BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22689_g1_i4 len=873 path=[1097:0-400 82:401-501 1597:502-543
1638:544-620 215:621-872]

Length=873
                                                                      Score     E

emb|CAN65555.1|  hypothetical protein VITISV_009833                     148   4e-38   Vitis vinifera
emb|CAN75351.1|  hypothetical protein VITISV_031045                     144   5e-37   Vitis vinifera
emb|CAN83877.1|  hypothetical protein VITISV_014760                     148   1e-36   Vitis vinifera
ref|YP_002000554.1|  orf490                                             146   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|YP_514636.1|  hypothetical protein OrsaiPp07                        146   2e-36   Oryza sativa Indica Group [Indian rice]
gb|AAP20859.1|  retrotransposon protein, putative, Ty1-copia sub-...    144   2e-36   Oryza sativa Japonica Group [Japonica rice]
emb|CAN61827.1|  hypothetical protein VITISV_027629                     147   2e-36   Vitis vinifera
gb|EEC76475.1|  hypothetical protein OsI_14210                          144   3e-36   Oryza sativa Indica Group [Indian rice]
gb|AAP53968.1|  retrotransposon protein, putative, Ty1-copia subc...    146   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001175678.1|  Os08g0544300                                       144   7e-35   
gb|ABA97008.1|  retrotransposon protein, putative, Ty1-copia subc...    145   8e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_085537.1|  hypothetical protein ArthMp070                        136   1e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAL86510.1|AC099040_14  putative retrotransposon protein             144   2e-34   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95366.1|  retrotransposon protein, putative, Ty1-copia subc...    141   2e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AAR88589.1|  putative copia-like retrotransposon protein             144   2e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AAM18766.1|AC099325_22  putative copia-like retrotransposon Ho...    144   2e-34   Oryza sativa Japonica Group [Japonica rice]
gb|ABB47033.2|  retrotransposon protein, putative, Ty1-copia subc...    144   2e-34   Oryza sativa Japonica Group [Japonica rice]
emb|CAN61640.1|  hypothetical protein VITISV_021909                     144   2e-34   Vitis vinifera
gb|ACF87376.2|  unknown                                                 140   3e-34   Zea mays [maize]
gb|AAT07563.1|  putative polyprotein                                    143   4e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AAL66754.1|AF464738_5  putative copia-like retrotransposon Hop...    142   5e-34   Zea mays [maize]
gb|ABF97142.1|  retrotransposon protein, putative, Ty1-copia subc...    140   5e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AAT85031.1|  putative polyprotein                                    142   6e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008665078.1|  PREDICTED: retrovirus-related Pol polyprotei...    140   9e-34   
gb|ACY72569.1|  unknown                                                 142   1e-33   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67640.1|  H0102C09.1                                             142   1e-33   Oryza sativa [red rice]
gb|AAU10682.1|  putative polyprotein                                    141   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006575791.1|  PREDICTED: uncharacterized mitochondrial pro...    132   1e-33   
gb|AAK55460.1|AC069300_15  putative gag-pol polyprotein                 141   1e-33   Oryza sativa Japonica Group [Japonica rice]
gb|AAK53860.1|AC016781_14  Putative retroelement                        140   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|AAB82754.1|  retrofit                                                140   3e-33   Oryza longistaminata [long-staminate rice]
gb|AAM15418.1|  hypothetical protein                                    136   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002456118.1|  hypothetical protein SORBIDRAFT_03g030787          140   3e-33   Sorghum bicolor [broomcorn]
gb|AAM15511.1|  hypothetical protein                                    135   3e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAX95823.1|  retrotransposon protein, putative, unclassified         131   4e-33   Oryza sativa Japonica Group [Japonica rice]
gb|ABF95666.1|  retrotransposon protein, putative, Ty1-copia subc...    139   4e-33   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95065.1|  retrotransposon protein, putative, Ty1-copia subc...    139   5e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002457887.1|  hypothetical protein SORBIDRAFT_03g018791          137   7e-33   Sorghum bicolor [broomcorn]
ref|XP_002460196.1|  hypothetical protein SORBIDRAFT_02g024427          139   8e-33   Sorghum bicolor [broomcorn]
ref|XP_002489074.1|  hypothetical protein SORBIDRAFT_0139s002040        139   8e-33   Sorghum bicolor [broomcorn]
ref|XP_004980236.1|  PREDICTED: uncharacterized mitochondrial pro...    128   1e-32   
emb|CAN68364.1|  hypothetical protein VITISV_021899                     135   1e-32   Vitis vinifera
gb|ABA93844.2|  retrotransposon protein, putative, unclassified         138   1e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002438095.1|  hypothetical protein SORBIDRAFT_10g007953          138   1e-32   Sorghum bicolor [broomcorn]
dbj|BAB90546.1|  putative rice retrotransposon retrofit gag/pol p...    138   1e-32   Oryza sativa Japonica Group [Japonica rice]
gb|AAK02020.2|AC074283_1  Putative gag-pol polyprotein                  138   2e-32   Oryza sativa [red rice]
ref|XP_002451986.1|  hypothetical protein SORBIDRAFT_04g012210          137   2e-32   Sorghum bicolor [broomcorn]
emb|CAR66103.1|  RT-RNaseH                                              134   2e-32   Triticum turgidum subsp. durum
gb|AAT69582.1|  putative polyprotein                                    137   2e-32   Oryza sativa Japonica Group [Japonica rice]
gb|AAN06870.1|  Putative gag-pol polyprotein                            137   2e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67061.1|  H0112G12.6                                             136   3e-32   Oryza sativa [red rice]
gb|AAD22155.1|AF061282_8  polyprotein                                   137   3e-32   Sorghum bicolor [broomcorn]
ref|XP_004966848.1|  PREDICTED: uncharacterized protein LOC101777861    137   4e-32   
ref|XP_004954854.1|  PREDICTED: uncharacterized mitochondrial pro...    128   4e-32   
ref|XP_002489126.1|  hypothetical protein SORBIDRAFT_0019s003280        135   5e-32   Sorghum bicolor [broomcorn]
ref|XP_010239037.1|  PREDICTED: uncharacterized protein LOC104584914    134   5e-32   
emb|CAE04319.3|  OSJNBb0016D16.10                                       136   5e-32   Oryza sativa [red rice]
gb|AAX96193.1|  retrotransposon protein, putative, Ty1-copia sub-...    136   8e-32   Oryza sativa Japonica Group [Japonica rice]
gb|ACA61613.1|  hypothetical protein AP2_E11.1                          132   8e-32   Arabidopsis lyrata subsp. petraea
gb|AAK53852.1|AC016781_6  Putative retroelement                         135   9e-32   Oryza sativa Japonica Group [Japonica rice]
pir||T02087  gag/pol polyprotein - maize retrotransposon Hopscotch      136   9e-32
gb|ABA98049.1|  retrotransposon protein, putative, Ty1-copia subc...    135   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98286.2|  retrotransposon protein, putative, Ty1-copia subc...    135   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453623.1|  hypothetical protein SORBIDRAFT_04g009135          134   2e-31   Sorghum bicolor [broomcorn]
gb|AAU10819.1|  putative polyprotein                                    135   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002442174.1|  hypothetical protein SORBIDRAFT_08g015513          134   2e-31   Sorghum bicolor [broomcorn]
gb|ACV42639.1|  gag/pol                                                 135   2e-31   
gb|AAL34933.1|AC079037_6  Putative gag-pol polyprotein                  133   2e-31   Oryza sativa [red rice]
gb|AAM08751.1|AC025098_18  Putative copia-type polyprotein              135   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|ABA97658.1|  retrotransposon protein, putative, Ty1-copia subc...    135   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008665853.1|  PREDICTED: protein SHOOT GRAVITROPISM 6-like       135   3e-31   
ref|XP_002444394.1|  hypothetical protein SORBIDRAFT_07g021220          132   3e-31   Sorghum bicolor [broomcorn]
gb|AEJ07956.1|  putative polyprotein                                    131   3e-31   
gb|EMT21953.1|  ABC transporter C family member 10                      135   4e-31   
emb|CAN71258.1|  hypothetical protein VITISV_043225                     133   5e-31   Vitis vinifera
emb|CAN67588.1|  hypothetical protein VITISV_036280                     134   5e-31   Vitis vinifera
emb|CAE04646.2|  OSJNBa0061G20.2                                        130   7e-31   Oryza sativa Japonica Group [Japonica rice]
gb|KHN20350.1|  Putative mitochondrial protein                          126   9e-31   
emb|CCH50966.1|  T4.5                                                   133   1e-30   
ref|XP_008646585.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    132   1e-30   
ref|XP_008366454.1|  PREDICTED: uncharacterized protein LOC103430102    130   1e-30   
ref|XP_002445564.1|  hypothetical protein SORBIDRAFT_07g021665          130   1e-30   Sorghum bicolor [broomcorn]
gb|ABG00000.1|  retrotransposon protein, putative, Ty1-copia subc...    133   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004959292.1|  PREDICTED: uncharacterized mitochondrial pro...    125   1e-30   
gb|ABA97652.1|  retrotransposon protein, putative, Ty1-copia subc...    132   2e-30   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95721.1|  retrotransposon protein, putative, Ty1-copia subc...    132   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002444329.1|  hypothetical protein SORBIDRAFT_07g020255          132   2e-30   Sorghum bicolor [broomcorn]
gb|ABF94964.1|  retrotransposon protein, putative, Ty1-copia subc...    131   2e-30   Oryza sativa Japonica Group [Japonica rice]
gb|AAU43956.1|  unknown protein                                         132   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004963727.1|  PREDICTED: uncharacterized protein LOC101777694    132   2e-30   
ref|XP_002446435.1|  hypothetical protein SORBIDRAFT_06g016046          131   2e-30   Sorghum bicolor [broomcorn]
ref|XP_002444548.1|  hypothetical protein SORBIDRAFT_07g023610          130   3e-30   Sorghum bicolor [broomcorn]
ref|XP_008366917.1|  PREDICTED: uncharacterized protein LOC103430548    130   3e-30   
emb|CAN62227.1|  hypothetical protein VITISV_008101                     128   4e-30   Vitis vinifera
ref|XP_002466349.1|  hypothetical protein SORBIDRAFT_01g006185          128   4e-30   Sorghum bicolor [broomcorn]
gb|AAG46116.1|AC073166_14  putative copia-like retrotransposon po...    131   4e-30   Oryza sativa [red rice]
gb|ABF96081.1|  retrotransposon protein, putative, Ty1-copia subc...    131   4e-30   Oryza sativa Japonica Group [Japonica rice]
gb|AAG13591.2|AC051633_7  putative gag/pol polyprotein                  131   4e-30   Oryza sativa [red rice]
ref|XP_010065142.1|  PREDICTED: uncharacterized protein LOC104452376    130   6e-30   
gb|AAW56918.1|  putative polyprotein                                    130   6e-30   Oryza sativa Japonica Group [Japonica rice]
emb|CAN67403.1|  hypothetical protein VITISV_025614                     130   7e-30   Vitis vinifera
ref|XP_002489193.1|  hypothetical protein SORBIDRAFT_0013s009070        130   1e-29   Sorghum bicolor [broomcorn]
ref|XP_008356535.1|  PREDICTED: uncharacterized protein LOC103420252    130   1e-29   
emb|CAN83871.1|  hypothetical protein VITISV_044470                     122   1e-29   Vitis vinifera
emb|CAN68489.1|  hypothetical protein VITISV_037543                     130   1e-29   Vitis vinifera
ref|XP_010069795.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    130   1e-29   
gb|ABW81031.1|  LTRGag-pol-polymerase 3                                 129   2e-29   Arabidopsis lyrata subsp. lyrata
ref|NP_001174286.1|  Os05g0235100                                       127   3e-29   
ref|XP_010694315.1|  PREDICTED: uncharacterized protein LOC104907126    125   5e-29   
ref|XP_002455933.1|  hypothetical protein SORBIDRAFT_03g027495          126   5e-29   Sorghum bicolor [broomcorn]
emb|CAN73071.1|  hypothetical protein VITISV_032383                     127   8e-29   Vitis vinifera
gb|AAT93988.1|  putative polyprotein                                    127   8e-29   Oryza sativa Japonica Group [Japonica rice]
gb|ABA94664.1|  retrotransposon protein, putative, unclassified         127   9e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008376990.1|  PREDICTED: uncharacterized protein LOC103440084    126   1e-28   
ref|XP_010686475.1|  PREDICTED: uncharacterized protein LOC104900682    127   1e-28   
ref|XP_004963982.1|  PREDICTED: uncharacterized protein LOC101777276    126   1e-28   
gb|ABA99152.1|  retrotransposon protein, putative, unclassified         126   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AIG20414.1|  RVT_2 super family protein                              125   2e-28   
gb|AAT85012.1|  putative reverse transcriptase                          122   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011010893.1|  PREDICTED: uncharacterized protein LOC105115645    126   2e-28   
gb|AAK51235.1|AF287471_1  polyprotein                                   126   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAD21687.1|  Strong similarity to gi|3600044 T12H20.12 proteas...    125   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010039234.1|  PREDICTED: uncharacterized protein LOC104427926    125   3e-28   
gb|ABA91195.1|  retrotransposon protein, putative, Ty1-copia subc...    125   3e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CAN64816.1|  hypothetical protein VITISV_010668                     125   4e-28   Vitis vinifera
ref|XP_010430787.1|  PREDICTED: uncharacterized protein LOC104715028    125   4e-28   
ref|XP_010669333.1|  PREDICTED: copia protein isoform X1                125   4e-28   
ref|XP_009359358.1|  PREDICTED: uncharacterized protein LOC103949948    125   4e-28   
ref|XP_004966833.1|  PREDICTED: uncharacterized protein LOC101766505    124   5e-28   
ref|XP_002443133.1|  hypothetical protein SORBIDRAFT_08g010840          124   5e-28   Sorghum bicolor [broomcorn]
emb|CAN68274.1|  hypothetical protein VITISV_032833                     123   6e-28   Vitis vinifera
gb|AAP52546.1|  retrotransposon protein, putative, Ty1-copia subc...    123   8e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004986808.1|  PREDICTED: uncharacterized protein LOC101773259    124   1e-27   
ref|XP_006605007.1|  PREDICTED: uncharacterized mitochondrial pro...    119   1e-27   
emb|CAN78447.1|  hypothetical protein VITISV_026810                     123   1e-27   Vitis vinifera
gb|AGV40508.1|  hypothetical protein                                    123   1e-27   
emb|CAN83285.1|  hypothetical protein VITISV_004139                     124   2e-27   Vitis vinifera
gb|AAD43604.1|AC005698_3  T3P18.3                                       123   2e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CAN68496.1|  hypothetical protein VITISV_010947                     124   2e-27   Vitis vinifera
emb|CAC37623.1|  copia-like polyprotein                                 123   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002489309.1|  hypothetical protein SORBIDRAFT_0010s008890        123   2e-27   Sorghum bicolor [broomcorn]
emb|CAN61230.1|  hypothetical protein VITISV_010115                     120   2e-27   Vitis vinifera
ref|XP_010683797.1|  PREDICTED: uncharacterized protein LOC104898410    122   3e-27   
emb|CAN60203.1|  hypothetical protein VITISV_036059                     123   3e-27   Vitis vinifera
emb|CAN72498.1|  hypothetical protein VITISV_010513                     123   3e-27   Vitis vinifera
ref|XP_002449547.1|  hypothetical protein SORBIDRAFT_05g018930          121   3e-27   Sorghum bicolor [broomcorn]
ref|XP_010666841.1|  PREDICTED: uncharacterized protein LOC104883959    122   3e-27   
ref|XP_008341972.1|  PREDICTED: uncharacterized protein LOC103404787    122   3e-27   
emb|CAB10381.1|  retrotransposon like protein                           118   4e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ACP30598.1|  disease resistance protein                              122   4e-27   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_002445301.1|  hypothetical protein SORBIDRAFT_07g008525          121   4e-27   Sorghum bicolor [broomcorn]
ref|XP_008366955.1|  PREDICTED: uncharacterized protein LOC103430588    120   4e-27   
ref|XP_010534677.1|  PREDICTED: uncharacterized protein LOC104810178    119   4e-27   
emb|CAN76151.1|  hypothetical protein VITISV_012673                     122   4e-27   Vitis vinifera
ref|XP_004967003.1|  PREDICTED: uncharacterized mitochondrial pro...    114   4e-27   
gb|KHN45218.1|  Putative mitochondrial protein                          117   5e-27   
emb|CBI32394.3|  unnamed protein product                                122   5e-27   
emb|CAN81355.1|  hypothetical protein VITISV_039158                     122   5e-27   Vitis vinifera
emb|CAN78451.1|  hypothetical protein VITISV_005945                     120   6e-27   Vitis vinifera
emb|CAN64288.1|  hypothetical protein VITISV_022326                     122   7e-27   Vitis vinifera
emb|CAN73924.1|  hypothetical protein VITISV_041509                     122   7e-27   Vitis vinifera
emb|CAN74921.1|  hypothetical protein VITISV_022027                     119   7e-27   Vitis vinifera
emb|CAN79148.1|  hypothetical protein VITISV_004343                     122   7e-27   Vitis vinifera
gb|ABA98073.1|  retrotransposon protein, putative, unclassified         120   7e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002489175.1|  hypothetical protein SORBIDRAFT_0013s004020        121   8e-27   Sorghum bicolor [broomcorn]
ref|XP_008341155.1|  PREDICTED: uncharacterized protein LOC103404078    121   9e-27   
gb|AID60162.1|  copia-like LTR-retrotransposon                          120   9e-27   
ref|XP_008228040.1|  PREDICTED: uncharacterized protein LOC103327479    121   1e-26   
emb|CAN59952.1|  hypothetical protein VITISV_006720                     121   1e-26   Vitis vinifera
emb|CAN63683.1|  hypothetical protein VITISV_030301                     121   1e-26   Vitis vinifera
gb|ABA94767.2|  retrotransposon protein, putative, unclassified         121   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AID60119.1|  hypothetical protein                                    120   1e-26   
ref|XP_006603141.1|  PREDICTED: uncharacterized mitochondrial pro...    115   1e-26   
emb|CAN59963.1|  hypothetical protein VITISV_022756                     118   1e-26   Vitis vinifera
ref|XP_008389560.1|  PREDICTED: uncharacterized protein LOC103451895    120   2e-26   
ref|XP_004971463.1|  PREDICTED: uncharacterized mitochondrial pro...    116   2e-26   
ref|XP_010684978.1|  PREDICTED: uncharacterized protein LOC104899479    120   2e-26   
emb|CAN66863.1|  hypothetical protein VITISV_013500                     120   2e-26   Vitis vinifera
ref|XP_004954648.1|  PREDICTED: uncharacterized mitochondrial pro...    114   2e-26   
dbj|BAM42647.1|  polyprotein                                            120   3e-26   
gb|KHN44882.1|  Putative mitochondrial protein                          114   3e-26   
dbj|BAM44531.1|  polyprotein                                            120   3e-26   
dbj|BAM42650.1|  Polyprotein                                            120   3e-26   
dbj|BAM44530.1|  polyprotein                                            120   3e-26   
dbj|BAM42646.1|  polyprotein                                            120   3e-26   
dbj|BAA78427.1|  polyprotein                                            120   3e-26   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM44532.1|  polyprotein                                            120   3e-26   
dbj|BAM44529.1|  polyprotein                                            120   3e-26   
emb|CAN71553.1|  hypothetical protein VITISV_034738                     119   3e-26   Vitis vinifera
dbj|BAA78424.1|  polyprotein                                            119   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAC79110.1|  putative polyprotein of LTR transposon                  120   3e-26   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM44535.1|  polyprotein                                            119   3e-26   
emb|CAN69370.1|  hypothetical protein VITISV_010057                     117   3e-26   Vitis vinifera
dbj|BAM44534.1|  polyprotein                                            119   4e-26   
emb|CAN66359.1|  hypothetical protein VITISV_018312                     117   4e-26   Vitis vinifera
ref|XP_008358376.1|  PREDICTED: uncharacterized protein LOC103422119    119   6e-26   
emb|CAA19714.1|  putative protein                                       118   6e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44388.1|  hypothetical protein AALP_AA1G251100                    119   6e-26   
gb|KDP32454.1|  hypothetical protein JCGZ_13379                         113   7e-26   
gb|ABB47203.2|  retrotransposon protein, putative, unclassified         118   7e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010045758.1|  PREDICTED: uncharacterized protein LOC104434554    117   7e-26   
emb|CAN69607.1|  hypothetical protein VITISV_009561                     118   8e-26   Vitis vinifera
ref|XP_009350454.1|  PREDICTED: nuclear cap-binding protein subun...    117   9e-26   
emb|CAN76078.1|  hypothetical protein VITISV_008973                     118   9e-26   Vitis vinifera
gb|AAN34944.1|  Putative retroelement                                   118   9e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05417.1|  OSJNBa0035I04.5                                        118   9e-26   Oryza sativa [red rice]
gb|KHN17267.1|  Putative mitochondrial protein                          113   9e-26   
ref|XP_006577466.1|  PREDICTED: uncharacterized mitochondrial pro...    114   9e-26   
emb|CAA19715.1|  putative protein                                       118   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAM74347.1|AC115686_14  Putative retroelement                        118   1e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CAN81099.1|  hypothetical protein VITISV_017741                     118   1e-25   Vitis vinifera
emb|CAH66488.1|  OSIGBa0076I14.9                                        118   1e-25   Oryza sativa [red rice]
gb|AAK43485.1|AC084807_10  polyprotein, putative                        117   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30733.1|  hypothetical protein AALP_AA6G020200                    118   2e-25   
ref|XP_006595215.1|  PREDICTED: uncharacterized mitochondrial pro...    112   2e-25   
ref|XP_006465491.1|  PREDICTED: uncharacterized protein LOC102624640    117   2e-25   
dbj|BAM42649.1|  Polyprotein                                            117   2e-25   
dbj|BAA78426.1|  polyprotein                                            117   3e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CAN64509.1|  hypothetical protein VITISV_041217                     117   3e-25   Vitis vinifera
emb|CAN75274.1|  hypothetical protein VITISV_043735                     115   3e-25   Vitis vinifera
ref|XP_006580846.1|  PREDICTED: uncharacterized mitochondrial pro...    110   3e-25   
ref|XP_008228903.1|  PREDICTED: uncharacterized protein LOC103328294    117   3e-25   
ref|XP_006584292.1|  PREDICTED: uncharacterized protein LOC102668041    117   3e-25   
ref|XP_004295686.1|  PREDICTED: uncharacterized mitochondrial pro...    111   3e-25   
ref|XP_006605005.1|  PREDICTED: uncharacterized protein LOC102669234    116   3e-25   
emb|CAN69851.1|  hypothetical protein VITISV_009554                     116   4e-25   Vitis vinifera
ref|XP_009772944.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   5e-25   
ref|XP_008337999.1|  PREDICTED: probable LRR receptor-like serine...    115   6e-25   
emb|CAN71108.1|  hypothetical protein VITISV_001478                     116   6e-25   Vitis vinifera
emb|CAN81057.1|  hypothetical protein VITISV_033321                     112   6e-25   Vitis vinifera
gb|EMT30087.1|  hypothetical protein F775_00021                         115   6e-25   
emb|CAN60809.1|  hypothetical protein VITISV_044451                     112   7e-25   Vitis vinifera
ref|XP_010227141.1|  PREDICTED: uncharacterized protein LOC104581367    115   7e-25   
ref|XP_008680330.1|  PREDICTED: uncharacterized protein LOC103655331    110   8e-25   
gb|AAG12528.1|AC015446_9  Hypothetical Protein                          114   8e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CAN75478.1|  hypothetical protein VITISV_020209                     115   8e-25   Vitis vinifera
ref|XP_004246220.1|  PREDICTED: uncharacterized protein LOC101249672    114   1e-24   
ref|XP_008358596.1|  PREDICTED: uncharacterized protein LOC103422324    115   1e-24   
ref|XP_010493723.1|  PREDICTED: uncharacterized protein LOC104770945    114   1e-24   
gb|KHN07818.1|  Retrovirus-related Pol polyprotein from transposo...    110   1e-24   
ref|XP_008365257.1|  PREDICTED: uncharacterized protein LOC103428904    114   1e-24   
ref|XP_008389883.1|  PREDICTED: uncharacterized protein LOC103452157    114   1e-24   
ref|XP_006481389.1|  PREDICTED: probable LRR receptor-like serine...    114   1e-24   
ref|XP_008365969.1|  PREDICTED: uncharacterized protein LOC103429605    114   2e-24   
ref|XP_008348842.1|  PREDICTED: uncharacterized protein LOC103412011    114   2e-24   
emb|CAN82221.1|  hypothetical protein VITISV_015226                     114   2e-24   Vitis vinifera
emb|CAN60276.1|  hypothetical protein VITISV_028253                     112   2e-24   Vitis vinifera
gb|KHN41724.1|  Copia protein                                           109   2e-24   
emb|CAB40035.1|  retrotransposon like protein                           114   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004304542.1|  PREDICTED: uncharacterized mitochondrial pro...    110   2e-24   
gb|AAC35532.1|  contains similarity to proteases                        114   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008345130.1|  PREDICTED: uncharacterized protein LOC103408038    114   2e-24   
gb|KFK45117.1|  hypothetical protein AALP_AA1G346500                    114   2e-24   
emb|CAN67546.1|  hypothetical protein VITISV_027734                     114   2e-24   Vitis vinifera
ref|XP_008350549.1|  PREDICTED: uncharacterized protein LOC103413885    114   3e-24   
ref|XP_008347011.1|  PREDICTED: uncharacterized protein LOC103410016    114   3e-24   
gb|KFK24063.1|  hypothetical protein AALP_AAs51996U000100               107   4e-24   
ref|XP_008349120.1|  PREDICTED: uncharacterized protein LOC103412315    113   4e-24   
emb|CAN67073.1|  hypothetical protein VITISV_011746                     113   4e-24   Vitis vinifera
ref|XP_008386299.1|  PREDICTED: uncharacterized protein LOC103448812    113   5e-24   
ref|XP_008356672.1|  PREDICTED: uncharacterized protein LOC103420386    113   6e-24   
gb|ABA97278.2|  retrotransposon protein, putative, Ty1-copia subc...    111   6e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008361413.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    112   7e-24   
emb|CAN66306.1|  hypothetical protein VITISV_031415                     107   7e-24   Vitis vinifera
emb|CAN69367.1|  hypothetical protein VITISV_035520                     112   8e-24   Vitis vinifera
emb|CAN70259.1|  hypothetical protein VITISV_002222                     107   8e-24   Vitis vinifera
gb|KFK22153.1|  hypothetical protein AALP_AAs43348U000100               105   9e-24   
ref|XP_006580767.1|  PREDICTED: uncharacterized mitochondrial pro...    106   9e-24   
ref|XP_010501996.1|  PREDICTED: uncharacterized protein LOC104779340    112   9e-24   
gb|AAC67200.1|  putative retroelement pol polyprotein                   112   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|EPS67678.1|  hypothetical protein M569_07096                         111   1e-23   
ref|XP_004488380.1|  PREDICTED: uncharacterized mitochondrial pro...    104   1e-23   
ref|XP_008344301.1|  PREDICTED: uncharacterized protein LOC103407129    111   2e-23   
gb|AAD22324.1|  putative retroelement pol polyprotein                   108   2e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CAN79393.1|  hypothetical protein VITISV_010428                     111   2e-23   Vitis vinifera
gb|AAK62788.1|AC027036_9  polyprotein, putative                         111   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006605238.1|  PREDICTED: uncharacterized mitochondrial pro...    105   2e-23   
emb|CAN73437.1|  hypothetical protein VITISV_031733                     111   2e-23   Vitis vinifera
gb|AAK62793.1|AC027036_14  polyprotein, putative                        111   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004959393.1|  PREDICTED: uncharacterized mitochondrial pro...    106   2e-23   
dbj|BAA78423.1|  polyprotein                                            111   2e-23   
dbj|BAK41511.1|  polyprotein                                            111   2e-23   
emb|CAN76473.1|  hypothetical protein VITISV_016007                     111   2e-23   
emb|CAN77373.1|  hypothetical protein VITISV_008342                     106   2e-23   
emb|CAN59880.1|  hypothetical protein VITISV_029938                     105   3e-23   
emb|CAN65808.1|  hypothetical protein VITISV_033389                     111   3e-23   
emb|CAN81070.1|  hypothetical protein VITISV_037301                     105   3e-23   
emb|CAN69178.1|  hypothetical protein VITISV_024410                     105   3e-23   
ref|XP_008378632.1|  PREDICTED: uncharacterized protein LOC103441708    110   3e-23   
ref|XP_007033044.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    104   4e-23   
emb|CAN70825.1|  hypothetical protein VITISV_039828                     106   4e-23   
emb|CAN67493.1|  hypothetical protein VITISV_022776                     105   4e-23   
emb|CAN75856.1|  hypothetical protein VITISV_005690                     105   4e-23   
gb|AAF99727.1|AC004557_6  F17L21.7                                      110   4e-23   
emb|CAN79136.1|  hypothetical protein VITISV_034813                     105   4e-23   
emb|CAN73073.1|  hypothetical protein VITISV_032385                     105   4e-23   
gb|KHN06274.1|  Retrovirus-related Pol polyprotein from transposo...    110   4e-23   
emb|CAN79734.1|  hypothetical protein VITISV_039266                     106   4e-23   
emb|CAN77797.1|  hypothetical protein VITISV_040893                     102   5e-23   
emb|CAN59895.1|  hypothetical protein VITISV_002882                     105   5e-23   
emb|CAN83125.1|  hypothetical protein VITISV_015109                     110   5e-23   
emb|CAN62447.1|  hypothetical protein VITISV_024007                     110   6e-23   
ref|XP_004297966.1|  PREDICTED: uncharacterized mitochondrial pro...    102   6e-23   
ref|XP_006596628.1|  PREDICTED: uncharacterized mitochondrial pro...    102   6e-23   
emb|CAN70968.1|  hypothetical protein VITISV_033354                     105   6e-23   
ref|XP_008382407.1|  PREDICTED: uncharacterized protein LOC103445199    109   6e-23   
emb|CAN75571.1|  hypothetical protein VITISV_009506                     105   6e-23   
emb|CAN69088.1|  hypothetical protein VITISV_031062                     109   7e-23   
dbj|BAA78425.1|  polyprotein                                            109   8e-23   
gb|AAF63111.1|AC006423_12  Similar to gag-pol polyproteins              109   9e-23   
ref|XP_008392161.1|  PREDICTED: uncharacterized protein LOC103454341    106   1e-22   
ref|XP_010555983.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    109   1e-22   
ref|XP_008386293.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       108   1e-22   
ref|XP_004292800.1|  PREDICTED: uncharacterized mitochondrial pro...    103   1e-22   
emb|CAA16691.1|  retrotransposon - like protein                         108   1e-22   
ref|XP_008374297.1|  PREDICTED: uncharacterized protein LOC103437591    108   1e-22   
emb|CAB46043.1|  retrotransposon like protein                           108   1e-22   
emb|CAN77222.1|  hypothetical protein VITISV_010482                     105   1e-22   
gb|KHN21230.1|  Retrovirus-related Pol polyprotein from transposo...    108   1e-22   
ref|XP_004174143.1|  PREDICTED: uncharacterized mitochondrial pro...    103   1e-22   
gb|AAC02672.1|  polyprotein                                             108   2e-22   
emb|CAN65230.1|  hypothetical protein VITISV_034221                     105   2e-22   
emb|CAN72527.1|  hypothetical protein VITISV_009255                     108   2e-22   
ref|XP_010665060.1|  PREDICTED: uncharacterized protein LOC104882664    107   3e-22   
ref|XP_004295389.1|  PREDICTED: uncharacterized mitochondrial pro...    101   3e-22   
ref|XP_004170499.1|  PREDICTED: uncharacterized mitochondrial pro...  99.8    3e-22   
ref|XP_008381548.1|  PREDICTED: uncharacterized protein LOC103444402    107   3e-22   
emb|CAN62863.1|  hypothetical protein VITISV_030334                     107   3e-22   
ref|XP_008347300.1|  PREDICTED: uncharacterized protein LOC103410364    107   3e-22   
ref|XP_004309959.1|  PREDICTED: uncharacterized mitochondrial pro...    102   3e-22   
gb|AAD41979.1|  putative retroelement pol polyprotein                   107   3e-22   
emb|CAN81771.1|  hypothetical protein VITISV_012076                     103   3e-22   
ref|XP_006582651.1|  PREDICTED: uncharacterized mitochondrial pro...    103   3e-22   
dbj|BAK41507.1|  polyprotein                                            107   3e-22   
gb|ABG22118.1|  polyprotein                                             103   3e-22   
emb|CAN74819.1|  hypothetical protein VITISV_034590                     107   4e-22   
gb|KFK33814.1|  hypothetical protein AALP_AA5G063400                    105   4e-22   
ref|XP_010671929.1|  PREDICTED: uncharacterized protein LOC104888604    107   4e-22   
gb|AAF02855.1|AC009324_4  Similar to retrotransposon proteins           107   4e-22   
ref|XP_008342226.1|  PREDICTED: uncharacterized protein LOC103405031    107   4e-22   
ref|XP_006598379.1|  PREDICTED: uncharacterized mitochondrial pro...    103   5e-22   
emb|CAN79884.1|  hypothetical protein VITISV_002539                     107   5e-22   
ref|XP_006586529.1|  PREDICTED: uncharacterized mitochondrial pro...    100   5e-22   
gb|AAC02669.1|  polyprotein                                             107   5e-22   
emb|CAN70495.1|  hypothetical protein VITISV_042039                     103   5e-22   
emb|CAN72532.1|  hypothetical protein VITISV_007474                     103   5e-22   
gb|AAC02664.1|  polyprotein                                             107   5e-22   
ref|XP_008665822.1|  PREDICTED: uncharacterized protein LOC103644390    106   5e-22   
emb|CAN64673.1|  hypothetical protein VITISV_007430                     107   5e-22   
gb|AAC02666.1|  polyprotein                                             107   5e-22   
emb|CAN64628.1|  hypothetical protein VITISV_039432                     105   6e-22   
emb|CAN75996.1|  hypothetical protein VITISV_022989                     102   6e-22   
ref|XP_009145096.1|  PREDICTED: uncharacterized protein LOC103868780    107   6e-22   
ref|XP_008342448.1|  PREDICTED: uncharacterized protein LOC103405249    106   6e-22   
emb|CAN72132.1|  hypothetical protein VITISV_040707                     105   7e-22   
emb|CAN65942.1|  hypothetical protein VITISV_001716                     106   7e-22   
ref|XP_010468517.1|  PREDICTED: uncharacterized protein LOC104748602    103   7e-22   
emb|CAN67925.1|  hypothetical protein VITISV_021168                     106   7e-22   
emb|CAN75744.1|  hypothetical protein VITISV_040125                     106   8e-22   
emb|CAN72421.1|  hypothetical protein VITISV_007663                     100   8e-22   
dbj|BAB10876.1|  polyprotein                                            106   9e-22   
ref|XP_010534024.1|  PREDICTED: uncharacterized protein LOC104809678    106   9e-22   
emb|CAN63730.1|  hypothetical protein VITISV_030286                     106   9e-22   
ref|XP_008387250.1|  PREDICTED: uncharacterized protein LOC103449699    106   9e-22   
emb|CAN67338.1|  hypothetical protein VITISV_016115                     106   9e-22   
emb|CAN81715.1|  hypothetical protein VITISV_032902                     105   9e-22   
emb|CAN70817.1|  hypothetical protein VITISV_029336                     106   9e-22   
emb|CAN74129.1|  hypothetical protein VITISV_041770                     104   1e-21   
emb|CAN83455.1|  hypothetical protein VITISV_029958                     103   1e-21   
emb|CAN60609.1|  hypothetical protein VITISV_036599                     106   1e-21   
emb|CAN81139.1|  hypothetical protein VITISV_018760                     106   1e-21   
emb|CAN72663.1|  hypothetical protein VITISV_031849                     105   1e-21   
emb|CAN65591.1|  hypothetical protein VITISV_042091                     106   1e-21   
emb|CAN61207.1|  hypothetical protein VITISV_015446                     105   1e-21   
emb|CAN69691.1|  hypothetical protein VITISV_026777                     106   1e-21   
emb|CAN61322.1|  hypothetical protein VITISV_012106                     106   1e-21   
ref|XP_008364001.1|  PREDICTED: uncharacterized protein LOC103427704    106   1e-21   
emb|CAN76679.1|  hypothetical protein VITISV_034325                     105   1e-21   
emb|CAN73101.1|  hypothetical protein VITISV_042890                     105   1e-21   
emb|CAN62614.1|  hypothetical protein VITISV_028123                     105   1e-21   
ref|XP_006582558.1|  PREDICTED: uncharacterized mitochondrial pro...  99.4    1e-21   
emb|CAN70689.1|  hypothetical protein VITISV_012155                     105   1e-21   
emb|CAN63507.1|  hypothetical protein VITISV_029435                     105   1e-21   
emb|CAN75922.1|  hypothetical protein VITISV_030752                     105   2e-21   
ref|XP_004978139.1|  PREDICTED: uncharacterized mitochondrial pro...    100   2e-21   
emb|CAN63185.1|  hypothetical protein VITISV_000411                     104   2e-21   
emb|CAN64462.1|  hypothetical protein VITISV_008322                     100   2e-21   
emb|CAN72398.1|  hypothetical protein VITISV_041202                     105   2e-21   
emb|CAN62535.1|  hypothetical protein VITISV_041880                     105   2e-21   
emb|CAN78751.1|  hypothetical protein VITISV_028425                     105   2e-21   
emb|CAN59936.1|  hypothetical protein VITISV_001878                     105   2e-21   
gb|AAF79259.1|AC023279_8  F12K21.14                                     102   2e-21   
emb|CAN72018.1|  hypothetical protein VITISV_001841                     105   2e-21   
emb|CAB42059.1|  Tpv2-1c                                                102   2e-21   
gb|ABI34342.1|  Polyprotein, putative                                   104   3e-21   
emb|CAN82526.1|  hypothetical protein VITISV_028058                     104   3e-21   
ref|XP_007019438.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    103   3e-21   
emb|CAN61537.1|  hypothetical protein VITISV_012372                     103   3e-21   
emb|CAN77643.1|  hypothetical protein VITISV_007625                     101   3e-21   
emb|CAN79672.1|  hypothetical protein VITISV_012210                     104   3e-21   
ref|XP_004292511.1|  PREDICTED: uncharacterized mitochondrial pro...    100   4e-21   
ref|XP_009354183.1|  PREDICTED: uncharacterized protein LOC103945350    104   4e-21   
emb|CAN84135.1|  hypothetical protein VITISV_000113                     104   4e-21   
gb|ABI34329.1|  Integrase core domain containing protein                104   4e-21   
emb|CAN77046.1|  hypothetical protein VITISV_035257                     104   4e-21   
ref|XP_010541762.1|  PREDICTED: retrovirus-related Pol polyprotei...    103   5e-21   
gb|KHN05629.1|  Retrovirus-related Pol polyprotein from transposo...    104   5e-21   
emb|CAN63482.1|  hypothetical protein VITISV_011510                     103   5e-21   
ref|XP_006606839.1|  PREDICTED: uncharacterized mitochondrial pro...  96.7    5e-21   
emb|CAN62074.1|  hypothetical protein VITISV_001619                     103   5e-21   
emb|CAN71246.1|  hypothetical protein VITISV_011986                     103   5e-21   
emb|CAN60274.1|  hypothetical protein VITISV_024841                     104   5e-21   
emb|CAN72440.1|  hypothetical protein VITISV_039162                     103   6e-21   
emb|CAN73234.1|  hypothetical protein VITISV_033857                     103   6e-21   
gb|KHN17953.1|  Retrovirus-related Pol polyprotein from transposo...    103   6e-21   
gb|KHN44566.1|  Copia protein                                         98.6    6e-21   
emb|CAN62328.1|  hypothetical protein VITISV_029806                     103   6e-21   
gb|KHN04829.1|  Copia protein                                         98.6    6e-21   
emb|CAN71996.1|  hypothetical protein VITISV_023485                     103   7e-21   
emb|CAN80753.1|  hypothetical protein VITISV_003323                     103   7e-21   
ref|XP_008390627.1|  PREDICTED: uncharacterized protein LOC103452871    103   7e-21   
emb|CAN73151.1|  hypothetical protein VITISV_029990                     100   7e-21   
gb|AGW47867.1|  polyprotein                                             103   7e-21   
gb|AAF69172.1|AC007915_24  F27F5.11                                     103   7e-21   
emb|CAN62266.1|  hypothetical protein VITISV_025647                     103   8e-21   
gb|KHN22040.1|  Retrovirus-related Pol polyprotein from transposo...    103   8e-21   
gb|KHN36156.1|  Retrovirus-related Pol polyprotein from transposo...    103   8e-21   
gb|KHN45517.1|  Hydroxymethylglutaryl-CoA synthase                    98.2    8e-21   
gb|AAT38747.2|  Polyprotein, putative                                   103   8e-21   
emb|CAN70036.1|  hypothetical protein VITISV_019695                     102   9e-21   
emb|CAN63326.1|  hypothetical protein VITISV_030143                     100   9e-21   
emb|CAN59884.1|  hypothetical protein VITISV_026166                     103   9e-21   
emb|CAN78142.1|  hypothetical protein VITISV_015958                     101   9e-21   
emb|CAN77642.1|  hypothetical protein VITISV_007624                   99.4    9e-21   
ref|XP_004174156.1|  PREDICTED: uncharacterized mitochondrial pro...  96.7    1e-20   
ref|XP_004295979.1|  PREDICTED: uncharacterized mitochondrial pro...  99.4    1e-20   
gb|AFP55537.1|  retrotransposon polyprotein                             103   1e-20   
ref|XP_006493639.1|  PREDICTED: LRR receptor-like serine/threonin...    103   1e-20   
emb|CAN78715.1|  hypothetical protein VITISV_030863                     103   1e-20   
emb|CAN82137.1|  hypothetical protein VITISV_019176                   98.6    1e-20   
emb|CAN83392.1|  hypothetical protein VITISV_041406                     103   1e-20   
ref|XP_008387175.1|  PREDICTED: uncharacterized protein LOC103449620    102   1e-20   
emb|CAN79194.1|  hypothetical protein VITISV_000236                     102   1e-20   
emb|CAN67330.1|  hypothetical protein VITISV_010353                   98.2    1e-20   
gb|AAF79879.1|AC000348_32  T7N9.5                                       103   1e-20   
ref|XP_010110492.1|  Bifunctional phosphatase IMPL2                   99.0    1e-20   
emb|CAN79573.1|  hypothetical protein VITISV_017340                   98.6    1e-20   
emb|CAN81940.1|  hypothetical protein VITISV_007358                     102   1e-20   
emb|CAN61823.1|  hypothetical protein VITISV_008493                   99.8    2e-20   
ref|XP_006574083.1|  PREDICTED: uncharacterized mitochondrial pro...  98.6    2e-20   
emb|CAA72990.1|  unnamed protein product                              98.2    2e-20   
gb|ABJ96383.1|  hypothetical protein                                  97.1    2e-20   
ref|XP_009604985.1|  PREDICTED: uncharacterized protein LOC104099639    102   2e-20   
ref|XP_010527127.1|  PREDICTED: uncharacterized protein LOC104804512    102   2e-20   
ref|XP_004306286.1|  PREDICTED: uncharacterized mitochondrial pro...  97.4    2e-20   
emb|CAN69344.1|  hypothetical protein VITISV_006017                   99.0    2e-20   
emb|CAN63081.1|  hypothetical protein VITISV_016842                     102   2e-20   
emb|CAN78864.1|  hypothetical protein VITISV_007439                     101   3e-20   
gb|AAO26690.1|AF478377_1  gag-pol polyprotein                         98.2    3e-20   
gb|AAZ41811.1|  01P13-1                                                 102   3e-20   
ref|XP_004293174.1|  PREDICTED: uncharacterized mitochondrial pro...  95.9    3e-20   
emb|CAN78880.1|  hypothetical protein VITISV_024991                     102   3e-20   
ref|XP_004974519.1|  PREDICTED: uncharacterized protein LOC101767510    100   3e-20   
ref|XP_010444961.1|  PREDICTED: uncharacterized protein LOC104727565    101   3e-20   
emb|CAN68148.1|  hypothetical protein VITISV_035665                     102   3e-20   
emb|CAN63530.1|  hypothetical protein VITISV_038849                     101   3e-20   
emb|CAN83506.1|  hypothetical protein VITISV_027576                     101   3e-20   
ref|XP_006574281.1|  PREDICTED: uncharacterized mitochondrial pro...  94.7    3e-20   
emb|CAN78269.1|  hypothetical protein VITISV_006711                   98.2    4e-20   
ref|XP_004297914.1|  PREDICTED: uncharacterized mitochondrial pro...  94.0    4e-20   
ref|XP_010030914.1|  PREDICTED: uncharacterized protein LOC104420833  98.6    4e-20   
ref|XP_004294137.1|  PREDICTED: uncharacterized mitochondrial pro...  97.8    4e-20   
emb|CAN80123.1|  hypothetical protein VITISV_009646                   99.4    4e-20   
emb|CAN67972.1|  hypothetical protein VITISV_033301                   96.7    5e-20   
ref|XP_004515892.1|  PREDICTED: uncharacterized mitochondrial pro...  97.8    5e-20   
gb|AAG50698.1|AC079604_5  copia-type polyprotein, putative              101   5e-20   
emb|CAN74064.1|  hypothetical protein VITISV_028146                     100   5e-20   
gb|KHN23712.1|  Retrovirus-related Pol polyprotein from transposo...  96.7    5e-20   
ref|XP_004172502.1|  PREDICTED: uncharacterized mitochondrial pro...  97.4    5e-20   
gb|AAG60117.1|AC073555_1  copia-type polyprotein, putative              100   5e-20   
emb|CAN71676.1|  hypothetical protein VITISV_015838                     100   6e-20   
gb|EHK62721.1|  hypothetical protein M3S_E02                          92.4    6e-20   
emb|CAB71063.1|  copia-type polyprotein                                 100   6e-20   
gb|AAD50001.1|AC007259_14  Hypothetical protein                         100   6e-20   
ref|XP_008246364.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   6e-20   
emb|CAN77210.1|  hypothetical protein VITISV_000141                     100   6e-20   
ref|XP_006297338.1|  hypothetical protein CARUB_v10013358mg           99.8    6e-20   
emb|CAN74532.1|  hypothetical protein VITISV_019849                   99.0    7e-20   
emb|CAN69566.1|  hypothetical protein VITISV_033535                     100   7e-20   
gb|AAM98191.1|  unknown protein                                       99.8    8e-20   
ref|XP_006605051.1|  PREDICTED: uncharacterized mitochondrial pro...  94.0    9e-20   
emb|CAN63193.1|  hypothetical protein VITISV_017130                     100   9e-20   
gb|AAC62795.1|  contains similarity to retroviral aspartyl protea...    100   9e-20   
emb|CAN77834.1|  hypothetical protein VITISV_024733                     100   1e-19   
emb|CAN63908.1|  hypothetical protein VITISV_044218                     100   1e-19   
gb|KFK29449.1|  hypothetical protein AALP_AA7G135900                  99.0    1e-19   
emb|CAN75728.1|  hypothetical protein VITISV_031408                   99.8    1e-19   
emb|CAN69688.1|  hypothetical protein VITISV_026774                   99.8    1e-19   
ref|XP_004487715.1|  PREDICTED: uncharacterized mitochondrial pro...  96.3    1e-19   
gb|KFK23369.1|  hypothetical protein AALP_AAs49046U000200             99.0    1e-19   



