQQIGCNRLIIQSDCMEVVQIMTDGGFTANSAAAIY  767

Query  367   RRCIKEAENFLAVVFLHIYREQNKLADKL  281
               C      F  +   H  RE N+  D +
Sbjct  768   EDCNILWSGFADITIEHCSREANQCTDHI  796



>emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1357

 Score =   173 bits (439),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 150/573 (26%), Positives = 236/573 (41%), Gaps = 26/573 (5%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             LLDR+  +L GWK K LS AG+  L K+V+ A+P Y M    LP  V  EI     RF W
Sbjct  775   LLDRMWKKLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVYKLPVAVIQEIHSAMARFWW  834

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G   +    KM  ++W+ +   K  GG+G ++L   N A + K  WRL     +L ++ +
Sbjct  835   G--GKGDERKMHWLSWEKMCKPKCMGGMGFKDLAVFNDALLGKQVWRLLHNKESLLSRVM  892

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL-TAK  1436
             + KY+   G         S S +W+ I   +  +  GL   V +G     W   W+   +
Sbjct  893   SAKYYPH-GDVRYARLGYSHSYSWRSIWGAKSLVLEGLIWRVGDGTKIDIWSAPWVGDEE  951

Query  1435  PLYEKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
               + K     GL      V +  D  R  W  E I+R+    + + + ++ L+     D 
Sbjct  952   GRFIKSARVEGL----EVVGDLMDVERKEWNVELIERHFNERDQQCILAIPLSTRCLQDE  1007

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
               W+    G +SVK+AY         +  +VW ++WSL V  ++  F+W      +    
Sbjct  1008  LTWAYSKDGTYSVKTAYMLGKGGNLDDFHRVWNILWSLNVSPKVRHFLWRACTSSLPVRK  1067

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR----HSLQRRTEESMRNLDWNS  911
                RRH+     C  CA + E   HLF RC    ++W     + L    E+         
Sbjct  1068  VLQRRHLIDEAGCPCCAREDETQFHLFYRCPMSLKLWEELGSYILLPGIEDEAMCDTLVR  1127

Query  910   WLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETA  731
             W  M+ K  ++  +           LW +W  RN  VF     P       + R   E  
Sbjct  1128  WSQMDAKVVQKGCY----------ILWNVWVERNRRVFEHTSQPATVVGQRIMR-QVEDF  1176

Query  730   AAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGNWCR  551
               +  + +   R +        W  P  G +KLNTD S   +G    G + RD+ G  C 
Sbjct  1177  NNYAVKIYGGMRSSAALSPS-RWYAPPVGAIKLNTDASLAEEGWVGLGVIARDSEGKVCF  1235

Query  550   GYTYRI-GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNNN  374
               T R+       VAE   +    R+A+ +G   ++ E DS +  + L          + 
Sbjct  1236  AATRRVRAYWPPEVAECKAIYMATRLAQAHGYGDVIFESDSLVATKRLTKAAIFFSDLDA  1295

Query  373   IVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
             I+   +     F +V F H+ R+ N +A  LA+
Sbjct  1296  ILGDILSMCNAFSSVSFSHVKRDGNTVAHNLAR  1328



>ref|XP_009103763.1| PREDICTED: uncharacterized protein LOC103829818 [Brassica rapa]
Length=1304

 Score =   173 bits (439),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 161/587 (27%), Positives = 245/587 (42%), Gaps = 48/587 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DRI  + +GW  + LS AG++T+ KSVL+ +P + M    LP  +C  I+    RF W
Sbjct  744   IIDRIKQKAKGWSNRFLSTAGKMTMLKSVLSLVPSHAMSCFQLPVSLCKRIQSTLTRFWW  803

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D+  G  KMS +AW+ +   K +GGL  R++ + N A + KL WR+   P+ L  + L
Sbjct  804   --DDSMGRKKMSWIAWNKLIRPKDQGGLDFRDIQSFNEAYLAKLAWRIINNPDKLIGRIL  861

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY H     L    +  IS+ W+G+   R+ + S  +  V NG+S   W   WL+ + 
Sbjct  862   LGKYCHNE-PFLAVDVKVEISHGWRGVLIGRDIVMSNASWEVGNGESINIWTKPWLSCE-  919

Query  1432  LYEKLRGTLGLPELYATVNEYW-DKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
             + E   G   L  L  TV++++    R W  + I+  LP EE +++ ++  +    PD  
Sbjct  920   VQESPMGPAPLQYLNLTVSDFFLPNSREWNVDMIRLVLPMEE-QKILAIKPSVTGAPDKL  978

Query  1255  GWSPDPRGCFSVKSAYGWA-----DNAARQEADKVWG---LIWSLRVPARISMFIWLVKH  1100
              W     G ++ KS Y  A     D      AD+ +     +W+L+   +  +F+W   H
Sbjct  979   SWLGAKSGSYTTKSGYATALSTRTDPMDTSIADQSFDWKKAVWTLKTSPKTKLFVWKALH  1038

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH-----SLQRRTEES  935
             G +        R I  +  C  C    E +DHLF  C    ++W       S++      
Sbjct  1039  GAIPAGEALRARQINVDGKCKRC-NLPETIDHLFFHCPFAKQVWTSAPVFPSIEYNGSIV  1097

Query  934   MRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWL  755
             +RN   N     NL     +G    W       LW +W  RN  VFN  L    + L   
Sbjct  1098  LRNQWINLISRKNLPPTGVEGQLAPW------ILWGIWTARNNLVFNDKLTSATETLSKA  1151

Query  754   RRCDSE-----TAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLK-LNTDGSC-TSDGQA  596
                  E     T ++      P Q H           K D  W + LN  G     +GQ 
Sbjct  1152  ISLAREWGTCQTISSPLPAVPPTQAH---ASPNCIVVKSDAAWNETLNVAGLGWVMEGQN  1208

Query  595   SCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVE  416
                      H       T       +     W         +E G  RI  E DS +LV+
Sbjct  1209  RTSSFSLPAH----HVRTPLAAEALALREAIWK-------CRELGFTRIRCESDSAVLVK  1257

Query  415   ALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
             ALK ++T       I+      A +F  + F  I R++N  AD LAK
Sbjct  1258  ALK-EDTFLTGLYGILIDIQALASSFECISFNWISRKKNVEADVLAK  1303



>gb|AAB82639.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1374

 Score =   173 bits (439),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 158/600 (26%), Positives = 248/600 (41%), Gaps = 48/600 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L DR+  ++ GW++  LS  G+  L K+V  A+P YTM    +PK +C +IE     F W
Sbjct  768   LKDRLGKKVLGWQSNFLSPGGKEILLKAVAMALPTYTMSCFKIPKTICQQIESVMAEF-W  826

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
              ++++ G   +   AW  ++  K  GGLG + +   N A + K  WR+ TE ++L AK  
Sbjct  827   WKNKKEGRG-LHWKAWCHLSRPKAVGGLGFKEIEAFNIALLGKQLWRMITEKDSLMAKVF  885

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              ++Y  +S         R  S AWK I   +  ++ G+  V+ NG++   W D W+ AKP
Sbjct  886   KSRYFSKSDPLNAPLGSRP-SFAWKSIYEAQVLIKQGIRAVIGNGETINVWTDPWIGAKP  944

Query  1432  LY-------EKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEE  1274
                        L        ++   +      R W W  +    P    E + +L    +
Sbjct  945   AKAAQAVKRSHLVSQYAANSIHVVKDLLLPDGRDWNWNLVSLLFPDNTQENILALRPGGK  1004

Query  1273  NTPDGWGWSPDPRGCFSVKSAY----------GWADNAARQEADKVWGLIWSLRVPARIS  1124
              T D + W     G +SVKS Y                 +   D ++  IW L VP +I 
Sbjct  1005  ETRDRFTWEYSRSGHYSVKSGYWVMTEIINQRNNPQEVLQPSLDPIFQQIWKLDVPPKIH  1064

Query  1123  MFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRT  944
              F+W   +  +        RH+   + C  C    E ++HL  +C      W  S     
Sbjct  1065  HFLWRCVNNCLSVASNLAYRHLAREKSCVRCPSHGETVNHLLFKCPFARLTWAIS----P  1120

Query  943   EESMRNLDWNSWLTMN----LKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPL  776
               +    +W   L  N    L   + Q  E          LW LWK RN+ VF       
Sbjct  1121  LPAPPGGEWAESLFRNMHHVLSVHKSQPEESDHHALIPWILWRLWKNRNDLVFKGREFTA  1180

Query  775   EQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEER-LSWEKPDEGWLKLNTDGSCTSD-G  602
              Q +  L+   +E   A+  R  P  +      +R + W+ P  GW+K NTDG+ + D G
Sbjct  1181  PQVI--LKA--TEDMDAWNNRKEPQPQVTSSTRDRCVKWQPPSHGWVKCNTDGAWSKDLG  1236

Query  601   QASCGGVLRDTHGNW----CRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIEC  437
                 G VLR+  G       R    +     + V A  W VL   R    +  RR++ E 
Sbjct  1237  NCGVGWVLRNHTGRLLWLGLRALPSQQSVLETEVEALRWAVLSLSR----FNYRRVIFES  1292

Query  436   DSKMLVEALKGKETGQEQNNNI--VRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALT  263
             DS+ LV  ++ +         I  +R  ++   +F  V F    RE N +AD+ A+ +L+
Sbjct  1293  DSQYLVSLIQNEMDIPSLAPRIQDIRNLLR---HFEEVKFQFTRREGNNVADRTARESLS  1349



>ref|XP_010495785.1| PREDICTED: uncharacterized protein LOC104772929 [Camelina sativa]
Length=1074

 Score =   172 bits (437),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 153/594 (26%), Positives = 254/594 (43%), Gaps = 62/594 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DRI  +   W  + LS AG++T+ KSVL A+P YTM    LPK +CS I+    RF W
Sbjct  513   IVDRIKQKGLSWSTRFLSSAGKLTMLKSVLAAMPSYTMSCFKLPKSLCSRIQSAFTRFWW  572

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               DE+    KM  +AWD +T     GGL  R++ T N A + K+ WR+ T+P+ L AK L
Sbjct  573   --DEKPTKKKMCWLAWDKMTKSLKDGGLEFRDIQTFNDAFLAKISWRILTQPSCLLAKIL  630

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  ++   L +      S+ WK I   R+ L+  L  +V  G+        WL+   
Sbjct  631   LGKYCKKT-HFLDSPAPFHASHGWKSICIGRDLLKPKLGMIVGTGEDIPISRTPWLS---  686

Query  1432  LYEKLRGTLGLP----ELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTP  1265
               ++     G P     +    +      + W    I++ LP  E E +  +  + +  P
Sbjct  687   -LDQPSAPFGPPTEENHMLRVSDLLQAHTKEWDVNLIRKTLPMYE-EAILKIKPSTKGGP  744

Query  1264  DGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGL----------------IWSLRVPA  1133
             D W W P   G ++ KS Y  +   ++   D+                    IW+++   
Sbjct  745   DLWAWLPTVDGIYTTKSGYHESLKPSQLPRDQELSSATQNENAENCFPWKKEIWNIKCSP  804

Query  1132  RISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQ  953
             +  + +W      +        R I +N  C +C G+ E   HLF  C     +W     
Sbjct  805   KTKLLLWKASQQALPVGSNLLARRINTNLTCPHC-GRPETELHLFFHCPYATVVWN----  859

Query  952   RRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLE  773
                                 K   ++ F+    E F + L  LW  RN  +FN+     E
Sbjct  860   --------------------KAPFKEVFKPEEVENFKSGL-TLWTTRNRLIFNKIQAQAE  898

Query  772   QKLD--WLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ  599
               L+  ++R  + + A     +  P Q  +R     L   +     +  +TD +  +DG 
Sbjct  899   DTLNLVFIRAKEWQEAQQVHPQENPSQ--SRVFPLSLRPAQIPSSRILCSTDAAWKNDGI  956

Query  598   ASCGGVLRD-THGNWCRGYT-YRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKM  425
               CG + ++ +     +G +  R+ R +  +AEA    + L +A E G  ++    DS++
Sbjct  957   TGCGWIFKNSSESTLLQGSSNSRLIR-SPLMAEAIATFKALGVAIESGFTQVQFASDSQL  1015

Query  424   LVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALT  263
             LV+AL  + + +E  + I+   +  A  F    F +I +  N+ AD LAK AL+
Sbjct  1016  LVQALNRRSSPKEI-HGIIYDALSLASQFDFCNFFYIPKNCNRQADALAKSALS  1068



>ref|XP_008367240.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=806

 Score =   171 bits (432),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 160/563 (28%), Positives = 234/563 (42%), Gaps = 69/563 (12%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW-G  1790
             D++ ARL GW  + LS AG+  L K+V   +P + M    LP GVC ++EK  R + W G
Sbjct  242   DKMEARLAGWSEQFLSQAGKEVLIKAVAMXLPNFAMSCFKLPIGVCRDMEKAVRSYWWRG  301

Query  1789  RDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLT  1610
               ++ G +  S   WD +   K+ GGLG +++   N A + K+GWRL   P +L A  L 
Sbjct  302   NSQKRGCHWAS---WDKLMKQKSAGGLGFKDIQCFNLAFLAKIGWRLIQNPTSLLANVLR  358

Query  1609  TKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLT----  1442
              KY +         + R+ S  WKGI   R  L+ G+   V +G+S     D WL     
Sbjct  359   DKY-YPGKCFKDAGKGRNTSWGWKGIFESRTVLQHGVRWRVGDGESINIRKDPWLPTPTT  417

Query  1441  --AKPLYEKLRGTLGLPELYATVNEYWDKV-RGWKWEKIQRYLPTEELERLASLCLTEEN  1271
               AKPL         L E+   V +  D + + WK   I      EE   + S+ L++  
Sbjct  418   FLAKPLDN-------LEEI--KVRDLIDPISKSWKEGVITEGFNREEARTILSIPLSKSG  468

Query  1270  TPDGWGWSPDPRGCFSVKSAYGWADNAARQEA---------------DKVWGLIWSLRVP  1136
               D   W     G +SVK+ YG A N     A               +  W  IW L+VP
Sbjct  469   CLDRLVWHYTVNGDYSVKTGYGVAMNMMENGALGKKGRGASSMLRKNNLTWKRIWKLQVP  528

Query  1135  ARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSL  956
              +I  F+W   +  +   +   RR I     C  C    E  +HLF +C    R W  S 
Sbjct  529   NKIKFFLWKCCNKALAVRHNLQRRQIRVENICGVCNTFDESENHLFFQCDFSHRFWFGSP  588

Query  955   QRRTEESMRNLDW-NSWLTMNLKGDRQQGFEEGWPE-RFGTRLWWLWKWRNEAVFN----  794
                    +   D+  +W  +          EE   E  FG  LW LWK RN+ VFN    
Sbjct  589   LHINSHELAGADFLENWDKICTSTKNMDKAEEILQEVAFG--LWRLWKNRNDVVFNGVHR  646

