BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22680_g1_i5 len=1748 path=[6194:0-262 6457:263-362 @10850@!:363-977
5084:978-1747]

Length=1748
                                                                      Score     E

ref|XP_009623406.1|  PREDICTED: ELMO domain-containing protein C-...    454   5e-154   
ref|XP_009788778.1|  PREDICTED: ELMO domain-containing protein C-...    453   1e-153   
gb|KDP28872.1|  hypothetical protein JCGZ_14643                         443   3e-149   
ref|XP_007052337.1|  ELMO/CED-12 family protein isoform 1               441   2e-148   
ref|XP_008232538.1|  PREDICTED: ELMO domain-containing protein A ...    439   2e-148   
ref|XP_010325250.1|  PREDICTED: ELMO domain-containing protein A ...    439   3e-148   
ref|XP_009623404.1|  PREDICTED: ELMO domain-containing protein C-...    440   4e-148   
ref|XP_002526467.1|  ELMO domain-containing protein, putative           439   7e-148   Ricinus communis
gb|KDO85481.1|  hypothetical protein CISIN_1g024106mg                   439   8e-148   
ref|XP_009788777.1|  PREDICTED: ELMO domain-containing protein C-...    439   9e-148   
ref|XP_006445444.1|  hypothetical protein CICLE_v10021713mg             439   9e-148   
ref|XP_008232536.1|  PREDICTED: ELMO domain-containing protein A ...    438   2e-147   
ref|XP_009374117.1|  PREDICTED: ELMO domain-containing protein A-...    437   5e-147   
ref|XP_006347984.1|  PREDICTED: ELMO domain-containing protein A-...    436   5e-147   
ref|XP_008374822.1|  PREDICTED: ELMO domain-containing protein A-...    437   7e-147   
ref|XP_007220430.1|  hypothetical protein PRUPE_ppa009980mg             436   8e-147   
ref|XP_009373207.1|  PREDICTED: ELMO domain-containing protein A ...    435   2e-146   
ref|XP_009374118.1|  PREDICTED: ELMO domain-containing protein A-...    434   2e-146   
ref|XP_009373205.1|  PREDICTED: ELMO domain-containing protein A ...    435   4e-146   
ref|XP_010086775.1|  ELMO domain-containing protein A                   434   6e-146   
gb|KDO85478.1|  hypothetical protein CISIN_1g024106mg                   434   7e-146   
ref|XP_004306979.1|  PREDICTED: ELMO domain-containing protein A-...    434   1e-145   
ref|XP_008459793.1|  PREDICTED: ELMO domain-containing protein A-...    433   1e-145   
ref|XP_008459794.1|  PREDICTED: ELMO domain-containing protein A-...    432   1e-145   
ref|XP_011017367.1|  PREDICTED: ELMO domain-containing protein C-...    432   6e-145   
ref|XP_006375161.1|  hypothetical protein POPTR_0014s04870g             431   9e-145   
ref|XP_011032422.1|  PREDICTED: ELMO domain-containing protein C-...    430   1e-144   
gb|KDO85480.1|  hypothetical protein CISIN_1g024106mg                   431   1e-144   
ref|XP_008375781.1|  PREDICTED: ELMO domain-containing protein A ...    430   1e-144   
ref|XP_004140510.1|  PREDICTED: ELMO domain-containing protein A-...    431   1e-144   
ref|XP_008375779.1|  PREDICTED: ELMO domain-containing protein A ...    431   1e-144   
ref|XP_006375162.1|  hypothetical protein POPTR_0014s04870g             429   4e-144   
gb|KDO85476.1|  hypothetical protein CISIN_1g024106mg                   427   2e-143   
emb|CBI16679.3|  unnamed protein product                                428   3e-143   
gb|KDO85477.1|  hypothetical protein CISIN_1g024106mg                   427   4e-143   
ref|XP_003534475.1|  PREDICTED: ELMO domain-containing protein A ...    427   4e-143   
ref|XP_011101856.1|  PREDICTED: ELMO domain-containing protein A-...    426   8e-143   
ref|XP_002271650.1|  PREDICTED: ELMO domain-containing protein A ...    426   9e-143   Vitis vinifera
ref|XP_010661410.1|  PREDICTED: ELMO domain-containing protein A ...    425   1e-142   
ref|XP_004229736.1|  PREDICTED: ELMO domain-containing protein A ...    426   1e-142   
ref|XP_003552489.1|  PREDICTED: ELMO domain-containing protein A-...    426   1e-142   