>emb|CAN65555.1| hypothetical protein VITISV_009833 [Vitis vinifera]
Length=325

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
            + K I +P    + +  + TL+ DPT + SLAGALQYLT+TR +LSFSVN +CQ MHAPT
Sbjct  64   DAKPISTPFVVGQHLSAEGTLFSDPTLFRSLAGALQYLTITRPDLSFSVNSICQFMHAPT  123

Query  208  VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
              H+  LKR+LRYVK     GL++ K S+R++  +SD+DWAGCP   +ST+G+A+F G+N
Sbjct  124  EDHFCALKRILRYVKGTAHHGLQLHKQSTRDLLGYSDADWAGCPDTRRSTTGYAIFFGAN  183

Query  388  LVSWVTKRK  414
            L+SW +K++
Sbjct  184  LISWSSKKQ  192



>emb|CAN75351.1| hypothetical protein VITISV_031045 [Vitis vinifera]
Length=300

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
            + K I +P    + +  + TL+ DPT + SLAGALQYLT+T  +LSFSVN +CQ MHAPT
Sbjct  64   DAKPISTPFVVGQHLSAEGTLFSDPTLFRSLAGALQYLTITSPDLSFSVNSICQFMHAPT  123

Query  208  VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
              H+  LKR+LRYVK     GL++ K S+R++  +SD+DW GCP   +ST+G+A+F G+N
Sbjct  124  EDHFRALKRILRYVKGTAHHGLQLHKQSTRDLLGYSDADWDGCPDTRRSTTGYAIFFGAN  183

Query  388  LVSWVTKRK  414
            L+SW +K++
Sbjct  184  LISWSSKKQ  192



>emb|CAN83877.1| hypothetical protein VITISV_014760 [Vitis vinifera]
Length=707

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
            + K I +P    + + +  TL+ DPT + SLAGALQYLT+TR +LSFSVN +CQ +HAPT
Sbjct  446  DAKPISTPFVVGQHLSVGGTLFSDPTLFRSLAGALQYLTITRPDLSFSVNSICQFIHAPT  505

Query  208  VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
              H+  LKR+LRYVK     GL++ K S+R++  +SDSDWAGCP   +ST+G+A+F G+N
Sbjct  506  EDHFHALKRILRYVKGTAHHGLQLHKQSTRDLLGYSDSDWAGCPDTRRSTTGYAIFFGAN  565

Query  388  LVSWVTKRK  414
            L+SW +K++
Sbjct  566  LISWSSKKQ  574



>ref|YP_002000554.1| orf490 [Oryza sativa Japonica Group]
 dbj|BAC19858.1| orf490 [Oryza sativa Japonica Group]
Length=490

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +1

Query  31   CKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            CKEI +P+ST+  ++    +    +D T+Y S+ GALQYLT+TR +++F VN++CQ++HA
Sbjct  246  CKEINTPLSTTDKLLAKEGEPLGAEDSTRYRSIVGALQYLTLTRPDIAFPVNKVCQYLHA  305

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            PT  HW  +KR+LRY+K  +  GLR+ KS S  + AFSD+DWAGCP D KST GFAVFLG
Sbjct  306  PTSLHWTAVKRILRYLKGSLGLGLRICKSDSTLVSAFSDADWAGCPDDRKSTGGFAVFLG  365

Query  382  SNLVSW  399
            +NL+SW
Sbjct  366  ANLISW  371



>ref|YP_514636.1| hypothetical protein OrsaiPp07 [Oryza sativa Indica Group]
 ref|YP_003433855.1| hypothetical protein OrrupM_p18 [Oryza rufipogon]
 gb|AAZ99275.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AAZ99329.1| hypothetical protein (mitochondrion) [Oryza sativa Japonica Group]
 gb|AAZ99382.1| hypothetical protein (mitochondrion) [Oryza sativa Japonica Group]
 dbj|BAI67959.1| hypothetical protein [Oryza rufipogon]
 dbj|BAI67987.1| hypothetical protein [Oryza sativa Indica Group]
 gb|AER12982.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AER13050.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AEZ03755.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AEZ03764.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 dbj|BAN67511.1| hypothetical protein (mitochondrion) [Oryza rufipogon]
 dbj|BAN67513.1| hypothetical protein (mitochondrion) [Oryza rufipogon]
Length=490

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +1

Query  31   CKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            CKEI +P+ST+  ++    +    +D T+Y S+ GALQYLT+TR +++F VN++CQ++HA
Sbjct  246  CKEINTPLSTTDKLLAKEGEPLGAEDSTRYRSIVGALQYLTLTRPDIAFPVNKVCQYLHA  305

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            PT  HW  +KR+LRY+K  +  GLR+ KS S  + AFSD+DWAGCP D KST GFAVFLG
Sbjct  306  PTSLHWTAVKRILRYLKGSLGLGLRICKSDSTLVSAFSDADWAGCPDDRKSTGGFAVFLG  365

Query  382  SNLVSW  399
            +NL+SW
Sbjct  366  ANLISW  371



>gb|AAP20859.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=352

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVIDTTLY---DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            ++CK + +P+S S+ ++         +D TQY S+ GALQYLT+TR +++FSVN++CQ +
Sbjct  97   SDCKSVATPLSASEKLIAGKGTILGPNDATQYRSIVGALQYLTLTRLDIAFSVNKVCQFL  156

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
            H PT  HW  +KR+LRY+K     GLR+ KSSS  +  +SD+DWAGC  D +ST GFAV+
Sbjct  157  HNPTTEHWAAVKRILRYIKQCTGLGLRICKSSSMIVSGYSDADWAGCLDDRRSTGGFAVY  216

Query  376  LGSNLVSWVTKRK  414
            LG NLVSW  K++
Sbjct  217  LGDNLVSWNAKKQ  229



>emb|CAN61827.1| hypothetical protein VITISV_027629 [Vitis vinifera]
Length=638

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            A   + K I +P    + +  + TL+ +PT + SLAGALQYLT+TR +LSFSVN +CQ M
Sbjct  373  ASMIDAKPISTPFVVGQHLSAEGTLFSNPTLFRSLAGALQYLTITRPDLSFSVNSICQFM  432

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
            HAPT  H+  LKR+LRYVK     GL++ K S+R++  +SD+DWAGCP   +ST+G+A+F
Sbjct  433  HAPTEDHFRALKRILRYVKGXAHHGLQLHKQSTRDLLGYSDADWAGCPDXRRSTTGYAIF  492

Query  376  LGSNLVSWVTKRK  414
             G+NL+SW +K++
Sbjct  493  FGANLISWSSKKQ  505



>gb|EEC76475.1| hypothetical protein OsI_14210 [Oryza sativa Indica Group]
Length=391

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +1

Query  28   ECKEIFSPISTS-KTVVIDTTLY--DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
            ECK + +P+STS K  V + TL    D TQY S+ GALQYLT+TR ++SFS+N++CQ +H
Sbjct  137  ECKPVSTPLSTSEKLSVNEGTLLGPQDSTQYRSVVGALQYLTLTRPDISFSINKVCQFLH  196

Query  199  APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
            APT +HW  +KR+LRYVK  V  GL+  ++ S  +  FSD+DWAG P D +ST GFAVFL
Sbjct  197  APTTTHWAAVKRILRYVKYTVDTGLKFCRNPSLLVSGFSDADWAGSPDDRRSTGGFAVFL  256

Query  379  GSNLVSWVTKRK  414
            G NLVSW  +++
Sbjct  257  GPNLVSWSARKQ  268



>gb|AAP53968.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=932

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 93/131 (71%), Gaps = 3/131 (2%)
 Frame = +1

Query  31   CKEIFSPISTSKTVVIDTTLY---DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            CK   +P+ST++ + I+   +   +D + Y S+ GALQYLT+TR +LSF VN++CQ +H+
Sbjct  687  CKPASTPLSTTEKLSIEDGDFLGQNDASHYRSIVGALQYLTLTRSDLSFLVNKVCQFLHS  746

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            PT  HW  +KR+LRY+K  V FGLR  KS S  I AFSD+DWAGC  D +ST GFAVFLG
Sbjct  747  PTTVHWSAVKRILRYIKGTVEFGLRFGKSDSMLISAFSDADWAGCSDDRRSTGGFAVFLG  806

Query  382  SNLVSWVTKRK  414
             NL+SW  +++
Sbjct  807  PNLISWSARKQ  817



>ref|NP_001175678.1| Os08g0544300 [Oryza sativa Japonica Group]
 dbj|BAH94406.1| Os08g0544300 [Oryza sativa Japonica Group]
Length=821

 Score =   144 bits (363),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +1

Query  28   ECKEIFSPISTS-KTVVIDTTLY--DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
            ECK + +P+STS K  V + TL    D TQY S+ GALQYLT+TR ++SFS+N++CQ +H
Sbjct  567  ECKPVSTPLSTSEKLSVNEGTLLGPQDSTQYRSVVGALQYLTLTRPDISFSINKVCQFLH  626

Query  199  APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
            APT +HW  +KR+LRYVK  V  GL+  ++ S  +  FSD+DWAG P D +ST GFAVFL
Sbjct  627  APTTTHWAAVKRILRYVKYTVDTGLKFCRNPSLLVSGFSDADWAGSPDDRRSTGGFAVFL  686

Query  379  GSNLVSWVTKRK  414
            G NLVSW  +++
Sbjct  687  GPNLVSWSARKQ  698



>gb|ABA97008.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1202

 Score =   145 bits (365),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = +1

Query  25    TECKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
             ++CK + +P+S S+ +     +    +D T+Y SL GALQYLT+TR +LSFSVN++CQ++
Sbjct  1043  SDCKAVNTPLSISEKLSAHEGNPLGPEDSTRYRSLVGALQYLTLTRPDLSFSVNKVCQYL  1102

Query  196   HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             HAPT  HW   KR+LRY+K  V  GL++ KS+S  + AFSD+DWAGC  D +ST GFAVF
Sbjct  1103  HAPTTKHWAAAKRILRYLKHTVKLGLKISKSNSLLVSAFSDADWAGCLDDRRSTGGFAVF  1162

Query  376   LGSNLVSWVTKRK  414
             +G NLVSW  +++
Sbjct  1163  IGPNLVSWSARKQ  1175



>ref|NP_085537.1| hypothetical protein ArthMp070 [Arabidopsis thaliana]
 sp|P92519.1|M810_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg00810; 
AltName: Full=ORF240b (mitochondrion) [Arabidopsis thaliana]
 emb|CAA69823.1| unnamed protein product [Arabidopsis thaliana]
Length=240

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = +1

Query  10   NFAFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQ  189
            N A   +CK + +P+       + T  Y DP+ + S+ GALQYLT+TR ++S++VN +CQ
Sbjct  67   NNAGMLDCKPMSTPLPLKLNSSVSTAKYPDPSDFRSIVGALQYLTLTRPDISYAVNIVCQ  126

Query  190  HMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFA  369
             MH PT++ ++ LKRVLRYVK  +  GL + K+S   + AF DSDWAGC +  +ST+GF 
Sbjct  127  RMHEPTLADFDLLKRVLRYVKGTIFHGLYIHKNSKLNVQAFCDSDWAGCTSTRRSTTGFC  186

Query  370  VFLGSNLVSWVTKRK  414
             FLG N++SW  KR+
Sbjct  187  TFLGCNIISWSAKRQ  201



>gb|AAL86510.1|AC099040_14 putative retrotransposon protein [Oryza sativa Japonica Group]
Length=1139

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  31   CKEIFSPISTSKTV-VIDTTLYD--DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            CK   +P+STS+ + V + +L    D T Y S+ GALQYLT+TR +++FS+N++CQ +H+
Sbjct  785  CKPAPTPLSTSEKLSVQEGSLLGPGDATNYRSIVGALQYLTLTRPDIAFSINKVCQFLHS  844

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            PT++HW  +KR++RY++  V  GL+++KS S  ++AFSD+DWAGC  D +STSGFAVFLG
Sbjct  845  PTLTHWSAVKRIIRYLRGTVGMGLKIQKSQSMLVNAFSDADWAGCVDDRRSTSGFAVFLG  904

Query  382  SNLVSWVTKRK  414
            SNL+SW  +++
Sbjct  905  SNLISWSVRKQ  915



>gb|ABA95366.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=552

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +1

Query  28   ECKEIFSPI-STSKTVVIDTTLYD--DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
            +CK + +P+ ++ K +V + TL    D TQY S+ GAL YLT+TR ++SFSVN++CQ +H
Sbjct  303  DCKPVSTPLLASEKLLVHEGTLLGQKDTTQYRSIVGALPYLTLTRPDISFSVNKVCQFLH  362

Query  199  APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
            +PT  HW  +KR+LRY+K  V  GLR+ KSSS  +  F D+DWAGC  D +ST GFAVFL
Sbjct  363  SPTTVHWTVVKRILRYLKYTVNCGLRISKSSSLLVSGFCDADWAGCLDDRRSTGGFAVFL  422

Query  379  GSNLVSWVTKRK  414
            GSNLVSW  +++
Sbjct  423  GSNLVSWSARKQ  434



>gb|AAR88589.1| putative copia-like retrotransposon protein [Oryza sativa Japonica 
Group]
Length=1399

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +1

Query  28    ECKEIFSPISTS-KTVVIDTTLY--DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
             ECK + +P+STS K  V + TL    D TQY S+ GALQYLT+TR ++SFS+N++CQ +H
Sbjct  1145  ECKPVSTPLSTSEKLSVNEGTLLGPQDSTQYRSVVGALQYLTLTRPDISFSINKVCQFLH  1204

Query  199   APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
             APT +HW  +KR+LRYVK  V  GL+  ++ S  +  FSD+DWAG P D +ST GFAVFL
Sbjct  1205  APTTTHWAAVKRILRYVKYTVDTGLKFCRNPSLLVSGFSDADWAGSPDDRRSTGGFAVFL  1264

Query  379   GSNLVSWVTKRK  414
             G NLVSW  +++
Sbjct  1265  GPNLVSWSARKQ  1276



>gb|AAM18766.1|AC099325_22 putative copia-like retrotransposon Hopscotch polyprotein [Oryza 
sativa Japonica Group]
Length=1150

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 99/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  31   CKEIFSPISTS-KTVVIDTTLYD--DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            CK   +P+STS K  V + +L    D T Y S+ GALQYLT+TR +++FS+N++CQ +H+
Sbjct  817  CKPAPTPLSTSEKLSVQEGSLLGPGDATNYRSIVGALQYLTLTRPDIAFSINKVCQFLHS  876

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            PT++HW  +KR++RY++  V  GL+++KS S  ++AFSD+DWAGC  D +STSGFAVFLG
Sbjct  877  PTLTHWSAVKRIIRYLRGTVGMGLKIQKSQSMLVNAFSDADWAGCVDDRRSTSGFAVFLG  936

Query  382  SNLVSWVTKRK  414
            SNL+SW  +++
Sbjct  937  SNLISWSVRKQ  947



>gb|ABB47033.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1142

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  31   CKEIFSPISTSKTV-VIDTTLYD--DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            CK   +P+STS+ + V + +L    D T Y S+ GALQYLT+TR +++FS+N++CQ +H+
Sbjct  779  CKPAPTPLSTSEKLSVQEGSLLGPGDATNYRSIVGALQYLTLTRPDIAFSINKVCQFLHS  838

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            PT++HW  +KR++RY++  V  GL+++KS S  ++AFSD+DWAGC  D +STSGFAVFLG
Sbjct  839  PTLTHWSAVKRIIRYLRGTVGMGLKIQKSQSMLVNAFSDADWAGCVDDRRSTSGFAVFLG  898

Query  382  SNLVSWVTKRK  414
            SNL+SW  +++
Sbjct  899  SNLISWSVRKQ  909



>emb|CAN61640.1| hypothetical protein VITISV_021909 [Vitis vinifera]
Length=1361

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
             + K I +P    + +  + TL+ DPT + SLAGALQYLT+TR +LSFSVN + Q MHAPT
Sbjct  1100  DAKPISTPFVVGQHLSAEGTLFSDPTLFRSLAGALQYLTITRPDLSFSVNSIFQFMHAPT  1159