Query  793   ----------RNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEE--RLSWEKPD  650
                       +N+    + L    +C+ +           L  +N   E+  RL W KP 
Sbjct  647   QHLEVMMLWRKNIYEFREALSLSLKCEDQ-----------LISNNLKTEQSPRLHWTKPK  695

Query  649   EGWLKLNTDGS-CTSDGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQ-GLRM  476
              G +K+NTD + C S  +   G V RD  G            C S  A     ++  L  
Sbjct  696   FGTIKVNTDAAWCXSSLRTGVGWVGRDFAGLLQFAGGSGTSICHSAAAAEACAIRSALVS  755

Query  475   AKEYGARRIMIECDSKMLVEALK  407
               E G  +++IE D+  +++ L+
Sbjct  756   XIENGCDKVIIESDALGIIKMLR  778



>ref|XP_008382376.1| PREDICTED: uncharacterized protein LOC103445169 [Malus domestica]
Length=1330

 Score =   172 bits (437),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 154/591 (26%), Positives = 236/591 (40%), Gaps = 40/591 (7%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             RI  +L+GWK   LS AG+  L K+V+ AIP Y M     P  +C E++    +F W  D
Sbjct  724   RILGKLQGWKQXMLSRAGKEVLIKAVVQAIPAYPMNIFKFPATLCKELDALIAKFWW--D  781

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
             +     K+  V+ + +   K  GG+G RN    N A + K  WRL  EP++LWA+ +  +
Sbjct  782   DSGVRRKIHWVSMETLGLPKHLGGMGFRNFQEFNDALLAKQCWRLIAEPDSLWAQVMKAR  841

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y     S L  ++    S AW  +   R+ +  G    +  G+  R W+D WL A  L  
Sbjct  842   YFPNC-SFLDASKGGRASWAWSSLLVGRDLILKGAHWQIMGGEEVRLWVDRWLPA--LXS  898

Query  1423  KLRGTLGLPELYATVNEYWDKV-----RGWKWEKIQRYLPTEELERLASLCLTEENTP--  1265
                  LG  E+  T N     +     R W  E +  +L   E    A++C T    P  
Sbjct  899   GHPSPLG--EVAVTRNTRVSXIICPSSRTWDLEFLLPFLSAGE---CAAICDTPIGNPRR  953

Query  1264  -DGWGWSPDPRGCFSVKSAYGW-----------ADNAARQEADKVWGLIWSLRVPARISM  1121
              D   W+    G +SVK  Y W               +R   + +W  IW ++VPA++  
Sbjct  954   KDRLIWASTRNGIYSVKXGYLWLQLHSLSLRBHCSPXSRSVPELLWKGIWRIKVPAKVRN  1013

Query  1120  FIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTE  941
             F+W   H  + T     +R  +       C  Q E + HLF  C  V  IW     +   
Sbjct  1014  FLWSSLHNALATVAVLFQRRSSLTPIXPICLCQEESIVHLFLSCPWVISIWSGGALKYNI  1073

Query  940   ESMRNLDWNSWLTMNLKGDRQQGFEEGWPERF-GTRLWWLWKWRNEAVFNR-NLLPLEQK  767
                    W +WL      +      + W   +     W +WK R + VFN+ +++P +  
Sbjct  1074  LVGSLSSWGAWLHDVFTSNLGSSASKEWVRTYVAFTCWHIWKSRCDYVFNQVHIIPSKI-  1132

Query  766   LDWLRRCDSETAAAFEERHWP-LQRHNRGGEERLS--WEKPDEGWLKLNTDGSCTSDGQA  596
                L   D   A     R  P + R    G  R    W  P   ++KLN D S +   +A
Sbjct  1133  ---LMGIDLXVAEFLIARSTPEISRAVDHGRVRQPCRWTPPVSPFVKLNVDASWSRVSKA  1189

Query  595   SCGGVL-RDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLV  419
                 V  RD  G++     Y I      +AE   + +G  +A       +++E DS   +
Sbjct  1190  GFAAVXARDARGDFIAAVRYPIFASCVAMAEVLALXRGCELAVSLNISSVIVESDSLESI  1249

Query  418   EALKGK-ETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWA  269
               L      G  +    +       E+F    +  + R  N  AD LA + 
Sbjct  1250  SCLSNSLLNGNXEAYPFLANAWDLGESFQDCRWSWVPRSANMAADSLASFG  1300



>ref|XP_006367640.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum 
tuberosum]
Length=1035

 Score =   172 bits (435),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 166/638 (26%), Positives = 261/638 (41%), Gaps = 85/638 (13%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++ +I+ R+  W  + L+  G+  L  +VL ++P+Y +     PK V  +I +   +F W
Sbjct  232   MVQKIAKRILTWHNRFLTFGGKWILINNVLQSMPVYMLSALKPPKKVLDQIHQIFAKFFW  291

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G     G      VAW  +   KT GGLG R+LH MN+A   KL W  +    +LW K +
Sbjct  292   G--NLGGIKGKHWVAWGDLCYPKTEGGLGFRSLHNMNKALFAKLWWNFRVSTTSLWVKYM  349

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  +   H V       S  W+ + + RE +E  +   ++ G S+ FW D+W     
Sbjct  350   WNKYCKK--LHPVVATSLGASQVWRKMISIREEVEHDIWWQIKAGNSS-FWFDNWTRQGA  406

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLC---LTEENTPD  1262
             LY          EL     +Y+    GW   K++  L  E +E +        +EE    
Sbjct  407   LYYTEGDCAQEEELEV---QYFITNDGWDETKLKDLLSEEMVEHIILNIRPKTSEEGIDK  463

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTN  1082
              W W  +  G F+VKSAY       R+E ++    +W   +P +IS F+W V   ++ T 
Sbjct  464   AW-WCGNLTGLFTVKSAYHRI--RGRKEEEEWRRYMWIKGMPIKISFFLWRVWRRKIATY  520

Query  1081  YERTRRHITSNEYCYNCA-GQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWL  905
                 R  I     CY C  G+ E + HL        ++W+               + S+ 
Sbjct  521   DNLKRMKIPVVSKCYCCKEGEMETMTHLLLTAPIAQKLWKQ--------------FASYA  566

Query  904   TMNLKG-DRQQGFEEGWPERFGTRL------------WWLWKWRN------EAVFNRNLL  782
              + + G + QQ   + W  +   +L            W LWK RN      E  +N    
Sbjct  567   GIIINGLNLQQLIFKWWDYKASNKLSQILKAVLAVIMWELWKRRNSYRHGKETTYNNMYY  626

Query  781   PLEQKLDWLRRCDSETAAAFEERHWP-----LQRHNRGGEERLS-WEKPDEGWLKLNTDG  620
               +  L  L              HWP     LQ +      ++  W KP EGW+  NTDG
Sbjct  627   QCQLILYQLVTIKFPWIKGL-TYHWPQVVGMLQNYKPPLHYKVVRWRKPSEGWVTCNTDG  685

Query  619   SCTSDGQ-ASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMI  443
             +   + + +S G  +RD +G+      + IG  T+  AEA  V + L+   E G R++ +
Sbjct  686   ASKGNPRMSSYGYCIRDKNGDLLYAEAHNIGETTNMEAEATTVWKALQFCYENGLRKVRL  745

Query  442   ECDSKMLVEALKGKETGQEQNNNIVRRC-------------IKEAENFLAVVFLHIYREQ  302
             E DS  L               N++ R              I E    + V   H+YRE 
Sbjct  746   ETDSLAL--------------QNMITRSWKIPWELVEKLEEIHEIMQQIDVQVCHVYREV  791

Query  301   NKLADKLAKWALTTQGG--LHIFEVPPGEFEVRMALDR  194
             N+LAD +A   + T+     H F   P   +  + +D+
Sbjct  792   NQLADFIANTTINTEHKKVFHHFHQLPSLGKKLLNIDK  829



>ref|XP_008354602.1| PREDICTED: uncharacterized protein LOC103418244 [Malus domestica]
Length=1384

 Score =   172 bits (436),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 163/632 (26%), Positives = 250/632 (40%), Gaps = 54/632 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L D+   +L GWK K LS+AGRV L +SV  ++ +++      P  +   + +  R FIW
Sbjct  776   LADKAKXKLTGWKGKLLSMAGRVQLTQSVFQSMLLHSFSVYKWPSSLLRPLSRCARNFIW  835

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D      K   V+   I   K  GGLGLR+L ++N   ++KLGW + T  ++ W+  L
Sbjct  836   SXDVTX--KKSVTVSXRQICAPKBEGGLGLRDLGSLNTXALLKLGWLIITT-DSPWSIYL  892

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               ++      +  + +R SI   W GI +    L      V+ NG +T  W+D WL   P
Sbjct  893   RERFKLHGRLYSCSYKRSSI---WPGIKSILHILFQNCRWVIGNGSTTSLWVDKWLDX-P  948

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPT--EELERLASLCLTEENTPDG  1259
             + + +  T     L  T  +  + +R  KW     +  T  +  + +  + L  +   D 
Sbjct  949   IVDVVGATEIAXSLSRT--KVSNIIRMGKWVIPXXFSSTFPDLTKXILEMPLPIDEDKDV  1006

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWG-LIWSLRVPARISMFIWLVKHGRVLTN  1082
               W     G FS    Y   +    +   K W  +IW   +P R S+ +W +   ++ T 
Sbjct  1007  LIWEVSTSGVFSFSDGY---EIVRHRFPVKSWASIIWRPFIPPRYSILVWKILFNKLPTX  1063

Query  1081  YERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWLT  902
                 RR I     C  C    E +DHLF  C      W     +           +    
Sbjct  1064  DXLQRRGIPLAPICQLCHKNSESIDHLFSSCEFAXCAWXWLATQFGTIIPXTXSJSDLXL  1123

Query  901   MNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAF  722
             + L           W       L  +WK RN+  F       E K     R    T+   
Sbjct  1124  VFLSKRFSPHLRNVWJASGFFLLMAIWKMRNKVKF-------EGKPPSFSRLCXSTSXWI  1176

Query  721   EERHWPLQRHNRGGEER--------------------LSWEKPDEGWLKLNTDGSCTSD-  605
              +       H RG  +R                    + W  P   W+K+NTDG    + 
Sbjct  1177  RQVGALTPXHVRGILDRQLLVSLGISPNSCKAPSIVPVXWHXPPFSWVKVNTDGLAKGNP  1236

Query  604   GQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKM  425
             G A+CGGV RD+ G +  G++  +G  TS  AE   V+  + +A   G + + +E DS  
Sbjct  1237  GPAACGGVXRDSAGYFLGGFSLSLGHRTSFYAELHAVILAVELAHARGWQNLWLESDSSS  1296

Query  424   LVEALKGKETG-----QEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTT  260
             ++              Q + NN    C    +N +     HI+RE N +ADKLA   L +
Sbjct  1297  VISCFAXGSFSPPWSLQTRWNN----CTLHLQN-MXFRCSHIFREXNVVADKLANLGLLS  1351

Query  259   QGGLHIFEVPPGEFEVRMALDRLGASSPRRVS  164
                L     PP E    +  D LG  + R VS
Sbjct  1352  S-SLVWHSTPPIEILXPLHSDFLGMPTYRFVS  1382



>gb|AAM18736.1|AC092548_14 putative reverse transcriptase [Oryza sativa Japonica Group]
Length=1509

 Score =   172 bits (436),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 150/542 (28%), Positives = 225/542 (42%), Gaps = 80/542 (15%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +RI  R++GWK K LS AG+  L K+V   IP + M    L K +C +I K   ++ W
Sbjct  969   LKERIWQRIQGWKEKLLSRAGKEILIKAVAQVIPTFAMGCFELTKDLCDQISKMIAKYWW  1028

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                E+  +NKM  ++W+ +T  K  GGLG R+++  N A + K GWRL  +P++L ++ L
Sbjct  1029  SNQEK--DNKMHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVL  1086

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----  1445
               KY    G      +  ++S  W+ I      L++G+   V +G     W D W+    
Sbjct  1087  RAKYFPL-GDCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRVGDGSKINIWADPWIPRGW  1145

Query  1444  TAKPLYEKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENT  1268
             + KP+    RG      L   V E  D   G W  + + +    E++  + S+ +  E  
Sbjct  1146  SRKPMTP--RGA----NLVTKVEELIDPYTGTWDEDLLSQTFWEEDVAAIKSIPVHVE-M  1198

Query  1267  PDGWGWSPDPRGCFSVKSAYGWADNAARQEA--------------DKVWGLIWSLRVPAR  1130
              D   W  D RGCF+VKSAY       R+ +              D  W  +W L VP +
Sbjct  1199  EDVLAWHFDARGCFTVKSAYKVQREMERRASRNGCPGVSNWESGDDDFWKKLWKLGVPGK  1258

Query  1129  ISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQR  950
             I  F+W + H  +        R +  +  C  C    ED  HLF +C  V ++W    Q 
Sbjct  1259  IKHFLWRMCHNTLALRANLHHRGMDVDTRCVMCGRYNEDAGHLFFKCKPVKKVW----QA  1314

Query  949   RTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTR----LWWLWKWRNEAVFNRNLL  782
                E +R++     L     G          PE   T     LW  WK RNE        
Sbjct  1315  LNLEELRSM-----LEQQTSGKNVLQSIYCRPENERTSAIVCLWQWWKERNE--------  1361

Query  781   PLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-  605
                                        ++  R GE  + W +P   ++K+NTDG+ +S+ 
Sbjct  1362  ---------------------------EKSPRTGECAV-WRRPPLNFVKINTDGAYSSNM  1393

Query  604   GQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIECDSK  428
              Q   G V+RD  G   +              AE       ++ A E G  RI +E DS 
Sbjct  1394  KQGGWGFVIRDQTGAVLQAGAGPAAYLQDAFHAEVVACAAAIKTASERGMSRIELETDSM  1453

Query  427   ML  422
             ML
Sbjct  1454  ML  1455



>ref|XP_007217321.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
 gb|EMJ18520.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
Length=1275

 Score =   172 bits (436),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 158/608 (26%), Positives = 249/608 (41%), Gaps = 69/608 (11%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +R+  +L+GW+ +TLS+AG+  L K V  +IP+Y M    LP+G+C EIE+   RF W
Sbjct  706   LKERVWKKLQGWREQTLSIAGKEVLLKVVAQSIPLYVMSCFLLPQGLCHEIEQMMARFWW  765

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +Q  N K+  + W+ +   KT GG+G R L   N A + K GWRL   P++L ++ L
Sbjct  766   G--QQGENRKIHWMRWERLCKAKTEGGMGFRCLQAFNMAMLAKQGWRLVHNPHSLASRLL  823

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY  ++     T   R  S  WK I   R+ LE G    + +GKS R W D W+    
Sbjct  824   KAKYFPQTNFWEATLGSRP-SCVWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPA  882