gb|KHN11554.1|  ELMO domain-containing protein A                        425   2e-142   
ref|XP_008232537.1|  PREDICTED: ELMO domain-containing protein A ...    425   2e-142   
ref|XP_007139653.1|  hypothetical protein PHAVU_008G048000g             425   3e-142   
ref|XP_002301236.2|  phagocytosis and cell motility protein ELMO1       425   3e-142   Populus trichocarpa [western balsam poplar]
ref|XP_010052792.1|  PREDICTED: LOW QUALITY PROTEIN: ELMO domain-...    424   4e-142   
ref|XP_009603915.1|  PREDICTED: ELMO domain-containing protein A-...    424   1e-141   
ref|XP_010540214.1|  PREDICTED: ELMO domain-containing protein A-...    423   1e-141   
ref|XP_010325248.1|  PREDICTED: ELMO domain-containing protein A ...    422   1e-141   
ref|XP_006347983.1|  PREDICTED: ELMO domain-containing protein A-...    422   2e-141   
ref|XP_009603976.1|  PREDICTED: ELMO domain-containing protein A-...    422   3e-141   
emb|CDP09425.1|  unnamed protein product                                422   4e-141   
ref|XP_009758299.1|  PREDICTED: ELMO domain-containing protein A-...    422   5e-141   
ref|XP_009758300.1|  PREDICTED: ELMO domain-containing protein A-...    421   9e-141   
ref|XP_006375167.1|  hypothetical protein POPTR_0014s04870g             419   3e-140   
ref|XP_010692034.1|  PREDICTED: ELMO domain-containing protein C        419   3e-140   
ref|XP_007134408.1|  hypothetical protein PHAVU_010G045300g             418   4e-140   
ref|XP_011102321.1|  PREDICTED: ELMO domain-containing protein A-...    417   2e-139   
ref|XP_011101858.1|  PREDICTED: ELMO domain-containing protein A-...    417   3e-139   
ref|XP_010540212.1|  PREDICTED: ELMO domain-containing protein A-...    417   3e-139   
ref|XP_010258740.1|  PREDICTED: ELMO domain-containing protein A-...    417   4e-139   
ref|XP_007134407.1|  hypothetical protein PHAVU_010G045300g             416   5e-139   
ref|XP_003529029.1|  PREDICTED: ELMO domain-containing protein A-...    415   7e-139   
ref|XP_003529028.1|  PREDICTED: ELMO domain-containing protein A-...    415   2e-138   
ref|XP_006602864.1|  PREDICTED: ELMO domain-containing protein A-...    414   6e-138   
ref|XP_006576714.1|  PREDICTED: ELMO domain-containing protein A-...    412   8e-138   
ref|XP_010275485.1|  PREDICTED: ELMO domain-containing protein A        412   2e-137   
ref|XP_006338906.1|  PREDICTED: ELMO domain-containing protein A-...    412   3e-137   
ref|XP_003521062.1|  PREDICTED: ELMO domain-containing protein A-...    410   8e-137   
ref|XP_010413581.1|  PREDICTED: ELMO domain-containing protein C-...    410   8e-137   
ref|XP_010512336.1|  PREDICTED: ELMO domain-containing protein A-...    409   1e-136   
gb|EYU40351.1|  hypothetical protein MIMGU_mgv1a012020mg                410   2e-136   
gb|EYU42340.1|  hypothetical protein MIMGU_mgv1a011776mg                409   2e-136   
ref|XP_006576713.1|  PREDICTED: ELMO domain-containing protein A-...    409   4e-136   
ref|XP_010540213.1|  PREDICTED: ELMO domain-containing protein A-...    408   1e-135   
ref|XP_010559084.1|  PREDICTED: ELMO domain-containing protein A ...    408   1e-135   
ref|XP_010258745.1|  PREDICTED: ELMO domain-containing protein A-...    405   7e-135   
ref|XP_006838580.1|  hypothetical protein AMTR_s00002p00213620          406   8e-135   
ref|XP_004492914.1|  PREDICTED: ELMO domain-containing protein A-...    405   8e-135   
ref|NP_001030900.1|  ELMO/CED-12 domain-containing protein              405   9e-135   Arabidopsis thaliana [mouse-ear cress]
gb|AFK41607.1|  unknown                                                 404   1e-134   
ref|XP_010512335.1|  PREDICTED: ELMO domain-containing protein A-...    404   3e-134   
dbj|BAH20005.1|  AT3G60260                                              403   3e-134   Arabidopsis thaliana [mouse-ear cress]
gb|EPS57180.1|  hypothetical protein M569_17641                         404   4e-134   