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               H+  LKR+LRYVK     GL++ K S+R++  +SD+DWAGCP   +ST+G+A+F G+N
Sbjct  1160  EDHFRALKRILRYVKGTAHHGLQLHKQSTRDLLGYSDADWAGCPDTRRSTTGYAIFFGAN  1219

Query  388   LVSWVTKRK  414
             L+SW +K++
Sbjct  1220  LISWSSKKQ  1228



>gb|ACF87376.2| unknown [Zea mays]
Length=526

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  T C    +P+ T SK    D  L   PT Y SLAGALQYLT+TR ++S++V Q+C  
Sbjct  271  ANMTHCNPCHTPVDTNSKPASTDGCLLSQPTVYRSLAGALQYLTLTRPDISYAVQQVCLF  330

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MHAP  +H   LKR+LRYV+  + +GL + +SSS ++ A+SD+DWAGCP   +STSG+ V
Sbjct  331  MHAPRDTHMSLLKRILRYVRGTLDYGLHIYRSSSLDLLAYSDADWAGCPDTRRSTSGYCV  390

Query  373  FLGSNLVSWVTKRK  414
            FLG+NLV+W +KR+
Sbjct  391  FLGANLVAWSSKRQ  404



>gb|AAT07563.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAT07631.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1431

 Score =   143 bits (360),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = +1

Query  25    TECKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
             ++CK + +P+S S+ +     +    +D T+Y SL GALQYLT+TR +LSFSVN++CQ++
Sbjct  1181  SDCKAVNTPLSISEKLSAHEGNPFGPEDSTRYRSLVGALQYLTLTRPDLSFSVNKVCQYL  1240

Query  196   HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             HAPT  HW   KR+LRY+K  V  GL++ KS+S  + AFSD+DWAGC  D  ST GFAVF
Sbjct  1241  HAPTTKHWAAAKRILRYLKHTVKLGLKISKSNSLLVSAFSDADWAGCLDDRHSTGGFAVF  1300

Query  376   LGSNLVSWVTKRK  414
             +G NLVSW  +++
Sbjct  1301  IGPNLVSWSARKQ  1313



>gb|AAL66754.1|AF464738_5 putative copia-like retrotransposon Hopscotch polyprotein [Zea 
mays]
Length=1313

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = +1

Query  25    TECKEIFSPISTSKTVVI--DTTLYD-DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
             ++CK I +P+STS+ + I   + L + D TQY S+ GALQYLT+TR +++FSVN++CQ +
Sbjct  1064  SDCKPISTPLSTSEKLSIHEGSPLGEKDITQYRSIVGALQYLTLTRPDIAFSVNKVCQFL  1123

Query  196   HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             HAPT  HW  +KR+LRY+K     GL + +S S  + AFSD+DWAG   D KST GFAVF
Sbjct  1124  HAPTTLHWAAVKRILRYIKQCTNLGLHIHRSDSTLVSAFSDADWAGSVDDRKSTGGFAVF  1183

Query  376   LGSNLVSWVTKRK  414
             LGSNLVSW  +++
Sbjct  1184  LGSNLVSWSARKQ  1196



>gb|ABF97142.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=658

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 95/137 (69%), Gaps = 11/137 (8%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVIDTTLYD-------DPTQYMSLAGALQYLTVTRRNLSFSVNQL  183
            ++CK + +P+S S+ +    + Y+       D T Y SL GAL YLT+TR +LSFSVN++
Sbjct  69   SDCKAVNTPLSISEKL----SAYEGTPLGPVDSTWYRSLVGALHYLTLTRPDLSFSVNKV  124

Query  184  CQHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSG  363
            CQ++HAPT  HW   KR+LRY+K  V  GL++ KS+S  + AFSD+DWAGC  D +ST G
Sbjct  125  CQYLHAPTTEHWAAAKRILRYLKHTVKLGLKIGKSNSLLVSAFSDADWAGCLDDRRSTGG  184

Query  364  FAVFLGSNLVSWVTKRK  414
            FAVF+G NLVSW  +++
Sbjct  185  FAVFIGPNLVSWSARKQ  201



>gb|AAT85031.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF96679.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1437

 Score =   142 bits (359),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = +1

Query  25    TECKEIFSPISTSKTVVIDTTLY---DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
             ++CK + +P+S S+ ++         +D TQY S+ GALQYLT+TR +++FSVN++CQ +
Sbjct  1182  SDCKSVATPLSASEKLIAGKGTILGPNDATQYRSIVGALQYLTLTRLDIAFSVNKVCQFL  1241

Query  196   HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             H PT  HW  +KR+LRY+K     GLR+ KSSS  +  +SD+DWAGC  D +ST GFAV+
Sbjct  1242  HNPTTEHWAAVKRILRYIKQCTGLGLRICKSSSMIVSGYSDADWAGCLDDRRSTGGFAVY  1301

Query  376   LGSNLVSWVTKRK  414
             LG NLVSW  K++
Sbjct  1302  LGDNLVSWNAKKQ  1314



>ref|XP_008665078.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X3 [Zea mays]
Length=737

 Score =   140 bits (353),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            A   ECK   +P+ T   V    T   DPT Y SLAGALQYL  TR N++++V Q+C HM
Sbjct  547  AGMVECKPCVTPVDTQGKVSAAGTPVADPTGYRSLAGALQYLIFTRPNIAYAVQQVCLHM  606

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
            H P   H   LKRVLRY++  + FGL +R+S + E+  ++D+DWAGCP   +STSG+AVF
Sbjct  607  HDPREPHLTALKRVLRYLRGTIDFGL-LRRSPTTELRVYTDADWAGCPDTGRSTSGYAVF  665

Query  376  LGSNLVSWVTKRK  414
            LG +LVSW +KR+
Sbjct  666  LGDSLVSWSSKRQ  678



>gb|ACY72569.1| unknown [Oryza sativa Japonica Group]
Length=1436

 Score =   142 bits (357),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 95/137 (69%), Gaps = 11/137 (8%)
 Frame = +1

Query  25    TECKEIFSPISTSKTVVIDTTLYD-------DPTQYMSLAGALQYLTVTRRNLSFSVNQL  183
             + CK + +P+S S+ +    TLY+       D TQY S+ GALQYLT+TR ++++SVN++
Sbjct  1187  SNCKPVSTPLSVSEKL----TLYEGSPLGPNDATQYRSIVGALQYLTLTRPDIAYSVNKV  1242

Query  184   CQHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSG  363
             CQ +HAPT  HW  +KR+LRY+    + GL + KS+S  +H +SD+DWAG   D KST G
Sbjct  1243  CQFLHAPTTDHWTAVKRILRYLNQCTSLGLNIHKSASTLVHGYSDADWAGSVDDRKSTGG  1302

Query  364   FAVFLGSNLVSWVTKRK  414
             FAVFLGSNLVSW  +++
Sbjct  1303  FAVFLGSNLVSWSARKQ  1319



>emb|CAH67640.1| H0102C09.1 [Oryza sativa Indica Group]
Length=1825

 Score =   142 bits (357),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
             +CK + +P+S ++ + I   D    +D T Y S+ GALQYLT+TR ++SFSVN++CQ++H
Sbjct  1084  KCKPVSTPLSPTEKLSIHQGDVLGPNDATNYRSIVGALQYLTLTRPDISFSVNKVCQYLH  1143

Query  199   APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
             +PT  HW  +KR+LRY++     GL++RKSSS  +  FSD+DWAGC  D +ST GFAV+L
Sbjct  1144  SPTTVHWAAVKRILRYLQQTSGLGLKIRKSSSLLVSGFSDADWAGCLDDRRSTGGFAVYL  1203

Query  379   GSNLVSWVTKRK  414
             G NLVSW  +++
Sbjct  1204  GPNLVSWSARKQ  1215



>gb|AAU10682.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1210

 Score =   141 bits (356),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
             +CK + +P+ST++ +   T    D T+Y S+ GALQYLT+TR + SF++N++CQ +H+PT
Sbjct  1077  DCKPVDTPLSTTEKLSAYTGSIQDATRYRSIVGALQYLTLTRPDTSFAINKVCQFLHSPT  1136

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
             + HW  +KR+LRYVK  V  GL++  SSS  I AFSD+DWAG   D +ST GFA+FLGSN
Sbjct  1137  MQHWMAVKRILRYVKSSVDLGLKLNSSSSTIISAFSDADWAGSVDDRRSTGGFAIFLGSN  1196

Query  388   LVSWVTKRK  414
             LVSW  + +
Sbjct  1197  LVSWSARSR  1205



>ref|XP_006575791.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=192

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 89/134 (66%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTS-KTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A    C    +P+ T  K      + Y+DPT+Y SLAGALQYLT TR ++S++V Q+C H
Sbjct  46   AGMANCSSCPTPVDTKPKLNASKDSPYEDPTKYCSLAGALQYLTFTRPDISYAVQQICLH  105

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   LK +LRY++  +++GL + KSS  ++ +++D+DW GCP   +STSG+ V
Sbjct  106  MHDPRNEHMSALKHILRYLQGTLSYGLHLYKSSFNKLISYTDADWGGCPDTRRSTSGYCV  165

Query  373  FLGSNLVSWVTKRK  414
            FLG NL+SW +KR+
Sbjct  166  FLGDNLISWSSKRQ  179



>gb|AAK55460.1|AC069300_15 putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|AAP54977.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1031

 Score =   141 bits (355),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            ++CK + +P+S S+ +     +    +D T+Y SL GALQYLT+TR +LSFSVN++CQ++
Sbjct  781  SDCKAVNTPLSISEKLSAHEGNPLGPEDSTRYRSLVGALQYLTLTRPDLSFSVNKVCQYL  840

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
            HA T  HW   KR+LRY+K  V  GL++ KS+S  + AFSD+DWAGC  D +ST GFAVF
Sbjct  841  HAATTKHWVAAKRILRYLKHTVKLGLKISKSNSLLVSAFSDADWAGCLDDRRSTGGFAVF  900

Query  376  LGSNLVSWVTKRK  414
            +G NLVSW  +++
Sbjct  901  IGPNLVSWSARKQ  913



>gb|AAK53860.1|AC016781_14 Putative retroelement [Oryza sativa Japonica Group]
Length=1096

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 95/137 (69%), Gaps = 11/137 (8%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVIDTTLYD-------DPTQYMSLAGALQYLTVTRRNLSFSVNQL  183
            ++CK + +P+S S+ +    + Y+       D T Y SL GAL YLT+TR +LSFSVN++
Sbjct  848  SDCKAVNTPLSISEKL----SAYEGTPLGPVDSTWYRSLVGALHYLTLTRPDLSFSVNKV  903

Query  184  CQHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSG  363
            CQ++HAPT  HW   KR+LRY+K  V  GL++ KS+S  + AFSD+DWAGC  D +ST G
Sbjct  904  CQYLHAPTTEHWAAAKRILRYLKHTVKLGLKIGKSNSLLVSAFSDADWAGCLDDRRSTGG  963

Query  364  FAVFLGSNLVSWVTKRK  414
            FAVF+G NLVSW  +++
Sbjct  964  FAVFIGPNLVSWSARKQ  980



>gb|AAB82754.1| retrofit [Oryza longistaminata]
Length=1445

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 95/137 (69%), Gaps = 11/137 (8%)
 Frame = +1

Query  25    TECKEIFSPISTSKTVVIDTTLYD-------DPTQYMSLAGALQYLTVTRRNLSFSVNQL  183
             + CK + +P+S S+ +    TLY+       D  QY S+ GALQYLT+TR ++++SVN++
Sbjct  1196  SNCKPVSTPLSVSEKL----TLYEGSPLGPNDAIQYRSIVGALQYLTLTRPDIAYSVNKV  1251

Query  184   CQHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSG  363
             CQ +HAPT SHW  +KR+LRY+    + GL + KS+S  +H +SD+DWAG   D KST G
Sbjct  1252  CQFLHAPTTSHWIAVKRILRYLNQCTSLGLHIHKSASTLVHGYSDADWAGSIDDRKSTGG  1311

Query  364   FAVFLGSNLVSWVTKRK  414
             FAVFLGSNLVSW  +++
Sbjct  1312  FAVFLGSNLVSWSARKQ  1328



>gb|AAM15418.1| hypothetical protein [Arabidopsis thaliana]
Length=385

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = +1

Query  10   NFAFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQ  189
            N A   +CK + +P+       + T  Y DP+ + S+ GALQYLT+TR ++S++VN +CQ
Sbjct  212  NNAGMLDCKPMSTPLPLKLNSSVSTAKYPDPSDFCSIVGALQYLTLTRPDISYAVNIVCQ  271

Query  190  HMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFA  369
             MH PT++ ++ LKRVLRYVK  +  GL + K+S   + AF DSDWAGC +  +ST+GF 
Sbjct  272  RMHEPTLADFDLLKRVLRYVKGTIFHGLYIHKNSKLNVQAFCDSDWAGCTSTRRSTTGFC  331

Query  370  VFLGSNLVSWVTKRK  414
             FLG N++SW  KR+
Sbjct  332  TFLGCNIISWSAKRQ  346



>ref|XP_002456118.1| hypothetical protein SORBIDRAFT_03g030787 [Sorghum bicolor]
 gb|EES01238.1| hypothetical protein SORBIDRAFT_03g030787 [Sorghum bicolor]
Length=1567

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  T+CK   +P+ T  K    + T   DPT Y SLAGALQYLT TR +++++V Q+C H
Sbjct  1316  AGMTDCKPCSTPVDTQGKLSEAEGTPVTDPTAYRSLAGALQYLTFTRPDITYAVQQICLH  1375

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRV-RKSSSREIHAFSDSDWAGCPAD*KSTSGFA  369
             MH P   H   LKR+LRY++  V FGL + R+SSS E+  ++D+DWAGCP   +STSG+A
Sbjct  1376  MHDPREPHLTALKRILRYLRGSVDFGLLLHRRSSSTELVVYTDADWAGCPDTRRSTSGYA  1435

Query  370   VFLGSNLVSWVTKRK  414
             VFLG NLVSW++KR+
Sbjct  1436  VFLGGNLVSWLSKRQ  1450



>gb|AAM15511.1| hypothetical protein [Arabidopsis thaliana]
Length=385

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = +1

Query  10   NFAFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQ  189
            N A   +CK + +P+       + T  Y DP+ + S+ GALQYLT+TR ++S++VN +CQ
Sbjct  212  NNAGMLDCKPMSTPLPLKLNSSVSTAKYPDPSDFRSIVGALQYLTLTRPDISYAVNIVCQ  271

Query  190  HMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFA  369
             MH PT++ ++ LKRVLRYVK  +  GL + K+S   + AF DSDWAGC +  +ST+GF 
Sbjct  272  RMHEPTLADFDLLKRVLRYVKGTIFHGLYIHKNSKLNVQAFCDSDWAGCTSTRRSTTGFC  331

Query  370  VFLGSNLVSWVTKRK  414
             FLG N++SW  KR+
Sbjct  332  TFLGCNIISWSAKRQ  346



>gb|AAX95823.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA93145.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=197

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 86/128 (67%), Gaps = 1/128 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A   ECK   +P+ T SK    D +   DPT Y SLAG LQYLT TR ++S++V Q+C H
Sbjct  70   AGMLECKPCSTPVDTCSKMSSSDGSPVADPTDYRSLAGVLQYLTFTRPDISYAVQQVCLH  129

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   LKR+LRY++  +  GL +++S+  ++ A+SD+DWAGCP   KSTSG+AV
Sbjct  130  MHDPREPHLAALKRILRYIRGTLDLGLHIQRSAQLDLVAYSDADWAGCPDTRKSTSGYAV  189

Query  373  FLGSNLVS  396
            FLG NL+S
Sbjct  190  FLGDNLIS  197



>gb|ABF95666.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
Length=976

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVID-TTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  ++CK   +P+ TS     + +    DPT + SLAGALQYLT TR ++S++V Q+C H
Sbjct  718  AGMSDCKPCLTPVDTSAKFSTEGSPSVSDPTDFRSLAGALQYLTFTRPDISYAVQQVCLH  777

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P  SH   LKR+LRY++  + +GL +++SSS ++ A+SD++WAGCP   KST G+AV
Sbjct  778  MHDPRESHLTALKRILRYIRGTLEYGLHIQRSSSFDLMAYSDANWAGCPDTRKSTFGYAV  837

Query  373  FLGSNLVSWVTKRK  414
            FLG NL+SW +KR+
Sbjct  838  FLGDNLISWSSKRQ  851



>gb|ABA95065.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=825

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 94/137 (69%), Gaps = 11/137 (8%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVIDTTLYD-------DPTQYMSLAGALQYLTVTRRNLSFSVNQL  183
            + CK + +P+S S+ +    TLY+       D TQY S+ GALQYLT+TR ++++SVN++
Sbjct  677  SNCKPVSTPLSVSEKL----TLYEGSPLGPNDATQYRSIVGALQYLTLTRPDIAYSVNKV  732

Query  184  CQHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSG  363
            CQ +HAPT  HW  +KR+LRY+    +  L + KS+S  +H +SD+DWAG   D KST G
Sbjct  733  CQFLHAPTTDHWTVVKRILRYLNQCTSLRLNIHKSASTLVHGYSDADWAGSIDDRKSTGG  792

Query  364  FAVFLGSNLVSWVTKRK  414
            FAVFLGSNLVSW  +++
Sbjct  793  FAVFLGSNLVSWSARKQ  809



>ref|XP_002457887.1| hypothetical protein SORBIDRAFT_03g018791 [Sorghum bicolor]
 gb|EES03007.1| hypothetical protein SORBIDRAFT_03g018791 [Sorghum bicolor]
Length=683

 Score =   137 bits (346),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  T+CK   +P+ T  K    + T   DPT Y SLAGALQYLT TR +++++V Q+C H
Sbjct  452  AGMTDCKPCSTPLDTQGKISEAEGTPVTDPTAYRSLAGALQYLTFTRPDITYAVQQICLH  511

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   LKR+L Y++  V FGL  R+SSS E+  ++D+DWAGCP   +STS +AV
Sbjct  512  MHDPREPHLTALKRILHYLRGTVDFGLLHRRSSSTELVVYTDADWAGCPDTRRSTSSYAV  571

Query  373  FLGSNLVSWVTKRK  414
            FLG NLVSW +KR+
Sbjct  572  FLGGNLVSWSSKRQ  585



>ref|XP_002460196.1| hypothetical protein SORBIDRAFT_02g024427 [Sorghum bicolor]
 gb|EER96717.1| hypothetical protein SORBIDRAFT_02g024427 [Sorghum bicolor]
Length=1575

 Score =   139 bits (350),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  T+CK   +P+ T  K    + T   DPT Y SLAGALQYLT TR +++++V Q+C H
Sbjct  1324  AGMTDCKPCSTPVDTQGKLSEAEGTPVTDPTAYRSLAGALQYLTFTRPDITYAVQQICLH  1383

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRV-RKSSSREIHAFSDSDWAGCPAD*KSTSGFA  369
             MH P   H   LKR+LRY++  V FGL + R+SSS E+  ++D+DWAGCP   +STSG+A
Sbjct  1384  MHDPREPHLTALKRILRYLRGSVDFGLLLHRRSSSTELVVYTDADWAGCPDTRRSTSGYA  1443

Query  370   VFLGSNLVSWVTKRK  414
             VFLG NLVSW +KR+
Sbjct  1444  VFLGGNLVSWSSKRQ  1458



>ref|XP_002489074.1| hypothetical protein SORBIDRAFT_0139s002040 [Sorghum bicolor]
 gb|EES20269.1| hypothetical protein SORBIDRAFT_0139s002040 [Sorghum bicolor]
Length=1822

 Score =   139 bits (351),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  T+CK   +P+ T  K    + T   DPT Y SLAGALQYLT TR +++++V Q+C H
Sbjct  1571  AGMTDCKPCSTPVDTQGKLSEAEGTPVTDPTAYRSLAGALQYLTFTRPDITYAVQQICLH  1630

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRV-RKSSSREIHAFSDSDWAGCPAD*KSTSGFA  369
             MH P   H   LKR+LRY++  V FGL + R+SSS E+  ++D+DWAGCP   +STSG+A
Sbjct  1631  MHDPREPHLTALKRILRYLRGSVDFGLLLHRRSSSTELVVYTDADWAGCPDTRRSTSGYA  1690

Query  370   VFLGSNLVSWVTKRK  414
             VFLG NLVSW +KR+
Sbjct  1691  VFLGGNLVSWSSKRQ  1705



>ref|XP_004980236.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Setaria italica]
Length=130

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 83/129 (64%), Gaps = 0/129 (0%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
            T CK   +P+ T+  +  D     D + + SLAGALQYLT TR +++++V Q+C  MH P
Sbjct  2    TNCKPCSTPVDTNPKLASDGPPVKDASSFHSLAGALQYLTFTRPDIAYAVQQVCLFMHDP  61

Query  205  TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
               H   LK++LRY+   +  GL +R SSS ++  +SD DWAGC    KSTSGFAVFLG 
Sbjct  62   RKPHLAALKQILRYIHDTLVLGLLLRPSSSAKLTVYSDIDWAGCSETRKSTSGFAVFLGD  121

Query  385  NLVSWVTKR  411
            NLVSW +KR
Sbjct  122  NLVSWSSKR  130



>emb|CAN68364.1| hypothetical protein VITISV_021899 [Vitis vinifera]
Length=431

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVI-DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  +E K + SP++    + I D T  +DPT Y SL GALQY T+TR +++++VN+LCQ 
Sbjct  70   AGLSESKSMASPMAAGPVLSIADGTRLEDPTLYRSLVGALQYCTITRPDIAYTVNKLCQF  129

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MHAPT +H + +KRVLRY+K  + +GL  + SSS ++ A++D+DWA CP D +STSG+ +
Sbjct  130  MHAPTSTHLQVVKRVLRYLKGSLFYGLSFQPSSSLDLIAYTDADWASCPDDRRSTSGYCI  189

Query  373  FLGSNLVSWVTKRK  414
            F G NLVSW   ++
Sbjct  190  FFGGNLVSWSASKQ  203



>gb|ABA93844.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1099

 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  ++CK   +P+ T +K    D +   DPT Y SLA ALQYLT TR ++S+ V Q+C H
Sbjct  851  AGMSDCKPCSTPVDTNAKLSSTDGSPVLDPTDYRSLASALQYLTFTRPDISYVVQQVCLH  910

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P  SH   LKR+LRYV+  +  GL +R S S ++ A+SD++WAGCP   KSTSG+AV
Sbjct  911  MHDPRDSHLATLKRILRYVRGTLDLGLHIRHSPSTDLVAYSDANWAGCPDTRKSTSGYAV  970

Query  373  FLGSNLVSWVTKRK  414
            FLG NLVSW +KR+
Sbjct  971  FLGDNLVSWSSKRQ  984



>ref|XP_002438095.1| hypothetical protein SORBIDRAFT_10g007953 [Sorghum bicolor]
 gb|EER89462.1| hypothetical protein SORBIDRAFT_10g007953 [Sorghum bicolor]
Length=1330

 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 92/135 (68%), Gaps = 2/135 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  T+CK   +P+ T  K    +     DPT Y SLAGALQYLT TR +++++V Q+C H
Sbjct  1079  AGMTDCKPCSTPVDTQGKISEAEGIPVTDPTAYRSLAGALQYLTFTRPDITYAVQQICLH  1138

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRV-RKSSSREIHAFSDSDWAGCPAD*KSTSGFA  369
             MH P   H   LKR+LRY++  V FGL + R+SSS E+  ++D+DWAGCP   +STSG+A
Sbjct  1139  MHDPREPHLAALKRILRYLRGTVDFGLLLHRRSSSTELVVYTDADWAGCPDTRRSTSGYA  1198

Query  370   VFLGSNLVSWVTKRK  414
             VFLG NLVSW +KR+
Sbjct  1199  VFLGGNLVSWSSKRQ  1213



>dbj|BAB90546.1| putative rice retrotransposon retrofit gag/pol polyprotein [Oryza 
sativa Japonica Group]
Length=1448

 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 95/137 (69%), Gaps = 11/137 (8%)
 Frame = +1

Query  25    TECKEIFSPISTSKTVVIDTTLYD-------DPTQYMSLAGALQYLTVTRRNLSFSVNQL  183
             + CK + +P+S S+ +    TLY+       D TQY S+ GALQYLT+TR ++++SVN++
Sbjct  1199  SNCKPVSTPLSVSEKL----TLYEGSPLGPNDATQYRSIVGALQYLTLTRPDIAYSVNKV  1254

Query  184   CQHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSG  363
             CQ +HAPT SHW  +KR+LRY+    + GL V KS+S  +H +SD+D AG   D KST G
Sbjct  1255  CQFLHAPTTSHWIAVKRILRYLNQCTSLGLHVHKSASTLVHGYSDADGAGSIDDRKSTGG  1314

Query  364   FAVFLGSNLVSWVTKRK  414
             FAVFLGSNLVSW  +++
Sbjct  1315  FAVFLGSNLVSWSARKQ  1331



>gb|AAK02020.2|AC074283_1 Putative gag-pol polyprotein [Oryza sativa]
 gb|AAP52036.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1058

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 91/131 (69%), Gaps = 3/131 (2%)
 Frame = +1

Query  31   CKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            CK + +P+ST + +     +     D TQY S+ GALQYLT+TR ++SFSVN++CQ +  
Sbjct  804  CKSVGTPLSTVEKLSAYEGEKLGEKDATQYRSVVGALQYLTLTRPDISFSVNKVCQFLQN  863

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            PT  HW  +KR+LRYVK  +  GL+V KSSS  + A+SD+DWA C  D +ST GFAVFLG
Sbjct  864  PTTVHWATVKRILRYVKGTLGLGLKVEKSSSNIVSAYSDADWADCLDDKRSTGGFAVFLG  923

Query  382  SNLVSWVTKRK  414
            SNL+SW  +++
Sbjct  924  SNLISWNARKQ  934



>ref|XP_002451986.1| hypothetical protein SORBIDRAFT_04g012210 [Sorghum bicolor]
 gb|EES04962.1| hypothetical protein SORBIDRAFT_04g012210 [Sorghum bicolor]
Length=786

 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 92/139 (66%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    H*WNFAFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVN  177
            H  + A  TECK   +P+ T SK    + T   D T + SLAGALQYLT TR +++++V 
Sbjct  552  HFLDRAGMTECKPCSTPVDTNSKVAAAEGTPVSDATDFRSLAGALQYLTFTRPDIAYAVQ  611

Query  178  QLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KST  357
            Q+C HMH P   H   LKR+LRYV+  +  GL +R S+S ++  ++D+DW GCP   +ST
Sbjct  612  QICLHMHDPREPHLAALKRILRYVQGTLHLGLLLRPSTSTDLVVYTDADWVGCPDTRRST  671

Query  358  SGFAVFLGSNLVSWVTKRK  414
            SG+AVFLG NLVSW +KR+
Sbjct  672  SGYAVFLGDNLVSWSSKRQ  690



>emb|CAR66103.1| RT-RNaseH [Triticum turgidum subsp. durum]
Length=420

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 94/131 (72%), Gaps = 3/131 (2%)
 Frame = +1

Query  31   CKEIFSPISTSKTVVIDTTLY---DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            CK + +P+STS+ + ++       DD T Y S+ GALQYLT+TR ++S+SVN++CQ++HA
Sbjct  163  CKLVSTPLSTSEKLTVEGGELLGADDATNYRSVVGALQYLTLTRPDISYSVNKICQYLHA  222

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            P+  HW  +KR+LR++K  +  G+++ KS S  + A+SD+D A C  D +ST GFAVFLG
Sbjct  223  PSTVHWTTVKRILRHLKFTMGLGIKITKSPSMLVSAYSDADRAECADDRRSTGGFAVFLG  282

Query  382  SNLVSWVTKRK  414
            SNLVSW  +++
Sbjct  283  SNLVSWSARKQ  293



>gb|AAT69582.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAU44112.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1256

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = +1

Query  25    TECKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
             T+CK + +P+STS+ + +   D    +D + Y S+ GALQYLT+TR ++ F VN++CQ +
Sbjct  1007  TDCKPVSTPLSTSEKLTLHEGDLLGPNDASNYRSVVGALQYLTLTRPDIYFPVNKVCQFL  1066

Query  196   HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             HAPT+ HW  +KR+LRY+K     GL++ KS S  +  +SD+DWAG   D +ST GFAVF
Sbjct  1067  HAPTIVHWAAMKRILRYLKQCTKLGLKISKSKSMLVSGYSDADWAGNIDDRRSTGGFAVF  1126

Query  376   LGSNLVSWVTKRK  414
             LG NLVSW  K++
Sbjct  1127  LGDNLVSWNAKKQ  1139



>gb|AAN06870.1| Putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|ABF94109.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1247

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
             +CK + +P+STS+ + I   D    +D T Y S+ GALQYLT+TR +++F VN++CQ +H
Sbjct  999   DCKPVSTPLSTSEKLSINEGDPLGPNDATHYRSVVGALQYLTLTRPDIAFPVNKVCQFLH  1058

Query  199   APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
             APT  HW  +KR+LRY+K     GL++ KS S  + A+SD+DWAG   D +ST GFAVFL
Sbjct  1059  APTTHHWAAVKRILRYLKQCTRLGLKLSKSRSMLVSAYSDADWAGSLDDRRSTGGFAVFL  1118

Query  379   GSNLVSWVTKRK  414
             G NLVSW  +++
Sbjct  1119  GDNLVSWSARKQ  1130



>emb|CAH67061.1| H0112G12.6 [Oryza sativa Indica Group]
Length=811

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPI-STSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A   +CK   +P+ +T+K    D     DPT + SLAGALQYLT TR ++S++V Q+C H
Sbjct  563  AGMADCKPCNTPVDTTAKLSSSDGPPVADPTDFRSLAGALQYLTFTRPDISYAVQQVCLH  622

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   LKR+LRY++  +  GL +++SS+ ++  +SD+DWAGCP   +STSG+AV
Sbjct  623  MHDPREPHLAALKRILRYIRGSMDLGLHIQRSSACDLAVYSDADWAGCPDTRRSTSGYAV  682

Query  373  FLGSNLVSWVTKRK  414
            FLG NLVSW +KR+
Sbjct  683  FLGDNLVSWSSKRQ  696



>gb|AAD22155.1|AF061282_8 polyprotein [Sorghum bicolor]
Length=1012

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVIDTT---LYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
            +C  + +P+ +S+ + I+       +D T+Y S+ GALQYLT+TR ++SF+VN++CQ +H
Sbjct  764  KCHPVDTPLCSSEKLSIEDGNKLGSEDATKYCSVVGALQYLTLTRPDISFAVNKVCQFLH  823

Query  199  APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
            +PT  HW  +KR+LRY+K     G++  KS S  + AF+D+DWAGC  D +ST GFAVFL
Sbjct  824  SPTTIHWSAVKRILRYIKGTTKLGIKFSKSESMLVSAFADADWAGCVDDRRSTGGFAVFL  883

Query  379  GSNLVSWVTKRK  414
            G+NL+SW  K++
Sbjct  884  GNNLISWTAKKQ  895



>ref|XP_004966848.1| PREDICTED: uncharacterized protein LOC101777861 [Setaria italica]
Length=2179

 Score =   137 bits (346),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 90/133 (68%), Gaps = 0/133 (0%)
 Frame = +1

Query  16    AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
             A  + CK   +P+ T   + +D     DP+QY SLAGALQYLT TR +++++V Q+C +M
Sbjct  1287  AGMSHCKPSSTPVDTHSKLPVDGVSVSDPSQYRSLAGALQYLTFTRPDIAYAVQQVCLYM  1346

Query  196   HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             H P   H   LKR+LRY++  +  GL + ++S  ++  ++D+DWAGCP   KSTSG+AVF
Sbjct  1347  HDPREPHLSALKRILRYLQGTLDLGLHLHRTSPADLTVYTDADWAGCPDTRKSTSGYAVF  1406

Query  376   LGSNLVSWVTKRK  414
             LG NL+SW +KR+
Sbjct  1407  LGDNLISWSSKRQ  1419



>ref|XP_004954854.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Setaria italica]
Length=199