Query  1432  LYEKLRGTL-GLPELYATVNEYWDKVRGWKWEKIQR-YLPTEELERLASLCLTEENTPDG  1259
              +  +   L G+     +     +    W  +K+   +LP + ++ +  + L+    PD 
Sbjct  883   TFAVITSPLDGMENTKVSELICNEGSPQWDLQKLNNLFLPVDVVD-IVRIPLSIRAPPDR  941

Query  1258  WGWSPDPRGCFSVKSAYGWA----------DNAARQEADKVWGLIWSLRVPARISMFIWL  1109
               W+ D  G F+VKSAY  A           +++  +   +W  IW+  VP ++ +F W 
Sbjct  942   IVWNYDKHGLFTVKSAYRVALRVTSGDEDESSSSNSDTGMLWRHIWNATVPTKLKIFAWR  1001

Query  1108  VKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMR  929
             V H  + T     ++ +   + C  C    E   H+   C      W  SL  R      
Sbjct  1002  VAHDILPTKANLIKKGVDMQDMCMFCGDITESALHVLAMCPFAVATWNISLLTR------  1055

Query  928   NLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRR  749
                 ++   +        GF + +   F T            V +R   P+        R
Sbjct  1056  ----HAHQGVQRSPHEVVGFAQQYVHEFITA-----NDTPSKVTDRVRDPVRWAAPPSGR  1106

Query  748   CDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDT  569
                    AF+            G E +       G +  + DG   +    S G VL   
Sbjct  1107  LKFNFDGAFDP---------TSGREAV-------GVVARDADGGFVAAVAKSVGEVLSAE  1150

Query  568   HGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQ  389
             H                  AE     +G+ +A   G    + E DS ++V A+  K  GQ
Sbjct  1151  H------------------AEILVAREGVALALSLGTASPIFEGDSAVVVSAI--KRAGQ  1190

Query  388   EQNN--NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFE  215
             + +N   IV       + F + +F    RE N +A +LA++ L        FEVPP   +
Sbjct  1191  DYSNIGTIVEDVKHLQQQFPSSLFQFTPREANGVAHRLARFGLHNVDNFIWFEVPPDLIQ  1250

Query  214   VRMALDRL  191
               +  D L
Sbjct  1251  DALLCDVL  1258



>ref|XP_010462630.1| PREDICTED: uncharacterized protein LOC104743220 [Camelina sativa]
Length=746

 Score =   169 bits (429),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 159/587 (27%), Positives = 255/587 (43%), Gaps = 43/587 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D+I  R   W ++TLS AG+  L KSVL+++P Y M    LP  +C  I+    RF W
Sbjct  176   IVDKIRQRSHSWSSRTLSEAGKQVLLKSVLSSMPSYAMTCFKLPGSLCKRIQSVLTRFWW  235

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D++    KMS VAW  +T  K  GGLG R++   N A + K+ WRL  EPNTL A+ L
Sbjct  236   --DDKPDKQKMSWVAWTKLTRPKNAGGLGFRDMERFNDALLAKIAWRLLKEPNTLLARVL  293

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL-TAK  1436
               KY H S S +  +   + S+ W+ I A R  ++ G   ++ NG+S + W D WL T  
Sbjct  294   LGKYCH-SYSFMECSIPSNPSHGWRSIMAGRNVIKQGAGWLIGNGESVKIWRDPWLSTTT  352

Query  1435  PLYEKLRGTLGLPELYATVNEYWD-KVRGWKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
             PL     G +   +   TV+   D     W W KI+  LP + ++ +  + L      D 
Sbjct  353   PLCP--YGPIREHQEGETVSSLLDPSTNQWNWSKIREELP-QYVDCIKQIPLAPSRREDQ  409

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVW---GLIWSLRVPARISMFIWLVKHGRVL  1088
               W P   G ++ +S YG        +A   +     +W L    ++  F+W      + 
Sbjct  410   LVWLPVKSGQYTTRSGYGITSTFDIPDAALNFNWQSHLWKLHTSPKVKNFLWKAMSDALP  469

Query  1087  TNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS----LQRRTEESMRNLD  920
                +  RR + +   C +C G+ E + HL   C     +W  +    L+  +  ++ +  
Sbjct  470   VGEQLARRGLNAEVTCRSC-GETESVSHLLLHCRRAKEVWLKAPILHLEISSTTTIEDFL  528

Query  919   WNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDS  740
               +    NL      G  +G  E +    W L   RN  VF    +P+    D L R   
Sbjct  529   SLAKHKCNLP---PSGVSKG--ELYPWIRWQLSLARNSLVFEDKEIPVS---DILIR---  577

Query  739   ETAAAFEERHWPLQRHNRGGEERLSWEKPDE----GWLKLNTDGS-CTSDGQASCG-GVL  578
                A    R W  +  N     RL+ ++P++       K+  D +  ++ G    G  V+
Sbjct  578   ---AIKSAREWQ-EAQNMLTTPRLTTDQPEQPVQTSSCKVFVDAAWNSTTGNGGFGWAVV  633

Query  577   RDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKE  398
                     R   ++    ++ +AEAW V   L+ +       + +  D + L+      E
Sbjct  634   NADSAYEERFSDHKESIGSALIAEAWAVFLALKHSLLLNKTELQLFSDCQSLI-----NE  688

Query  397   TGQEQNNNIVRRCIKEA-ENFLAVVFLHIYREQNKLADKLAKWALTT  260
              G       + + I+E   +F A+ F  I R  N +AD LAK AL +
Sbjct  689   DGFHIELFGLLQDIRELRSSFDAISFTFIPRLANHVADSLAKEALAS  735



>ref|XP_008367994.1| PREDICTED: uncharacterized protein LOC103431605 [Malus domestica]
Length=1647

 Score =   172 bits (436),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 166/595 (28%), Positives = 252/595 (42%), Gaps = 39/595 (7%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             D+I A + GW  + LS AG+  L K+V  A+P Y M    LP GVC ++E+  R + W  
Sbjct  773   DKIEAXMSGWAEQFLSQAGKEILVKTVAMALPNYAMSCFKLPIGVCRDVERAIRNYWWRG  832

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
             +EQ     +  ++ D +   K  GGLG +++  +N A + K+GWR+   P +L A  L  
Sbjct  833   NEQ--RKGIHWISXDRLMKQKKAGGLGFKDIQCVNLAFLAKIGWRITLNPMSLLASVLRD  890

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             KY     S     + ++ S  WKG+   R+ L  GL   V NGKS     D W   KP  
Sbjct  891   KYFP-GKSFGEXPKGKNTSXGWKGLFEARKVLNLGLRWRVGNGKSINIREDPWF-PKPAT  948

Query  1426  EKLRGTLGLPELYATVNEYWDK-VRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGW  1250
              K+R    L E    V++  D   + W+ + I      +++  +  + L+   + D   W
Sbjct  949   FKVRPRNNLVE--TMVSDLIDSDTKIWRTDLIANGFHRDDVSTILIIPLSHAGSNDRLVW  1006

Query  1249  SPDPRGCFSVKSAYGWA----DNAA--------RQEADK---VWGLIWSLRVPARISMFI  1115
                  G +SVKS Y  A    D+ A          E++K   VW  IW L+VP +I +FI
Sbjct  1007  HYATNGIYSVKSGYSMALKLMDDXALGRKXXGNPSESNKLKMVWNNIWRLQVPHKIRIFI  1066

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEES  935
             W   +  +       RRH+  +  C  C    E  +HLF RC      W  S        
Sbjct  1067  WRCCNNALAVRRNLKRRHMRVDNVCGVCXAVNETENHLFFRCEISHVFWFCSPLHLNSHV  1126

Query  934   MRNLDW-NSWLTM-NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLD  761
             +   D+  SW    +   DR    +      FG  LW LWK RN+ VF        Q LD
Sbjct  1127  LEGRDFLESWCNFCDQVKDRIDADDIXHDFAFG--LWRLWKNRNDVVFKG---IYRQPLD  1181

Query  760   WL---RRCDSETAAAFE---ERHWPLQRHNRGGEERL--SWEKPDEGWLKLNTDGS-CTS  608
              L   ++   E  A+     E H           +R+   W++P  G +K+NTD + C  
Sbjct  1182  ILEAWKKSTGEYKASLAPDXEDHSLRMPKXIXVSDRICTKWKRPRFGTIKINTDAAWCKD  1241

Query  607   DGQASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQ-GLRMAKEYGARRIMIECDS  431
               +   G + RD  G          G   S  A     ++  L    ++G   I+IE D+
Sbjct  1242  TLRMGVGWLGRDFAGLLQXAGGSGTGFSHSAAAAEASAIRFALLSCIDHGFDDIIIESDA  1301

Query  430   KMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
               ++  LK +         I+      A+   +V F  + RE N+ A  +AK+  
Sbjct  1302  STIIXMLKKEILVDFSIECILDDIEXLAQKLRSVSFAFVPREGNRAAHSVAKYVF  1356



>ref|XP_009138589.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=739

 Score =   169 bits (429),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 152/620 (25%), Positives = 267/620 (43%), Gaps = 56/620 (9%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L DR+  R++GW+ + LS AG+  + K+V  A+P YTM    LPK VC +I        W
Sbjct  119   LKDRMRERVQGWQTRFLSPAGKEVMLKAVALALPTYTMACFLLPKTVCKKIVSIMSEVWW  178

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                ++S    +   +WD +   K  GGLG +++   N A + K  WR+ +  ++L  +  
Sbjct  179   KNKQES--RGIYWKSWDQMCKRKENGGLGFKDIEAFNLALLGKQLWRMLSVKDSLLTRVF  236

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              ++Y  +S         R  S AW+ I A ++ ++ G   ++ +G+ T+ + DSW+  +P
Sbjct  237   KSRYFAKSDPLSAGLGSRP-SYAWRSIHAAQKLIQQGARVLIGSGEDTKVFQDSWIGQQP  295

Query  1432  L-------------YEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLAS  1292
                            + LR  L + EL        ++ R W  E + R  P +E   ++ 
Sbjct  296   ARRAQVVRWNSRDSRQYLRHNLRVRELLI------NQGREWNMELLTRLFPDDEARNISK  349

Query  1291  LCLTEENTPDGWGWSPDPRGCFSVKSAY----GWADNAARQEADK-----VWGLIWSLRV  1139
             +      + D + W  + +G ++VKS Y       D +A  E D+     ++ L WS   
Sbjct  350   IRTCGNGSKDIYIWDYNKKGHYTVKSGYWVQVNVLDRSAAVEIDQPSLDHLFQLAWSTET  409

Query  1138  PARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS  959
               ++  F+W      +       RRHI     C  C    E ++H+  +C     +W  S
Sbjct  410   SPKVHHFLWRCISNLLPVAGNLARRHIAKEAGCLRCGCDTETVNHVLFQCPFARLVWALS  469

Query  958   LQRRTEES--MRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRN-  788
                   E   M +L  N +  +N+K +  +  E+   E     LW LWK RNE +F    
Sbjct  470   PIPAPPEGIIMNSLYSNIYHALNIKKEYPR--EDIQAEIVPWILWRLWKNRNELLFKGKE  527

Query  787   ------LLPLEQKL-DWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLN  629
                   +L   + L DW  RC +E  AA +       +      +  +W+ P   W K N
Sbjct  528   FEAGSLILKAREDLEDWQGRCQAEITAAEKNE----AKRATTSVQTHTWKPPPTDWFKCN  583

Query  628   TDGSCTSDGQAS-CGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGAR  455
             +DG+   + + S  G + RD  G+        + +  S++  EA  +  G      +G +
Sbjct  584   SDGAWHQNRETSGLGWICRDASGHVLWAGARAVTKMDSSILTEAEALRWGAETLAGFGYK  643

Query  454   RIMIECDSKMLVEALKGKE---TGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADK  284
              ++ E DS  LV+ + G E      +    ++R  +   +++    +    R  NK AD+
Sbjct  644   NVIFETDSLSLVKMINGNEEVWPVLQPTVEMIRHALLRIQSYEVRFYP---RGGNKAADR  700

Query  283   LAKWALTTQGGL-HIFEVPP  227
             +AK  +T    +  ++ V P
Sbjct  701   IAKETITFVSNVPKLYSVVP  720



>ref|XP_008351907.1| PREDICTED: uncharacterized protein LOC103415345 [Malus domestica]
Length=1736

 Score =   172 bits (436),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 158/589 (27%), Positives = 245/589 (42%), Gaps = 60/589 (10%)
 Frame = -1

Query  1966  DRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGR  1787
             +R+  R+ GW  + LS+AG+  L KSV  A+P YTM    LP  +  EIE+   RF W R
Sbjct  1164  NRLDERINGWAEQFLSMAGKEVLIKSVAAALPXYTMSCFQLPIHLAKEIEQVIARF-WWR  1222

Query  1786  DEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTT  1607
             D+++    +  + W+ +   K  GGLG R +   N A + K+GWRL +   +  A+ L  
Sbjct  1223  DQRT-KKGIHWMTWNKVAXKKVYGGLGFREIIDFNLAMLAKVGWRLISNXGSJLARVLQA  1281

Query  1606  KYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLY  1427
             KY+  S S L        S  WKGI   R+ L++G+   V +    +   D WL   P+ 
Sbjct  1282  KYYP-SSSFLDAPVGXGTSWGWKGILQGRKILKAGVRWRVGDXTCIQIGKDPWL---PIP  1337

Query  1426  EKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWS  1247
                R T    E+   V +  D    WK E I+     +E + + S+ ++    PD   W 
Sbjct  1338  RTFRPTSRHEEMPIFVADLVDMEGMWKREVIELCFSEDEAKTILSMPISRFGCPDRVVWH  1397

Query  1246  PDPRGCFSVKSAY---------------GWADNAARQEADKVWGLIWSLRVPARISMFIW  1112
                 G +SVKS Y               G   ++     D VW  IWSL+VP ++  F W
Sbjct  1398  YTRNGVYSVKSGYIVAQEMNKNXELGRKGVGQSSVDDNRDMVWRDIWSLKVPPKLCHFXW  1457

Query  1111  LVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESM  932
                   +       RR +  +  C  C              ++V+  W ++   +  E+ 
Sbjct  1458  KGCKNILAXXMNLQRRGVRLDINCPFCD-------------NEVETQWLYAKYSKEGEAS  1504

Query  931   RNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLR  752
               L W                           LW LWK RN  VF +  +     +  L+
Sbjct  1505  DLLXWXV-----------------------GGLWRLWKCRNSLVFEKVAVDPLTAIHLLK  1541

Query  751   RCDSETAAAFEERHWPLQRHNRG-GEERLSWEKPDEGWLKLNTDGS-CTSDGQASCGGVL  578
             +   E   + E +  PL R           W KP  G LK+N DG+ C+       G V 
Sbjct  1542  QQWEEWVISDEAQVQPLSRGQLVRAPXPHQWIKPPFGTLKVNCDGAWCSRTXIGGVGWVA  1601

Query  577   RDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK  401
             RD  G +         +C S++ AEA  +   L      G   I +E DS++LV+ + G+
Sbjct  1602  RDFVGIFNGAGGXGNMQCVSSIMAEAEALRVALVACVAKGFTXIQLETDSQVLVDMIXGR  1661