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 90/133 (68%), Gaps = 0/133 (0%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            A  T+CK   +P+ T+  +V+D     D + + S+AGALQYLT TR +++++V Q+C  M
Sbjct  8    AGMTDCKPCSTPMDTNPKLVVDGPPVKDASGFRSIAGALQYLTFTRLDIAYAVQQVCLFM  67

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
            H P   H   LKR+LRY++  +  GL +R S S E+  +SD+DWAGCP   KSTSG+AVF
Sbjct  68   HDPREPHLAALKRILRYIQGTLDLGLLLRLSPSAELLVYSDNDWAGCPETRKSTSGYAVF  127

Query  376  LGSNLVSWVTKRK  414
            LG NLVSW +KR+
Sbjct  128  LGDNLVSWSSKRQ  140



>ref|XP_002489126.1| hypothetical protein SORBIDRAFT_0019s003280 [Sorghum bicolor]
 gb|EES20370.1| hypothetical protein SORBIDRAFT_0019s003280 [Sorghum bicolor]
Length=761

 Score =   135 bits (341),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  25   TECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            ++CK   +P+ T +K    D     DPT Y SLAGALQYLT TR +++++V Q+C HMH 
Sbjct  506  SDCKPCSTPVDTCAKVSASDGPSVTDPTAYRSLAGALQYLTFTRPDIAYAVQQICLHMHD  565

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            P  SH    KR+LRY+K  + +GL + +SS  ++  ++D+DWAGCP   +STSG+AVFLG
Sbjct  566  PRESHLTAAKRILRYLKGTLDYGLVIPRSSPSQLTVYTDADWAGCPDTRRSTSGYAVFLG  625

Query  382  SNLVSWVTKRK  414
            S+LVSW +KR+
Sbjct  626  SSLVSWSSKRQ  636



>ref|XP_010239037.1| PREDICTED: uncharacterized protein LOC104584914 [Brachypodium 
distachyon]
Length=540

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  ++CK + +P+ T SK          D ++Y SL GALQYLT+ R ++S++V Q C H
Sbjct  54   ANMSDCKPVSTPVDTGSKISATSGNPAPDASEYRSLVGALQYLTMARPDISYAVQQACLH  113

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MHAPTV H   +K++LRY++    +G+++R +SS ++ A+SD+DW GCP   +STSG+AV
Sbjct  114  MHAPTVEHLAFVKQILRYIRGTAGYGIQLRPASSLDLIAYSDADWPGCPDTGRSTSGYAV  173

Query  373  FLGSNLVSWVTKRK  414
            FLG  LVSW +KR+
Sbjct  174  FLGDALVSWSSKRQ  187



>emb|CAE04319.3| OSJNBb0016D16.10 [Oryza sativa Japonica Group]
Length=950

 Score =   136 bits (342),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 95/137 (69%), Gaps = 11/137 (8%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVIDTTLYD-------DPTQYMSLAGALQYLTVTRRNLSFSVNQL  183
            + CK + +P+S S+ +    TLY+       D TQY S+ GALQYLT+TR ++++SVN++
Sbjct  264  SNCKPVSTPLSVSEKL----TLYEGSPLGPNDATQYRSIVGALQYLTLTRPDIAYSVNKV  319

Query  184  CQHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSG  363
            CQ +HAPT  HW  +KR+LRY+    + GL + KS+S  +H +S++DWAG   D KST G
Sbjct  320  CQFLHAPTTRHWTGVKRILRYLNQCTSLGLNIHKSASTLVHGYSNADWAGSIDDRKSTGG  379

Query  364  FAVFLGSNLVSWVTKRK  414
            FA+F+GSNLVSW  +++
Sbjct  380  FAIFVGSNLVSWSARKQ  396



>gb|AAX96193.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=1621

 Score =   136 bits (343),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVI-DTTLY--DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
             +CK   +P+S S+ + + + +L   +D + Y S+ GALQYLT+TR +++FSVN++CQ +H
Sbjct  927   DCKPANTPLSVSEKLSLHEGSLLGPEDASHYRSVVGALQYLTLTRPDIAFSVNKVCQFLH  986

Query  199   APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
             APT  HW  +KR+LRY+K     GL + KS S  +  FSD+DWAGC  D +ST GFA+FL
Sbjct  987   APTTVHWIAVKRILRYLKQCTRLGLEIHKSGSTLVSGFSDADWAGCLDDRRSTGGFAIFL  1046

Query  379   GSNLVSWVTKRK  414
             GSNLVSW  +++
Sbjct  1047  GSNLVSWNARKQ  1058



>gb|ACA61613.1| hypothetical protein AP2_E11.1 [Arabidopsis lyrata subsp. petraea]
Length=471

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIS-TSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A   +CK + +P+   SK  V D  L ++PT Y  LAGALQYLT TR ++S++V+Q+C +
Sbjct  213  AGMEDCKPLATPVDLQSKLSVDDGELIENPTFYRRLAGALQYLTFTRPDISYAVHQVCLY  272

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P V H + LKR++RY++  +++G+++ +     + A+SD+DWAGCP   +STSG+ V
Sbjct  273  MHKPRVPHLQALKRIIRYLQGTLSYGIQMTRGRIDTLTAYSDADWAGCPDTRRSTSGYCV  332

Query  373  FLGSNLVSWVTKRK  414
            FLG NL+SW  KR+
Sbjct  333  FLGPNLISWSAKRQ  346



>gb|AAK53852.1|AC016781_6 Putative retroelement [Oryza sativa Japonica Group]
Length=920

 Score =   135 bits (340),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  97   DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
            D T+Y +L GALQYLT+TR +LSFSVN++CQ++HAPT  HW   KR+LRY+K  V  GL+
Sbjct  790  DSTRYRNLVGALQYLTLTRPDLSFSVNKVCQYLHAPTTEHWAVAKRILRYLKHTVKLGLK  849

Query  277  VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            + KS+S  + AFSD+DWAGC  D  ST GFAVF+G NLVSW  +++
Sbjct  850  ISKSNSLLVSAFSDADWAGCLDDRLSTGGFAVFIGPNLVSWSARKQ  895



>pir||T02087 gag/pol polyprotein - maize retrotransposon Hopscotch
 gb|AAA57005.1| copia-like retrotransposon Hopscotch polyprotein [Zea mays]
Length=1439

 Score =   136 bits (342),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDTTLYDDP---TQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
             CK + +P++TS+ +         P   T+Y S+ GALQYLT+TR +LS+++N++CQ +HA
Sbjct  1186  CKPVHTPVATSEKLSASAGTLLSPEETTKYRSVVGALQYLTLTRPDLSYAINRVCQFLHA  1245

Query  202   PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
             PT  HW  +KR+LR ++  +  GL +R S S  + AFSD+DWAGCP D KST G+A+FLG
Sbjct  1246  PTDLHWTAVKRILRNIQHTIGLGLTIRPSLSLMLSAFSDADWAGCPDDRKSTGGYALFLG  1305

Query  382   SNLVSWVTKRK  414
              NL+SW +K++
Sbjct  1306  PNLISWNSKKQ  1316



>gb|ABA98049.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1460

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVI-DTTLY--DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
             +CK   +P+S S+ + + + +L   +D + Y S+ GALQYLT+TR +++FSVN++CQ +H
Sbjct  1205  DCKPANTPLSVSEKLSLHEGSLLGPEDASHYRSVVGALQYLTLTRPDIAFSVNKVCQFLH  1264

Query  199   APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
             APT  HW  +KR+LRY+K     GL + KS S  +  FSD+DWAGC  D +ST GFA+FL
Sbjct  1265  APTTVHWIAVKRILRYLKQCTRLGLEIHKSGSTLVSGFSDADWAGCLDDRRSTGGFAIFL  1324

Query  379   GSNLVSWVTKRK  414
             GSNLVSW  +++
Sbjct  1325  GSNLVSWNARKQ  1336



>gb|ABA98286.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1478

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVI-DTTLY--DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
             +CK   +P+S S+ + + + +L   +D + Y S+ GALQYLT+TR +++FSVN++CQ +H
Sbjct  1198  DCKPANTPLSVSEKLSLHEGSLLGPEDASHYRSVVGALQYLTLTRPDIAFSVNKVCQFLH  1257

Query  199   APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
             APT  HW  +KR+LRY+K     GL + KS S  +  FSD+DWAGC  D +ST GFA+FL
Sbjct  1258  APTTVHWIAVKRILRYLKQCTRLGLEIHKSGSTLVSGFSDADWAGCLDDRRSTGGFAIFL  1317

Query  379   GSNLVSWVTKRK  414
             GSNLVSW  +++
Sbjct  1318  GSNLVSWNARKQ  1329



>ref|XP_002453623.1| hypothetical protein SORBIDRAFT_04g009135 [Sorghum bicolor]
 gb|EES06599.1| hypothetical protein SORBIDRAFT_04g009135 [Sorghum bicolor]
Length=801

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  T CK   +P+ T  K    + +   DPT Y SLAGALQYLT TR +++++V Q+C H
Sbjct  551  AGMTGCKPCPTPVDTQGKLSEAEGSPVADPTAYRSLAGALQYLTFTRPDITYAVQQVCLH  610

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   LKR+LRY++  V +GL + +S S E+  ++D+DWAGCP   +STSG+AV
Sbjct  611  MHDPREPHLTALKRLLRYLRGTVDYGLLLHRSPSTELVVYTDADWAGCPDTRRSTSGYAV  670

Query  373  FLGSNLVSWVTKRK  414
            FLG NL+SW +KR+
Sbjct  671  FLGGNLMSWSSKRQ  684



>gb|AAU10819.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAV24907.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1679

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPI-STSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A   +CK   +P+ +T+K    D     DPT + SLAGALQYLT TR ++S++V Q+C H
Sbjct  1431  AGMADCKPCNTPVDTTAKLSSSDGPPVADPTDFRSLAGALQYLTFTRPDISYAVQQVCLH  1490

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
             MH P   H   LKR+L Y++  V  GL +++SS+ ++  +SD+DWAGCP   +STSG+AV
Sbjct  1491  MHDPREPHLAALKRILHYIRGSVDLGLHIQRSSACDLAVYSDADWAGCPDTRRSTSGYAV  1550

Query  373   FLGSNLVSWVTKRK  414
             FLG NLVSW +KR+
Sbjct  1551  FLGDNLVSWSSKRQ  1564



>ref|XP_002442174.1| hypothetical protein SORBIDRAFT_08g015513 [Sorghum bicolor]
 gb|EES16012.1| hypothetical protein SORBIDRAFT_08g015513 [Sorghum bicolor]
Length=757

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            ++ K + +P+ +++ + I   D    +D T+Y SL GALQYLT+TR ++SF+VN++CQ +
Sbjct  516  SKSKPVHTPLPSTQKISITDGDKLGEEDCTRYRSLVGALQYLTLTRPDISFAVNKVCQFL  575

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
            HAPT +H   +KR+LRY++    FGLR+RKS  R + AFS +DWAG   D +ST GFAVF
Sbjct  576  HAPTTTHLSAVKRILRYIQGTSKFGLRIRKSKCRIVSAFSYADWAGDVDDRRSTGGFAVF  635

Query  376  LGSNLVSWVTKRK  414
            LG NL+SW  +++
Sbjct  636  LGENLISWTAQKQ  648



>gb|ACV42639.1| gag/pol [Oryza sativa Japonica Group]
Length=1448

 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 91/130 (70%), Gaps = 7/130 (5%)
 Frame = +1

Query  46    SPISTSKTVVIDTTLYD-------DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
             +P+ST  +V    TLY+       D TQY S+ GALQYLT+TR ++++SVN++CQ +HAP
Sbjct  1202  TPVSTPLSVSEKLTLYEGSPLGPNDATQYRSIVGALQYLTLTRPDIAYSVNKVCQFLHAP  1261

Query  205   TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
             T SHW  +KR+LRY+    + GL V KS+S  +H +SD+D AG   D KST GFAVFLGS
Sbjct  1262  TTSHWIAVKRILRYLNQCTSPGLHVHKSASTLVHGYSDADGAGSIDDRKSTGGFAVFLGS  1321

Query  385   NLVSWVTKRK  414
             NLVSW  +++
Sbjct  1322  NLVSWSARKQ  1331



>gb|AAL34933.1|AC079037_6 Putative gag-pol polyprotein [Oryza sativa]
 gb|AAP51877.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=725

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 89/134 (66%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A    CK + +P      +  D   L+ D + Y S+ GALQYLT+TR +++++V Q+C H
Sbjct  427  AGMANCKAVATPADAKPKLSSDEGPLFQDSSWYRSITGALQYLTLTRPDIAYAVQQVCLH  486

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MHAP  +H   LKR+LRY+K    FGL +R S+S  + AFSD+DWAGCP   +STSGF +
Sbjct  487  MHAPREAHVTLLKRILRYIKGTAAFGLHLRASTSPTLTAFSDADWAGCPDTRRSTSGFCI  546

Query  373  FLGSNLVSWVTKRK  414
            FLG +L+SW +KR+
Sbjct  547  FLGDSLISWSSKRQ  560



>gb|AAM08751.1|AC025098_18 Putative copia-type polyprotein [Oryza sativa Japonica Group]
Length=1803

 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A    CK + +P      +  D   L+ D + Y S+AGALQYLT+TR +++++V Q+C H
Sbjct  1151  AGMANCKAVATPADAKPKLSSDEGPLFQDSSWYRSIAGALQYLTLTRPDIAYAVQQVCLH  1210

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
             MHAP  +H   LKR+LRY+K    FGL +R S+S  + AFSD+DWAGCP   +STSGF +
Sbjct  1211  MHAPREAHVTLLKRILRYIKGTAAFGLHLRASTSPTLTAFSDADWAGCPDTRRSTSGFCI  1270

Query  373   FLGSNLVSWVTKRK  414
             FLG +L+SW +KR+
Sbjct  1271  FLGDSLISWSSKRQ  1284



>gb|ABA97658.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1597

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = +1

Query  25    TECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
             T+CK   + + T +K    D     DPT Y SLAGALQYLT TR ++S++V Q+C HMH 
Sbjct  1342  TDCKPCATLVDTCAKLSSTDAPPVADPTDYRSLAGALQYLTFTRPDISYAVQQVCLHMHD  1401

Query  202   PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
             P   H   LKR+LRYV+  +  GL +++S + ++   SD+DWAGCP   KSTSG+AVFLG
Sbjct  1402  PREVHLAALKRILRYVRGTIDLGLHIQRSQATDLVVCSDADWAGCPDTRKSTSGYAVFLG  1461

Query  382   SNLVSWVTKRK  414
              NLVSW +KR+
Sbjct  1462  DNLVSWSSKRQ  1472



>ref|XP_008665853.1| PREDICTED: protein SHOOT GRAVITROPISM 6-like [Zea mays]
Length=2204

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 91/136 (67%), Gaps = 5/136 (4%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDTTLYD---DPTQYMSLAGALQYLTVTRRNLSFSVNQLC  186
            A  ++CK   +P+ T     +   + D   DPT Y SLAGALQYLT TR ++S++V Q+C
Sbjct  790  AQMSDCKPCSTPVDTQAK--LSEAMGDPVADPTGYRSLAGALQYLTFTRPDISYAVQQVC  847

Query  187  QHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGF  366
             HMH P   H   LKR+LRY++  V +GL   +S+S E+  ++D+DWAGCP   +STSG+
Sbjct  848  LHMHDPQEPHLAALKRLLRYLRGTVDYGLLFHRSTSSELVVYTDADWAGCPDTRRSTSGY  907

Query  367  AVFLGSNLVSWVTKRK  414
            AVFLG NLVSW +KR+
Sbjct  908  AVFLGGNLVSWSSKRQ  923



>ref|XP_002444394.1| hypothetical protein SORBIDRAFT_07g021220 [Sorghum bicolor]
 gb|EES13889.1| hypothetical protein SORBIDRAFT_07g021220 [Sorghum bicolor]
Length=623

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 90/137 (66%), Gaps = 1/137 (1%)
 Frame = +1

Query  7    WNFAFTTECKEIFSPISTS-KTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQL  183
            ++ A   ECK   +P+ T+ K    +     D T + SLAGALQYLT TR ++++ V Q+
Sbjct  380  YHRAGMAECKPCSTPVDTNPKVAAAEGGPVSDATDFRSLAGALQYLTFTRPDIAYVVQQV  439

Query  184  CQHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSG  363
            C HMH P   H   LKR+LRYV+  +  GL +R S+S ++  ++D+DWAGCP   KSTSG
Sbjct  440  CLHMHDPREPHLAALKRILRYVRGTLHLGLMLRPSTSTDLVVYTDADWAGCPDTRKSTSG  499

Query  364  FAVFLGSNLVSWVTKRK  414
            + VFLG+NLVSW +KR+
Sbjct  500  YVVFLGNNLVSWSSKRQ  516



>gb|AEJ07956.1| putative polyprotein [Sorghum propinquum]
Length=534

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 87/133 (65%), Gaps = 0/133 (0%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            A  + CK   +P+     +  D     D TQY SLAGALQYLT TR +++++V Q+C +M
Sbjct  283  AGMSACKPCSTPVDLHSKLSEDGPPVGDATQYRSLAGALQYLTFTRPDIAYAVQQICLYM  342

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
            H P   H   LKR+LRY++   T GL + +SS  E+  ++D+DWAGCP   +STSG+AVF
Sbjct  343  HDPREPHLAALKRILRYLQGTTTLGLTMCRSSPTELVVYTDADWAGCPDTRRSTSGYAVF  402

Query  376  LGSNLVSWVTKRK  414
            LG NLVSW +KR+
Sbjct  403  LGDNLVSWSSKRQ  415



>gb|EMT21953.1| ABC transporter C family member 10 [Aegilops tauschii]
Length=3041

 Score =   135 bits (339),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 91/131 (69%), Gaps = 3/131 (2%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
             CK   +P+S+++ + +   D    +D T+Y SL GALQYLT+TR ++SF+VN++CQ +HA
Sbjct  2536  CKASPTPLSSTEKLSLEEGDLLGQEDSTRYRSLVGALQYLTLTRPDISFAVNKVCQFLHA  2595

Query  202   PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
             PT  H    KR++RYVK  ++ GL   KSSS  + AFSDSDWAGC  D +ST GFAVF G
Sbjct  2596  PTTVHLTAAKRIVRYVKNTMSLGLTFTKSSSTLVSAFSDSDWAGCIDDRRSTGGFAVFFG  2655

Query  382   SNLVSWVTKRK  414
              NL+SW  K++
Sbjct  2656  PNLISWCVKKQ  2666



>emb|CAN71258.1| hypothetical protein VITISV_043225 [Vitis vinifera]
Length=881

 Score =   133 bits (334),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 88/133 (66%), Gaps = 0/133 (0%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            A   E K I +P      +     L+ DPT + SLA ALQYLT+TR +LSFSVN + Q+M
Sbjct  633  AXMIEAKPISTPFVVGXHLSTTXKLFSDPTLFRSLAEALQYLTITRSDLSFSVNSIXQYM  692

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
            HA    H+  LKR+L YVK  V  GL++ ++S  E+ A+SDSDWAGCP   +STSG+ +F
Sbjct  693  HASIEDHFRALKRILHYVKGTVHHGLQLHRTSFHELLAYSDSDWAGCPDTRRSTSGYLIF  752

Query  376  LGSNLVSWVTKRK  414
             G+NLVSW +K++
Sbjct  753  FGANLVSWCSKKQ  765



>emb|CAN67588.1| hypothetical protein VITISV_036280 [Vitis vinifera]
Length=1379

 Score =   134 bits (336),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
            + K + +P+  S+ +  + T + DPT Y SL GALQYLT+TR NL+ S+N + Q +HAPT
Sbjct  538  DSKPVPTPMIVSQRLSSEGTPFADPTLYRSLVGALQYLTITRPNLAHSINSVSQFLHAPT  597

Query  208  VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
              H++ +KR+LRYV+  + FGL+    SS  + A+SD+DWAGCP   +STSG+++FLG+N
Sbjct  598  EVHFQAVKRILRYVQGTLHFGLKFTSCSSMGLVAYSDADWAGCPDTRRSTSGYSIFLGNN  657

Query  388  LVSWVTKRK  414
            LVSW  K++
Sbjct  658  LVSWSAKKQ  666



>emb|CAE04646.2| OSJNBa0061G20.2 [Oryza sativa Japonica Group]
Length=542

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A   +CK   +PI T   V   T   Y DPT Y S+ GALQYLT+TR +LS++V Q+C H
Sbjct  282  AGLADCKPAPTPIDTKAKVSSTTGQPYSDPTFYRSIVGALQYLTLTRPDLSYAVQQVCLH  341

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH+P   HW  +KR+LRYV+     GL++R+SS+  + A+SD DWAGCP   +STSGF V
Sbjct  342  MHSPRDVHWTLVKRILRYVRGTTHKGLQLRRSSTPSLTAYSDVDWAGCPDTRRSTSGFCV  401

Query  373  FLGSNLVSWVTKRK  414
            F G +  SW +KR+
Sbjct  402  FFGDSSESWSSKRQ  415



>gb|KHN20350.1| Putative mitochondrial protein, partial [Glycine soja]
Length=255

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 86/130 (66%), Gaps = 1/130 (1%)
 Frame = +1

Query  28   ECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
             C    +P+ T SK        ++DPT+Y SLA  LQYLT TR ++S++V  +C HMHAP
Sbjct  3    NCSSCPTPVDTKSKLSATGDAPFNDPTKYRSLAETLQYLTFTRPDISYAVQHICLHMHAP  62

Query  205  TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
            T  H   LKR++RY++  ++ GL + KS+   + +++D+DW GCP   +STSG+ VFLG 
Sbjct  63   TNEHMSALKRIIRYLQGTLSHGLHLYKSTIDRLISYTDADWGGCPDTRRSTSGYCVFLGD  122

Query  385  NLVSWVTKRK  414
            NL+SW +KR+
Sbjct  123  NLISWSSKRQ  132



>emb|CCH50966.1| T4.5 [Malus x robusta]
Length=1670

 Score =   133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 90/127 (71%), Gaps = 2/127 (2%)
 Frame = +1

Query  34    KEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVS  213
             K   +P+STSK +    TL  DPT Y S  GALQYLT TR +L+F+VNQ+CQ+MH+P   
Sbjct  1410  KPCATPVSTSK-LDHSGTLLSDPTSYRSTVGALQYLTWTRPDLAFAVNQVCQYMHSPQTI  1468

Query  214   HWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLV  393
             H + +KR+LRY+K  V  GL   K  S+ + A+SD+DWAGCP D +STSG+ VFLGSNL+
Sbjct  1469  HLQAVKRILRYLKGTVDLGLWFTK-GSQCLTAWSDADWAGCPVDRRSTSGYCVFLGSNLI  1527

Query  394   SWVTKRK  414
             SW  K++
Sbjct  1528  SWSAKKQ  1534



>ref|XP_008646585.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103628087 
[Zea mays]
Length=1134

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 88/133 (66%), Gaps = 0/133 (0%)
 Frame = +1

Query  16    AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
             A   +CK   + + T   +        DPT Y SLAGALQYL  TR +++++V Q+C HM
Sbjct  954   AGMADCKPYATSVDTQGKLSAIGPPVADPTGYRSLAGALQYLLFTRPDIAYAVQQVCLHM  1013

Query  196   HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             H P   H   LKR+LRY++  + FGL +R+SS+ E+  ++D+DWAGCP   +STSG+AVF
Sbjct  1014  HDPREPHLTALKRILRYLRGTLDFGLLLRQSSTTELCVYTDADWAGCPDTRRSTSGYAVF  1073

Query  376   LGSNLVSWVTKRK  414
             LG NL+SW +KR+
Sbjct  1074  LGDNLISWSSKRQ  1086



>ref|XP_008366454.1| PREDICTED: uncharacterized protein LOC103430102 [Malus domestica]
Length=567

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 90/129 (70%), Gaps = 6/129 (5%)
 Frame = +1

Query  34   KEIFSPISTSKTVVIDTT--LYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
            K   +P+ + K   +D T  L  DPT+Y S+ GALQYLT TR +LSF+VNQ+CQ MHAP 
Sbjct  5    KPCLTPLGSHK---LDHTGPLLHDPTEYRSIVGALQYLTWTRPDLSFAVNQVCQFMHAPR  61

Query  208  VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
              H +  KR+LR++K  V+ GL  +K +   + A+SD+DWAGCP D +STSG+ +FLGSN
Sbjct  62   EPHLQAAKRILRFLKATVSHGLWFKKGTV-HLTAYSDADWAGCPFDRRSTSGYCIFLGSN  120

Query  388  LVSWVTKRK  414
            L+SW  K++
Sbjct  121  LISWSAKKQ  129



>ref|XP_002445564.1| hypothetical protein SORBIDRAFT_07g021665 [Sorghum bicolor]
 gb|EES15059.1| hypothetical protein SORBIDRAFT_07g021665 [Sorghum bicolor]
Length=599

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPI-STSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A    CK   +P+ +  K    D     D T Y S+ GALQYLT+TR +++++VNQ C +
Sbjct  391  AGMANCKPASTPVDAKQKLSATDGEPATDATFYRSITGALQYLTLTRPDIAYAVNQACLY  450

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH+P+ +HW  +KR+LRY++  ++ GL +  S S E+ A+SD+DWAGCP   +STSG+ +
Sbjct  451  MHSPSAAHWSLVKRILRYLRGSISDGLFISASPSNELQAYSDADWAGCPDTRRSTSGYCI  510

Query  373  FLGSNLVSWVTKRK  414
            FLG+ LVSW +KR+
Sbjct  511  FLGNTLVSWSSKRQ  524



>gb|ABG00000.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=2074

 Score =   133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +1

Query  97    DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
             D T+Y S+ GALQYLT+TR ++SF+VN++CQ +H+PT+ HW  +KR+LRYVK  V  GL+
Sbjct  1852  DATRYRSIVGALQYLTLTRPDISFAVNKVCQFLHSPTIDHWMAVKRILRYVKFSVDLGLK  1911

Query  277   VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             + +SSS  + AF D+DWAG   D +ST GFAVFLGSNLVSW  +++
Sbjct  1912  ISRSSSTLVSAFLDADWAGSIDDRRSTGGFAVFLGSNLVSWSARKQ  1957



>ref|XP_004959292.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Setaria italica]
Length=239

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  ++CK   + + T +K   I +    D T Y SLA ALQYLT TR N+++++ Q+C +
Sbjct  101  ANMSDCKTCATLVDTCAKLSAIASPPVKDATAYRSLASALQYLTFTRLNITYAIQQICLY  160

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   LKR+LRY++   T GL++R SSS E+  +SD+DWAGC     STSG+AV
Sbjct  161  MHDPQECHLVALKRILRYLRGTATLGLQIRLSSSSELVVYSDADWAGCLDTRYSTSGYAV  220

Query  373  FLGSNLVSWVTKRK  414
            FLG NLVSW +KR+
Sbjct  221  FLGDNLVSWSSKRQ  234



>gb|ABA97652.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1145

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 91/130 (70%), Gaps = 3/130 (2%)
 Frame = +1

Query  31    CKEIFSPISTSKTV-VIDTTLY--DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
             CK + +P+S S+ + V + +L   +D TQ+ S+ GALQYLT+TR +++FSVN++CQ +H 
Sbjct  1016  CKPVTTPMSVSEKLSVHEGSLLGPNDATQFRSIVGALQYLTLTRPDIAFSVNKVCQFLHT  1075

Query  202   PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
             PT  HW  +KR+LRY+K     GL + KS S  +  FSD+DWAG   D +ST GFA+F+G
Sbjct  1076  PTTVHWAAVKRILRYLKSCTKMGLNIHKSGSTLVSGFSDADWAGSIDDRRSTGGFAIFIG  1135

Query  382   SNLVSWVTKR  411
             SNLVSW  ++
Sbjct  1136  SNLVSWNARK  1145



>gb|ABA95721.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=900

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 94/142 (66%), Gaps = 12/142 (8%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            T CK + +P+ST++ + +   D     D TQY S+ GALQYLT+TR ++S+SVN++CQ +
Sbjct  643  TSCKPVSTPLSTAEKLSVEIGDELGPSDVTQYRSIVGALQYLTLTRPDISYSVNKVCQFL  702

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCP---------AD*  348
              PT +HW  +KR+LRY+K  +  GL++ KSSS  + AFSD+DWAG           AD 
Sbjct  703  QTPTTAHWSAVKRILRYLKGTLDLGLKIVKSSSNLVSAFSDADWAGSVDDRRSTGGFADR  762

Query  349  KSTSGFAVFLGSNLVSWVTKRK  414
            +ST GFAVF G NL+SW  +++
Sbjct  763  RSTGGFAVFFGDNLISWSARKQ  784



>ref|XP_002444329.1| hypothetical protein SORBIDRAFT_07g020255 [Sorghum bicolor]
 gb|EES13824.1| hypothetical protein SORBIDRAFT_07g020255 [Sorghum bicolor]
Length=987

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 89/134 (66%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  T CK   +P+ T  K    + +L  DPT Y +LAGALQYLT TR +++++V Q+C H
Sbjct  737  AGMTGCKPCPTPVDTQGKLSEAEGSLVADPTAYRNLAGALQYLTFTRPDITYAVQQVCLH  796

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   LK +LRY++  V +GL + +S S E+  + D+DWAGCP   +STSG+AV
Sbjct  797  MHDPREPHLTALKCLLRYLRGTVDYGLLLHRSPSSELVVYIDADWAGCPDTRRSTSGYAV  856

Query  373  FLGSNLVSWVTKRK  414
            FLG NLVSW +KR+
Sbjct  857  FLGGNLVSWSSKRQ  870



>gb|ABF94964.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=846

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 90/132 (68%), Gaps = 3/132 (2%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
            +CK + +P+STS+ +     D     D T Y S+ GALQYLT+TR +++F VN++CQ +H
Sbjct  598  DCKPVSTPLSTSEKLSAHEGDLLGPLDATNYRSVVGALQYLTLTRPDIAFPVNKVCQFLH  657

Query  199  APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
            APT  HW  +KR+LRY+K     GL++ KS S  + A+SD+DWAG   D +ST GFAVFL
Sbjct  658  APTTIHWVAVKRILRYLKHCTKLGLKLCKSKSMLVSAYSDADWAGSLDDRRSTGGFAVFL  717

Query  379  GSNLVSWVTKRK  414
            G NLVSW  +++
Sbjct  718  GDNLVSWCARKQ  729



>gb|AAU43956.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU44069.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1447

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 90/132 (68%), Gaps = 3/132 (2%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
             +CK + +P+STS+ +     D     D T Y S+ GALQYLT+TR +++F VN++CQ +H
Sbjct  1199  DCKPVSTPLSTSEKLSAHEGDLLGPLDATNYRSVVGALQYLTLTRPDIAFPVNKVCQFLH  1258

Query  199   APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
             APT  HW  +KR+LRY+K     GL++ KS S  + A+SD+DWAG   D +ST GFAVFL
Sbjct  1259  APTTVHWAAVKRILRYLKQCTKLGLKLCKSKSMLVSAYSDADWAGSLDDRRSTGGFAVFL  1318

Query  379   GSNLVSWVTKRK  414
             G NLVSW  +++
Sbjct  1319  GDNLVSWCARKQ  1330



>ref|XP_004963727.1| PREDICTED: uncharacterized protein LOC101777694 [Setaria italica]
Length=1416

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 3/136 (2%)
 Frame = +1

Query  16    AFTTECKEIFSPISTS-KTVVIDTTLYDDP--TQYMSLAGALQYLTVTRRNLSFSVNQLC  186
             A  T+CK   +P+ T+ K    D  L      + Y SLAGALQYLT TR ++S++V Q+C
Sbjct  1156  AGMTDCKSCQTPVDTNPKLSDSDGNLLSAAAASDYRSLAGALQYLTFTRPDISYAVQQVC  1215

Query  187   QHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGF  366
              HMHAP  SH   LKR+LRYV+  +  GL +R S   E   +SD+DWAGCP   KSTSG+
Sbjct  1216  LHMHAPRDSHLAALKRILRYVRGTLHLGLLLRPSVQTEFVVYSDADWAGCPDTRKSTSGY  1275

Query  367   AVFLGSNLVSWVTKRK  414
             AVFLG NLVSW +KR+
Sbjct  1276  AVFLGDNLVSWSSKRQ  1291



>ref|XP_002446435.1| hypothetical protein SORBIDRAFT_06g016046 [Sorghum bicolor]
 gb|EES10763.1| hypothetical protein SORBIDRAFT_06g016046 [Sorghum bicolor]
Length=856

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            ++CK   +P+ T   V  D      DPT Y SLAGALQYLT TR +++++V Q+C HMH 
Sbjct  615  SDCKPCTTPVDTCAKVSADAGPAVADPTAYRSLAGALQYLTFTRPDIAYAVQQICLHMHD  674

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            P  +H    KR+LRY++  + FGL + +S+  ++  ++D+DWAGCP   +STSG+AVFLG
Sbjct  675  PREAHLVAAKRILRYLQGTLHFGLIIPRSAPTQLVVYTDADWAGCPDTRRSTSGYAVFLG  734

Query  382  SNLVSWVTKRK  414
             +LVSW +KR+
Sbjct  735  GSLVSWSSKRQ  745



>ref|XP_002444548.1| hypothetical protein SORBIDRAFT_07g023610 [Sorghum bicolor]
 gb|EES14043.1| hypothetical protein SORBIDRAFT_07g023610 [Sorghum bicolor]
Length=791

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 93/136 (68%), Gaps = 3/136 (2%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLY--DDPTQYMSLAGALQYLTVTRRNLSFSVNQLC  186
            A  T+CK   +P+ T  K    +  +   +D T Y SLAGALQYLT TR +++++V QLC
Sbjct  539  AGMTDCKSCSTPVDTQGKLSEAEGPMLGPEDSTAYRSLAGALQYLTFTRPDITYAVQQLC  598

Query  187  QHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGF  366
             +MHAP   H   +KR+LRY++  + +GL + +SSS E+  ++D+DWAGCP   +STSG+
Sbjct  599  LYMHAPREPHLAAMKRLLRYLRGTLGYGLLLSRSSSAELVVYTDADWAGCPDTRRSTSGY  658

Query  367  AVFLGSNLVSWVTKRK  414
            AVFLG NLVSW +KR+
Sbjct  659  AVFLGGNLVSWSSKRQ  674



>ref|XP_008366917.1| PREDICTED: uncharacterized protein LOC103430548 [Malus domestica]
Length=749

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 91/129 (71%), Gaps = 2/129 (2%)
 Frame = +1

Query  31   CKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTV  210
             K   +P+ST K +  D+ L  + T+Y SL GALQYLT TR +LSF+VN +CQ+MH P V
Sbjct  391  AKPCATPLSTDK-LDHDSPLLANLTEYRSLVGALQYLTWTRPDLSFAVNLVCQYMHRPRV  449

Query  211  SHWEQLKRVLRYVK*IVTFGLRVRKSSSR-EIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
            SH + +KR+LRY+K  +  G    K+S+  +I AFSD+DWAGCP D +ST GF +FLGS+
Sbjct  450  SHLQAVKRILRYLKGTIDLGXWFSKTSAPLDIQAFSDADWAGCPLDRRSTGGFCIFLGSS  509

Query  388  LVSWVTKRK  414
            ++SW  K++
Sbjct  510  IISWSAKKQ  518



>emb|CAN62227.1| hypothetical protein VITISV_008101 [Vitis vinifera]
Length=514

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 87/128 (68%), Gaps = 1/128 (1%)
 Frame = +1

Query  34   KEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVS  213
            K I  P    + +  +  L+ DPT + SLAGALQYLT+TR +LSFSVN +CQ MHAPT  
Sbjct  253  KPISIPCVVDQHLSTEGKLFSDPTMFHSLAGALQYLTITRSDLSFSVNSICQFMHAPTED  312

Query  214  HWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFA-VFLGSNL  390
            H+  LKR+LRYVK     GL++ + S+ +I A+SD+DWAGCP   + T+G+A  F  +NL
Sbjct  313  HFRALKRILRYVKGTPHHGLQLHQQSTHDILAYSDADWAGCPDTYRCTTGYANFFFCTNL  372

Query  391  VSWVTKRK  414
            VS  +K++
Sbjct  373  VSCSSKKQ  380



>ref|XP_002466349.1| hypothetical protein SORBIDRAFT_01g006185 [Sorghum bicolor]
 gb|EER93347.1| hypothetical protein SORBIDRAFT_01g006185 [Sorghum bicolor]
Length=557

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPI-STSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  + CK   +P+ +  K    D     DPT Y S+ GALQYLT+TR ++++ VNQ C H
Sbjct  384  AGMSNCKPASTPMEAKPKLSATDGEPASDPTFYRSITGALQYLTLTRPDIAYGVNQACLH  443

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MHAP   HW  +KR+LRY++  +  G+++  + S  +  +SD+DW GCP   +STSG+ V
Sbjct  444  MHAPRDVHWNLVKRILRYLRGTINHGIKISATPSTALKVYSDADWGGCPDTQRSTSGYCV  503

Query  373  FLGSNLVSWVTKRK  414
            FLG +L+SW +KR+
Sbjct  504  FLGDSLMSWSSKRQ  517



>gb|AAG46116.1|AC073166_14 putative copia-like retrotransposon polyprotein [Oryza sativa 
Japonica Group]
Length=1302

 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  94    DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGL  273
             DD + Y S+AGALQYLT+TR +++++V Q+C HMHAP  +H   LKR+LRY+K    FGL
Sbjct  1048  DDSSWYRSIAGALQYLTLTRPDIAYAVQQVCLHMHAPREAHVTLLKRILRYIKGTAAFGL  1107

Query  274   RVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
              +R S+S  + AFSD+DWAGCP   +STSGF +FLG +L+SW +KR+
Sbjct  1108  HLRASTSPTLTAFSDADWAGCPDTRRSTSGFCIFLGDSLISWSSKRQ  1154



>gb|ABF96081.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1180

 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 90/132 (68%), Gaps = 3/132 (2%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
            +CK + + +STS+ + +   D    +D + Y S+ GALQYLT+TR +++F VN++CQ +H
Sbjct  826  DCKPVSASLSTSEKLTLHEGDLLGLNDASNYRSVVGALQYLTLTRPDIAFPVNKVCQFLH  885

Query  199  APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
            APT  HW  +KR+LRY+K     GL++ KS S  +  +SD+DWAG   D +ST GFAVFL
Sbjct  886  APTTIHWATVKRILRYLKQCTKLGLKISKSKSMLVSGYSDTDWAGNVDDRRSTRGFAVFL  945

Query  379  GSNLVSWVTKRK  414
            G NLVSW  +++
Sbjct  946  GDNLVSWNARKQ  957



>gb|AAG13591.2|AC051633_7 putative gag/pol polyprotein [Oryza sativa Japonica Group]
Length=1417

 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  94    DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGL  273
             DD + Y S+AGALQYLT+TR +++++V Q+C HMHAP  +H   LKR+LRY+K    FGL
Sbjct  1146  DDSSWYRSIAGALQYLTLTRPDIAYAVQQVCLHMHAPREAHVTLLKRILRYIKGTAAFGL  1205

Query  274   RVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
              +R S+S  + AFSD+DWAGCP   +STSGF +FLG +L+SW +KR+
Sbjct  1206  HLRASTSPTLTAFSDADWAGCPDTRRSTSGFCIFLGDSLISWSSKRQ  1252



>ref|XP_010065142.1| PREDICTED: uncharacterized protein LOC104452376 [Eucalyptus grandis]
Length=1169

 Score =   130 bits (328),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 86/130 (66%), Gaps = 1/130 (1%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVI-DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
            +C+ + +P+S     +I D  L   P +Y SL G LQYLT+TR +++++ N LCQ M  P
Sbjct  654  DCRPVSTPLSLRPAAIITDDILLQHPLEYRSLVGGLQYLTITRPDIAYATNLLCQKMQQP  713

Query  205  TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
            T+  + +LKRVLRYVK  VT GL +  +S   ++ F+D+DWAGC    +ST+GF  +LGS
Sbjct  714  TLGDFHKLKRVLRYVKGTVTLGLTIHSNSFMHLYGFADADWAGCSTTRRSTTGFCTYLGS  773

Query  385  NLVSWVTKRK  414
            NL+SW  KR+
Sbjct  774  NLISWSAKRQ  783



>gb|AAW56918.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1018

 Score =   130 bits (327),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 92/132 (70%), Gaps = 6/132 (5%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVI---DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
            +CK + +P+ TS+ + +   D     D T+Y S+ GALQYLT+TR ++SFSVN++CQ   
Sbjct  818  DCKPVNTPLLTSEKLSVNEGDLLGPKDATEYRSIVGALQYLTLTRLDISFSVNKVCQ---  874

Query  199  APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
             PT  HW  +KR+LRY+K  V+ GL++ KS +  + +FSD+DWA C AD +ST GF VFL
Sbjct  875  CPTTVHWAAVKRILRYLKHTVSCGLKINKSPTLLVSSFSDADWASCLADRRSTGGFTVFL  934

Query  379  GSNLVSWVTKRK  414
            GSNLVSW  +++
Sbjct  935  GSNLVSWSARKQ  946



>emb|CAN67403.1| hypothetical protein VITISV_025614 [Vitis vinifera]
Length=1271

 Score =   130 bits (327),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +1

Query  76    IDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*  255
             +D   + D T Y S  GALQYLT+TR ++SF+VN+ CQ M  PT +HW  +KR+LRY+K 
Sbjct  989   LDGEPFSDATLYRSTVGALQYLTLTRPDISFAVNKACQFMATPTTTHWLAVKRILRYLKG  1048

Query  256   IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
              +++G+++++S+S +IH ++D+DWA CP D +ST G+ +FLG NLVSW + ++
Sbjct  1049  TLSYGIQMQQSTSLDIHGYTDADWASCPDDRRSTGGYGIFLGPNLVSWSSNKQ  1101



>ref|XP_002489193.1| hypothetical protein SORBIDRAFT_0013s009070 [Sorghum bicolor]
 gb|EES20288.1| hypothetical protein SORBIDRAFT_0013s009070 [Sorghum bicolor]
Length=1219

 Score =   130 bits (326),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A   EC    +P+ T +K    D     D TQY SLAGALQYLT+TR +L+++V Q+C  
Sbjct  522  AGMAECHSTATPVDTRAKLSATDGAPVADATQYRSLAGALQYLTLTRPDLAYAVQQVCLF  581

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   LKRVLRYVK  ++ GL +       + A+SD+DWAGCP   +STSG+ V
Sbjct  582  MHDPREPHLAMLKRVLRYVKGTLSTGLHIGVGGLDTLTAYSDADWAGCPDSRRSTSGYCV  641

Query  373  FLGSNLVSWVTKRK  414
            FLG NLVSW +KR+
Sbjct  642  FLGDNLVSWSSKRQ  655



>ref|XP_008356535.1| PREDICTED: uncharacterized protein LOC103420252 [Malus domestica]
Length=1312

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 90/130 (69%), Gaps = 6/130 (5%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDTT--LYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
              K   +P+ + K   +D T  L  DPT+Y S+ GALQYLT TR +LSF+VNQ+CQ MHAP
Sbjct  1053  AKPCLTPLGSHK---LDHTGPLLHDPTEYRSIVGALQYLTWTRPDLSFAVNQVCQFMHAP  1109

Query  205   TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
                H +  KR+LR++K  V+ GL  +K +   + A+SD+DWAGCP D +STSG+ +FLGS
Sbjct  1110  REPHLQAAKRILRFLKATVSHGLWFKKGTV-HLTAYSDADWAGCPFDRRSTSGYCIFLGS  1168

Query  385   NLVSWVTKRK  414
             NL+SW  K++
Sbjct  1169  NLISWSAKKQ  1178



>emb|CAN83871.1| hypothetical protein VITISV_044470 [Vitis vinifera]
Length=216

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            TE K   +P++TS  + + + T   DPT+Y ++ G+LQYL++TR +++++VN+L Q MH 
Sbjct  2    TEAKPAPTPLATSPILTLQSGTPLSDPTEYRTVVGSLQYLSLTRPDIAYTVNKLSQFMHQ  61

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            PT  HW  +KR+LRY+   +  G+ +R++S   +HAFSDSDWAG   D  STS + ++LG
Sbjct  62   PTSDHWNAVKRLLRYLCGTLDHGITLRRTSPLALHAFSDSDWAGNKDDFTSTSAYIIYLG  121

Query  382  SNLVSWVTKRK  414
             N +SW +K++
Sbjct  122  HNPISWSSKKQ  132



>emb|CAN68489.1| hypothetical protein VITISV_037543 [Vitis vinifera]
Length=1449

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +1

Query  76    IDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*  255
             +D   + D T Y S  GALQYLT+TR ++SF+VN+ CQ M  PT +HW  +KR+LRY+K 
Sbjct  1131  LDGEPFSDATLYRSTVGALQYLTLTRPDISFAVNKACQFMATPTTTHWLAVKRILRYLKG  1190

Query  256   IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
              +++G+++++S+S +IH ++D+DWA CP D +ST G+ +FLG NLVSW + ++
Sbjct  1191  TLSYGIQMQQSTSLDIHGYTDADWASCPDDRRSTGGYGIFLGPNLVSWSSNKQ  1243



>ref|XP_010069795.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104456640 
[Eucalyptus grandis]
Length=1324

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVI-DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
            E K I +P+S   T++I D+    +P +Y S+ G LQYLT+TR +++++ N LCQ M  P
Sbjct  646  ESKPISTPLSLRPTILINDSMALSNPAKYRSIVGGLQYLTLTRPDIAYATNLLCQKMQKP  705

Query  205  TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
            T++   ++KRVLRYVK  + FGL +   S+  ++ FSD+DWAGC    +ST+GF  +LGS
Sbjct  706  TIADLHRMKRVLRYVKGTIHFGLFIHSQSTMHLYGFSDADWAGCTETRRSTTGFCTYLGS  765

Query  385  NLVSWVTKRK  414
            NL+SW  K++
Sbjct  766  NLISWAAKKQ  775



>gb|ABW81031.1| LTRGag-pol-polymerase 3 [Arabidopsis lyrata subsp. lyrata]
Length=1296

 Score =   129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPISTSKTVVID-TTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  T C    +P+   + +  D +    DPT Y SLAGALQYLT TR ++SF+V Q+C  
Sbjct  1052  ANMTNCNPCLTPVDMKQKLAADGSPPVADPTFYRSLAGALQYLTFTRPDISFAVQQICLF  1111

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
             MH P  +H   LK +LRY+K  ++ G+ + K +S E+  +SD+DWAGCP   +STSG+ V
Sbjct  1112  MHDPREAHLNALKIILRYIKGTISHGIHMTKPTSFELTTYSDADWAGCPCIRRSTSGYCV  1171

Query  373   FLGSNLVSWVTKRK  414
             +LG NLVSW +KR+
Sbjct  1172  YLGGNLVSWSSKRQ  1185



>ref|NP_001174286.1| Os05g0235100 [Oryza sativa Japonica Group]
 dbj|BAH93014.1| Os05g0235100, partial [Oryza sativa Japonica Group]
Length=841

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  +EC    +P+   SK    D     DPT+Y SL GALQYLT+TR  L+++V Q+C  
Sbjct  583  AGMSECHSTATPVDARSKLSATDGAPVSDPTEYRSLVGALQYLTLTRPELAYAVQQVCLF  642

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   +KR+LRY+K  +  GL +  +    + A+SD+DWAGCP   +STSG+ V
Sbjct  643  MHDPREPHLALIKRILRYIKGTLHIGLHLGTTPVDSLTAYSDADWAGCPDSHRSTSGYCV  702

Query  373  FLGSNLVSWVTKRK  414
            FLG NLVSW +KR+
Sbjct  703  FLGDNLVSWSSKRQ  716



>ref|XP_010694315.1| PREDICTED: uncharacterized protein LOC104907126 [Beta vulgaris 
subsp. vulgaris]
Length=491

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = +1

Query  91   YDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFG  270
            Y DPTQ+  LAGALQYLT TR ++S++V Q+C HMHAP  +H   LKR++RY++  +T G
Sbjct  368  YADPTQFRQLAGALQYLTFTRPDISYAVQQICLHMHAPCDTHMSALKRIIRYLQGTLTHG  427

Query  271  LRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            L +  SS   +  ++D+DW GCP   +STSG+ VF+G NL+ W  KR+
Sbjct  428  LHLYPSSVNSLICYTDADWGGCPDTRRSTSGYCVFMGDNLIFWSAKRQ  475



>ref|XP_002455933.1| hypothetical protein SORBIDRAFT_03g027495 [Sorghum bicolor]
 gb|EES01053.1| hypothetical protein SORBIDRAFT_03g027495 [Sorghum bicolor]
Length=682

 Score =   126 bits (317),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVIDTTL-YDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            + CK   +P+ T   V  D      DPT Y SL GALQYLT TR ++++SV Q+C HMH 
Sbjct  428  SNCKPCSTPVDTCAKVPADADPSVADPTAYRSLVGALQYLTFTRPDIAYSVQQVCLHMHD  487

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            P  +H    KR+LRY++  +  GL + +++  ++  ++D+DWAGCP   +STSG+AVFLG
Sbjct  488  PRETHLVAAKRILRYLQGTLNHGLVIPRTAPTQLRVYTDADWAGCPDTRRSTSGYAVFLG  547

Query  382  SNLVSWVTKRK  414
             +LVSW +KR+
Sbjct  548  GSLVSWSSKRQ  558



>emb|CAN73071.1| hypothetical protein VITISV_032383 [Vitis vinifera]
Length=1239

 Score =   127 bits (319),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
             + K + +P+  S+ + +  + + +PT Y SL GALQYLT+TR +++ +VN + Q +HAPT
Sbjct  967   DSKPVHTPMVVSQHLTVAGSPFSNPTLYRSLVGALQYLTITRPDIAHAVNSVSQFLHAPT  1026

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSS-SREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
             + H+  +KR+LRYVK  + FGL  R S+    + A+SD+DWAGCP   +STSG++++LG+
Sbjct  1027  IDHFLAVKRILRYVKGTLHFGLTFRPSTIPSALVAYSDADWAGCPDTRRSTSGYSIYLGN  1086

Query  385   NLVSWVTKRK  414
             NLVSW  K++
Sbjct  1087  NLVSWSAKKQ  1096



>gb|AAT93988.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1480

 Score =   127 bits (319),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  +EC    +P+   SK    D     DPT+Y SL GALQYLT+TR  L+++V Q+C  
Sbjct  1222  AGMSECHSTATPVDARSKLSATDGAPVSDPTEYRSLVGALQYLTLTRPELAYAVQQVCLF  1281

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
             MH P   H   +KR+LRY+K  +  GL +  +    + A+SD+DWAGCP   +STSG+ V
Sbjct  1282  MHDPREPHLALIKRILRYIKGTLHIGLHLGTTPVDSLTAYSDADWAGCPDSHRSTSGYCV  1341

Query  373   FLGSNLVSWVTKRK  414
             FLG NLVSW +KR+
Sbjct  1342  FLGDNLVSWSSKRQ  1355



>gb|ABA94664.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=966

 Score =   127 bits (318),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTS-KTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  T CK   +PI TS K    D      PT + SL  ALQYLT TR +++++V Q+C H
Sbjct  718  AGKTNCKPCTTPIDTSAKHSATDDAPVAAPTDFRSLTRALQYLTFTRPDIAYAVQQVCLH  777

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   L R+LRYV+ ++  GL ++ S++ E   +SD+DWAGCP   +ST G+AV
Sbjct  778  MHDPREPHLAALTRILRYVRGMLDLGLHIQPSAATEPVVYSDADWAGCPDTRRSTLGYAV  837

Query  373  FLGSNLVSWVTKRK  414
            FLG NLVSW +KR+
Sbjct  838  FLGDNLVSWSSKRQ  851



>ref|XP_008376990.1| PREDICTED: uncharacterized protein LOC103440084 [Malus domestica]
Length=1106

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 5/112 (4%)
 Frame = +1

Query  85   TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVT  264
            +L  DP +Y S+ GALQYLT TR +LSF+VNQ+CQ MHAP   H +  KR+LR++K  V+
Sbjct  864  SLLPDPHEYRSIVGALQYLTWTRPDLSFAVNQVCQFMHAPREPHLQAAKRILRFLKAXVS  923

Query  265  FGLRVRKSSSREIH--AFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             GL  +K    +IH  A+SD+DWAGCP D +STSG+ +FLGSNL+SW  K++
Sbjct  924  HGLWFKKG---DIHLTAYSDADWAGCPFDRRSTSGYCIFLGSNLISWSAKKQ  972



>ref|XP_010686475.1| PREDICTED: uncharacterized protein LOC104900682 [Beta vulgaris 
subsp. vulgaris]
Length=4583

 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPISTSKTVVI-DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  ++ K + +P+  + ++ + D   +D+PT+Y +L G+LQYL +TR +++FSVN+L Q 
Sbjct  1113  AHMSDAKPVTTPMDPNSSLSLHDGPPHDNPTEYRTLVGSLQYLGLTRPDVAFSVNKLSQF  1172

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
             MH PT  HW+ LKR+LRY+   +T+GL +  +S   +HAFSDSDWAG   D  ST  + V
Sbjct  1173  MHCPTAPHWQALKRLLRYLCGTLTYGLNISHNSPHTLHAFSDSDWAGDKDDFISTGAYIV  1232

Query  373   FLGSNLVSWVTKRK  414
             +LGSN +SW +K++
Sbjct  1233  YLGSNPISWSSKKQ  1246



>ref|XP_004963982.1| PREDICTED: uncharacterized protein LOC101777276 [Setaria italica]
Length=1188

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 82/129 (64%), Gaps = 0/129 (0%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
             +CK   +P+ T   +  D T   D T Y S+AGALQYLT T  +++F+V Q+C  MH P 
Sbjct  908   DCKPCSTPVETHSKLSADGTPVTDATDYRSIAGALQYLTFTHPDIAFAVQQVCLFMHDPR  967

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               H   +KR+LRY++     GL + +S+   +  +SD+DWAGCP   +STSGFAVFLG N
Sbjct  968   EPHLAAMKRILRYLQGSQDLGLHLSRSAPDTLTVYSDADWAGCPDTRRSTSGFAVFLGDN  1027

Query  388   LVSWVTKRK  414
             L+SW  KR+
Sbjct  1028  LISWSAKRQ  1036



>gb|ABA99152.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=989

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTS-KTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A   ECK   +P+ T+ K   +      DP+ + SLA ALQYLT TR +++++V Q+C H
Sbjct  726  AGMAECKPCSTPVDTNPKLSAVTGDPVQDPSDFRSLAIALQYLTFTRPDIAYAVQQVCLH  785

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   LK +L YV+  +  GL +R ++  E+ A+SD+DWAGCP   KSTSG+AV
Sbjct  786  MHDPREPHLAALKWILWYVRGTLHLGLVLRPTAQHELIAYSDADWAGCPDTRKSTSGYAV  845

Query  373  FLGSNLVSWVTKRK  414
            FLG NL+SW +KR+
Sbjct  846  FLGDNLISWSSKRQ  859



>gb|AIG20414.1| RVT_2 super family protein [Brassica oleracea var. alboglabra]
Length=707

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = +1

Query  10   NFAFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLC  186
            N A  + CK   +P+   SK    D     +PT+Y SLAGALQYLT  R ++++ V QLC
Sbjct  475  NRAGMSTCKPCTTPVDMKSKLDADDDKKVSNPTEYRSLAGALQYLTFKRPDITYLVQQLC  534

Query  187  QHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGF  366
              MH P  SH + LKRV+RY++     GL++ K+    + A++D+DWAGCP   +STSGF
Sbjct  535  LFMHDPRDSHLQALKRVIRYLQGTKQMGLQLLKNQKMSMTAYTDADWAGCPGTRRSTSGF  594

Query  367  AVFLGSNLVSWVTKRK  414
             ++LG NL+SW  KR+
Sbjct  595  CIYLGDNLISWSAKRQ  610



>gb|AAT85012.1| putative reverse transcriptase [Oryza sativa Japonica Group]
 gb|ABF96664.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=361

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  T+CK   +P+ T +K    D     DPT + SLAGALQYLT TR +++++V Q+  H
Sbjct  205  AGMTDCKPCSTPVDTNAKLSSADGAPVSDPTDFHSLAGALQYLTFTRPDIAYAVQQVYLH  264

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   LKR+LRYV   + + L    S + ++ A+SD+DWAGCP   +STSG+ V
Sbjct  265  MHDPRELHLAALKRILRYVHGTLDYSLHFHCSPTVDLVAYSDADWAGCPDTRRSTSGYTV  324

Query  373  FLGSNLVSWVTKRK  414
            FLG N +SW +KR+
Sbjct  325  FLGDNFISWSSKRQ  338



>ref|XP_011010893.1| PREDICTED: uncharacterized protein LOC105115645 [Populus euphratica]
Length=1338

 Score =   126 bits (317),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +1

Query  88   LYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTF  267
            L+ DPT + SLAGALQYLT+TR +LSF VN +CQ MH PT  ++  LK +LRYVK IV  
Sbjct  542  LFSDPTLFRSLAGALQYLTITRPDLSFYVNSICQFMHTPTEDYFRALKCILRYVKSIVHH  601

Query  268  GLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            G ++ K  + ++ A+SD+DWAGCP   +ST+ + +FLG+NL+SW +K++
Sbjct  602  GFQLYKVYTHKLLAYSDADWAGCPDTLRSTTRYVIFLGANLISWSSKKQ  650


 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  88    LYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTF  267
             L+ DPT + SLAGALQYLT+TR +L F VN +CQ MH P   ++  LK +LRYVK IV  
Sbjct  1081  LFSDPTLFRSLAGALQYLTITRPDLLFYVNSICQFMHTPIEDYFRALKCILRYVKSIVHH  1140

Query  268   GLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             GL++ K  + ++ A+SD+DWAGCP   +ST+ + +FLG+NL+SW +K++
Sbjct  1141  GLQLHKVYTHKLLAYSDADWAGCPDTLRSTTRYVIFLGANLISWSSKKQ  1189



>gb|AAK51235.1|AF287471_1 polyprotein [Arabidopsis thaliana]
Length=1453

 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
             A  + C  + +P+       +++ L+ +PT + SLAG LQYLT+TR ++ F+VN +CQ M
Sbjct  1142  AAMSNCNSMPTPLP-QHIENLNSDLFPEPTYFRSLAGKLQYLTITRPDIQFAVNFICQRM  1200

Query  196   HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             H+PT + +  LKR+LRYVK  +  GL ++K+ +  + A+SDSDWAGC    +ST+GF   
Sbjct  1201  HSPTTADFGLLKRILRYVKGTIHLGLHIKKNQNLSLVAYSDSDWAGCKETRRSTTGFCTL  1260

Query  376   LGSNLVSWVTKRK  414
             LG NL+SW  KR+
Sbjct  1261  LGCNLISWSAKRQ  1273



>gb|AAD21687.1| Strong similarity to gi|3600044 T12H20.12 protease homolog from 
Arabidopsis thaliana BAC gb|AF080119 and is a member of the 
reverse transcriptase family PF|00078 [Arabidopsis thaliana]
Length=1415

 Score =   125 bits (315),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
             A  ++C  + +P+   +   +++ L+ +PT + SLAG LQYLT+TR ++ F+VN +CQ M
Sbjct  1116  AGMSDCNPMPTPLP-QQLDNLNSELFAEPTYFRSLAGKLQYLTITRPDIQFAVNFICQRM  1174

Query  196   HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             H+PT S +  LKR+LRY+K  +  GL ++++S+  + A+SDSD AGC    +ST+GF + 
Sbjct  1175  HSPTTSDFGLLKRILRYIKGTIGMGLPIKRNSTLTLSAYSDSDHAGCKNTRRSTTGFCIL  1234

Query  376   LGSNLVSWVTKRK  414
             LGSNL+SW  KR+
Sbjct  1235  LGSNLISWSAKRQ  1247



>ref|XP_010039234.1| PREDICTED: uncharacterized protein LOC104427926 [Eucalyptus grandis]
Length=851

 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVI-DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A   + K + +P+S    V+I DT    +PT+Y SL G LQYLT+TR +++++ N LCQ 
Sbjct  542  AHMLDSKPVSTPLSLKPPVLINDTIPLTNPTEYRSLVGGLQYLTLTRPDIAYATNILCQR  601

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            M   T++ +  LKRVLRY+K  +  GL +   S+  ++ FSD+DWAGC    +ST+GF +
Sbjct  602  MQQLTIADFNHLKRVLRYIKGTLKLGLFLHSHSTMHLYGFSDADWAGCAETRRSTTGFCI  661

Query  373  FLGSNLVSWVTKRK  414
            +LGSNL+SW  K++
Sbjct  662  YLGSNLISWAAKKQ  675



>gb|ABA91195.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=978

 Score =   125 bits (314),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPI-STSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  +EC    +PI + SK    D     DPT+Y SLAGALQYLT+TR  L++ V Q+C  
Sbjct  766  AGMSECHSTATPIDALSKLSATDGAPVSDPTEYRSLAGALQYLTLTRPELAYVVQQVCLF  825

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   +KR+LRY+K  +  GL +  +    + A+S +DWAGCP   +STSG+ V
Sbjct  826  MHDPREPHLALIKRILRYIKGTLHIGLHLGTTLVDSLTAYSHADWAGCPDSRRSTSGYCV  885

Query  373  FLGSNLVSWVTKRK  414
            FLG NLVSW +KR+
Sbjct  886  FLGDNLVSWSSKRR  899



>emb|CAN64816.1| hypothetical protein VITISV_010668 [Vitis vinifera]
Length=1212

 Score =   125 bits (314),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
             + K I +P    + + I+  L+ DPT + S AGALQYLT+TR +LSFSVN +CQ MHAPT
Sbjct  994   DAKPISTPCVVGQHLSIEGKLFSDPTMFRSFAGALQYLTITRPDLSFSVNSICQFMHAPT  1053

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
               H+  LKR+LRYVK     GL++ + S+ +I A+SD +WAGCP   +ST+G+A+F 
Sbjct  1054  EDHFRALKRILRYVKGTPHHGLQLHQQSTHDILAYSDPNWAGCPDTRRSTTGYAIFF  1110



>ref|XP_010430787.1| PREDICTED: uncharacterized protein LOC104715028 [Camelina sativa]
Length=1121

 Score =   125 bits (314),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  88   LYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTF  267
            L+ +P+ + SLAG LQYLT+TR ++ F+VN +CQ MH PT++ +  LKR+LRY++   TF
Sbjct  377  LFPEPSYFRSLAGKLQYLTLTRPDIQFAVNFVCQRMHTPTMADFGLLKRILRYIRGTTTF  436

Query  268  GLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            GLR+ K+S   + A+SDSDWAGC    +ST+GF  FL +N++SW  KR+
Sbjct  437  GLRLNKTSFPPVLAYSDSDWAGCKETRRSTTGFCTFLNTNIISWSAKRQ  485


 Score =   124 bits (312),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +1

Query  70   VVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYV  249
            V +   L+ +P+ + SLAG LQYLT+TR ++ F+VN +CQ MH PT++ +  LKR+LRY+
Sbjct  561  VALGDELFPEPSYFRSLAGKLQYLTLTRPDIQFAVNFVCQRMHTPTMADFGLLKRILRYI  620

Query  250  K*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            +    FGLR+ K+S   + A+SDSDWAGC    +ST+GF  FL +N++SW  KR+
Sbjct  621  RGTTMFGLRLNKTSFPPVLAYSDSDWAGCKETRRSTTGFCTFLNTNIISWSAKRQ  675