Query  400   ETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQG  254
                +   + I+       + F+A+ FL+  R  NK A  +A +A+  +G
Sbjct  1662  IQPEVILDGILWDISILKQQFVAIEFLYTPRACNKAAHMVASYAVRMRG  1710



>ref|XP_004954924.1| PREDICTED: uncharacterized protein LOC101756955 [Setaria italica]
Length=1203

 Score =   172 bits (435),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 149/601 (25%), Positives = 253/601 (42%), Gaps = 66/601 (11%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+DR++ R+ GWK KTLSL G+  L KS+  A+P+Y M    +PK +C  I     ++ W
Sbjct  634   LIDRVNTRINGWKEKTLSLGGKEILIKSIAQAVPVYAMMVFQIPKSICKGITNAISQYWW  693

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G D++  + +M    W  +   K +GG+G R+L + N A + K  WRL  EP +L A+ L
Sbjct  694   GDDDE--HRRMHWQEWWKMCLPKDKGGMGFRDLQSFNLAMLAKQAWRLLCEPESLCARVL  751

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y+  +G  L    +   S  W+ I A  E  + G    V +G     W D+W+    
Sbjct  752   RARYYP-NGKLLQARNKNGSSFTWQSILAGLECFKHGYIWRVGDGTQINIWEDNWIPGSH  810

Query  1432  --LYEKLRGTLGLPELYATVNEYWDKV-RGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
                 +  RG      L +TV+E  + +   W  + ++      ++ R+  +  T     D
Sbjct  811   NLKIQTARGN----NLVSTVDELINPITMQWDVDLLKAIFWPTDVYRIRQIP-TTLGRED  865

Query  1261  GWGWSPDPRGCFSVKSAYGWA-DN----------AARQEADKVWGLIWSLRVPARISMFI  1115
                W  +  G FSV+SAY    DN          A+    +++W  +W ++VP +I +F 
Sbjct  866   VVAWHYNRSGRFSVRSAYHCQWDNKYGQRHHQVQASFASGNQLWKKLWRMKVPGKIKIFG  925

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEES  935
             W    G V        RHI     C  C    ED+ HL   C     +W+    R   + 
Sbjct  926   WRALKGLVPCRAILANRHIGQLGGCPVCQNGAEDIKHLLFTCDRAREVWQALGVRERLQY  985

Query  934   MRNLDWNSWLTMNLKGDRQQGFEE---GWPERFGTRLWWLWKWRNEAVFNRNL-LPLEQK  767
                +D +  + ++    R++  +    G  E   T  W+LW  R + V    + LP    
Sbjct  986   YLTIDRSGSVVIDEIIRREELIDTLNVGLAELVLTAGWYLWWERRQIVHGEEVQLPARSA  1045

Query  766   LDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCG  587
             +         + AA  + +    +  +GG                            S G
Sbjct  1046  M---------SIAALTKNYQNAMK--KGG----------------------------SVG  1066

Query  586   GVLRDTHGN-WCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEAL  410
              ++RD++G      ++Y      + +AEA+ + +GL +A+  G  R++++ D   +V+ +
Sbjct  1067  SIIRDSNGGILAAAHSYLPHLIDAPMAEAYALKEGLMLAQHIGCNRLIVQSDCMEVVQIM  1126

Query  409   KGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVP  230
             +           I   C      F  +   H YRE N+ A  LA+ A+ T+      + P
Sbjct  1127  RDGGFTANSAAPIYDECNIVWNGFQEISIEHCYREANQAAHLLARRAMQTKQNCIWDDEP  1186

Query  229   P  227
             P
Sbjct  1187  P  1187



>gb|AAP53315.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1505

 Score =   172 bits (435),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 150/542 (28%), Positives = 225/542 (42%), Gaps = 80/542 (15%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +RI  R++GWK K LS AG+  L K+V   IP + M    L K +C +I K   ++ W
Sbjct  965   LKERIWQRIQGWKEKLLSRAGKEILIKAVAQVIPTFAMGCFELTKDLCDQISKMIAKYWW  1024

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                E+  +NKM  ++W+ +T  K  GGLG R+++  N A + K GWRL  +P++L ++ L
Sbjct  1025  SNQEK--DNKMHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVL  1082

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----  1445
               KY    G      +  ++S  W+ I      L++G+   V +G     W D W+    
Sbjct  1083  RAKYFPL-GDCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRVGDGSKINIWADPWIPRGW  1141

Query  1444  TAKPLYEKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENT  1268
             + KP+    RG      L   V E  D   G W  + + +    E++  + S+ +  E  
Sbjct  1142  SRKPMTP--RGA----NLVTKVEELIDPYTGTWDEDLLSQTFWEEDVAAIKSIPVHVE-M  1194

Query  1267  PDGWGWSPDPRGCFSVKSAYGWADNAARQEA--------------DKVWGLIWSLRVPAR  1130
              D   W  D RGCF+VKSAY       R+ +              D  W  +W L VP +
Sbjct  1195  EDVLAWHFDARGCFTVKSAYKVQREMERRASRNGCPGVSNWESGDDDFWKKLWKLGVPGK  1254

Query  1129  ISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQR  950
             I  F+W + H  +        R +  +  C  C    ED  HLF +C  V ++W    Q 
Sbjct  1255  IKHFLWRMCHNTLALRANLHHRGMDVDTRCVMCGRYNEDAGHLFFKCKPVKKVW----QA  1310

Query  949   RTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTR----LWWLWKWRNEAVFNRNLL  782
                E +R++     L     G          PE   T     LW  WK RNE        
Sbjct  1311  LNLEELRSM-----LEQQTSGKNVLQSIYCRPENERTSAIVCLWQWWKERNE--------  1357

Query  781   PLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSD-  605
                                        ++  R GE  + W +P   ++K+NTDG+ +S+ 
Sbjct  1358  ---------------------------EKSPRTGECAV-WRRPPLNFVKINTDGAYSSNM  1389

Query  604   GQASCGGVLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIECDSK  428
              Q   G V+RD  G   +              AE       ++ A E G  RI +E DS 
Sbjct  1390  KQGGWGFVIRDQTGAVLQAGAGPAAYLQDAFHAEVVACAAAIKTASERGMSRIELETDSM  1449

Query  427   ML  422
             ML
Sbjct  1450  ML  1451



>ref|XP_009118503.1| PREDICTED: uncharacterized protein LOC103843513 [Brassica rapa]
Length=732

 Score =   169 bits (427),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 113/347 (33%), Positives = 174/347 (50%), Gaps = 25/347 (7%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             +LDRI  +   WK + LS AG+  L K+VL A+P YTM    +P  +C +I+    RF W
Sbjct  198   ILDRIRQKTLSWKNRFLSGAGKEILLKAVLTAMPAYTMSCFKIPLSLCKQIQSLLTRFWW  257

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D      KM  VAWD +T  K  GGLG  ++ T N A + K+GWRL   PN+L A+ L
Sbjct  258   --DANPEQKKMCWVAWDTLTLPKYAGGLGFWDIETFNDALLAKIGWRLIHSPNSLLAQVL  315

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK-  1436
               KY  R  S L  T   S+S+ W+GI A RE L+ GL  +V +G+  R W D WL+   
Sbjct  316   LGKY-ARYTSFLDCTAPSSMSHGWRGILAGREILKKGLGWIVGSGEKIRVWQDPWLSCVS  374

Query  1435  ------PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEE  1274
                   P+  +    L + +L   ++  WDK      +KI+ +LP  E E + ++  +  
Sbjct  375   PQAPIGPINHQ-DAQLRVSDLLCPISNSWDK------DKIRAHLPQYE-EHILTIGTSSA  426

Query  1273  NTPDGWGWSPDPRGCFSVKSAY----GWADNAARQEADKVW-GLIWSLRVPARISMFIWL  1109
              + D   W  D  G ++ K+ Y    G++D    Q     W   IW+++   ++  F+W 
Sbjct  427   PSQDSLAWLFDKSGVYTTKTGYGVGMGFSDLKDSQAPSFDWLKNIWNIKTSPKLKNFLWK  486

Query  1108  VKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW  968
             +    V  +   +RR + S   C  C  + +D+ H+F +C   +R+W
Sbjct  487   LMRKAVPVSANLSRRGVPSFN-CKTCDVEEDDI-HVFLKCRVAERVW  531



>ref|XP_009110782.1| PREDICTED: uncharacterized protein LOC103836292 [Brassica rapa]
Length=767

 Score =   169 bits (428),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 168/596 (28%), Positives = 252/596 (42%), Gaps = 58/596 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DRI  R   W    LS AG+  L K+VL A+P Y M    +P  +C +I+    RF W
Sbjct  192   IVDRIRQRSHSWTTSFLSGAGKQVLLKAVLAAMPTYAMSCFKIPVSLCKQIQSVFTRFWW  251

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D +    KMS ++WD +T  K+ GGLG R +   N A + KL WR+ T+PN+L ++TL
Sbjct  252   --DSKPNLKKMSWISWDRLTLPKSAGGLGFREIEKFNEALLAKLAWRILTDPNSLLSRTL  309

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY H + S +  +   S S+ W+GI A R+ L+ G+  +V NGK    W + WL    
Sbjct  310   LGKYCH-TYSFMECSSPSSASHGWRGILAARDVLKKGMGWLVGNGKDINIWTEPWLA---  365

Query  1432  LYEKLRGTLGLPEL----YATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEEN--  1271
             L +  R T G P L        + +      W    I+ +LP  E +    LCL   +  
Sbjct  366   LDKPTRPT-GPPPLNSINLCVQDLFLPNSTSWNISAIRLHLPHHEQD---ILCLNPSSFG  421

Query  1270  TPDGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWG---LIWSLRVPARISMFIWLVKH  1100
               D   W P+  G +S K+ Y  +   A    D+ +     +W++    +    +W + +
Sbjct  422   MVDTRVWLPERSGDYSTKTGYALSKLNATPPRDQAFNWNQFVWNVATSPKTKQLLWRIGN  481

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIW-----RHSLQRRTEES  935
               +        R I  +  C  C G  E + H+   C    R+W            T  +
Sbjct  482   NALSVGSNLLARGIMVDGACKRC-GAPETILHVLLNCPFASRVWNLLPANLKPSPDTSTT  540

Query  934   MRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWL  755
             +  L  NS  T  L           W        W+LW  RN+ +F  NLL  E+++  +
Sbjct  541   ISLLLQNSKKTTCLPPTGVSNPVHPW------LFWYLWTSRNKLLF-ENLLLSEEEV--V  591

Query  754   RRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDG----QASCG  587
              R   E  A  E +       +R    R S          + +  SC  D     ++  G
Sbjct  592   LRSIKEARAWQEAQVRTCPPTSRPKPTRKSCPTSS-----VTSGLSCFVDAAWDVRSGFG  646

Query  586   GV-----LRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKML  422
             G+      RDT G   +  + R    ++ VAE   V   L  A   G R + I  DSK L
Sbjct  647   GMGWLFTSRDT-GVIAQDSSNRRFVASALVAETLAVKAALSAAVSSGFRALTIYSDSKTL  705

Query  421   VEAL-KGKETGQEQN--NNIVRRCIKEAENFL-AVVFLHIYREQNKLADKLAKWAL  266
             V  L  G +  + Q   ++I   C      FL ++ F  + R  N  AD LAK AL
Sbjct  706   VTLLTSGGKCVELQGLLHDIHMLC-----TFLESISFCFVPRSDNIDADSLAKAAL  756



>emb|CCA66153.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   171 bits (433),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 175/615 (28%), Positives = 268/615 (44%), Gaps = 51/615 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++ ++  +L  WK+  LS+ GR+TL K+ L+ +P+Y M    +PKGV  +I    RRF+W
Sbjct  764   VISKLEKKLASWKSNLLSIGGRLTLIKACLSNLPLYYMSLFPIPKGVLGKIVAIQRRFLW  823

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               +  S    M LV+WD+I   K  GGLGL NLH  N A + K  WR   EP+ LW + +
Sbjct  824   SGN--SSKKGMPLVSWDLIALPKHLGGLGLGNLHHKNTALLFKWIWRFLNEPHALWRQVV  881

Query  1612  TTKYHHRSGSHLVTTRRRSISN---AWKGI------SAERETLESGLTHV-VRNGKSTRF  1463
               KY  +      TTR  S+S+    W GI      S + + L      V + +G +T F
Sbjct  882   HGKYGLKDS---FTTRDLSLSSYGGPWNGICNAILKSPQAKKLAFHQVRVQIGDGSNTLF  938

Query  1462  WMDSWLTAKPLYEKLRGTLGLP---ELYATVNEYWDKVRGWKWEKI-QRYLPTEELERLA  1295
             W D W+ A PL  +      L    + Y ++  +WD +  W+W  +  R L   +L   A
Sbjct  939   WHDVWVGANPLKTECPRLFRLSLQQDAYVSLCGFWDGL-CWRWSLLWSRPLRQRDLHEQA  997

Query  1294  SL------CLTEENTPDGWGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPA  1133
             +L       + +++  D   W+P   G FSVKS      N     + +    +W   VP 
Sbjct  998   TLLNIINRAVLQKDGKDHLIWAPSKSGIFSVKSFSLELANMEESRSFEATKELWKGLVPF  1057

Query  1132  RISMFIWLVKHGRVLTNYERTRRHITSNE--YCYNCAGQREDLDHLFRRCHDVDRIWRHS  959
             RI +F+W V  GR+ T  +     + SNE   C  C+   E  +HLF  C     +W   
Sbjct  1058  RIEIFVWFVILGRLNTKEKLLNLKLISNEDSSCIFCSSSIESTNHLFLECSYSKELWHWW  1117

Query  958   LQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNR---N  788
              Q      +         T  +   + + F++ W   F   LW +WK RN  +F     +
Sbjct  1118  FQIWNVAWVLPSSIKELFTHWIPPFKGKFFKKVWMSCFFIILWTIWKERNSRIFQEKPNS  1177

Query  787   LLPLEQKLD-----WLRRCDSETAAAFEE-------RHW--PL--QRHNRGGEERLSWEK  656
              L L++ +      W++  +     + E+        +W  P+  Q+          W  
Sbjct  1178  KLQLKELILLRLGWWIKGWNEPFPYSAEDIVRNPLCLNWLTPVKPQKAIMPAPFPQHWSP  1237

Query  655   PDEGWLKLNTDGSCTSDGQ-ASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLR  479
             P  G LK N D S  S  Q +S GGVLRD  GN+   ++  I       AE   + + L+
Sbjct  1238  PSIGSLKWNVDASIKSSLQKSSIGGVLRDHKGNFICMFSSPIPFMEINNAEVLAIHRALK  1297

Query  478   MAKEYG---ARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYR  308
             ++          I++E DS   V   K   +G    N I+      A     V   +  R
Sbjct  1298  ISAACPRIWGSHIIVESDSSNAVSWCKKDASGPWNLNFILNFIRNSASKDPKVSITYKGR  1357