>ref|XP_010669333.1| PREDICTED: copia protein isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010669334.1| PREDICTED: copia protein isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010669335.1| PREDICTED: copia protein isoform X1 [Beta vulgaris subsp. vulgaris]
Length=977

 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  + CK   +P+ T  K     T  Y DP+ Y SLAGALQYLT TR ++S++V Q+C +
Sbjct  719  AGMSTCKPSATPVDTKPKLGATSTAPYADPSHYRSLAGALQYLTFTRPDISYAVQQVCLY  778

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P  +H   LKR++RY++  +  GL +  S++  + +++D+DW GCP   +STSG+ V
Sbjct  779  MHDPRDAHMHALKRIIRYLQGTLDHGLHLYPSTTSTLISYTDADWGGCPDTRRSTSGYCV  838

Query  373  FLGSNLVSWVTKRK  414
            FLG NL+SW  KR+
Sbjct  839  FLGDNLLSWSAKRQ  852



>ref|XP_009359358.1| PREDICTED: uncharacterized protein LOC103949948 [Pyrus x bretschneideri]
Length=1243

 Score =   125 bits (314),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 87/131 (66%), Gaps = 2/131 (2%)
 Frame = +1

Query  25   TECKEIFSPI-STSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            TE K I +P+ S  K        YD P  Y S+ GALQY+T+TR +LS++VNQ+CQ MH+
Sbjct  787  TEAKPISTPVPSGHKLSAYVGESYDKPDVYRSVVGALQYITITRPDLSYAVNQVCQFMHS  846

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            P  +HW  +KR+LRY+K   T GL + K  S +I AFSD+D+AG P    ST GF ++ G
Sbjct  847  PKTTHWMAVKRILRYLKATHTHGL-LYKPGSTQISAFSDADYAGNPNSLHSTGGFCIYHG  905

Query  382  SNLVSWVTKRK  414
            SNLVSW +K++
Sbjct  906  SNLVSWSSKKQ  916



>ref|XP_004966833.1| PREDICTED: uncharacterized protein LOC101766505 [Setaria italica]
Length=943

 Score =   124 bits (312),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
            +CK   +P+ T   +  D     D + Y S+AGALQYLT TR +++++V Q+C +MH P 
Sbjct  785  DCKPCSTPVDTHAKLPADGVPVADSSHYRSIAGALQYLTFTRPDIAYAVQQVCLYMHDPR  844

Query  208  VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
              H   +KR+LRY++  +  G  + ++S  ++  +SD+DWAGCP   +STSG+ VFLG N
Sbjct  845  EPHLAAMKRILRYIQGSLELGFHLHRTSPTDLTVYSDADWAGCPETRRSTSGYGVFLGDN  904

Query  388  LVSWVTKRK*DL*QGII  438
            LVSW +K      QGI+
Sbjct  905  LVSWSSKH-----QGIV  916



>ref|XP_002443133.1| hypothetical protein SORBIDRAFT_08g010840 [Sorghum bicolor]
 gb|EES16971.1| hypothetical protein SORBIDRAFT_08g010840 [Sorghum bicolor]
Length=725

 Score =   124 bits (310),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPI-STSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A   EC    +P+ S +K    +     DP+ Y SLAG+LQYLT+TR +L+++V Q+C  
Sbjct  563  AGMAECHSTSTPVDSRAKLSATEGAPVADPSAYRSLAGSLQYLTLTRPDLAYAVQQVCLF  622

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P  +H   +KR+LRYVK  ++ GL +      ++ A+SD+DWAGCP   +STSGF V
Sbjct  623  MHDPREAHLALIKRILRYVKGTLSAGLHIGTGPVDKLIAYSDADWAGCPDSRRSTSGFCV  682

Query  373  FLGSNLVSWVTKRK  414
            FLG +LVSW +KR+
Sbjct  683  FLGDSLVSWSSKRQ  696



>emb|CAN68274.1| hypothetical protein VITISV_032833 [Vitis vinifera]
Length=715

 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = +1

Query  52   ISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLK  231
            +S +K    D     DP++Y  + GALQY+T+TR  +++S+NQLCQHM  PT +HW   K
Sbjct  495  VSGTKLSKFDGDPLLDPSEYHHIVGALQYITLTRPEIAYSMNQLCQHMQTPTTAHWTTAK  554

Query  232  RVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKR  411
            RVLRY+K  + FGL   K  S  I+A+ DSDWAG P D  ST G+ VF+G NL+SW  K+
Sbjct  555  RVLRYLKNTLDFGL-FYKPGSFAINAYCDSDWAGDPDDRCSTCGYGVFVGPNLISWSAKK  613

Query  412  K  414
            +
Sbjct  614  Q  614



>gb|AAP52546.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
 gb|AAX95563.1| hypothetical protein [Oryza sativa Japonica Group]
Length=760

 Score =   123 bits (309),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 89/136 (65%), Gaps = 9/136 (7%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDTTLY---DDPTQYMSLAGALQYLTVTRRNLSFSVNQLC  186
            A  + CK + +P+ST++ +   +       D T+Y S+ GAL      R ++SF VN++C
Sbjct  605  AGMSGCKPVATPMSTTEKLSAHSGSVLGEQDATKYRSIVGAL------RPDISFVVNKVC  658

Query  187  QHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGF  366
            Q +H PT+ HW  +KR+LRY+K  +  GLR+ +SSS  + AFSD+DWAG   D +ST GF
Sbjct  659  QFLHGPTLQHWMAVKRILRYIKSSIDLGLRINRSSSTLVSAFSDADWAGSVDDRRSTGGF  718

Query  367  AVFLGSNLVSWVTKRK  414
            AVFLGSNLVSW  +++
Sbjct  719  AVFLGSNLVSWSARKQ  734



>ref|XP_004986808.1| PREDICTED: uncharacterized protein LOC101773259 [Setaria italica]
Length=1950

 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 89/136 (65%), Gaps = 3/136 (2%)
 Frame = +1

Query  16    AFTTECKEIFSPIST-SKTVVIDTTLYD--DPTQYMSLAGALQYLTVTRRNLSFSVNQLC  186
             A   EC    +P+ T +K    D  L    D ++Y SLAGALQYLT+TR +L+++V Q+C
Sbjct  1690  AGMAECHPTTTPVDTHAKLSAADGDLLSEKDASEYRSLAGALQYLTLTRPDLAYAVQQVC  1749

Query  187   QHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGF  366
               MHAP   H   +KR+LR+V+  ++ GL +   S  ++ A+SD+DWAGCP   +STSGF
Sbjct  1750  LFMHAPREPHRALIKRILRFVQGTLSSGLHIGTGSVDKLTAYSDADWAGCPDSRRSTSGF  1809

Query  367   AVFLGSNLVSWVTKRK  414
              V+LG NLVSW +KR+
Sbjct  1810  CVYLGDNLVSWSSKRQ  1825



>ref|XP_006605007.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=298

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 85/136 (63%), Gaps = 1/136 (1%)
 Frame = +1

Query  10   NFAFTTECKEIFSPISTS-KTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLC  186
            + A  + CK   +P+ T  K     +T ++DPT Y SL GALQYLT TR +++++V QLC
Sbjct  35   DHAGMSSCKSSPTPVDTKLKLSATSSTPFEDPTLYRSLVGALQYLTFTRPDITYAVQQLC  94

Query  187  QHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGF  366
              MH P   H   LKR+L Y++  +  GL +  SS+  + +++D++W GCP   +ST G+
Sbjct  95   LFMHDPKDEHMHALKRILCYIQGTIDHGLHLYPSSTSTLVSYTDANWGGCPDRRRSTFGY  154

Query  367  AVFLGSNLVSWVTKRK  414
             VFLG NL+SW  KR+
Sbjct  155  CVFLGDNLISWSAKRQ  170



>emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera]
Length=1171

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = +1

Query  52    ISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLK  231
             ++++K    +  L  DP+ Y  + GALQY T+T  ++S++VNQLCQ+MH P   HW+ +K
Sbjct  1029  VASTKLSSTNGELLSDPSTYRHIIGALQYCTITXPDISYAVNQLCQYMHQPRTPHWQAMK  1088

Query  232   RVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKR  411
             RVLRY+K  V  GL     S  ++H + DSDWAG P D + TSG+ VFLG NLVSW +K+
Sbjct  1089  RVLRYLKGSVNHGL-FYTPSPLQLHTYCDSDWAGNPDDRRYTSGYGVFLGRNLVSWSSKK  1147

Query  412   K  414
             +
Sbjct  1148  Q  1148



>gb|AGV40508.1| hypothetical protein [Phaseolus vulgaris]
Length=1121

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +1

Query  82    TTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IV  261
             + ++ DPT Y S+ G LQYL VTR  LS+SVN++ Q MH+P + HW+ +KR+LRY+   +
Sbjct  968   SEIFSDPTLYRSVVGTLQYLLVTRLELSYSVNKVAQFMHSPQLHHWQAVKRILRYLAGTI  1027

Query  262   TFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
               GL +   SS  I AFSD+DW   P D KSTSGF V+LGSNL+SW+T ++
Sbjct  1028  DHGLLLHHQSSSFIKAFSDADWGVDPDDRKSTSGFCVYLGSNLISWLTHKQ  1078



>emb|CAN83285.1| hypothetical protein VITISV_004139 [Vitis vinifera]
Length=1556

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 90/142 (63%), Gaps = 7/142 (5%)
 Frame = +1

Query  10    NFAFT-------TECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSF  168
             ++AFT        +CK + +P+      + ++ L +DP+ +  L GALQYLT+TR +LS+
Sbjct  1252  HYAFTILERANMVDCKPMSTPLEAKTKTLPNSVLLEDPSYFRGLVGALQYLTLTRPDLSY  1311

Query  169   SVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*  348
             SVN   Q MHAPT+ H + ++R+LRYVK  +  GL     ++ ++ AFSD+DWAGC    
Sbjct  1312  SVNYASQFMHAPTLVHLKMVRRILRYVKGTIDIGLHFTSHTTLDLCAFSDADWAGCLTTR  1371

Query  349   KSTSGFAVFLGSNLVSWVTKRK  414
             +S +G+  FLG N++SW  K++
Sbjct  1372  RSITGYCTFLGGNIISWCAKKQ  1393



>gb|AAD43604.1|AC005698_3 T3P18.3 [Arabidopsis thaliana]
Length=1309

 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
             A  TEC  + +P+       +++  +++PT + SLAG LQYLT+TR ++ ++VN +CQ M
Sbjct  977   AGMTECNPMPTPLP-QHLEDLNSEPFEEPTYFRSLAGKLQYLTITRPDIQYAVNFICQRM  1035

Query  196   HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             HAPT S +  LKR+LRYVK  +  GL +RK  +  +  F DSD+AGC    +ST+GF + 
Sbjct  1036  HAPTNSDFGLLKRILRYVKGTINMGLPIRKHHNPVLSGFCDSDYAGCKDTRRSTTGFCIL  1095

Query  376   LGSNLVSWVTKRK  414
             LGS L+SW  KR+
Sbjct  1096  LGSTLISWSAKRQ  1108



>emb|CAN68496.1| hypothetical protein VITISV_010947 [Vitis vinifera]
Length=1539

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +1

Query  79    DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*I  258
             D     DP++Y  + GALQY+T+TR +++F+VN+ CQ M  P+  HW  +KR+LRY+K  
Sbjct  1312  DGVPLPDPSEYRRIVGALQYVTLTRLDIAFAVNKACQFMAKPSDVHWLAIKRILRYLKGT  1371

Query  259   VTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             ++ GL  + S+S E+  +SD DWA CP D +STSG+ VFLGSNL+SW + ++
Sbjct  1372  ISLGLHFQPSTSMELQGYSDVDWASCPDDRRSTSGYYVFLGSNLISWSSSKQ  1423



>emb|CAC37623.1| copia-like polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
             A  TEC  + +P+       +++  +++PT + SLAG LQYLT+TR ++ ++VN +CQ M
Sbjct  1134  AGMTECNPMPTPLP-QHLEDLNSEPFEEPTYFRSLAGKLQYLTITRPDIQYAVNFICQRM  1192

Query  196   HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             HAPT S +  LKR+LRYVK  +  GL +RK  +  +  F DSD+AGC    +ST+GF + 
Sbjct  1193  HAPTNSDFGLLKRILRYVKGTINMGLPIRKHHNPVLSGFCDSDYAGCKDTRRSTTGFCIL  1252

Query  376   LGSNLVSWVTKRK  414
             LGS L+SW  KR+
Sbjct  1253  LGSTLISWSAKRQ  1265



>ref|XP_002489309.1| hypothetical protein SORBIDRAFT_0010s008890 [Sorghum bicolor]
 gb|EES20102.1| hypothetical protein SORBIDRAFT_0010s008890 [Sorghum bicolor]
Length=1017

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            A    CK   +PI T   +        DP++Y S+AGALQYLT+TR +++++V Q C HM
Sbjct  639  AGMVNCKPAATPIDTKAKLPSSGAAVQDPSEYRSIAGALQYLTITRPDIAYAVQQACLHM  698

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRK-SSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            H P   H+  LKR+ RYV+   + GL +    S+  I A+SD+DWAGCP   +STSG+ +
Sbjct  699  HDPRDCHFAILKRIQRYVRGTTSHGLHLHGVPSTPTIIAYSDADWAGCPDTRRSTSGYCI  758

Query  373  FLGSNLVSWVTKRK  414
            +LG+ LVSW +KR+
Sbjct  759  YLGNALVSWSSKRQ  772



>emb|CAN61230.1| hypothetical protein VITISV_010115 [Vitis vinifera]
Length=478

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = +1

Query  10   NFAFTTECKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLC  186
            N    TE K   +P++TS  + + + T   DPT+Y ++ G+LQYL++TR +++++VN+L 
Sbjct  212  NRTHMTEAKPAPTPLATSPILTLQSGTPLSDPTEYRTVVGSLQYLSLTRPDIAYTVNKLS  271

Query  187  QHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGF  366
            Q MH PT  HW  +KR+LRY+   +   + +R++S   +HAFSDSDWAG   D  STS +
Sbjct  272  QFMHQPTSDHWNAVKRLLRYLCGTLDHDITLRRTSPLALHAFSDSDWAGNKDDFTSTSAY  331

Query  367  AVFLGSNLVSWVTKRK  414
             ++LG N +SW +K++
Sbjct  332  IIYLGHNPISWSSKKQ  347



>ref|XP_010683797.1| PREDICTED: uncharacterized protein LOC104898410 [Beta vulgaris 
subsp. vulgaris]
Length=1116

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A    CK   +P+ T +K          DPT + SLAGALQYLT TR ++S++V Q+C  
Sbjct  859  AHMASCKPSATPVDTKAKLSASSGPPVADPTLFRSLAGALQYLTFTRPDISYAVQQICLF  918

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P  SH   LKR++RYV+  +  GL +  S S  + +++D+DW GCP   +STSG+ V
Sbjct  919  MHDPRESHLHALKRIIRYVQGTLHLGLHLYSSPSTRLVSYTDADWGGCPDTRRSTSGYCV  978

Query  373  FLGSNLVSWVTKRK  414
            FLG NL+SW +KR+
Sbjct  979  FLGDNLISWSSKRQ  992



>emb|CAN60203.1| hypothetical protein VITISV_036059 [Vitis vinifera]
Length=1412

 Score =   123 bits (308),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 82/129 (64%), Gaps = 0/129 (0%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
             +CK + +P+        +  L +DP+ +  L GALQYLT+TR +LS+SVN   Q MHAPT
Sbjct  1027  DCKPMSTPLEAKTKTSPNNVLLEDPSHFRGLVGALQYLTLTRPDLSYSVNYASQFMHAPT  1086

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
             + H + ++R+LRYVK  +  GL     ++ ++ AFSD+DWAG P    S +G+  FLG N
Sbjct  1087  LMHLKMVRRILRYVKGTIDIGLHFTSHTTLDLCAFSDADWAGXPTTXXSITGYCTFLGXN  1146

Query  388   LVSWVTKRK  414
             L+SW  K++
Sbjct  1147  LISWCAKKQ  1155



>emb|CAN72498.1| hypothetical protein VITISV_010513 [Vitis vinifera]
Length=1394

 Score =   123 bits (308),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +1

Query  79    DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*I  258
             D     DP++Y  + GAL Y+T+TR +++F+VN+ CQ M  P+  HW  +KR+LRY+K  
Sbjct  1032  DGVPLPDPSEYRRIVGALXYVTLTRPDIAFAVNKACQFMAKPSDVHWLAVKRILRYLKGT  1091

Query  259   VTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             ++ GL  + S+S E+  +SD+DWA CP D +STSG+ VFLGSNL+SW + ++
Sbjct  1092  ISLGLHFQPSTSMELQGYSDADWASCPDDRRSTSGYCVFLGSNLISWSSSKQ  1143



>ref|XP_002449547.1| hypothetical protein SORBIDRAFT_05g018930 [Sorghum bicolor]
 gb|EES08535.1| hypothetical protein SORBIDRAFT_05g018930 [Sorghum bicolor]
Length=619

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPI-STSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A   EC    +P+ S +K    + T   DP+ Y SLAG+LQYLT+TR +L+++V Q+C  
Sbjct  362  AGMAECHLTSTPVDSRAKLSATEGTPVADPSAYRSLAGSLQYLTLTRPDLAYAVQQVCLF  421

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P  +H   +KR+LRYVK  ++ GL +      ++ A+SD+DWA CP   +STSGF V
Sbjct  422  MHDPREAHLALIKRILRYVKGTLSAGLHIGTGPVDKLIAYSDADWARCPDSRRSTSGFCV  481

Query  373  FLGSNLVSWVTKRK  414
            FLG +LVSW +KR+
Sbjct  482  FLGDSLVSWSSKRQ  495



>ref|XP_010666841.1| PREDICTED: uncharacterized protein LOC104883959 [Beta vulgaris 
subsp. vulgaris]
Length=929

 Score =   122 bits (306),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDTTLY-DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A  + CK   +P+ T   +   T +   DP+ Y SLAGALQYLT +R ++S++V Q+C  
Sbjct  671  AGMSACKPSPTPVDTKPKLSAQTEVACRDPSLYRSLAGALQYLTFSRPDISYAVQQICLF  730

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   LKR++RYVK  + +GL +  SS   + +++D+DW GCP   +STSG+ V
Sbjct  731  MHQPMEDHMSALKRIIRYVKGTLEYGLHLYPSSITTLISYTDADWGGCPDTRRSTSGYCV  790

Query  373  FLGSNLVSWVTKRK  414
            FLG NL+SW +KR+
Sbjct  791  FLGDNLLSWSSKRQ  804



>ref|XP_008341972.1| PREDICTED: uncharacterized protein LOC103404787 [Malus domestica]
Length=836

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +1

Query  79   DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*I  258
            D   Y++P  Y S+ GA+QYLT TR +++FSV+Q+CQ M  P VSH+  +KR+LRY+K  
Sbjct  633  DGEPYNNPIHYRSVVGAMQYLTFTRPDIAFSVHQVCQFMQCPMVSHYTAVKRILRYLKGT  692

Query  259  VTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            +T+GL     S+ +I AFSD+DWAG P D +ST+G  V+LGSN +SW +K++
Sbjct  693  MTYGLSYSH-SALDIKAFSDADWAGDPNDRRSTTGLVVYLGSNPISWSSKKQ  743



>emb|CAB10381.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB78644.1| retrotransposon like protein [Arabidopsis thaliana]
Length=326

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 85/142 (60%), Gaps = 13/142 (9%)
 Frame = +1

Query  28   ECKEIFSPISTS-KTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
            EC  + +P+      V     L+ +PT + SLAG LQYLT+TR +L FSVN +CQ MH P
Sbjct  3    ECSPMPTPLPLQLHKVPHQEELFANPTYFRSLAGKLQYLTLTRPDLQFSVNFVCQKMHQP  62

Query  205  TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSRE------------IHAFSDSDWAGCPAD*  348
            TVS +  LKR+LRYVK  ++ G+   K S  +            + A+SDSDW GC    
Sbjct  63   TVSDYNLLKRILRYVKGTLSMGIHFSKHSDFQLRVYTEKDPAFSLRAYSDSDWGGCKDTR  122

Query  349  KSTSGFAVFLGSNLVSWVTKRK  414
            +ST G+  FLG+NL+SW +K++
Sbjct  123  RSTGGYCTFLGTNLISWSSKKQ  144



>gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=2301

 Score =   122 bits (307),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPISTSKTVVI-DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  +EC  + +P+    + V      ++DPT + SLAG LQYLT+TR +L +SVN +CQ 
Sbjct  1149  AGMSECTTVATPLPLQLSKVPHQDKKFEDPTYFRSLAGKLQYLTLTRPDLQYSVNYVCQK  1208

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
             MH PTVS +  LKR+LRYV+  + +G+ + K +   + A+SDSDWAGC    +ST GF  
Sbjct  1209  MHEPTVSDFMLLKRILRYVQGTLDYGVNIFKDTDFTLRAYSDSDWAGCHNTRRSTGGFCT  1268

Query  373   FLGSNLVSWVTKRK  414
             +LG N++SW +K++
Sbjct  1269  YLGLNIISWSSKKQ  1282



>ref|XP_002445301.1| hypothetical protein SORBIDRAFT_07g008525 [Sorghum bicolor]
 gb|EES14796.1| hypothetical protein SORBIDRAFT_07g008525 [Sorghum bicolor]
Length=659

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 83/128 (65%), Gaps = 0/128 (0%)
 Frame = +1

Query  31   CKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTV  210
            CK   +P+ T   +  D     DP+ Y S+AGALQYLT TR +++++V Q+C +MH P  
Sbjct  413  CKPCSTPVDTHSKLSADGAAVTDPSSYRSIAGALQYLTFTRPDIAYAVQQVCLYMHDPRE  472

Query  211  SHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNL  390
             H   +KR+LRY++  +  GL + ++S  ++  ++D+DWAG P   KSTSG+AVFL  NL
Sbjct  473  PHLGAMKRILRYLQGTLDLGLHLHRTSPVDLTVYTDADWAGYPDTRKSTSGYAVFLVDNL  532

Query  391  VSWVTKRK  414
            +SW  KR+
Sbjct  533  ISWSFKRQ  540



>ref|XP_008366955.1| PREDICTED: uncharacterized protein LOC103430588 [Malus domestica]
Length=560

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  79   DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*I  258
            D   Y++PT Y S+ GALQYLT TR ++SFSV+Q+CQ M  P VSH+  +KR+LRY+K  
Sbjct  352  DGLPYNNPTAYRSIVGALQYLTFTRPDISFSVHQVCQFMQNPMVSHFTAVKRILRYLKDT  411

Query  259  VTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            +  GL   K S   I AFSD+DWAG P D +ST+G  VFLGSN VS  +K++
Sbjct  412  MQLGLTYSK-SDLTIRAFSDADWAGDPNDRRSTTGLVVFLGSNPVSXSSKKQ  462



>ref|XP_010534677.1| PREDICTED: uncharacterized protein LOC104810178 [Tarenaya hassleriana]
Length=463

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 86/129 (67%), Gaps = 1/129 (1%)
 Frame = +1

Query  31   CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
            C    +P+ T   + +DT     DP+ + S+ GALQYLT TR ++ ++V QLC  +HAP 
Sbjct  148  CNLCITPVDTKPKLSVDTGAPVADPSLFRSIVGALQYLTFTRPDIQYAVQQLCLFLHAPR  207

Query  208  VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
              H + +KRVL Y++  +  G+++R S++ E+ ++SD+DWAGC    +STSG+ VFLG N
Sbjct  208  EPHLQAMKRVLCYIQGTIHHGIQLRPSTTSELTSYSDADWAGCSDMRRSTSGYCVFLGDN  267

Query  388  LVSWVTKRK  414
            L+SW +KR+
Sbjct  268  LISWSSKRQ  276



>emb|CAN76151.1| hypothetical protein VITISV_012673 [Vitis vinifera]
Length=979

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 86/130 (66%), Gaps = 1/130 (1%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVI-DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
            +CK I + ++TS T+   D +L  DP+QY ++ G LQY T+TR ++SFS+N+LCQ M +P
Sbjct  790  DCKPIATXMTTSXTLYASDGSLLADPSQYHNIVGTLQYCTITRPDISFSINKLCQFMQSP  849

Query  205  TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
            T  HW+ +KR LRY+K   +FGL    S   ++   +D++W GC  D  STSG  +F GS
Sbjct  850  TDLHWKVVKRSLRYLKGTTSFGLSFHSSLDLQLTVXADANWVGCXDDRLSTSGHCIFFGS  909

Query  385  NLVSWVTKRK  414
            NLVSW + ++
Sbjct  910  NLVSWSSNKQ  919



>ref|XP_004967003.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Setaria italica]
Length=163

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            A   +C    +P+ T+  +  D  L  D   + S+A ALQYLT TR ++++ V Q+C  M
Sbjct  37   AGMMDCMPCSTPVDTNHKLAADGPLVKDEFGFCSIASALQYLTFTRTDIAYDVQQVCLFM  96

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
            H P   H + LKR+L+Y++ I+  GL +R + S E+  +SD  WAGCP   KSTS +AVF
Sbjct  97   HDPREPHLDALKRILQYIQGILDLGLLLRSTPSAELLVYSDVGWAGCPETWKSTSSYAVF  156

Query  376  LGSNLVS  396
            LG NLVS
Sbjct  157  LGDNLVS  163



>gb|KHN45218.1| Putative mitochondrial protein, partial [Glycine soja]
Length=283

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 81/129 (63%), Gaps = 1/129 (1%)
 Frame = +1

Query  31   CKEIFSPISTSKTVVID-TTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
            C+ + SP+  +  ++ D + +Y DP +Y  L G L YLT+TR ++SF+V  + Q M  P 
Sbjct  77   CRPVESPMDPNLKLMADQSEVYPDPERYRRLVGKLIYLTITRPDISFAVGVVSQFMQNPH  136

Query  208  VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
            + HW  + R+LRY+K     GL      + ++  + D+DWAGCP D +STSG+ VF+G N
Sbjct  137  LDHWNAVMRILRYIKRAPGQGLLYEDKGNTQLSGYCDADWAGCPMDRRSTSGYCVFIGGN  196

Query  388  LVSWVTKRK  414
            LVSW +K++
Sbjct  197  LVSWKSKKQ  205



>emb|CBI32394.3| unnamed protein product [Vitis vinifera]
Length=1135

 Score =   122 bits (305),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPISTSKTVVI-DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  +E K + SP++    + I D T ++DPT Y SL GALQY T+TR ++++++N+  Q 
Sbjct  958   AGLSESKLVTSPMAVGHVLSIADGTRFEDPTLYRSLVGALQYCTITRPDIAYTINKFFQF  1017

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
             MHAPT +H + +KRVLRY+K  + +GL  + SSS ++ A++D+D A CP D +ST+G+ +
Sbjct  1018  MHAPTSTHLQAVKRVLRYLKGSLFYGLSFQPSSSLDLIAYTDADGASCPDDRRSTNGYCI  1077

Query  373   FLGSNLVSWVTKRK  414
             F   NL+SW   ++
Sbjct  1078  FFRGNLISWSASKQ  1091



>emb|CAN81355.1| hypothetical protein VITISV_039158 [Vitis vinifera]
Length=1402

 Score =   122 bits (306),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +1

Query  76    IDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*  255
              D  L DD T Y S+ GALQY T+TR +++FS+N+ CQ MH PT +HW  +KR+LRY+K 
Sbjct  1145  FDGDLMDDVTMYRSVVGALQYATLTRPDIAFSINKACQFMHRPTSTHWSSVKRILRYLKG  1204

Query  256   IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
              +T GL ++ S+   I A++D+DW   P D +S+SG+ V+LG+NLVSW   ++
Sbjct  1205  TITHGLLLQPSAHFTIQAYTDADWGAQPDDRRSSSGYLVYLGNNLVSWTASKQ  1257



>emb|CAN78451.1| hypothetical protein VITISV_005945 [Vitis vinifera]
Length=773

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +1

Query  97   DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
            DP++Y    GALQY+T+TR +++F+VN+ CQ M  P+  HW  +KR+LRY+K  +  GL 
Sbjct  490  DPSEYRRTVGALQYVTLTRPDIAFAVNKACQFMAKPSDVHWMAVKRILRYLKGTIHLGLH  549

Query  277  VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             + ++S E   +SD+DWA CP D +STSG+ VFLGSNL+SW + ++
Sbjct  550  FQPAASMEXQGYSDADWASCPDDRRSTSGYCVFLGSNLISWSSSKQ  595



>emb|CAN64288.1| hypothetical protein VITISV_022326 [Vitis vinifera]
Length=1508

 Score =   122 bits (305),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +1

Query  79    DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*I  258
             D     DP++Y  + GAL Y+T+TR +++F+VN+ CQ M  P+  HW   KR+LRY+K  
Sbjct  1288  DGVPLPDPSEYRRIVGALXYVTLTRXDIAFAVNKACQFMAKPSDVHWLAXKRILRYLKGT  1347

Query  259   VTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             ++ GL  + S+S E+  +SD+DWA CP D +STSG+ VFLGSNL+SW + ++
Sbjct  1348  ISLGLHFQPSTSMELQGYSDADWASCPDDRRSTSGYXVFLGSNLISWSSSKQ  1399



>emb|CAN73924.1| hypothetical protein VITISV_041509 [Vitis vinifera]
Length=1434

 Score =   122 bits (305),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +1

Query  97    DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
             DP++Y    GALQY+T+TR +++F+VN+ CQ M  P+  HW  +KR+LRY+K  +  GL 
Sbjct  1143  DPSEYRRTVGALQYVTLTRPDIAFAVNKACQFMAKPSDVHWMAVKRILRYLKGTIHLGLH  1202

Query  277   VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
              + ++S E+  +SD+DWA CP D +STSG+ VFLGSNL+SW + ++
Sbjct  1203  FQPAASMELQGYSDADWASCPDDRRSTSGYCVFLGSNLISWSSSKQ  1248



>emb|CAN74921.1| hypothetical protein VITISV_022027 [Vitis vinifera]
Length=551

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 86/128 (67%), Gaps = 1/128 (1%)
 Frame = +1

Query  34   KEIFSPISTSKTVV-IDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTV  210
            K + +P S  +T+   D     DP++Y  + GALQY+T+TR +++F+VN+ CQ M  P+ 
Sbjct  233  KPVPTPGSLRRTLFQSDGVPLPDPSEYRCIVGALQYVTLTRPDIAFAVNKACQFMAKPSD  292

Query  211  SHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNL  390
             HW  +K +LRY+K  ++ GL  + S+S E+  +SD+DWA C  D +STSG+ VFLGSNL
Sbjct  293  VHWLAVKSILRYLKGTISLGLHFQPSTSMELQGYSDADWASCLNDRRSTSGYCVFLGSNL  352

Query  391  VSWVTKRK  414
            +SW + ++
Sbjct  353  ISWSSSKQ  360



>emb|CAN79148.1| hypothetical protein VITISV_004343 [Vitis vinifera]
Length=1334

 Score =   122 bits (305),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +1

Query  97    DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
             DP++Y    GALQY+T+TR +++F+VN+ CQ M  P+  HW  +KR+LRY+K  +  GL 
Sbjct  1143  DPSEYRRTVGALQYVTLTRPDIAFAVNKACQFMAKPSDVHWMAVKRILRYLKGTIHLGLH  1202

Query  277   VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
              + ++S E+  +SD+DWA CP D +STSG+ VFLGSNL+SW + ++
Sbjct  1203  FQPAASMELQGYSDADWASCPDDRRSTSGYCVFLGSNLISWSSSKQ  1248



>gb|ABA98073.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=724

 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +1

Query  97   DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
            +PT + SLAGALQYLT TR ++S++V Q+C HMH P   H   LKR+LRY++  +   L 
Sbjct  468  NPTDFRSLAGALQYLTFTRPDISYAVQQVCLHMHDPRKPHLAALKRILRYIRGTLDLSLH  527

Query  277  VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            +++S + ++  +SD+DWAGCP   +S SG+A+F G NLVSW +KR+
Sbjct  528  IQRSCTSDLTVYSDADWAGCPDTRRSMSGYAIFHGDNLVSWSSKRQ  573



>ref|XP_002489175.1| hypothetical protein SORBIDRAFT_0013s004020 [Sorghum bicolor]
 gb|EES20270.1| hypothetical protein SORBIDRAFT_0013s004020 [Sorghum bicolor]
Length=931

 Score =   121 bits (303),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +1

Query  97   DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
            DPT Y SL GALQYLT TR +++++V Q+C HMH P   H   LKR+L Y++  V + L 
Sbjct  761  DPTAYRSLVGALQYLTFTRPDITYAVQQICLHMHDPREPHQTALKRLLCYLRGTVNYRLL  820

Query  277  VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            +++SSS E+  ++++DWAGCP   +STSG+AVFLG NLVSW +KR+
Sbjct  821  LQRSSSTELVVYTNTDWAGCPDTRRSTSGYAVFLGGNLVSWSSKRQ  866



>ref|XP_008341155.1| PREDICTED: uncharacterized protein LOC103404078 [Malus domestica]
Length=986

 Score =   121 bits (303),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 87/127 (69%), Gaps = 2/127 (2%)
 Frame = +1

Query  34   KEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVS  213
            K   +P+ ++K     + L  DP+ Y S  GALQYLT TR +L+F+VNQ+CQHMH+P   
Sbjct  429  KPCSTPVGSAKLDHSGSPL-SDPSFYRSTVGALQYLTWTRPDLAFAVNQVCQHMHSPRTV  487

Query  214  HWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLV  393
            H + +KR+LRY+K  + FGL + K   + + A+SD+DWAGC  D +STSG+ VFLG NL+
Sbjct  488  HLQAVKRILRYLKGTLHFGLWLTK-GPQYLTAWSDADWAGCLVDRRSTSGYCVFLGPNLI  546

Query  394  SWVTKRK  414
            SW  K++
Sbjct  547  SWSAKKQ  553



>gb|AID60162.1| copia-like LTR-retrotransposon [Brassica napus]
Length=643

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            A  + C  + +P+ T+    +   L+ +PT + S+AG LQYLT++R ++ F+VN +CQ M
Sbjct  250  ANMSTCNPMPTPLPTTLDT-LQEDLFPEPTYFRSIAGKLQYLTISRPDIQFAVNFVCQRM  308

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
            H PTV  +  LKR++RYV+   + G+ +RK +   +  F DSDW+GC    +STSG    
Sbjct  309  HEPTVGDFGLLKRIMRYVRGTCSMGIHIRKQADMILSGFCDSDWSGCRETRRSTSGICTL  368

Query  376  LGSNLVSWVTKRK  414
            LGSNL+SW  KR+
Sbjct  369  LGSNLISWSAKRQ  381



>ref|XP_008228040.1| PREDICTED: uncharacterized protein LOC103327479 [Prunus mume]
Length=1047

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = +1

Query  79   DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*I  258
            D   Y +PT Y S+ GALQYLT TR +++FSV+Q+CQ M  P VSH+  +KR+LRY+K  
Sbjct  820  DGQPYGNPTLYRSIVGALQYLTFTRPDIAFSVHQVCQFMQNPMVSHFTAVKRILRYLKGT  879

Query  259  VTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            + FGL   +  +  + AFSD+DWAG P D +ST+G  VFLGSN VSW +K++
Sbjct  880  LHFGLSYTR-GNLNLTAFSDADWAGDPNDRRSTTGLVVFLGSNPVSWSSKKQ  930



>emb|CAN59952.1| hypothetical protein VITISV_006720 [Vitis vinifera]
Length=1365

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +1

Query  76    IDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*  255
              D  L DD T Y S+ GALQY T+TR +++FSVN+ CQ MH PT +HW  +KR+LRY+K 
Sbjct  1108  FDGDLMDDVTMYRSVVGALQYATLTRPDIAFSVNKACQFMHRPTSTHWSSVKRILRYLKG  1167

Query  256   IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
               T GL ++ S+   + A++D+DW   P D +S+SG+ V+LG+NLVSW   ++
Sbjct  1168  TTTHGLXLQPSAHFTVQAYTDADWGAQPDDRRSSSGYLVYLGNNLVSWTASKQ  1220



>emb|CAN63683.1| hypothetical protein VITISV_030301 [Vitis vinifera]
Length=1272

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +1

Query  97    DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
             DP +Y    GALQY+T+TR +++F+VN+ CQ M  P+  HW  +KR+LRY+K  +  GL 
Sbjct  1012  DPLEYRRTVGALQYVTLTRPDIAFAVNKACQFMAKPSDVHWMAVKRILRYLKGTIHLGLH  1071

Query  277   VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
              + ++S E+  +SD+DWA CP D +STSG+ VFLGSNL+SW + ++
Sbjct  1072  FQPAASMELQGYSDADWASCPDDRRSTSGYCVFLGSNLISWSSSKQ  1117



>gb|ABA94767.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2446

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A   EC    +P+ T +K    D     DP++Y S+AG LQYLT+ R +L+++V Q+C  
Sbjct  827  AGMAECHSTSTPVDTRAKLSATDGLPVADPSEYRSIAGTLQYLTLIRPDLTYAVQQVCLF  886

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH P   H   +KR+LRYVK  ++  L +  S  + + A+SD+DWAGCP   +STSG+ V
Sbjct  887  MHDPREPHLALVKRILRYVKGSLSTSLHIGSSMIQSLTAYSDADWAGCPDSRRSTSGYCV  946

Query  373  FLGSNLVSWVTKRK  414
            FLG NLVSW +KR+
Sbjct  947  FLGDNLVSWSSKRQ  960



>gb|AID60119.1| hypothetical protein [Brassica napus]
Length=848

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 81/126 (64%), Gaps = 3/126 (2%)
 Frame = +1

Query  46   SPISTSKTVVIDT---TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSH  216
            +P+ T     +DT    L+ +PT + S+AG LQYLT++R ++ F+VN +CQ MH PTV  
Sbjct  537  NPMPTPLPTTLDTLQEDLFPEPTYFRSIAGKLQYLTISRPDIQFAVNFVCQRMHEPTVGD  596

Query  217  WEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVS  396
            +  LKR++RYV+   + G+ +RK +   +  F DSDW+GC    +STSG    LGSNL+S
Sbjct  597  FGLLKRIMRYVRGTCSMGIHIRKQADMILSGFCDSDWSGCRETRRSTSGICTLLGSNLIS  656

Query  397  WVTKRK  414
            W  KR+
Sbjct  657  WSAKRQ  662



>ref|XP_006603141.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=268

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 84/130 (65%), Gaps = 1/130 (1%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVID-TTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
              K I +P++    + +D    + DPT Y S+ GALQY T+TR N+S++VN+LCQ MH+ 
Sbjct  114  NAKPIKTPLAPGSKLHMDGIDAFSDPTLYRSVVGALQYATITRPNISYAVNKLCQFMHSL  173

Query  205  TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
              SHW+ +K VLRY+   V  GL    S    I ++SDSDWA   ++  STSGF V+LG+
Sbjct  174  LESHWKAIKHVLRYLNGTVDHGLTFYPSQHLFITSYSDSDWACDSSNMWSTSGFCVYLGN  233

Query  385  NLVSWVTKRK  414
            NLVSW+ K++
Sbjct  234  NLVSWLAKKQ  243



>emb|CAN59963.1| hypothetical protein VITISV_022756 [Vitis vinifera]
Length=530

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +1

Query  97   DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
            DP++Y    GALQY+T+ R +++F+VN+ CQ M  P+  HW  +KR+LRY+K  +  GL 
Sbjct  270  DPSEYRRTVGALQYVTLXRPDIAFAVNKXCQFMAKPSDVHWMAVKRILRYLKGTIHLGLH  329

Query  277  VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             + ++S E+  +SD+DWA CP D +STSG+ VFLGSNL+ W + ++
Sbjct  330  FQPAASMELQGYSDADWASCPDDRRSTSGYCVFLGSNLIFWSSSKQ  375



>ref|XP_008389560.1| PREDICTED: uncharacterized protein LOC103451895 [Malus domestica]
Length=1300

 Score =   120 bits (302),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 90/130 (69%), Gaps = 2/130 (2%)
 Frame = +1

Query  28    ECKEIFSP-ISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
             +CK   +P +  ++ V  D T Y++PT Y S+ GALQYLT TR +++FSV+Q+CQ M +P
Sbjct  1041  DCKPCDTPCLPYTRLVKDDGTPYNNPTAYRSIVGALQYLTFTRPDIAFSVHQVCQFMQSP  1100

Query  205   TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
              +SH+  +KR+LRY+K  ++ G+   +     + AFSD+DWAG P D +ST+G  VFLG+
Sbjct  1101  MMSHFTAVKRILRYLKGTLSVGMSYTR-GDLLLKAFSDADWAGDPNDRRSTTGLVVFLGN  1159

Query  385   NLVSWVTKRK  414
             N +SW +K++
Sbjct  1160  NPISWSSKKQ  1169



>ref|XP_004971463.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Setaria italica]
Length=357

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 90/135 (67%), Gaps = 10/135 (7%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVIDTTLYDDP------TQYMSLAGALQYLTVTRRNLSFSVNQLCQ  189
            +CK + +P++ S+ + +D     DP      T+Y ++ G LQYLT+TR +++F+ N++CQ
Sbjct  110  DCKPMHTPMAVSEKLQVDVG---DPLDLETATRYRNIVGGLQYLTLTRPDIAFAFNKVCQ  166

Query  190  HMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFA  369
            + H  T+ H+  +K +LRY+   +++ L+  +SS+  I AFSD+DWAGC  D KST GF 
Sbjct  167  YFHCLTLVHYFAVKHILRYISGTISYVLKFVQSSNV-ISAFSDADWAGCSDDRKSTGGFG  225

Query  370  VFLGSNLVSWVTKRK  414
            VF G+NL+SW  K++
Sbjct  226  VFFGANLISWQAKKQ  240



>ref|XP_010684978.1| PREDICTED: uncharacterized protein LOC104899479 [Beta vulgaris 
subsp. vulgaris]
Length=1367

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  + CK   +P+ T +K          DPT + SLAGALQYLT TR ++S++V Q+C  
Sbjct  1109  ANMSSCKPSATPVDTKAKLSASSGPSVADPTLFRSLAGALQYLTFTRPDISYAVQQICLF  1168

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
             MH P   H + LKR+LRYV+  +  GL +  S    + +++D+DW GCP   +STSG+ V
Sbjct  1169  MHDPREPHLQALKRILRYVQGTLHLGLHLYASRDSRLVSYTDADWGGCPDTRRSTSGYCV  1228

Query  373   FLGSNLVSWVTKRK  414
             FLG NL+SW +KR+
Sbjct  1229  FLGDNLISWSSKRQ  1242



>emb|CAN66863.1| hypothetical protein VITISV_013500 [Vitis vinifera]
Length=1112

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = +1

Query  10    NFAFTTECKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLC  186
             N    TE K   +P++TS  + + + T   +PT+Y ++ G+LQYL++TR +++++VN+L 
Sbjct  872   NRTHMTEAKPAPTPLATSPILTLQSGTPLSNPTEYRTMVGSLQYLSLTRPDIAYTVNKLS  931

Query  187   QHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGF  366
             Q MH PT  HW  +KR+LRY+   +  G+ +R++S   +H FSDSDWAG   D  STS +
Sbjct  932   QFMHQPTSDHWNAVKRLLRYLCGTLDHGITLRRTSPLALHVFSDSDWAGNKDDFTSTSAY  991

Query  367   AVFLGSNLVSWVTKRK  414
              ++LG N +SW +K++
Sbjct  992   IIYLGHNPISWSSKKQ  1007



>ref|XP_004954648.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Setaria italica]
Length=231

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (63%), Gaps = 5/134 (4%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVI-DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
             CK + +P+ T   V   D  L    T Y S+AG LQYLT+T  ++++ VNQ C HMH P
Sbjct  3    NCKPVPTPVDTKPKVSTNDGELLSVATFYHSIAGVLQYLTLTWPDIAYVVNQACLHMHTP  62

Query  205  TVSHWEQLKRVLRYVK*I----VTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
              +HW  +K+VL Y++      +T  +RV  SSS ++  +SD DWAGCP   +STSG+ +
Sbjct  63   RDAHWNLIKQVLLYLRGTMRGTITDNIRVSASSSCDLTVYSDIDWAGCPDTRRSTSGYCI  122

Query  373  FLGSNLVSWVTKRK  414
            FLG+ LVSW +KR+
Sbjct  123  FLGNTLVSWSSKRQ  136



>dbj|BAM42647.1| polyprotein [Arabidopsis thaliana]
 dbj|BAM42648.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1220  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1279

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1280  DDHWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1339

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1340  PISWSSKKQ----KGVVRS  1354



>gb|KHN44882.1| Putative mitochondrial protein, partial [Glycine soja]
Length=283

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = +1

Query  31   CKEIFSPISTSKTVVID-TTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
            C+ I SP+  +  ++ D +  Y DP +Y  L G L YLT+TR ++SF+V  + Q M  P 
Sbjct  77   CRPIESPMDPNLKLMADQSEAYPDPERYKRLVGKLIYLTITRPDISFAVGVVSQFMQNPH  136

Query  208  VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
            + HW  + R+LRYVK     GL      S ++  + D DW GCP D +STSG+ VF+G N
Sbjct  137  LDHWNVVMRILRYVKKATGQGLLYEDKGSTQLSGYCDVDWVGCPMDRRSTSGYCVFIGGN  196

Query  388  LVSWVTKRK  414
            L+SW +K++
Sbjct  197  LISWKSKKQ  205



>dbj|BAM44531.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1220  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1279

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1280  DDHWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1339

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1340  PISWSSKKQ----KGVVRS  1354



>dbj|BAM42650.1| Polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1220  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1279

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1280  DDHWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1339

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1340  PISWSSKKQ----KGVVRS  1354



>dbj|BAM44530.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1220  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1279

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1280  DDHWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1339

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1340  PISWSSKKQ----KGVVRS  1354



>dbj|BAM42646.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1220  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1279

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1280  DDHWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1339

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1340  PISWSSKKQ----KGVVRS  1354



>dbj|BAA78427.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1220  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1279

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1280  DDHWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1339

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1340  PISWSSKKQ----KGVVRS  1354



>dbj|BAM44532.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1220  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1279

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1280  DDHWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1339

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1340  PISWSSKKQ----KGVVRS  1354



>dbj|BAM44529.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1220  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1279

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1280  DDHWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1339

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1340  PISWSSKKQ----KGVVRS  1354



>emb|CAN71553.1| hypothetical protein VITISV_034738 [Vitis vinifera]
Length=1312

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = +1

Query  97    DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
             D T Y SL GALQY+T+TR  +SF+VN+ CQ+M  PT SH +  KR+LRY+K   T G+ 
Sbjct  1085  DATHYRSLVGALQYITLTRPEISFAVNRACQYMARPTTSHLQAAKRILRYLKGTATHGIS  1144

Query  277   VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             +  S S  +  ++D+DWA CP D +STSGF +F G+NL+SW + ++
Sbjct  1145  IHASPSLSLQGYTDADWASCPDDRRSTSGFCLFFGTNLISWSSTKQ  1190



>dbj|BAA78424.1| polyprotein [Arabidopsis thaliana]
 dbj|BAM44533.1| polyprotein [Arabidopsis thaliana]
Length=1330

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1075  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1134

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1135  DDHWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1194

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1195  PISWSSKKQ----KGVVRS  1209



>gb|AAC79110.1| putative polyprotein of LTR transposon [Arabidopsis thaliana]
 emb|CAB77781.1| putative polyprotein of LTR transposon [Arabidopsis thaliana]
Length=1456

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1201  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1260

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1261  DDHWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1320

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1321  PISWSSKKQ----KGVVRS  1335



>dbj|BAM44535.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1220  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1279

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1280  DDHWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1339

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1340  PISWSSKKQ----KGVVRS  1354



>emb|CAN69370.1| hypothetical protein VITISV_010057 [Vitis vinifera]
Length=591

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = +1

Query  10   NFAFTTECKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLC  186
            N    TE K   +P++TS  + + + T   +PT+Y ++ G+LQYL++TR +++++VN+L 
Sbjct  325  NRTHMTEAKSAPTPLATSPILTLQSGTPLSNPTEYRTVVGSLQYLSLTRPDIAYTVNKLS  384

Query  187  QHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGF  366
            Q MH PT  HW  +KR+LRY+   +   + +R++S   +HAFSDSDWAG   D  STS +
Sbjct  385  QFMHQPTSDHWNAVKRLLRYLCGTLDHDITLRRTSPLALHAFSDSDWAGNKNDFTSTSAY  444

Query  367  AVFLGSNLVSWVTKRK  414
             ++LG N +SW +K++
Sbjct  445  IIYLGHNPISWSSKKQ  460



>dbj|BAM44534.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1220  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1279

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1280  DDHWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1339

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1340  PISWSSKKQ----KGVVRS  1354



>emb|CAN66359.1| hypothetical protein VITISV_018312 [Vitis vinifera]
Length=542

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +1

Query  127  ALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIH  306
            ALQY+T+TR ++++SVNQ CQHM APT +HW   KRVLRY+K  + FGL + K  S  I+
Sbjct  311  ALQYITLTRPDIAYSVNQJCQHMQAPTTAHWTAAKRVLRYLKNTLDFGL-LYKPGSFAIN  369

Query  307  AFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            A+ DSDWAG P D  ST G+ VF+G NL+SW  K++
Sbjct  370  AYCDSDWAGDPDDRXSTCGYGVFVGPNLISWSAKKQ  405



>ref|XP_008358376.1| PREDICTED: uncharacterized protein LOC103422119 [Malus domestica]
Length=1261

 Score =   119 bits (297),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +1

Query  28    ECKEIFSP-ISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
             +CK   +P +  ++ V  D T Y++PT Y S+ GALQYLT TR  ++FSV+Q+CQ M +P
Sbjct  1006  DCKPCDTPCLPYNRLVKDDGTPYNNPTAYXSIVGALQYLTFTRXXIAFSVHQVCQFMXSP  1065

Query  205   TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
              +SH+   KR+LRY+K  ++ G+   +     + AFSD+DWAG P D +ST+G  VFLG+
Sbjct  1066  MMSHFTXXKRILRYLKGTLSVGMSYTR-GDLLLKAFSDADWAGDPNDRRSTTGLVVFLGN  1124

Query  385   NLVSWVTKRK  414
             N +SW +K++
Sbjct  1125  NPISWSSKKQ  1134



>emb|CAA19714.1| putative protein [Arabidopsis thaliana]
 emb|CAB79575.1| putative protein [Arabidopsis thaliana]
Length=819

 Score =   118 bits (295),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 81/130 (62%), Gaps = 5/130 (4%)
 Frame = +1

Query  37   EIFSPISTSKTVVID-----TTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
            E  +P+ T   V +D       L+ DPT + S+AG LQYLT+TR ++ F+VN +CQ MH 
Sbjct  474  EHCTPLPTPLPVQLDRVPHQEELFSDPTYFRSIAGKLQYLTLTRPDIQFAVNFVCQKMHQ  533

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            PT+S +  LKR+LRY+K  +T G+   + S   + A+SDSDW  C    +S  G   F+G
Sbjct  534  PTISDFHLLKRILRYIKGTITMGISYSRDSPTLLQAYSDSDWGNCKQTRRSVGGLCTFMG  593

Query  382  SNLVSWVTKR  411
            +NLVSW +K+
Sbjct  594  TNLVSWSSKK  603



>gb|KFK44388.1| hypothetical protein AALP_AA1G251100, partial [Arabis alpina]
Length=2090

 Score =   119 bits (298),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 94/139 (68%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTS-KTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS K  +   T   DPT+Y ++ G+LQYL+ TR +L ++VN+L Q+MH+PT
Sbjct  1250  AKPVLTPMATSPKLSLYSGTHLSDPTEYRAILGSLQYLSFTRPDLCYAVNKLSQYMHSPT  1309

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW  LKR+LRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LGS+
Sbjct  1310  SDHWSALKRLLRYLAGTTDHGIFLQKGTTLTLHAYSDADWAGDKDDYVSTNGYIVYLGSH  1369

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +GI +S
Sbjct  1370  PLSWSSKKQ----KGIARS  1384



>gb|KDP32454.1| hypothetical protein JCGZ_13379 [Jatropha curcas]
Length=254

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = +1

Query  97   DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
            D T Y S+ GALQYLT+TR +++F+VN + Q M  PTV H + L R+ RYVK  +T GL 
Sbjct  19   DATLYRSIVGALQYLTLTRPDIAFAVNFVSQFMQDPTVVHMKFLHRIKRYVKGTLTHGLY  78

Query  277  VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
                S+ ++H F+D+DWAGCP   +ST+G+  F GSNL+SW  K++
Sbjct  79   FTSHSTMQLHGFADADWAGCPVTRRSTTGYCTFWGSNLISWCAKKQ  124



>gb|ABB47203.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1050

 Score =   118 bits (296),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 80/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  +EC    +P+    K    D     DP +Y SLAGALQYLT+TR  +++++ Q+C  
Sbjct  892   AGMSECHPTATPVDARCKLSATDGAPVSDPMEYRSLAGALQYLTLTRPEIAYAIQQVCLF  951

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
             MH P   H   +KR+LRY+K  +   L +  +    + A+SD+DW GCP    STSG+ V
Sbjct  952   MHDPREPHLALVKRILRYIKGTLHICLHIGTAPVDSLTAYSDADWVGCPDSRHSTSGYCV  1011

Query  373   FLGSNLVSWVTKRK  414
             FLG NLVSW +KR+
Sbjct  1012  FLGENLVSWSSKRQ  1025



>ref|XP_010045758.1| PREDICTED: uncharacterized protein LOC104434554 [Eucalyptus grandis]
Length=676

 Score =   117 bits (293),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  13   FAFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  T CK + +P+     +  DT L  +P +Y SL G LQYLT+TR +L+++ N LCQ 
Sbjct  405  IAHMTNCKPVSTPLQLRSVMTDDTALLSNPLEYRSLVGGLQYLTITRPDLAYATNTLCQK  464

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            +  PTV+   +LKR+LRYVK     GL +  +S   ++ FSD++WAGC    +ST+G+  
Sbjct  465  LQHPTVADLHRLKRILRYVKGTTHLGLFLHSNSLIALYDFSDANWAGCTNTRRSTTGYCA  524

Query  373  FLGSNLVS  396
            +LGSNL+S
Sbjct  525  YLGSNLLS  532



>emb|CAN69607.1| hypothetical protein VITISV_009561 [Vitis vinifera]
Length=1207

 Score =   118 bits (296),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
             + K + +P+  S+ + +    + +PT Y SL G LQYL +TR +++ +VN + Q +HAPT
Sbjct  988   DSKPVHTPMVVSQHLTVAGFPFSNPTLYRSLVGXLQYLPITRLDIAHAVNSVSQFLHAPT  1047

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSS-SREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
             + H+  +KR+LRYVK  + FGL    S+    + A+SD+DWAGCP   +STSG++++LG+
Sbjct  1048  IDHFLAVKRILRYVKGTLHFGLTFCPSTIPSALVAYSDADWAGCPDTRRSTSGYSIYLGN  1107

Query  385   NLVSWVTKRK  414
             NLVSW  K++
Sbjct  1108  NLVSWSAKKQ  1117



>ref|XP_009350454.1| PREDICTED: nuclear cap-binding protein subunit 1-like [Pyrus 
x bretschneideri]
 ref|XP_009350455.1| PREDICTED: nuclear cap-binding protein subunit 1-like [Pyrus 
x bretschneideri]
Length=854

 Score =   117 bits (294),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +1

Query  58   TSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRV  237
            +SK +     L  +PT+Y S+ G LQYLT TR +L+F+VNQ+CQ MHAP   H +  KRV
Sbjct  12   SSKKLDYSGPLLSNPTEYRSIVGGLQYLTWTRPDLAFAVNQICQFMHAPREQHLQVAKRV  71

Query  238  LRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            LR++K  ++ GL   K       A+SD+DWAGC  D +STSG+ VFLGSNL++W  K++
Sbjct  72   LRFLKGSLSHGLWFTKGPVH-FSAYSDADWAGCTFDRRSTSGYCVFLGSNLITWSAKKQ  129



>emb|CAN76078.1| hypothetical protein VITISV_008973 [Vitis vinifera]
Length=1146

 Score =   118 bits (296),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +1

Query  79    DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*I  258
             D     DP++Y    GALQY+T+TR +++F+VN+ CQ M  P+  HW  +KR+LRY+K  
Sbjct  912   DGVSLSDPSEYRRTMGALQYVTLTRPDIAFAVNKACQFMAKPSNVHWMAVKRILRYLKGT  971

Query  259   VTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             +  GL  + ++S E+  +SD+DWA CP D +ST+G+ VFL SNL+SW + ++
Sbjct  972   IHLGLHFQPAASMELQGYSDADWASCPNDRRSTNGYCVFLASNLISWSSSKQ  1023



>gb|AAN34944.1| Putative retroelement [Oryza sativa Japonica Group]
Length=1146

 Score =   118 bits (295),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 80/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  +EC    +P+    K    D     DP +Y SLAGALQYLT+TR  +++++ Q+C  
Sbjct  988   AGMSECHPTATPVDARCKLSATDGAPVSDPMEYRSLAGALQYLTLTRPEIAYAIQQVCLF  1047

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
             MH P   H   +KR+LRY+K  +   L +  +    + A+SD+DW GCP    STSG+ V
Sbjct  1048  MHDPREPHLALVKRILRYIKGTLHICLHIGTAPVDSLTAYSDADWVGCPDSRHSTSGYCV  1107

Query  373   FLGSNLVSWVTKRK  414
             FLG NLVSW +KR+
Sbjct  1108  FLGENLVSWSSKRQ  1121



>emb|CAE05417.1| OSJNBa0035I04.5 [Oryza sativa Japonica Group]
 emb|CAE05956.3| OSJNBb0088C09.15 [Oryza sativa Japonica Group]
Length=1246

 Score =   118 bits (296),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +1

Query  97    DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
             DPT+Y SLA ALQYLT+TR  ++++V Q+C+ MH P   H   +KR++RY+K  ++ GL 
Sbjct  1016  DPTEYRSLADALQYLTLTRPEIAYAVQQVCRFMHDPHEPHLALVKRIMRYIKGSLSAGLH  1075

Query  277   VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             +       + A+SD+DWAGCP   +STSG+ +FLG NLVSW +KR+
Sbjct  1076  IGTGPVGSLTAYSDADWAGCPDSRRSTSGYCIFLGDNLVSWSSKRQ  1121



>gb|KHN17267.1| Putative mitochondrial protein, partial [Glycine soja]
Length=283

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = +1

Query  31   CKEIFSPISTSKTVVID-TTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
            C+ + SP+  +  ++ D + +Y DP +Y  L G L YLT+TR ++SF+V  + Q M  P 
Sbjct  77   CRPVESPMDPNLKLMADQSEVYPDPERYRRLVGKLIYLTITRPDISFAVGVVSQFMQNPH  136

Query  208  VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
            + HW  + R+LRY+K     GL      + ++  + D+DWAGCP D +STS + VF+G N
Sbjct  137  LDHWNAVMRILRYIKRAPGQGLLYEDKGNTQLSGYCDADWAGCPIDRRSTSDYCVFIGGN  196

Query  388  LVSWVTKRK  414
            L+SW +K++
Sbjct  197  LISWKSKKQ  205



>ref|XP_006577466.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=387

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 85/136 (63%), Gaps = 1/136 (1%)
 Frame = +1

Query  10   NFAFTTECKEIFSPISTS-KTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLC  186
            ++A  + CK   +P+ T  K      T ++DPT Y SLAGALQYLT T+ +++++V Q+C
Sbjct  127  DYAGMSSCKSSPTPVDTKPKLSATSNTPFEDPTLYRSLAGALQYLTFTKPDITYAVQQVC  186

Query  187  QHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGF  366
              +H P   H   LKR+L Y++  +  GL +  S +  + +++D+DW+GCP    ST G+
Sbjct  187  LFIHDPKDEHMHALKRILCYIQGTIDHGLHLYPSFTSTLVSYTDADWSGCPNTGWSTFGY  246

Query  367  AVFLGSNLVSWVTKRK  414
             VFLG NL+SW  KR+
Sbjct  247  CVFLGDNLISWSAKRQ  262



>emb|CAA19715.1| putative protein [Arabidopsis thaliana]
 emb|CAB79576.1| putative protein [Arabidopsis thaliana]
Length=1318

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 81/130 (62%), Gaps = 5/130 (4%)
 Frame = +1

Query  37    EIFSPISTSKTVVID-----TTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
             E  +P+ T   V +D       L+ DPT + S+AG LQYLT+TR ++ F+VN +CQ MH 
Sbjct  973   EHCTPLPTPLPVQLDRVPHQEELFSDPTYFRSIAGKLQYLTLTRPDIQFAVNFVCQKMHQ  1032

Query  202   PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
             PT+S +  LKR+LRY+K  +T G+   + S   + A+SDSDW  C    +S  G   F+G
Sbjct  1033  PTISDFHLLKRILRYIKGTITMGISYSRDSPTLLQAYSDSDWGNCKQTRRSVGGLCTFMG  1092

Query  382   SNLVSWVTKR  411
             +NLVSW +K+
Sbjct  1093  TNLVSWSSKK  1102



>gb|AAM74347.1|AC115686_14 Putative retroelement [Oryza sativa Japonica Group]
Length=1250

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 80/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  +EC    +P+    K    D     DP +Y SLAGALQYLT+TR  +++++ Q+C  
Sbjct  1092  AGMSECHPTATPVDARCKLSATDGAPVSDPMEYRSLAGALQYLTLTRPEIAYAIQQVCLF  1151

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
             MH P   H   +KR+LRY+K  +   L +  +    + A+SD+DW GCP    STSG+ V
Sbjct  1152  MHDPREPHLALVKRILRYIKGTLHICLHIGTAPVDSLTAYSDADWVGCPDSRHSTSGYCV  1211

Query  373   FLGSNLVSWVTKRK  414
             FLG NLVSW +KR+
Sbjct  1212  FLGENLVSWSSKRQ  1225



>emb|CAN81099.1| hypothetical protein VITISV_017741 [Vitis vinifera]
Length=1455

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = +1

Query  31    CKEIFSPISTS-KTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
             CK   +P+ T  K  V D    +D   Y S  GALQY+T+TR  LSFSVN++CQ M  PT
Sbjct  1198  CKPARTPLPTGLKLRVGDGDPVEDLHGYRSTVGALQYVTITRPELSFSVNKVCQFMQNPT  1257

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               HW+ +KR+LRY++  +  GL ++KSS+ ++  F D+DWA    D +STSG  VFLG N
Sbjct  1258  EEHWKVVKRILRYLQGTLQHGLHLKKSSNLDLIGFCDADWASDLDDRRSTSGHCVFLGPN  1317

Query  388   LVSWVTKRK  414
             L+SW +K++
Sbjct  1318  LISWQSKKQ  1326



>emb|CAH66488.1| OSIGBa0076I14.9 [Oryza sativa Indica Group]
Length=1455

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +1

Query  97    DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
             DPT+Y SLA ALQYLT+TR  ++++V Q+C+ MH P   H   +KR++RY+K  ++ GL 
Sbjct  1225  DPTEYRSLADALQYLTLTRPEIAYAVQQVCRFMHDPHEPHLALVKRIMRYIKGSLSAGLH  1284

Query  277   VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             +       + A+SD+DWAGCP   +STSG+ +FLG NLVSW +KR+
Sbjct  1285  IGTGPVGSLTAYSDADWAGCPDSRRSTSGYCIFLGDNLVSWSSKRQ  1330