Query  307   EQNKLADKLAKWALT  263
             E N +AD LAK  L+
Sbjct  1358  ETNMVADALAKQGLS  1372



>ref|XP_009129277.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=534

 Score =   166 bits (421),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 149/535 (28%), Positives = 231/535 (43%), Gaps = 31/535 (6%)
 Frame = -1

Query  1861  MQTAALPKGVCSEIEKRTRRFIWGRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMN  1682
             M    LPK  C +I+    RF W  D++  + KMS V+W  +T  K+ GGLG R +   N
Sbjct  1     MTCFQLPKSFCKQIQTVLTRFWW--DDKPDHRKMSWVSWSTLTLPKSAGGLGCREIEKFN  58

Query  1681  RACMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESG  1502
              A + KL WR+   P++L ++ LT KY H S S L  T  RS S+ W+G+ A RE L  G
Sbjct  59    EALLAKLAWRILKYPDSLLSQVLTGKYCH-SSSFLTATSPRSASHGWRGVLAGREVLSKG  117

Query  1501  LTHVVRNGKSTRFWMDSWLTAK-PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRY  1325
             L  +V NG+    W D WL+ K PL      T    +L  + +        W    ++ +
Sbjct  118   LGWIVGNGRRINVWSDPWLSTKHPLCPMGPPTDSNKDLKVS-DLLETSTMEWNLSAVRLH  176

Query  1324  LPTEELERLASLCLTEENTPDGWGWSPDPRGCFSVKSAYG-WADNAARQEADKVWGL-IW  1151
             LP  E E +  L  +E +  D   W P   G +S K+ Y  W  N  +++ D  W L IW
Sbjct  177   LPQYE-EAIKKLIPSEFHMEDELVWLPTSNGTYSTKTGYALWRLNRDQEQMDFNWNLCIW  235

Query  1150  SLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRI  971
              ++   ++  F+W +K   +       RR +     C  C G  E   H+  +C    R+
Sbjct  236   QIKASPKLKHFLWKIKSKALPVGANLVRRGVEVEGRCKRC-GLMETERHVLLQCPFASRV  294

Query  970   WR--HSLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF  797
             W    +L +    ++ + +        +      G  E     +   LW+LW  RN  VF
Sbjct  295   WDLVPALYKPDPTAVTSPEILLQACRRMINLPPSGLNET--ALYPWILWYLWIARNRLVF  352

Query  796   NRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGS  617
               N    EQ+L         T A  E R W   +  +G ++     +          +  
Sbjct  353   -ENREGSEQEL--------VTLALKEARIWQSAQREKGKQQTPQKGRQAPPTCHRGMETQ  403

Query  616   CTSDGQ----ASCGG---VLRDTHGNWCRGYTY-RIGRCTSTVAEAWGVLQGLRMAKEYG  461
             C  D       S GG   + +DT     +  +  R    ++ VAEA GV  GL+ A+  G
Sbjct  404   CFVDAAWNAGTSGGGFGCIFKDTTSRTLQQCSSNRSNVSSALVAEALGVKPGLKAARLLG  463

Query  460   ARRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNK  296
              R++ I  DSK L++ +   E   E    ++    +   +F +V F  I R+ N+
Sbjct  464   LRKLAIRSDSKSLIKVINTNEKIVEA-QGVLFDIYQLCTSFTSVSFDFISRDFNE  517



>ref|XP_009146764.1| PREDICTED: uncharacterized protein LOC103870391 [Brassica rapa]
Length=985

 Score =   170 bits (431),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 148/561 (26%), Positives = 246/561 (44%), Gaps = 57/561 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DRI  R   W  + LS AG++T+ K+VL AIP Y M    LP+ +C+ I+    RF W
Sbjct  399   IVDRIRQRAANWSTRFLSRAGKLTMLKAVLTAIPTYAMSCFILPQSLCNRIQSSLTRFWW  458

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D+      M  VAW  +T  K  GGLGLR++   N+A + K+ WR+ T P+ L A+ L
Sbjct  459   --DKSPDKKNMCWVAWGKLTRPKKAGGLGLRDIQRFNQALLAKVAWRILTSPHCLLARVL  516

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK-  1436
             T KY H+  S L        S+ W+ I   R+ L+  L   + NG++TR W D W++ + 
Sbjct  517   TGKYCHKK-SFLDVQTPAVCSHGWRSILHGRDLLQEHLGRAIGNGQNTRLWKDPWISLQA  575

Query  1435  PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
             PL  K  G +    L   V++       W  +KI ++LP +  +++  L  ++E   D +
Sbjct  576   PL--KPYGPVQEAGLDLRVSDLLTDDLQWNKDKIDKFLP-DFTKQIQCLKPSKEGAEDIY  632

Query  1255  GWSPDPRGCFSVKSAYGWA------DNAARQEADKVWGL-------IWSLRVPARISMFI  1115
              W P   G +S KS Y          +  ++ ++    L       +WS++   ++ +F+
Sbjct  633   VWLPLESGVYSTKSGYNSKTQLNAHTHLQQRTSNPPPNLEFDWLKDVWSIKTAPKLKLFL  692

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH-----SLQR  950
             W +  G +    E  RR + +   C  C  + E   H+F +C     +WRH     S+  
Sbjct  693   WSIIQGALPLGSELQRRGMINAAACPRCK-KEESATHIFFQCPFAKEVWRHIPLNSSVHL  751

Query  949   RTEESMRNL--DWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF-NRNLLP  779
                E+  +    + S L +   G R       W        W LW  RN+ +F ++   P
Sbjct  752   ADAETFESYMGQFRSALCLPPTGIRSPVLP--W------ICWSLWTARNKLIFDDKTAQP  803

Query  778   LEQKLDWLRRCDSETAAAFEERHWPL-QRHNRGGEERLSWEKPDEGWLK-LNTDGSCTS-  608
             LE     L       AAA E   W L Q  ++    ++  + P    +  + +  SC   
Sbjct  804   LEIATKGL-------AAALE---WDLAQSTDQLKRNQVFPQAPSRRQIPGIQSYPSCFVD  853

Query  607   ---DGQASCGGVL----RDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRI  449
                D  ++  G+      D   N   G        +  +AE+  + QG++ A   G + +
Sbjct  854   AAWDASSNRAGIAWHFTNDLGTNSPPGSQIIDNVASPLMAESLALRQGIKEALSLGKKSV  913

Query  448   MIECDSKMLVEALKGKETGQE  386
                 D   L+ A+  +   +E
Sbjct  914   SFHSDCATLIRAISTQSQIKE  934



>gb|EAZ40370.1| hypothetical protein OsJ_24816 [Oryza sativa Japonica Group]
Length=613

 Score =   167 bits (422),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 154/560 (28%), Positives = 237/560 (42%), Gaps = 77/560 (14%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +R+  +++GWK K LS AG+  L K+V  AIP + M    L K +  EI     RF W
Sbjct  12    LKERVWKKIQGWKEKLLSRAGKDILIKAVAQAIPAFAMSCFDLTKTLYDEISSLISRFFW  71

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
              + ++   NKM  +AWD + +   +GGLG R+LH  N A +    WRL +  ++L A+ L
Sbjct  72    AQHDR--ENKMHWIAWDKLCSRTEKGGLGYRDLHLFNLAMLAHQAWRLLSNLDSLCARVL  129

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----  1445
               KY    G  +       IS +W+ I    + L+ GL   V +G     W D W+    
Sbjct  130   KAKY-FPDGKLMEVRESPGISYSWRSIVRGVQVLKVGLIWRVGDGTDIDMWNDPWIPLGT  188

Query  1444  TAKPLYEKLRGTL--GLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEEN  1271
             T +P+  + RG +   + +L   +   WD+      E IQ     E+++ + ++ +    
Sbjct  189   TKRPITPR-RGIVLNKVADLINPITGEWDR------ELIQDIFWEEDVKNILAIPV-HNG  240

Query  1270  TPDGWGWSPDPRGCFSVKSAY---------------GWADNAARQEADKVWGLIWSLRVP  1136
               D   W  DPRG FSVKSAY               G + +     A   W  +W L   
Sbjct  241   YSDVAAWHFDPRGIFSVKSAYHTLEYQRDRQAIRQTGESSSGKTSSAALQWEKLWRLNHL  300

Query  1135  ARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH--  962
              ++  F+W + H  +      ++R +  +  C  C    E+  H F +C  V   WR   
Sbjct  301   PKVKHFLWRLAHNSLPLRQNISKRGMEIDTRCPVCLRLDENGGHCFFKCKFVKPCWRMLN  360

Query  961   --------SLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKW---  815
                     SLQ  T +  +++       +NL+ D              T +  LW W   
Sbjct  361   FEHIRQELSLQTSTLDVCKHI-------LNLREDIML-----------TTVILLWNWWDA  402

Query  814   RNEAVFNRNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLK  635
             RN+     +    E+    + R  SE +  F ++     R N   +   +W  P +  LK
Sbjct  403   RNKVNAGEDRRTHEEVYSRVIRMVSENSLLFRDK----ARGNPSSQS--TWCPPPQCVLK  456

Query  634   LNTDGSCTSDGQASC-GGVLRDTHGNWCRGYTYRIGRC----TSTVAEAWGVLQGLRMAK  470
             LN DG+  +   +   G +LRD  GN   G   R GR      +  AEA   L  LR   
Sbjct  457   LNIDGAFQAANLSGGWGFILRDHEGN---GVLARAGRIELVHDALSAEAVACLHALRAVL  513

Query  469   EYGARRIMIECDSKMLVEAL  410
              +G     +E DS +LV AL
Sbjct  514   NHGFSYFSVETDSSILVSAL  533



>ref|XP_010674186.1| PREDICTED: uncharacterized protein LOC104890406 [Beta vulgaris 
subsp. vulgaris]
Length=1667

 Score =   171 bits (432),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 170/629 (27%), Positives = 264/629 (42%), Gaps = 81/629 (13%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++ +I+ RL  WK K LS+ GR+TL KS L+++P+Y M    +P GV  +I K +R F+W
Sbjct  1050  VISKITKRLASWKGKMLSIGGRLTLIKSSLSSLPLYYMSIYPIPMGVIQKIIKLSRSFLW  1109

Query  1792  GRDEQSGNNKMSL--VAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAK  1619
               D +    K++L  V+W +    K  GGLG+ N+   N A + K  WR   + +  W +
Sbjct  1110  NGDSE----KLALAPVSWKVAQLPKALGGLGIGNILHKNLALLFKWFWRYFDDSSLPWCQ  1165

Query  1618  TLTTKYHHRSGSHLVTTRRRSISNAWKGI-------SAERETLESGLTHVVRNGKSTRFW  1460
              +  KY + S   +      S    WK I       +  R+    G+  +V NG S  FW
Sbjct  1166  VIKAKYKYPSTFTVADLSIPSNGGPWKHICSAIIKHTGARDVAIKGVRKIVNNGMSCLFW  1225

Query  1459  MDSWLTAKPL---YEKLRGTLGLPELYATVNEYWDK---VRGWKWEKIQRYLPTEELER-  1301
              DSW+ A PL   + +L     L         +W+    V  + W++  R  P + +E+ 
Sbjct  1226  HDSWIEASPLKHIFPRLYSISILQNAPVESFGFWEGFTWVWTFSWKRSLR--PQDLVEKS  1283

Query  1300  -----LASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWADN---AARQEADKVWGLIWSL  1145
                  L  +CL+ E + D   W+ +  G FS KS     D     A Q+A K    IW  
Sbjct  1284  GLQRLLEKVCLSHE-SKDKLVWTFNSSGRFSSKSFSLELDKLGLLAHQDAIKG---IWKG  1339

Query  1144  RVPARISMFIWLVKHGRVLTNYERTRRHITSNE--YCYNCAGQREDLDHLFRRCHDVDRI  971
              VP RI +F+W V   R+ T        I   E   C  C    E  +HL   C   +++
Sbjct  1340  VVPHRIEIFVWTVLLERINTRQRLASLRIIPPESDVCPLCLSSSESCNHLMLHCEFSNQL  1399

Query  970   WRHSLQRRTEESMRNLDWNSWLTMNLKGDRQQG------FEEGWPERFGTRLWWLWKWRN  809
             W   L      ++    W   L+M    D+ +       F++ W   F    W +WK RN
Sbjct  1400  WHWWL------NLWGAKWAFPLSMRHAFDQWKSPINVPFFQKVWHACFFIISWSIWKERN  1453

Query  808   EAVFN---------RNLLPLEQKLDWLRR--CDSETAAAFEERHWP----------LQRH  692
               +F          R+++ L  +L W  +   D    +  + +  P          L + 
Sbjct  1454  ARIFENVSSTHVQIRDMILL--RLGWWIKGWSDEFPYSPLDIQRNPSCLIWNGFSNLSKG  1511

Query  691   NRGGEERLSWEKPDEGWLKLNTDGSCT-SDGQASCGGVLRDTHGNWCRGYTYRIGRCTST  515
              R       W  PD   +K N D S       ++ GGVLR+  GN+   ++  I      
Sbjct  1512  PRALTSACEWCPPDLNHIKWNVDASVNLLSSSSAIGGVLRNHAGNFICMFSSPIPFMEIN  1571

Query  514   VAEAWGVLQGLRMAKEYG---ARRIMIECDSKMLVEALKGKETG---QEQNNNIVRRCIK  353
              AE   +   +R++   G   + +I++E DS   V      E G      + N +R   K
Sbjct  1572  CAEILAIHHAIRISLSNGISKSSKILLESDSLNAVSWCNCDEGGPWNMSHHLNFIRNARK  1631

Query  352   EAENFLAVVFLHIYREQNKLADKLAKWAL  266
             +    L +   H  RE N +AD LAK  L
Sbjct  1632  K---HLCISITHRGRESNFVADSLAKQGL  1657



>ref|XP_008346916.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1007

 Score =   169 bits (429),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 150/608 (25%), Positives = 241/608 (40%), Gaps = 20/608 (3%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             RI+ +L+GWK  TLS AG+  L K+V+ AIP Y M     P  VC +++     F     
Sbjct  384   RIAGKLQGWKQSTLSKAGKEVLIKAVVQAIPAYPMNIFKFPAVVCDDLDALVAGFW--WG  441

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
             +  G  K+  V+ +++   K  GG+G ++    N A + K  WRL  EPN+LWA+ +  +
Sbjct  442   KAGGGGKIHWVSKEVLGLPKNIGGMGFKSFKEFNDALLAKQCWRLICEPNSLWARVIKAR  501

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y     S L  ++    S AW  + + R+ +  G    +  G+  R W+D WL +  L  
Sbjct  502   YFPHC-SFLEASKGGRASWAWSSLLSGRDVILQGTHWQILGGEDVRVWVDRWLPSLLLGH  560

Query  1423  KLR-GTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWS  1247
              +  G + +         +    R W    +Q +    E E + +  + + +  D   W+
Sbjct  561   PVPLGXVAVTRNLRVCKLFCPLSREWDLNFLQPFXTDVEXETIRATPIGDSSRRDRLIWA  620

Query  1246  PDPRGCFSVKSAYGWADN-----------AARQEADKVWGLIWSLRVPARISMFIWLVKH  1100
                 G +SVKS Y W  +            AR   +++W  +W + VP +I  F+W   H
Sbjct  621   ASKNGRYSVKSGYRWIQSRSLCLRDSRLPHARSVPEELWKCLWKIEVPPKIRHFLWSSLH  680

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
               + T     +R  +++  C  C    E   H+F  C  V  +W   +     +      
Sbjct  681   NALATKVNLFKRGASNSPICPICLCDDESTVHIFLLCPWVKHVWFGGVLSYKVDGXAISS  740

Query  919   WNSWLTMNLKGDRQQGFEEGWPER-FGTRLWWLWKWRNEAVFNR-NLLPLEQKLDWLRRC  746
             W  WL      +     +  W         W++WK R + VFN   ++P           
Sbjct  741   WFLWLQAIFSSNFGAPDDGMWVRSCVAFTCWFIWKARCDFVFNXVKIIPSRVVXAISSAM  800

Query  745   DSETAAAFEERHWPLQRH-NRGGEERLSWEKPDEGWLKLNTDGS-CTSDGQASCGGVLRD  572
             DS  AA        L+    +     + W  PD  + K+N D S C        G V+R 
Sbjct  801   DSFLAAGRSXEVCGLRXGVGQASXPVVCWTPPDPPFSKINVDASWCRMSLVGFVGVVVRS  860

Query  571   THGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK-ET  395
               G +     Y I    +  AEA  +L G ++    G   ++IE DS   V  L    E 
Sbjct  861   AEGQFIAAARYSIKASNAAAAEALALLHGCKLGVTLGLSEVIIESDSLEAVSCLSNSLED  920

Query  394   GQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFE  215
             G  +    +    K  E F    +  + R  N  AD L+    T    +   + PP    
Sbjct  921   GSXEAFPFLAMVKKIGETFQXCRWSWVPRTANMAADVLSSRVCTEMCDVVWVDRPPSSLV  980

Query  214   VRMALDRL  191
               +  D L
Sbjct  981   FVLNNDGL  988



>ref|XP_008355160.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=573

 Score =   166 bits (420),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 156/588 (27%), Positives = 240/588 (41%), Gaps = 50/588 (9%)
 Frame = -1

Query  1861  MQTAALPKGVCSEIEKRTRRFIWGRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMN  1682
             M     P  VC + +     F WGR  Q  + K   V+ +++   K  GGLG  N    N
Sbjct  1     MYMFKFPASVCQDFDSLVADFWWGR--QGASRKTHWVSXEVLGLPKDWGGLGFXNFADFN  58

Query  1681  RACMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESG  1502
              A + K  WRL ++P +LWA  +  +Y     S     +    S AW  +   RE L  G
Sbjct  59    DALLAKQCWRLLSDPMSLWAXVVKARYFPNC-SFWDAXKGGXASWAWSSLLVGREVLRKG  117

Query  1501  LTHVVRNGKSTRFWMDSWLTAKPL--YEKLRGTLGLPEL--YATVNEYWDKVRGWKWEKI  1334
                 +  G   R W+D WL + PL   E L      P L  ++ +++   + R W  + +
Sbjct  118   AHWQIMGGHDVRVWVDRWLPSLPLGRPEXLGEVAVSPNLRVHSLISQ---ESRIWDIDFL  174

Query  1333  QRYLPTEELERLASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWADNAARQEADK-----  1169
               +L  E    +  L + +    D   W     G +SVKS Y W    A    D+     
Sbjct  175   LPFLSEEAKLAINCLPIGDSRYKDRLIWDASKNGRYSVKSGYRWLQLGAIASRDQXLPRT  234

Query  1168  ------VWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLD  1007
                   +W  +W+L  P +I  F WL  H  + T     RR I  +  C  C  Q E ++
Sbjct  235   RLIPKNLWNQVWNLPAPXKIXCFFWLSLHRGLATXXXLFRRRIAQSPCCPICNSQDETIE  294

Query  1006  HLFRRCHDVDRIWR-HSLQRRTE-ESMRNLDWNSWLTMNLKGDRQQGFEE--GWPERF-G  842
             H+F  C  V  IW   +L  R + ES+ +  W  WL   L   R  G  E   W   +  
Sbjct  295   HIFLLCPWVRAIWFGGALNYRIDGESISS--WADWLMEVLV--RFPGGXEVRKWVCSYVA  350

Query  841   TRLWWLWKWRNEAVFNR-NLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLS  665
               +W++W+ R E VFN+  +LP    L       S   A +E   W     + GG  R S
Sbjct  351   FTVWFIWRTRCEFVFNQVPILPFXVLLG----VSSAVGAFWEAMGW-----SGGGAARPS  401

Query  664   --------WEKPDEGWLKLNTDGSCTSDGQASCGG-VLRDTHGNWCRGYTYRIGRCTSTV  512
                     W    + ++K+N D S +   ++   G V+RD  G +     + +   +  V
Sbjct  402   ARCGPIPLWIPXPDSFVKINVDASWSHASRSGFXGVVIRDASGQFVAAERFALSTXSVAV  461

Query  511   AEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK-ETGQEQNNNIVRRCIKEAENFL  335
             AEA  +L G ++    G + +++E DSK  ++ L G  E G  +   ++ R   E++ F 
Sbjct  462   AEATXLLCGCKLGSSLGFKSVIVESDSKESIDWLSGDVEVGSWKAFPVLTRVKVESDAFQ  521

Query  334   AVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDRL  191
                +  + R  N  AD LA  +    G       PP      +  D L
Sbjct  522   FCRWSWVPRXANGAADFLASRSFPEMGSRVWVHRPPSSLVFVLNKDGL  569



>ref|XP_009118883.1| PREDICTED: uncharacterized protein LOC103843855 [Brassica rapa]
Length=1293

 Score =   170 bits (430),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 158/602 (26%), Positives = 269/602 (45%), Gaps = 51/602 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++D +  +   W  + LS AG+ T+ +SVL+A P + M +  LP  +C +I+    RF W
Sbjct  714   IVDSMRQKAASWSTQFLSTAGKATMIQSVLSAKPNFAMSSFLLPVSLCKQIQTILTRFWW  773

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D++ G  K+   +W+ +T  K+ GGLG R++   N A + K+ WR+ T+P++L AK L
Sbjct  774   --DDKDGEKKICWKSWESLTHPKSLGGLGFRDVQAFNEALLAKIAWRILTKPDSLLAKVL  831

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
              +KY +++    V     +IS+ W+GI   R+ L   L   + NG++T  W DSW+   P
Sbjct  832   LSKYCYKTTFTKVIA-GSAISHGWRGILTGRDLLLRHLGRAIGNGETTNLWADSWI--DP  888

Query  1432  LYEKLR--GTLGLPELYATVNEYWDK-VRGWKWEKIQRYLPTEELERLASLCLTEENTPD  1262
             +   LR  G + L E    V +   +  + W   +I++ LP  E + + ++  +   T D
Sbjct  889   I-SNLRPIGPVPLQEKDLMVADILTRETKEWNTGRIRQLLPELE-DHILNIKPSVLGTGD  946

Query  1261  GWGWSPDPRGCFSVKSAYGWADNAARQ-----EADKVWG---LIWSLRVPARISMFIWLV  1106
              + W     G ++VK+ Y    +   Q     E D +W     IW+  +  ++  F+W +
Sbjct  947   SYIWPLQKTGEYTVKTGYYAIHSLDFQSTSLLEEDNMWSWKKHIWNPPLLPKLRFFLWKI  1006

Query  1105  KHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRN  926
                 + T      R +  N  C  C G+ E +DH+   C    ++W   L     E+   
Sbjct  1007  ATNSLPTGANLQTRGLLVNTSCPRC-GEVETIDHILFHCAFAKKVWTFGLWSTPREAGDL  1065

Query  925   LDWN-------SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF-NRNLLPLEQ  770
             + +        +W+ +   G     F   W        W LW  RN   F NR + P E 
Sbjct  1066  MTFKDTLRASFNWINLPPMGVTTNLFP--W------ICWNLWTARNLRTFENRTISPQEV  1117

Query  769   KLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASC  590
              L  +R       A    R  P    +    +R + E P    +  NTD +  SD +A+ 
Sbjct  1118  VLKAIRASKEWEVAQPCNRPTP----SPSTTQRHAAETPPMT-IFCNTDAAWKSDTKAAG  1172

Query  589   GG-VLRDTHGN-WCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVE  416
              G +  D +G+   RG + +    ++ +AE   V + L  A      +I +  DS+ L+ 
Sbjct  1173  LGWIFTDENGHELTRGSSAQHHVSSALMAETLAVREALIHAATLNLTKIYLRTDSQELIR  1232

Query  415   ALKGKETGQEQNN------NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQG  254
             A+    TG+  ++      ++          F    F+ I R  N+ AD LAK +L+   
Sbjct  1233  AIT---TGRRPSDLFGVLSDVDSLASPPTSPFAFCRFVFISRAFNESADSLAKASLSLYL  1289

Query  253   GL  248
             GL
Sbjct  1290  GL  1291



>ref|XP_007226707.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
 gb|EMJ27906.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
Length=1011

 Score =   169 bits (428),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 161/342 (47%), Gaps = 21/342 (6%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +R+  +L+ WK K LS AG+  L K V  AIPIYTM    LPK VC ++ K   +F W
Sbjct  661   LKERLWKKLQTWKGKLLSGAGKEILIKVVAQAIPIYTMSYFLLPKYVCEDLNKLVAQFWW  720

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               +  + N K+  +AWD +   K  GGLG RNLH  N A + K GWRL   P++L  K L
Sbjct  721   --NSSTENKKIHWMAWDRLCAPKEEGGLGFRNLHAFNLALLAKQGWRLLQNPDSLITKVL  778

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY   + S L T      S  WK +   R  +  G    V +G +   W D WL   P
Sbjct  779   KAKY-FPTRSFLETAVSLHASVVWKSLYEARTVIIQGSRWQVGSGDTIGIWEDRWL---P  834

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRG----WKWEKIQRYLPTEELERLASLCLTEENTP  1265
                  R     PE ++ + +  D + G    W    +Q     EE+  + S+ L+   TP
Sbjct  835   QPNSFRIFFPKPE-HSAITKVSDLIHGDSREWNVPLLQNVFFPEEVMLIRSIPLSLRLTP  893

Query  1264  DGWGWSPDPRGCFSVKSAYGWADN-------AARQEADKV---WGLIWSLRVPARISMFI  1115
             D   W  D +G F+VKSAY  A +       A+   +D V   W L+W   VPAR+  F 
Sbjct  894   DMLVWHYDKKGMFTVKSAYHVARSVHSSTGRASSSNSDAVARNWSLLWKAIVPARVKTFW  953

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRC  989
             W V  G + T     R+ ++ +E C  C G  E   H+   C
Sbjct  954   WRVISGILPTKANLARKKVSLDEECMLCEGPVESSIHILCDC  995



>ref|XP_008358487.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=573

 Score =   166 bits (419),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 156/588 (27%), Positives = 240/588 (41%), Gaps = 50/588 (9%)
 Frame = -1

Query  1861  MQTAALPKGVCSEIEKRTRRFIWGRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMN  1682
             M     P  VC + +     F WGR  Q  + K   V+ +++   K  GGLG  N    N
Sbjct  1     MYMFKFPASVCQDFDSLVADFWWGR--QGASRKTHWVSXEVLGLPKDWGGLGFXNFADFN  58

Query  1681  RACMMKLGWRLKTEPNTLWAKTLTTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESG  1502
              A + K  WRL ++P +LWA  +  +Y     S     +    S AW  +   RE L  G
Sbjct  59    DALLAKQCWRLLSDPMSLWAXVVKARYFPNC-SFWDAXKGGXASWAWSSLLVGREVLRKG  117

Query  1501  LTHVVRNGKSTRFWMDSWLTAKPL--YEKLRGTLGLPEL--YATVNEYWDKVRGWKWEKI  1334
                 +  G   R W+D WL + PL   E L      P L  ++ +++   + R W  + +
Sbjct  118   AHWQIMGGHDVRVWVDRWLPSLPLGRPEXLGEVAVSPNLRVHSLISQ---ESRIWDIDFL  174

Query  1333  QRYLPTEELERLASLCLTEENTPDGWGWSPDPRGCFSVKSAYGWADNAARQEADK-----  1169
               +L  E    +  L + +    D   W     G +SVKS Y W    A    D+     
Sbjct  175   LPFLSEEAKLAINCLPIGDSRYKDRLIWDASKNGRYSVKSGYRWLQLGAIASRDQXLPRT  234

Query  1168  ------VWGLIWSLRVPARISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLD  1007
                   +W  +W+L  P +I  F WL  H  + T     RR I  +  C  C  Q E ++
Sbjct  235   RLIPKNLWNQVWNLPAPXKIXCFFWLSLHRGLATXXXLFRRRIAQSPCCPICNSQDETIE  294

Query  1006  HLFRRCHDVDRIWR-HSLQRRTE-ESMRNLDWNSWLTMNLKGDRQQGFEE--GWPERF-G  842
             H+F  C  V  IW   +L  R + ES+ +  W  WL   L   R  G  E   W   +  
Sbjct  295   HIFLLCPWVRAIWFGGALNYRIDGESISS--WADWLMEVLV--RFPGGXEVRKWVCSYVA  350

Query  841   TRLWWLWKWRNEAVFNR-NLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERLS  665
               +W++W+ R E VFN+  +LP    L       S   A +E   W     + GG  R S
Sbjct  351   FTVWFIWRTRCEFVFNQVPILPFXVLLG----VSSAVGAFWEAMGW-----SGGGAARPS  401

Query  664   --------WEKPDEGWLKLNTDGSCTSDGQASCGG-VLRDTHGNWCRGYTYRIGRCTSTV  512
                     W    + ++K+N D S +   ++   G V+RD  G +     + +   +  V
Sbjct  402   ARCGPIPLWIPXPDSFVKINVDASWSHASRSGFXGVVIRDASGQFVAAERFALSTXSVAV  461

Query  511   AEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGK-ETGQEQNNNIVRRCIKEAENFL  335
             AEA  +L G ++    G + +++E DSK  ++ L G  E G  +   ++ R   E++ F 
Sbjct  462   AEATXLLCGCKLGSSLGFKSVIVESDSKESIDWLSGDVEVGSWKAFPVLTRVKVESDAFQ  521

Query  334   AVVFLHIYREQNKLADKLAKWALTTQGGLHIFEVPPGEFEVRMALDRL  191
                +  + R  N  AD LA  +    G       PP      +  D L
Sbjct  522   FCRWSWVPRLANGAADFLASRSFPEMGSRVWVHRPPSSLVFVLNKDGL  569