>gb|AAK43485.1|AC084807_10 polyprotein, putative [Arabidopsis thaliana]
 dbj|BAH30336.1| hypothetical protein [Arabidopsis thaliana]
Length=1459

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 85/130 (65%), Gaps = 1/130 (1%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVI-DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
             + K + +P+ TS  + +   T  +D ++Y S+ G+LQYL  TR +++F+VN+L Q MH P
Sbjct  1210  DAKPVATPLPTSPKLTLHGGTKLNDASEYRSVVGSLQYLAFTRPDIAFAVNRLSQFMHQP  1269

Query  205   TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
             T  HW+  KRVLRY+    T G+ +  SS   +HAFSD+DWAG  AD  ST+ + ++LG 
Sbjct  1270  TSDHWQAAKRVLRYLAGTTTHGIFLNSSSPIHLHAFSDADWAGDSADYVSTNAYVIYLGR  1329

Query  385   NLVSWVTKRK  414
             N +SW +K++
Sbjct  1330  NPISWSSKKQ  1339



>gb|KFK30733.1| hypothetical protein AALP_AA6G020200 [Arabis alpina]
Length=3091

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = +1

Query  16    AFTTECKEIFSPISTSKTVVIDTTL-YDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
             A  + C  + +P+ T    V D    +++ T + SLAG LQYLT+TR +L ++VN +CQ 
Sbjct  1297  AGMSNCVPMPTPLPTQPDRVSDQEKEFENATYFKSLAGKLQYLTLTRPDLQYAVNFVCQR  1356

Query  193   MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
             MH PT   ++ LKR+LRYVK  +T G+   K++   + A+SDSDW GC    +ST G+  
Sbjct  1357  MHKPTQGDFKLLKRILRYVKGTLTMGISFSKNTDFTLRAYSDSDWVGCTVTRRSTGGYCT  1416

Query  373   FLGSNLVSWVTKRK  414
             FLG+NL+SW +K++
Sbjct  1417  FLGNNLISWSSKKQ  1430



>ref|XP_006595215.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=275

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 81/127 (64%), Gaps = 0/127 (0%)
 Frame = +1

Query  34   KEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVS  213
            K   +P+     +  + T  DDP+ +  L G+LQYLT+TR ++S+SVN + Q M++PT  
Sbjct  35   KPKITPLEAKMKMTSNNTPLDDPSYFCGLVGSLQYLTLTRPDISYSVNFVSQFMNSPTTM  94

Query  214  HWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLV  393
            H +   R+LRYVK  +  GL    +++ ++ AFSD+DWA  P   +ST+G+ ++LG NL+
Sbjct  95   HLQMAHRILRYVKGTIDVGLHFTSNTTLDLFAFSDADWACSPTTRRSTTGYCIYLGGNLI  154

Query  394  SWVTKRK  414
            SW  K++
Sbjct  155  SWCAKKQ  161



>ref|XP_006465491.1| PREDICTED: uncharacterized protein LOC102624640 [Citrus sinensis]
Length=1682

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 87/131 (66%), Gaps = 1/131 (1%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
             +C  + +P++T   +   + ++  + +QY S  GALQY+T+TR  ++FSVN+L Q + +
Sbjct  584  ADCSPVPTPMATGHYLTKGSGSVISNSSQYKSAVGALQYVTLTRPEIAFSVNKLSQFLAS  643

Query  202  PTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLG  381
            PT  HWE  KR+LRY+K  + FGL      + +I+ FSDSDWA    D KS +G+AV+LG
Sbjct  644  PTAEHWESCKRLLRYLKGTIHFGLHFYHYGTMQINCFSDSDWACDKDDRKSVAGYAVYLG  703

Query  382  SNLVSWVTKRK  414
            SNLVSW +K++
Sbjct  704  SNLVSWSSKKQ  714



>dbj|BAM42649.1| Polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1220  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1279

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               +W  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1280  DDNWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1339

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1340  PISWSSKKQ----KGVVRS  1354



>dbj|BAA78426.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
              K + +P++TS  + + + T   DPT+Y  + G+LQYL  TR +LS++VN+L Q+MH PT
Sbjct  1220  AKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPT  1279

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               +W  LKRVLRY+      G+ ++K ++  +HA+SD+DWAG   D  ST+G+ V+LG +
Sbjct  1280  DDNWNALKRVLRYLAGTPDHGIFLKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHH  1339

Query  388   LVSWVTKRK*DL*QGIIKS  444
              +SW +K++    +G+++S
Sbjct  1340  PISWSSKKQ----KGVVRS  1354



>emb|CAN64509.1| hypothetical protein VITISV_041217 [Vitis vinifera]
Length=1269

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 88/136 (65%), Gaps = 1/136 (1%)
 Frame = +1

Query  10    NFAFTTECKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLC  186
             N    TE K   +P +TS  + + + T   D T+Y ++ G+LQYL++TR +++++VN+L 
Sbjct  1029  NRTHMTEAKPTLTPXATSPILTLQSGTXLSDXTEYRTMVGSLQYLSLTRPDIAYTVNKLS  1088

Query  187   QHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGF  366
             Q MH  T  HW  +KR+LRY+   +  G+ +R++S   +HAFSDSDWAG   D  STS +
Sbjct  1089  QFMHQSTSDHWNAVKRLLRYLCGTLDHGITLRRTSPLALHAFSDSDWAGNKDDFTSTSAY  1148

Query  367   AVFLGSNLVSWVTKRK  414
              ++LG N +SW +K++
Sbjct  1149  IIYLGHNPISWSSKKQ  1164



>emb|CAN75274.1| hypothetical protein VITISV_043735 [Vitis vinifera]
Length=656

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 85/128 (66%), Gaps = 1/128 (1%)
 Frame = +1

Query  34   KEIFSPISTSKTVV-IDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTV  210
            K   +P S  +T+   D  L  DP++Y  + GALQY+T+TR +++F+VN+ C+ M  P+ 
Sbjct  484  KPAPTPGSLGRTLCQSDGVLLPDPSEYRRIVGALQYVTLTRPDIAFAVNKACKFMAKPSD  543

Query  211  SHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNL  390
             HW  +KR+L Y+K  ++ GL  + S+S E+  +SD+DWA  P D +STSG+ VFL SNL
Sbjct  544  VHWLAVKRILHYLKGTISLGLHFQPSTSMELQGYSDADWASYPDDRRSTSGYCVFLCSNL  603

Query  391  VSWVTKRK  414
            +SW + ++
Sbjct  604  ISWSSSKQ  611



>ref|XP_006580846.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=228

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 81/124 (65%), Gaps = 3/124 (2%)
 Frame = +1

Query  52   ISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLK  231
            +S++K   I +   DDPTQ+ S+ GALQY T+TR  +SFSVN++CQ +  P   HW+ +K
Sbjct  82   VSSNKLSKIGSNEVDDPTQFRSVVGALQYATLTRPEISFSVNKVCQFLSNPLEEHWKAVK  141

Query  232  RVLRYVK*IVTFGLRVRKSSSRE---IHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWV  402
            R+LRY+      GL ++ +S ++   +  F D+DWA  P D +STS   VFLG NLVSW 
Sbjct  142  RILRYLSGTKHHGLLIQPASLQQPLHLLGFCDADWASDPDDRRSTSSACVFLGPNLVSWW  201

Query  403  TKRK  414
            +K++
Sbjct  202  SKKQ  205



>ref|XP_008228903.1| PREDICTED: uncharacterized protein LOC103328294 [Prunus mume]
Length=1224

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  79    DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*I  258
             D   Y +P  Y S+ GALQYLT TR +++FSV+Q+CQ M  P VSH+  +KR+LRY+K  
Sbjct  1015  DGEPYSNPKLYRSIVGALQYLTFTRPDIAFSVHQVCQFMQNPMVSHFTAVKRILRYLKGT  1074

Query  259   VTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             + FG+   +    ++ AFSD+DWAG P D +ST+G  VFLG+N +SW +K++
Sbjct  1075  MQFGISYTR-GDLQLKAFSDADWAGDPNDRRSTTGLVVFLGNNPISWSSKKQ  1125



>ref|XP_006584292.1| PREDICTED: uncharacterized protein LOC102668041 [Glycine max]
Length=1176

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVID-TTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
             C+ + SP+  +  ++ D +  Y DP +Y  L G L YLT+TR ++SF+V  + Q M  P 
Sbjct  927   CRPVESPMDPNLKLMADQSEAYPDPERYRRLVGKLIYLTITRPDISFAVGVISQFMQNPH  986

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
             + HW  + R+LRYVK     GL      S ++  + D+DWAGCP D +STSG+ VF+G N
Sbjct  987   LDHWNAVMRILRYVKRAPGQGLLYEDKGSTQLSGYCDADWAGCPMDRRSTSGYYVFIGGN  1046

Query  388   LVSWVTKRK  414
             L+SW +K++
Sbjct  1047  LISWKSKKQ  1055



>ref|XP_004295686.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Fragaria vesca subsp. vesca]
Length=261

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +1

Query  97   DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
            DPT+Y S+ GALQYLT+TR ++S+SVNQ+C+ MH+PT  HW  +K +LRY+K  +  GL+
Sbjct  68   DPTEYRSVVGALQYLTLTRPDISYSVNQVCKFMHSPTTIHWIAVKPILRYLKFSLNHGLK  127

Query  277  VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTK  408
              + SS  I A+ D+D+AG P + +ST G+ V+LG NL+SW  K
Sbjct  128  Y-QPSSLFISAYFDADYAGDPDNRQSTGGYCVYLGPNLISWSYK  170



>ref|XP_006605005.1| PREDICTED: uncharacterized protein LOC102669234 [Glycine max]
Length=922

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +1

Query  82   TTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IV  261
            +T ++DPT Y SLAGALQYLT  R N++++V  +C  MH P   H   LKR+LRY++  +
Sbjct  669  STPFEDPTLYRSLAGALQYLTFIRPNITYAVQHVCLFMHDPKDEHMHALKRMLRYIQGTI  728

Query  262  TFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
              GL +  S +  + +++D DW GCP   +STSG+ VFLG N +SW+ KR+
Sbjct  729  DHGLNLYPSYTSNLVSYTDVDWGGCPDTRRSTSGYCVFLGDNFISWLAKRQ  779



>emb|CAN69851.1| hypothetical protein VITISV_009554 [Vitis vinifera]
Length=1282

 Score =   116 bits (291),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +1

Query  79    DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*I  258
             D    D+ TQY S+ GALQYLT+TR +++F+VN+ CQ M  PT +HW  +KR+LRY+K  
Sbjct  1034  DGDPMDEVTQYRSVVGALQYLTITRPDIAFAVNKTCQFMQQPTSAHWLSVKRILRYLKGT  1093

Query  259   VTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             +  GL +  S++  I  FSD+DW   P D +S+SG+ V+LG NLVSW + ++
Sbjct  1094  MQDGLLLSPSTNLTIEGFSDADWGAQPDDRRSSSGYLVYLGGNLVSWSSTKQ  1145



>ref|XP_009772944.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104223244 
[Nicotiana sylvestris]
Length=1016

 Score =   115 bits (289),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVI-DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
            +C    +P+S+++ +   D     + T+Y  + G LQYL+ TR ++SFSVN+L Q MH+P
Sbjct  767  DCNSAKTPMSSTEVLQQNDGAEPTNATRYRRVLGKLQYLSFTRPDISFSVNKLSQFMHSP  826

Query  205  TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
            +  HW+ LKRVLRY++  + FGLR+++ +  ++H ++D+DWAG   D  ST+G+ +F G 
Sbjct  827  SELHWKALKRVLRYLQGTIQFGLRIQRDNDFKLHMYADADWAGDATDRASTTGYILFFGQ  886

Query  385  NLVSWVTKRK  414
            N VSW ++++
Sbjct  887  NPVSWSSRKQ  896



>ref|XP_008337999.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Malus domestica]
Length=1179

 Score =   115 bits (289),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 86/130 (66%), Gaps = 6/130 (5%)
 Frame = +1

Query  31    CKEIFSPISTSKTVVIDTT--LYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
             CK   +P+ST+K   +D T  L D+P +Y S+ GALQYLT T  ++SF+VNQ+CQ    P
Sbjct  987   CKPCSTPLSTTK---LDHTGPLLDNPXEYRSIVGALQYLTWTXPDISFAVNQVCQFFQCP  1043

Query  205   TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
               SH++ +KR+LR++K     GL  +K  S  + AFSD+DWAGC  D +ST G+ V+ G 
Sbjct  1044  RESHFQAVKRILRFLKGSAHQGLWFKK-GSLHLTAFSDADWAGCIFDRRSTXGYCVYFGP  1102

Query  385   NLVSWVTKRK  414
             NL+SW  K++
Sbjct  1103  NLISWSAKKQ  1112



>emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera]
Length=1354

 Score =   116 bits (290),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 87/138 (63%), Gaps = 9/138 (7%)
 Frame = +1

Query  28    ECKEIFSPISTSKTVVIDT--TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHA  201
             + K + +P+ TS T +  T  T   DPT Y +  G+LQYL++TR ++SF+VN++ Q MH 
Sbjct  1096  DAKPVLTPLPTSSTAISLTSGTPLSDPTPYRAAVGSLQYLSLTRPDISFAVNRMAQFMHQ  1155

Query  202   PTVSHWEQLKRVLRYVK*IVTFGLRVRKSS-------SREIHAFSDSDWAGCPAD*KSTS  360
             PT  HW  +KR+LRY+   +  GL + + S       S  +HAFSD+DWAG   D  STS
Sbjct  1156  PTSEHWVLVKRILRYLCGTLDKGLLLYRDSSIPLHGFSDSLHAFSDADWAGNKDDYSSTS  1215

Query  361   GFAVFLGSNLVSWVTKRK  414
              + V+LG NLVSW +K++
Sbjct  1216  AYLVYLGRNLVSWSSKKQ  1233



>emb|CAN81057.1| hypothetical protein VITISV_033321 [Vitis vinifera]
Length=331

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 85/130 (65%), Gaps = 1/130 (1%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVI-DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
            + K   +P+S++  + + D    ++ + Y S  GALQY  +T  N+ F+VN++CQ MH P
Sbjct  70   DAKPCPTPMSSNTNLSLHDGVALENGSDYHSFVGALQYCIMTSPNIVFTVNKVCQFMHHP  129

Query  205  TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
            +  HW+ +KR+LRY+K    FGL ++ S +  I  ++D+DWA C  D +STSG+ +FLGS
Sbjct  130  SDVHWQVVKRILRYLKGTYHFGLFLQPSLNFNITCYTDADWASCLDDRRSTSGYCLFLGS  189

Query  385  NLVSWVTKRK  414
            NLVSW + ++
Sbjct  190  NLVSWSSSKQ  199



>gb|EMT30087.1| hypothetical protein F775_00021 [Aegilops tauschii]
Length=877

 Score =   115 bits (288),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 81/127 (64%), Gaps = 1/127 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPIST-SKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A    CK   +P+ T +K    D +   D   Y S+ GALQYLT+TR  L ++V Q+C H
Sbjct  534  AGMLNCKPAATPVDTKAKLSATDGSPASDAPFYRSIVGALQYLTLTRPELQYAVQQVCLH  593

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MHAP  +HW  +KR+LRY++  +  GL ++ SSS +  A+SD+DWAGCP   +STSG+ V
Sbjct  594  MHAPRDAHWTAVKRILRYIRGTLDLGLSLQASSSLDPTAYSDADWAGCPDTRRSTSGYCV  653

Query  373  FLGSNLV  393
            +L  +L+
Sbjct  654  YLEPSLI  660



>emb|CAN60809.1| hypothetical protein VITISV_044451 [Vitis vinifera]
Length=377

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 82/133 (62%), Gaps = 0/133 (0%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
            A   +CK + +P+        +  L +D + +  L GALQYLT+TR +LS+SVN   Q M
Sbjct  241  ANMVDCKPMSTPLEAKTRTSSNDVLLEDLSYFRGLVGALQYLTLTRPDLSYSVNFASQFM  300

Query  196  HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
            HAPTV H + ++R+LRYVK  +   L    +++ ++ AFSD+DWAGCP   +S + +  F
Sbjct  301  HAPTVVHLKMVRRILRYVKGTIDIDLHFTSNTTLDLCAFSDADWAGCPTTRRSITRYCTF  360

Query  376  LGSNLVSWVTKRK  414
            LG NL+S   K++
Sbjct  361  LGGNLISSCAKKQ  373



>ref|XP_010227141.1| PREDICTED: uncharacterized protein LOC104581367 [Brachypodium 
distachyon]
Length=957

 Score =   115 bits (288),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 88/132 (67%), Gaps = 3/132 (2%)
 Frame = +1

Query  28   ECKEIFSPISTSKTVVIDTTLY---DDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMH  198
            +CK   +P++ ++ +  D  +    DD T+Y SL GALQYLT+TR ++SF+VN++CQ++ 
Sbjct  723  DCKPASTPMAVAEKLSRDEGVKLPPDDATRYRSLVGALQYLTLTRPDISFAVNKVCQYLQ  782

Query  199  APTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFL  378
            APT  H    KR+LRYVK   + GL++ KS S  +  FSD+DWAG   D +ST GF VF 
Sbjct  783  APTDLHLTAAKRILRYVKGTASMGLKLSKSPSSLLSGFSDADWAGSVDDRRSTRGFVVFF  842

Query  379  GSNLVSWVTKRK  414
            GSN VSW  +++
Sbjct  843  GSNPVSWGARKQ  854



>ref|XP_008680330.1| PREDICTED: uncharacterized protein LOC103655331 [Zea mays]
Length=260

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +1

Query  118  LAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSR  297
            L  ALQYLT +R +++++V Q+C HMH P   H   LKR+LRY++  + +GL +R S + 
Sbjct  153  LQRALQYLTFSRPDIAYAVQQVCLHMHTPREPHLTALKRILRYLRRSLDYGLLLRPSLTS  212

Query  298  EIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            ++  ++++DWAGCP   +STSG+AVFLG+NLVSW  KR+
Sbjct  213  DLVVYTNADWAGCPDTRRSTSGYAVFLGTNLVSWAAKRQ  251



>gb|AAG12528.1|AC015446_9 Hypothetical Protein [Arabidopsis thaliana]
Length=690

 Score =   114 bits (286),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +1

Query  91   YDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFG  270
            + D   + SLAG LQYLT+TR ++ F+VN +CQ MH+PTVS +  LKR+LRYVK   T G
Sbjct  419  FSDQRYFRSLAGKLQYLTLTRPDIQFAVNYVCQKMHSPTVSDYHLLKRILRYVKGTTTMG  478

Query  271  LRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            +   K +   + A+SDSD+ GC    +ST+GF  F GSN++SW ++++
Sbjct  479  ISFAKDTDCTVRAYSDSDYGGCKRTRRSTAGFCTFFGSNIISWCSQKQ  526



>emb|CAN75478.1| hypothetical protein VITISV_020209 [Vitis vinifera]
Length=1074

 Score =   115 bits (288),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +1

Query  97   DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
            D T Y SL GALQY+T+TR  +SF+VN+ CQ+M  PT SH +  KR+LRY+K   T G+ 
Sbjct  831  DATHYRSLVGALQYITLTRPEISFAVNRACQYMARPTTSHLQAAKRILRYLKGTATHGIS  890

Query  277  VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            +  S S  +  ++D DWA CP D +STSGF +F  +NL+SW + ++
Sbjct  891  IHASPSLSLQGYTDVDWASCPDDKRSTSGFCLFFCTNLISWSSTKQ  936



>ref|XP_004246220.1| PREDICTED: uncharacterized protein LOC101249672 [Solanum lycopersicum]
Length=645

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = +1

Query  25   TECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
            T+CK   SP  T+  +      +DDP+ + S+ GALQY T+TR  +SFSV+++CQ+M  P
Sbjct  2    TDCKPSPSPSDTTFQLSKHGETFDDPSLFRSIVGALQYATITRPEISFSVSRVCQYMQNP  61

Query  205  TVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGS  384
            T+ HW+ +KR+LRY+K  +T G+ +  S+S  IH + D+ WA  P D +S  GFAV  G 
Sbjct  62   TLDHWKAVKRILRYLKGSLTHGISISPSTSSSIHVYCDAGWAADPDDRRSHHGFAVCYGP  121

Query  385  NLVSWVTKRK  414
            NL+SW ++++
Sbjct  122  NLISWSSRKQ  131



>ref|XP_008358596.1| PREDICTED: uncharacterized protein LOC103422324 [Malus domestica]
Length=1195

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 2/129 (2%)
 Frame = +1

Query  31    CKEIFSP-ISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
             CK   +P +   + +  D   Y  P QY S+ GALQYLT TR +++F VNQ CQ MH P 
Sbjct  961   CKPCATPCLPCHRLLKDDGKPYHSPDQYRSIVGALQYLTFTRPDIAFFVNQACQFMHNPM  1020

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
              SH   +KR++RY+K    +GL   K     + ++SD+DWAG P D +STSGF VFLGSN
Sbjct  1021  ESHVIVVKRIIRYLKGTPDYGLHF-KPGPLSLLSYSDADWAGDPNDRRSTSGFIVFLGSN  1079

Query  388   LVSWVTKRK  414
              +SW +K++
Sbjct  1080  PISWSSKKQ  1088



>ref|XP_010493723.1| PREDICTED: uncharacterized protein LOC104770945 [Camelina sativa]
 ref|XP_010497182.1| PREDICTED: uncharacterized protein LOC104774223 [Camelina sativa]
Length=739

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSK-TVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A   +C  + +P+      +   + L+ +PT + SLAG LQYLT+TR ++ F+VN +CQ 
Sbjct  470  AGMADCAPMPTPLPLQPGKIAGQSKLFSNPTYFRSLAGKLQYLTLTRPDIQFAVNFVCQK  529

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            MH+P+   +  LKR+LRYVK  V  G+ +  ++   +  +SDS W+GC    +ST GF  
Sbjct  530  MHSPSEDDFFLLKRILRYVKGTVRLGINLSNTTDSTLRVYSDSGWSGCKDTSRSTGGFCT  589

Query  373  FLGSNLVSWVTKR  411
            FLG+N++SW +KR
Sbjct  590  FLGANIISWSSKR  602



>gb|KHN07818.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=270

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 79/129 (61%), Gaps = 1/129 (1%)
 Frame = +1

Query  31   CKEIFSPISTSKTVVID-TTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
            C+ + SP+  +  ++ D + +  DP +Y+ L G L YLT+TR ++SF+V  + Q M  P 
Sbjct  64   CRPVDSPMDPNLKLLADQSEMCPDPERYIRLVGKLIYLTITRPDISFAVGVVSQFMQNPR  123

Query  208  VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
            V HW  + R+LRY+K     GL      + ++  + D+DWAGCP D +STSG+ V +G N
Sbjct  124  VDHWNVVMRILRYIKRAPGQGLLYEDKGNTQVSGYCDADWAGCPMDRRSTSGYCVSIGGN  183

Query  388  LVSWVTKRK  414
             +SW +K++
Sbjct  184  AISWKSKKQ  192



>ref|XP_008365257.1| PREDICTED: uncharacterized protein LOC103428904 [Malus domestica]
Length=884

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +1

Query  85   TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVT  264
            TL  DPT Y S  GALQYLT TR +L+F+VNQ+ Q+MH+P   H + +KR+LRY+K  + 
Sbjct  753  TLLSDPTFYRSTVGALQYLTWTRPDLAFAVNQVXQYMHSPRXIHLQAVKRILRYLKGTLD  812

Query  265  FGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             GL   K   + + A+ ++DWAGCP D +STSG+  FLG NL+SW  K++
Sbjct  813  SGLWFTK-GCQSLTAWXBTDWAGCPIDRRSTSGYCXFLGPNLISWSAKKQ  861



>ref|XP_008389883.1| PREDICTED: uncharacterized protein LOC103452157 [Malus domestica]
Length=1141

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 83/129 (64%), Gaps = 1/129 (1%)
 Frame = +1

Query  31    CKEIFSPI-STSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPT  207
             CK   +P    ++ +  + T   DPT Y SL GALQYLT TR +LS+SVN  CQ+M++PT
Sbjct  895   CKPAPTPCKPNTQLLASEGTPLTDPTTYRSLVGALQYLTFTRLDLSYSVNVACQYMNSPT  954

Query  208   VSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
               H+  +KR+LRY++  +  GL    SS+  I AFSDSDWA  P   +S +GF V +G+N
Sbjct  955   EVHYALVKRILRYIQGTINCGLTYSASSNYSITAFSDSDWAADPNTRRSITGFVVCMGNN  1014

Query  388   LVSWVTKRK  414
              +SW +K++
Sbjct  1015  PISWQSKKQ  1023



>ref|XP_006481389.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Citrus sinensis]
Length=956

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = +1

Query  16   AFTTECKEIFSPISTSKTVVIDT-TLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQH  192
            A   + K   +P+S +  +  D   L+++P+ Y S+ G+LQY+T+TR +++F+VN+L Q 
Sbjct  76   AHMLDSKGCNTPMSVADKLYKDKGKLFENPSLYRSVIGSLQYVTLTRPDIAFTVNKLSQF  135

Query  193  MHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAV  372
            + APTV HW+  KRVLRY++   T+G++     S  + AFSD+ W   P D +S  G+ +
Sbjct  136  LAAPTVLHWQACKRVLRYLQCTATYGIQFYNLKSFSLTAFSDAYWGSDPDDRRSVGGYCI  195

Query  373  FLGSNLVSWVTKRK  414
            FLGSNLVSW +K++
Sbjct  196  FLGSNLVSWSSKKQ  209



>ref|XP_008365969.1| PREDICTED: uncharacterized protein LOC103429605 [Malus domestica]
Length=1188

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 88/133 (66%), Gaps = 6/133 (5%)
 Frame = +1

Query  25    TECKEIFSPISTSKTV---VIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHM  195
             T  K I +P+S+ + +   V D   Y +   Y S+ GALQYLT+TR +LS++VNQ+CQ M
Sbjct  923   TXAKPISTPVSSGQKLSAYVGDP--YANXEMYRSVVGALQYLTITRPDLSYAVNQICQFM  980

Query  196   HAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             H+P  +HW  +KR+LRY+K     GL + K  +  + A+SD+D+AG P    ST GF V+
Sbjct  981   HSPKNTHWMAVKRILRYLKATYNHGL-LYKPGTATLTAYSDADYAGNPDTRHSTGGFCVY  1039

Query  376   LGSNLVSWVTKRK  414
             LGS+LVSW +K++
Sbjct  1040  LGSSLVSWSSKKQ  1052



>ref|XP_008348842.1| PREDICTED: uncharacterized protein LOC103412011 [Malus domestica]
Length=1719

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +1

Query  79    DTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*I  258
             D   Y +PT Y SL GALQYLT TR +++FSV+Q+CQ M  P VSH+  +K +LRY+K  
Sbjct  918   DGEPYSNPTLYRSLVGALQYLTFTRPBIAFSVHQVCQFMQNPMVSHFTAVKXILRYLKGT  977

Query  259   VTFGLRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
             + FG+        ++ AFSD+DWAG P D  ST+G  VFLG++ +SW +K++
Sbjct  978   MQFGIXY-TXGDLQLKAFSDADWAGDPNDRXSTTGLVVFLGNSXISWSSKKQ  1028



>emb|CAN82221.1| hypothetical protein VITISV_015226 [Vitis vinifera]
Length=1007

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +1

Query  97   DPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFGLR  276
            D T Y S+ G L YLT+TR ++SF+VN+ CQ M  PT +HW  +K +LRY+K  +++ ++
Sbjct  754  DTTLYRSMVGXLXYLTLTRPDISFAVNKACQFMATPTTTHWLAVKWILRYLKGTLSYDIQ  813

Query  277  VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKRK  414
            ++ S+S +IH ++ +DWA CP D +ST G+ +FLG NLVSW + ++
Sbjct  814  MQXSTSLDIHGYTXADWASCPDDRRSTGGYGIFLGPNLVSWSSNKQ  859



>emb|CAN60276.1| hypothetical protein VITISV_028253 [Vitis vinifera]
Length=579

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = +1

Query  10   NFAFTTECKEIFSPISTSKTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQ  189
            N A   + K + +P+  S+ +  D   + DPT Y SL G  QYLT+T  +++  VN + Q
Sbjct  311  NXAQLLDSKPVHTPMIVSQHLTSDGPAFSDPTLYRSLVGVFQYLTITCPDIAHVVNSVSQ  370

Query  190  HMHAPTVSHWEQLKRVLRYVK*IVTFGLRVRKSSSR-EIHAFSDSDWAGCPAD*KSTSGF  366
             +HAPT+ H+  +KR+LRYVK  + FGL  R S++   + A+SD+DWAGC     STSG+
Sbjct  371  FLHAPTMDHFLAVKRILRYVKGTLHFGLTFRPSTAPGALVAYSDTDWAGCLDTRHSTSGY  430

Query  367  AVFLGSNLVSWVTKRK  414
            +++LG+NLVS   K++
Sbjct  431  SIYLGNNLVSSSAKKQ  446



>gb|KHN41724.1| Copia protein, partial [Glycine soja]
Length=260

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 82/133 (62%), Gaps = 4/133 (3%)
 Frame = +1

Query  28   ECKEIFSPISTS-KTVVIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAP  204
            +CK I +P+  + K        +D+PT Y S+ GALQY T+TR  L +SV+++CQ    P
Sbjct  3    DCKGISTPLPANLKLSKTGADPFDNPTLYRSIVGALQYATITRPELGYSVSKVCQFFAQP  62

Query  205  TVSHWEQLKRVLRYVK*IVTFGLRVRK---SSSREIHAFSDSDWAGCPAD*KSTSGFAVF  375
             VSHW  +KR+LRY+K  +  GL +     S+   I+AF D+DWA    D +STSG  +F
Sbjct  63   LVSHWSAVKRILRYLKGSIDHGLTLLPATTSAPLSINAFCDADWASDIDDRRSTSGACIF  122

Query  376  LGSNLVSWVTKRK  414
             G NLVSW +K++
Sbjct  123  FGPNLVSWWSKKQ  135



>emb|CAB40035.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB81170.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1515

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = +1

Query  91    YDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTVSHWEQLKRVLRYVK*IVTFG  270
             + +PT +  LAG LQYLT+TR ++ F+VN +CQ MHAPT+S +  LKR+L Y+K  +T G
Sbjct  1200  FPEPTYFRRLAGKLQYLTLTRPDIQFAVNFVCQKMHAPTMSDFHLLKRILHYLKGTMTMG  1259

Query  271   LRVRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSNLVSWVTKR  411
             + +  ++   +  +SDSDWAGC    +ST GF  FLG N++SW  KR
Sbjct  1260  INLSSNTDSVLRCYSDSDWAGCKDTRRSTGGFCTFLGYNIISWSAKR  1306



>ref|XP_004304542.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Fragaria vesca subsp. vesca]
Length=343

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 84/129 (65%), Gaps = 2/129 (2%)
 Frame = +1

Query  34   KEIFSPISTSKTV-VIDTTLYDDPTQYMSLAGALQYLTVTRRNLSFSVNQLCQHMHAPTV  210
            K   +P+S    +   D  L  +PT +  L G+LQYLT+TR +++F+VN + Q M  P V
Sbjct  90   KPASTPMSAKTNLTATDGALLPNPTPFRELVGSLQYLTITRPDIAFAVNTVSQFMSQPRV  149

Query  211  SHWEQLKRVLRYVK*IVTFGLR-VRKSSSREIHAFSDSDWAGCPAD*KSTSGFAVFLGSN  387
             H+  +KR+LRY+K  ++ GL    +  +  + A+SD+DWAGCP   +STSG+ V+LGSN
Sbjct  150  PHFIAVKRILRYIKGSLSHGLLFTPQQGTACLSAYSDADWAGCPDSRRSTSGYLVYLGSN  209

Query  388  LVSWVTKRK  414
            L+SW +K++
Sbjct  210  LISWCSKKQ  218



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1761970051296