>ref|XP_010692477.1| PREDICTED: uncharacterized protein LOC104905588 [Beta vulgaris 
subsp. vulgaris]
Length=1260

 Score =   169 bits (429),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 149/574 (26%), Positives = 236/574 (41%), Gaps = 28/574 (5%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+DRI  +L+GWK K LS AG+  L KSV+ AIP Y M     P  +  +I+    RF W
Sbjct  677   LIDRIWKKLQGWKEKLLSRAGKEVLLKSVIQAIPTYLMGVYKFPVFIIQKIQSAMARFWW  736

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +     K+    WD +   K  GG+G ++L   N A + +  WRL  EP +L  + +
Sbjct  737   GSSDT--QRKIHWKNWDSMCNLKCFGGMGFKDLTIFNDALLGRQAWRLTREPQSLLGRVM  794

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY       L      S S +W  I + +  L+ G+   V NG     W D W+    
Sbjct  795   KAKYFPNC-DFLNAPLGHSSSYSWSSIWSSKALLKEGVIWRVGNGSQINMWSDPWV----  849

Query  1432  LYEKLRGTLGLPELYAT-VNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
             L E  R     P      V+E  D  R  WK   ++ +L   +L  + +  L+    PD 
Sbjct  850   LDEGGRFLTSTPHASIRWVSELIDFDRMEWKTSLLESFLNERDLRCILASPLSATPVPDE  909

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
               W+      +SVK+AY            + W  IWSL V  ++  F+W +    +    
Sbjct  910   LTWAFTKDATYSVKTAYMIGKGGNLDNFHQAWVDIWSLDVSPKVRHFLWRLCTTSLPVRS  969

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS-----LQRRTEESMRNLDWN  914
                 RH+T ++ C    G+ E   H    C  +  +W  S       R    SM +L   
Sbjct  970   LLKHRHLTDDDLCPWGCGEIETQRHAIFDCPKMRDLWLDSGCQNLCSRDASMSMCDL-LV  1028

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSET  734
             SW +++ K   +  +            W +W  RN  +FN    P    +  + R   E 
Sbjct  1029  SWRSLDGKLRIKGAYLA----------WCIWGERNAKIFNNKTTPSSVLMQRVSRLVEEN  1078

Query  733   AAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGNWC  554
              +     + PL     G   +  W  P    +KLN D S   DG      + R + G   
Sbjct  1079  GSHARRIYQPLVPRRTGSPRQ--WIAPPADSIKLNVDASLAVDGWVGLSVIARRSDGGVL  1136

Query  553   RGYTYRI-GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNN  377
                  R+       +AEA  V   +++ + YG +R+++E D ++++  L          +
Sbjct  1137  FAAVRRVRAYWAPEIAEAKAVELAVKLGRRYGLQRVILESDCQVVINRLSKNAIFLSDLD  1196

Query  376   NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
              ++   +     F +VV+ H+ R+ N +A  LAK
Sbjct  1197  LVLFNILASCTYFSSVVWSHVKRDGNYVAHHLAK  1230



>ref|XP_008364002.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=839

 Score =   168 bits (425),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 128/485 (26%), Positives = 205/485 (42%), Gaps = 25/485 (5%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             RI  +L+GWK   LS AG   L K+V+ AIP Y M     P  +C E++    +F W  D
Sbjct  357   RILGKLQGWKQSMLSRAGNEVLIKAVVQAIPAYPMNIFKFPATLCKELDALIAKFWW--D  414

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
             + SG  K   V+ + +   K  GG+G RN    N A + K  WRL  EP++LWA+ +  +
Sbjct  415   DSSGRRKTHWVSMETLGLPKHLGGMGFRNFQDFNDALLAKQCWRLIVEPDSLWAQVMKAR  474

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPL-Y  1427
             Y     S L  T+    S AW  +   R+ ++ G    +  G+  R W+D W  A  L +
Sbjct  475   YFSNC-SFLDATKGDRTSWAWSSLLVGRDLIQKGAHWQIMGGEEVRLWVDRWXPALLLGH  533

Query  1426  EKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWS  1247
                 G + +       +      + W +E +  +L  EE   +    +      D   W+
Sbjct  534   PSPSGDVAVTRNTRVSSIICPSSKTWDFEFLLPFLSAEECAAIRDTPIGNPRRKDRLVWA  593

Query  1246  PDPRGCFSVKSAYGWA-----------DNAARQEADKVWGLIWSLRVPARISMFIWLVKH  1100
              +  G +SVKS Y W               +R   + +W  IW ++VPA++ +F+W   H
Sbjct  594   SNRNGSYSVKSGYLWLQLQSLSLIDHRSPISRSVPELLWKGIWRVKVPAKVRLFLWSSLH  653

Query  1099  GRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLD  920
               ++T     +R  +    C  C  Q E ++HL   C  V  IW     +   +      
Sbjct  654   NALVTVAVLFQRRSSPTPICPICLCQEESVEHLLLSCPWVFSIWSGGALKYNIQVGIFSS  713

Query  919   WNSWLTMNLKGDRQQGFEEGWPERF-GTRLWWLWKWRNEAVFNR-NLLPLEQKLDWLRRC  746
             W +WL      +      + W + +     W +WK R + VFN+  ++P +  +      
Sbjct  714   WGAWLHAVFTSNLGSLASKEWVQTYMAFTCWHIWKSRCDYVFNQVPIIPSKVIMG----I  769

Query  745   DSETAAAFEERHWPL--QRHNRGGEERLS-WEKPDEGWLKLNTDGSCTSDGQASCGGVL-  578
                 A     R  P+  Q  +RG   +L  W  P   ++KLN D S +    +    V+ 
Sbjct  770   GFSVAEFLNARSVPVNSQSVDRGLVRQLCRWTPPVSPFVKLNVDASWSRVNNSGFAAVVA  829

Query  577   RDTHG  563
             RD  G
Sbjct  830   RDARG  834



>ref|XP_009126346.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851256 
[Brassica rapa]
Length=1690

 Score =   169 bits (429),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 148/561 (26%), Positives = 246/561 (44%), Gaps = 57/561 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             ++DRI  R   W  + LS AG++T+ K+VL AIP Y M    LP+ +C+ I+    RF W
Sbjct  733   IVDRIRQRAANWSTRFLSRAGKLTMLKAVLTAIPTYAMSCFILPQSLCNRIQSSLTRFWW  792

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
               D+      M  VAW  +T  K  GGLGLR++   N+A + K+ WR+ T P+ L A+ L
Sbjct  793   --DKSPDKKNMCWVAWGKLTRPKKAGGLGLRDIQRFNQALLAKVAWRILTSPHCLLARVL  850

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAK-  1436
             T KY H+  S L        S+ W+ I   R+ L+  L   + NG++TR W D W++ + 
Sbjct  851   TGKYCHKK-SFLDVQTPAVCSHGWRSILHGRDLLQEHLGRAIGNGQNTRLWKDPWISLQA  909

Query  1435  PLYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
             PL  K  G +    L   V++       W  +KI ++LP +  +++  L  ++E   D +
Sbjct  910   PL--KPYGPVQEAGLDLRVSDLLTDDLQWNKDKIDKFLP-DFTKQIQCLKPSKEGAEDIY  966

Query  1255  GWSPDPRGCFSVKSAYGWA------DNAARQEADKVWGL-------IWSLRVPARISMFI  1115
              W P   G +S KS Y          +  ++ ++    L       +WS++   ++ +F+
Sbjct  967   VWLPLESGVYSTKSGYNSKTQLNAHTHLQQRTSNPPPNLEFDWLKDVWSIKTAPKLKLFL  1026

Query  1114  WLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRH-----SLQR  950
             W +  G +    E  RR + +   C  C  + E   H+F +C     +WRH     S+  
Sbjct  1027  WSIIQGALPLGSELQRRGMINAAACPRCK-KEESATHIFFQCPFAKEVWRHIPLNSSVHL  1085

Query  949   RTEESMRNL--DWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVF-NRNLLP  779
                E+  +    + S L +   G R       W        W LW  RN+ +F ++   P
Sbjct  1086  ADAETFESYMGQFRSALCLPPTGIRSPVLP--W------ICWSLWTARNKLIFDDKTAQP  1137

Query  778   LEQKLDWLRRCDSETAAAFEERHWPL-QRHNRGGEERLSWEKPDEGWLK-LNTDGSCTS-  608
             LE     L       AAA E   W L Q  ++    ++  + P    +  + +  SC   
Sbjct  1138  LEIATKGL-------AAALE---WDLAQSTDQLKRNQVFPQAPSRRQIPGIQSYPSCFVD  1187

Query  607   ---DGQASCGGVL----RDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRI  449
                D  ++  G+      D   N   G        +  +AE+  + QG++ A   G + +
Sbjct  1188  AAWDASSNRAGIAWHFTNDLGTNSPPGSQIIDNVASPLMAESLALRQGIKEALSLGKKSV  1247

Query  448   MIECDSKMLVEALKGKETGQE  386
                 D   L+ A+  +   +E
Sbjct  1248  SFHSDCATLIRAISTQSQIKE  1268



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score =   169 bits (428),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 150/603 (25%), Positives = 256/603 (42%), Gaps = 63/603 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +RI  R+ GW  + LS AG  T+ K+V  AIP Y M    +P  +C +++       W
Sbjct  740   LPERIWKRVNGWTDRPLSRAGMETMLKAVAQAIPNYVMSCFRIPVSICEKMKTCIADHWW  799

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G ++  G  KM   +W  ++T K  GG+G R   T N+A + +  WRL T+P++L ++ L
Sbjct  800   GFED--GKKKMHWKSWSWLSTPKFLGGMGFREFTTFNQAMLGRQCWRLLTDPDSLCSRVL  857

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y   S S     + +S S  W+ +   RE L  G+   V +GK+ + + D+W+    
Sbjct  858   KGRYFPNS-SFWEAAQPKSPSFTWRSLLFGRELLAKGVRWGVGDGKTIKIFSDNWIPG--  914

Query  1432  LYEKLRGTLGLPELYATVNEYWDK-VRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
                +L  TL      ATV+   ++  R W  + I+   P +  + +  + ++     D  
Sbjct  915   FRPQLVTTLSPFPTDATVSCLMNEDARCWDGDLIRSLFPVDIAKEILQIPISRHGDADFA  974

Query  1255  GWSPDPRGCFSVKSAYGWA---------DNAAR------QEADKVWGLIWSLRVPARISM  1121
              W  D  G +SV+SAY  A          N+ R       E+ K W  +W +  P ++ +
Sbjct  975   SWPHDKLGLYSVRSAYNLARSEAFFADQSNSGRGMASRLLESQKDWKGLWKINAPGKMKI  1034

Query  1120  FIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQRED-LDHLFRRCHDVDRIWRH------  962
              +W   H  + T ++  RRHI S + C  C   R+D ++H+F  C    +IW        
Sbjct  1035  TLWRAAHECLATGFQLRRRHIPSTDGCVFC--NRDDTVEHVFLFCPFAAQIWEEIKGKCA  1092

Query  961   -SLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFN---  794
               L R    +MR      W+   LK                   W +W+ RN    N   
Sbjct  1093  VKLGRNGFSTMRQ-----WIFDFLKRGSSHA-----NTLLAVTFWHIWEARNNTKNNNGT  1142

Query  793   ----RNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERL--SWEKPDEGWLKL  632
                 R ++ +   +D + + +++T               RGG  +    W+ P      +
Sbjct  1143  VHPQRVVIKILSYVDMILKHNTKTVDG-----------QRGGNTQAIPRWQPPPASVWMI  1191

Query  631   NTDGSCTSDGQA-SCGGVLRDTHGNWCRGYTYRIGRCT-STVAEAWGVLQGLRMAKEYGA  458
             N+D +  S  +    G ++RD  G      +  I       +AEA  + + L +AKE G 
Sbjct  1192  NSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLAKEEGL  1251

Query  457   RRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLA  278
               I++  D   ++  ++     +     ++    K A  F+   F+H+ R  N  A  LA
Sbjct  1252  EHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLAAHSLA  1311

Query  277   KWA  269
             + A
Sbjct  1312  RNA  1314



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score =   169 bits (429),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 150/603 (25%), Positives = 256/603 (42%), Gaps = 63/603 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L +RI  R+ GW  + LS AG  T+ K+V  AIP Y M    +P  +C +++       W
Sbjct  783   LPERIWKRVNGWTDRPLSRAGMETMLKAVAQAIPNYVMSCFRIPVSICEKMKTCIADHWW  842

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G ++  G  KM   +W  ++T K  GG+G R   T N+A + +  WRL T+P++L ++ L
Sbjct  843   GFED--GKKKMHWKSWSWLSTPKFLGGMGFREFTTFNQAMLGRQCWRLLTDPDSLCSRVL  900

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               +Y   S S     + +S S  W+ +   RE L  G+   V +GK+ + + D+W+    
Sbjct  901   KGRYFPNS-SFWEAAQPKSPSFTWRSLLFGRELLAKGVRWGVGDGKTIKIFSDNWIPG--  957

Query  1432  LYEKLRGTLGLPELYATVNEYWDK-VRGWKWEKIQRYLPTEELERLASLCLTEENTPDGW  1256
                +L  TL      ATV+   ++  R W  + I+   P +  + +  + ++     D  
Sbjct  958   FRPQLVTTLSPFPTDATVSCLMNEDARCWDGDLIRSLFPVDIAKEILQIPISRHGDADFA  1017

Query  1255  GWSPDPRGCFSVKSAYGWA---------DNAARQ------EADKVWGLIWSLRVPARISM  1121
              W  D  G +SV+SAY  A          N+ R       E+ K W  +W +  P ++ +
Sbjct  1018  SWPHDKLGLYSVRSAYNLARSEAFFADQSNSGRGMASRLLESQKDWKGLWKINAPGKMKI  1077

Query  1120  FIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQRED-LDHLFRRCHDVDRIWRH------  962
              +W   H  + T ++  RRHI S + C  C   R+D ++H+F  C    +IW        
Sbjct  1078  TLWRAAHECLATGFQLRRRHIPSTDGCVFC--NRDDTVEHVFLFCPFAAQIWEEIKGKCA  1135

Query  961   -SLQRRTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFN---  794
               L R    +MR      W+   LK                   W +W+ RN    N   
Sbjct  1136  VKLGRNGFSTMRQ-----WIFDFLKRGSSHA-----NTLLAVTFWHIWEARNNTKNNNGT  1185

Query  793   ----RNLLPLEQKLDWLRRCDSETAAAFEERHWPLQRHNRGGEERL--SWEKPDEGWLKL  632
                 R ++ +   +D + + +++T               RGG  +    W+ P      +
Sbjct  1186  VHPQRVVIKILSYVDMILKHNTKTVDG-----------QRGGNTQAIPRWQPPPASVWMI  1234

Query  631   NTDGSCTSDGQA-SCGGVLRDTHGNWCRGYTYRIGRCT-STVAEAWGVLQGLRMAKEYGA  458
             N+D +  S  +    G ++RD  G      +  I       +AEA  + + L +AKE G 
Sbjct  1235  NSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLAKEEGL  1294

Query  457   RRIMIECDSKMLVEALKGKETGQEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLA  278
               I++  D   ++  ++     +     ++    K A  F+   F+H+ R  N  A  LA
Sbjct  1295  EHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLAAHSLA  1354

Query  277   KWA  269
             + A
Sbjct  1355  RNA  1357



>gb|EAZ40645.1| hypothetical protein OsJ_25114 [Oryza sativa Japonica Group]
Length=560

 Score =   165 bits (418),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 157/550 (29%), Positives = 240/550 (44%), Gaps = 57/550 (10%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L DRI  R++GWK K LS  G+  L K+V  AIP + M    L K +C +I K   R+ W
Sbjct  7     LKDRIWQRIQGWKEK-LSRTGKEVLIKAVAQAIPTFAMGCFDLTKDICEQISKMIARYWW  65

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                E+   NKM  ++W+ +T  K  GGLG R++H  N A + K GWRL   P +L A+ L
Sbjct  66    SNQEKE--NKMHWLSWEKLTEPKWAGGLGFRDIHAFNLAMLAKQGWRLIQNPESLCAQVL  123

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWL----  1445
               KY+  SG+     +  ++S  W+ I     TL  G+   V NG +   W D W+    
Sbjct  124   KAKYYP-SGNIFSAKKCANMSYTWRSICRGLLTLRDGMIWRVGNGAAINIWSDPWIPSDH  182

Query  1444  TAKPLYEKLRGTLGLPELYATVNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENT  1268
             T +P+  + R       L   V E  D   G W  E + +    E++  + ++ +  E  
Sbjct  183   TRRPITPRGRN------LVTRVEELIDPSTGSWDVELLTQTFWPEDVNMIRTIPVHIE-M  235

Query  1267  PDGWGWSPDPRGCFSVKSAYGWADNAARQ--------------EADKVWGLIWSLRVPAR  1130
              D   W  D +G FSVKSAY    +   Q              E +  W  +W +++P +
Sbjct  236   DDMLAWHYDEKGLFSVKSAYKVQRDGELQRRKRGSAGLSNGSTEREMYWKKVWKMQLPGK  295

Query  1129  ISMFIWLVKHGRVLTNYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQR  950
             +  FIW   H  +       +R +  +  C  C    ED  HLF +C  V ++W+     
Sbjct  296   VKHFIWRFSHNILALRVNLQQRGMDLDSRCIICNRMNEDAGHLFFKCKKVKKVWQ-----  350

Query  949   RTEESMRNLDWNSWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQ  770
               E ++  L        + +   +  F     E     +  LW+W +E    RN +   +
Sbjct  351   --ENNLEILRQELAEKRSGREVMETVFNRPAKEILLASI-TLWQWWSE----RNRVQEGE  403

Query  769   KLDWLRRCDSE---TAAAFEERHWPLQRHN--RGGEERLSWEKPDEGWLKLNTDGSCTSD  605
             +     R  SE     AA  E +  L + +  R       W + D+G +K+NTDG+   D
Sbjct  404   R----GRSPSELGFIIAALAEEYMKLNKKDSKRAPSRNEKWSRTDQGVMKINTDGAF--D  457

Query  604   GQASCGG---VLRDTHGNWCRGYTYRIGRCTSTV-AEAWGVLQGLRMAKEYGARRIMIEC  437
                  GG    +RD  G   +    ++    +   AEA     G+R A E G +R+  E 
Sbjct  458   PFTRTGGWGFAIRDHSGKVVKSGAGKVQILMNAFHAEALACAAGIRAASECGMQRVTAET  517

Query  436   DSKMLVEALK  407
             DS ML  AL+
Sbjct  518   DSTMLKSALE  527



>ref|XP_006485451.1| PREDICTED: uncharacterized protein LOC102622884 [Citrus sinensis]
Length=1160

 Score =   169 bits (427),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 138/579 (24%), Positives = 253/579 (44%), Gaps = 29/579 (5%)
 Frame = -1

Query  1963  RISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIWGRD  1784
             ++  ++  W+ K  S  G+  L K+ + AIP + M    +P G+C +I++    F WG  
Sbjct  541   KVLNKISSWQHKFFSCGGKEVLIKAAVQAIPAFAMSVFKIPLGICEDIQRIVGNFWWGSS  600

Query  1783  EQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTLTTK  1604
              +  +   S   W+ ++  K +GG+G R+  + N+A + K GWR++  P++L A+ L  +
Sbjct  601   RERRSIHWS--KWEKMSQAKCKGGMGFRDFASFNQALLAKQGWRIQQCPDSLVARVLQAR  658

Query  1603  YHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKPLYE  1424
             Y H S + L      + S  W+ I   R+ +  G    + NG+       +W+  KP   
Sbjct  659   YFH-SSNFLNAKIGSNPSYIWRSILWGRQIICGGSRWRIGNGQDVHIHKANWIP-KPFTF  716

Query  1423  KLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWGWSP  1244
             K      +P   A V+E  +    W  E I ++    + + +  + L      D   W  
Sbjct  717   KPVIKPTMPS-EALVSELINGENCWDEELIYKHFDKMDADVITQIPLPRRLREDELIWHF  775

Query  1243  DPRGCFSVKSAYGWADN-------AARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLT  1085
                G ++VKS Y  A         ++ + +   W +IWSL +P +I +F+W      + +
Sbjct  776   GKSGQYTVKSGYQRALKIRFPAMPSSSESSKNEWNIIWSLALPKKIRIFVWRAAKNLLPS  835

Query  1084  NYERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHSLQRRTEESMRNLDWNSWL  905
                  +R I     C  C    E++ H    C    ++WR SL     ++    D     
Sbjct  836   AENLWKRKIVQEPTCQLCKMGIENVFHALVDCKAAKKVWRLSLFYIDIQAAPGQD-----  890

Query  904   TMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFN---RNLLPLEQKLDWLRRCDSET  734
              ++L    ++       + F   LW  W  RN+ +F     N   +  K + +       
Sbjct  891   ILSLLHGVKRMRSNADVDLFAVMLWAKWNARNQWLFKGKRENPQSVVAKAEAVMEAYKRV  950

Query  733   AAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQ-ASCGGVLRDTHGNW  557
               + +  H   Q+       +L W  P EG++K+NTD +  S+   A  G V+RD +G  
Sbjct  951   QPSADVSHGKQQK-----VAQLGWNPPQEGFVKINTDAATNSEKNLAGLGAVIRDENGQ-  1004

Query  556   CRGYTYRIGRCTSTV--AEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQ  383
                   ++ +   +V  AEA  +  GL++AK+   + +++E DS+ +V  +  ++  + +
Sbjct  1005  VTATAIKVSKFHGSVAYAEAEAMEWGLQVAKDAHVKDVIMESDSQEVVSLVNNRQGSRSE  1064

Query  382   NNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWAL  266
                +V    K  E+F  V  ++ +R  N +A  L K AL
Sbjct  1065  IYWVVLEIQKLKESFDHVSCVYTHRSCNAIAHSLVKIAL  1103



>emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score =   169 bits (428),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 149/574 (26%), Positives = 236/574 (41%), Gaps = 28/574 (5%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L+DRI  +L+GWK K LS AG+  L KSV+ AIP Y M     P  +  +I+    RF W
Sbjct  772   LIDRIWKKLQGWKEKLLSRAGKEVLLKSVIQAIPTYLMGVYKFPVFIIQKIQSAMARFWW  831

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
             G  +     K+    WD +   K  GG+G ++L   N A + +  WRL  EP +L  + +
Sbjct  832   GSSDT--QRKIHWKNWDSMCNLKCFGGMGFKDLTIFNDALLGRQAWRLTREPQSLLGRVM  889

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               KY       L      S S +W  I + +  L+ G+   V NG     W D W+    
Sbjct  890   KAKYFPNC-DFLNAPLGHSSSYSWSSIWSSKALLKEGVIWRVGNGSQINMWSDPWV----  944

Query  1432  LYEKLRGTLGLPELYAT-VNEYWDKVRG-WKWEKIQRYLPTEELERLASLCLTEENTPDG  1259
             L E  R     P      V+E  D  R  WK   ++ +L   +L  + +  L+    PD 
Sbjct  945   LDEGGRFLTSTPHASIRWVSELIDFDRMEWKTSLLESFLNERDLRCILASPLSATPVPDE  1004

Query  1258  WGWSPDPRGCFSVKSAYGWADNAARQEADKVWGLIWSLRVPARISMFIWLVKHGRVLTNY  1079
               W+      +SVK+AY            + W  IWSL V  ++  F+W +    +    
Sbjct  1005  LTWAFTKDATYSVKTAYMIGKGGNLDNFHQAWVDIWSLDVSPKVRHFLWRLCTTSLPVRS  1064

Query  1078  ERTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWRHS-----LQRRTEESMRNLDWN  914
                 RH+T ++ C    G+ E   H    C  +  +W  S       R    SM +L   
Sbjct  1065  LLKHRHLTDDDLCPWGCGEIETQRHAIFDCPKMRDLWLDSGCQNLCSRDASMSMCDL-LV  1123

Query  913   SWLTMNLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSET  734
             SW +++ K   +  +            W +W  RN  +FN    P    +  + R   E 
Sbjct  1124  SWRSLDGKLRIKGAYLA----------WCIWGERNAKIFNNKTTPSSVLMQRVSRLVEEN  1173

Query  733   AAAFEERHWPLQRHNRGGEERLSWEKPDEGWLKLNTDGSCTSDGQASCGGVLRDTHGNWC  554
              +     + PL     G   +  W  P    +KLN D S   DG      + R + G   
Sbjct  1174  GSHARRIYQPLVPRRTGSPRQ--WIAPPADSIKLNVDASLAVDGWVGLSVIARRSDGGVL  1231

Query  553   RGYTYRI-GRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKMLVEALKGKETGQEQNN  377
                  R+       +AEA  V   +++ + YG +R+++E D ++++  L          +
Sbjct  1232  FAAVRRVRAYWAPEIAEAKAVELAVKLGRRYGLQRVILESDCQVVINRLSKNAIFLSDLD  1291

Query  376   NIVRRCIKEAENFLAVVFLHIYREQNKLADKLAK  275
              ++   +     F +VV+ H+ R+ N +A  LAK
Sbjct  1292  LVLFNILASCTYFSSVVWSHVKRDGNYVAHHLAK  1325



>ref|XP_008358855.1| PREDICTED: uncharacterized protein LOC103422573 [Malus domestica]
Length=1419

 Score =   169 bits (427),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 164/630 (26%), Positives = 244/630 (39%), Gaps = 52/630 (8%)
 Frame = -1

Query  1972  LLDRISARLEGWKAKTLSLAGRVTLAKSVLNAIPIYTMQTAALPKGVCSEIEKRTRRFIW  1793
             L D+  A+L GWK K LS+ GRV L +SV  ++ +++      P  +   + +  R FIW
Sbjct  776   LADKAKAKLTGWKXKLLSMXGRVQLTQSVFQSMLLHSFXVYKWPSSLLRXLSRCARNFIW  835

Query  1792  GRDEQSGNNKMSLVAWDIITTDKTRGGLGLRNLHTMNRACMMKLGWRLKTEPNTLWAKTL  1613
                  S       V+W  I   K  GGLGLR+L ++N   ++KLGW + T  ++ W+   
Sbjct  836   SGXVTS--KXXVTVSWXQICAXKNEGGLGLRDLGSLNTTALLKLGWLIITT-DSPWSIYJ  892

Query  1612  TTKYHHRSGSHLVTTRRRSISNAWKGISAERETLESGLTHVVRNGKSTRFWMDSWLTAKP  1433
               ++      +  +  R SI   W GI +    L      V+ NG +T  W+D WL  KP
Sbjct  893   RXRFKLHGRLYSCSYXRSSI---WPGIKSILHILFQNCRWVIGNGSTTSLWVDKWLD-KP  948

Query  1432  LYEKLRGTLGLPELYATVNEYWDKVRGWKWEKIQRYLPTEELERLASLCLTEENTPDGWG  1253
             + + +  T   P    T       +  W    I      +  + +  + L  +   D   
Sbjct  949   IVDVVGATXIAPSXSRTKVSNIIXMGXWVIPSIFSXXFPDLTKEILEMPLPIDEDKDVLI  1008

Query  1252  WSPDPRGCFSVKSAYGWADNAARQEADKVWG-LIWSLRVPARISMFIWLVKHGRVLTNYE  1076
             W     G FS    Y   +    +   K W  +IW   +P R S+ +W +   ++ T  +
Sbjct  1009  WEXSXSGXFSFSDGY---EIVRHRFPVKSWASIIWXPFIPPRYSILVWKILFNKLPTEDQ  1065

Query  1075  RTRRHITSNEYCYNCAGQREDLDHLFRRCHDVDRIWR-HSLQRRTEESMRNLDWNSWLTM  899
               RR I     C  C    E ++HLF  C      WR  + Q  T         + WL  
Sbjct  1066  LQRRGIXLAPICQLCHKNSESIBHLFSSCXFAQCAWRWLATQFGTXIXPXGSLSDLWLXF  1125

Query  898   NLKGDRQQGFEEGWPERFGTRLWWLWKWRNEAVFNRNLLPLEQKLDWLRRCDSETAAAFE  719
              L           W       L  +WK RN+  F       E K     R    T A   
Sbjct  1126  -LSKRFSPHLXNVWLASGFFLLMAIWKMRNKVKF-------EGKPPSFSRLCRSTXAWIR  1177

Query  718   ERHWPLQRHNRGGEER--------------------LSWEKPDEGWLKLNTDGSCTSD-G  602
             +       H RG  +R                      W  P   W K+NTDG    + G
Sbjct  1178  QVGALTPGHVRGXLDRQLLVSLGISPNXCKAPSIVXXXWHPPPXSWXKVNTDGLAKGNPG  1237

Query  601   QASCGGVLRDTHGNWCRGYTYRIGRCTSTVAEAWGVLQGLRMAKEYGARRIMIECDSKML  422
              A+CGGV RD+ G +  G++  +G  TS  AE   V+    +A   G   + +E DS  +
Sbjct  1238  XAACGGVFRDSXGYFLGGFSLSLGHRTSFYAELHXVILAXELAHARGWXNLWLESDSSSV  1297

Query  421   VEALKGKETG-----QEQNNNIVRRCIKEAENFLAVVFLHIYREQNKLADKLAKWALTTQ  257
             +              Q + NN    C    +N +     HI+RE N +ADKLA   L + 
Sbjct  1298  ISCFASXSFSPPWSLQTRWNN----CTLXLQN-MXFRCSHIFREGNXVADKLANLGLLSS  1352

Query  256   GGLHIFEVPPGEFEVRMALDRLGASSPRRV  167
               L     PP E    +  D LG  + R +
Sbjct  1353  -SLVWHSTPPIEILPPLHSDFLGMPTYRNI  1381



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5869337085684