ref|XP_006291683.1|  hypothetical protein CARUB_v10017843mg             404   5e-134   
gb|EYU42341.1|  hypothetical protein MIMGU_mgv1a011776mg                404   6e-134   
ref|XP_010469207.1|  PREDICTED: ELMO domain-containing protein A-...    403   1e-133   
ref|XP_004248988.1|  PREDICTED: ELMO domain-containing protein A-...    401   4e-133   
ref|XP_006397658.1|  hypothetical protein EUTSA_v10001587mg             401   5e-133   
ref|XP_006402600.1|  hypothetical protein EUTSA_v10006159mg             401   5e-133   
ref|XP_002876544.1|  hypothetical protein ARALYDRAFT_486497             400   9e-133   
ref|NP_567097.1|  ELMO/CED-12 domain-containing protein                 400   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011093232.1|  PREDICTED: ELMO domain-containing protein A-...    400   2e-132   
ref|XP_003624290.1|  ELMO domain-containing protein A                   399   3e-132   
ref|XP_010919756.1|  PREDICTED: ELMO domain-containing protein A-...    399   3e-132   
ref|XP_009104257.1|  PREDICTED: ELMO domain-containing protein A-...    398   4e-132   
emb|CDY42685.1|  BnaC04g22210D                                          398   7e-132   
ref|NP_566027.1|  ELMO/CED-12 domain-containing protein                 397   1e-131   Arabidopsis thaliana [mouse-ear cress]
gb|KEH17885.1|  ELMO/CED-12 family protein                              397   2e-131   
gb|KEH17881.1|  ELMO/CED-12 family protein                              395   6e-131   
emb|CAN74275.1|  hypothetical protein VITISV_036799                     395   7e-131   Vitis vinifera
ref|XP_006294803.1|  hypothetical protein CARUB_v10023854mg             395   1e-130   
gb|AAL51113.1|AF458341_1  At2g44770/F16B22.26                           394   2e-130   Arabidopsis thaliana [mouse-ear cress]
emb|CDX67822.1|  BnaA07g18620D                                          394   3e-130   
ref|XP_008794920.1|  PREDICTED: ELMO domain-containing protein A-...    394   4e-130   
emb|CDY64764.1|  BnaC06g42810D                                          394   4e-130   
ref|XP_002862539.1|  hypothetical protein ARALYDRAFT_497408             393   6e-130   
ref|XP_004515336.1|  PREDICTED: ELMO domain-containing protein A-...    392   9e-130   
ref|XP_004515337.1|  PREDICTED: ELMO domain-containing protein A-...    391   2e-129   
ref|XP_010919754.1|  PREDICTED: ELMO domain-containing protein A-...    391   3e-129   
ref|XP_009142280.1|  PREDICTED: ELMO domain-containing protein A ...    391   4e-129   
ref|XP_009133688.1|  PREDICTED: ELMO domain-containing protein A-...    391   4e-129   
ref|XP_009104256.1|  PREDICTED: ELMO domain-containing protein A-...    391   5e-129   
ref|XP_009116710.1|  PREDICTED: ELMO domain-containing protein A-...    391   5e-129   
ref|XP_010506412.1|  PREDICTED: ELMO domain-containing protein A-...    390   6e-129   
ref|XP_006587780.1|  PREDICTED: ELMO domain-containing protein A ...    390   6e-129   
ref|XP_010518081.1|  PREDICTED: ELMO domain-containing protein A-...    390   7e-129   
emb|CDX83414.1|  BnaA03g20920D                                          390   8e-129   
ref|XP_004515335.1|  PREDICTED: ELMO domain-containing protein A-...    390   9e-129   
ref|XP_009142281.1|  PREDICTED: ELMO domain-containing protein A ...    390   1e-128   
ref|XP_009388250.1|  PREDICTED: ELMO domain-containing protein A-...    390   1e-128   
ref|XP_010661409.1|  PREDICTED: ELMO domain-containing protein A ...    389   1e-128   
emb|CDY23455.1|  BnaC04g49830D                                          389   5e-128   
emb|CDY41180.1|  BnaA09g38350D                                          389   5e-128   
ref|XP_011017372.1|  PREDICTED: ELMO domain-containing protein C-...    387   6e-128   
emb|CDY30485.1|  BnaA04g25860D                                          388   6e-128   
ref|XP_006375163.1|  hypothetical protein POPTR_0014s04870g             385   2e-127   
ref|XP_010661411.1|  PREDICTED: ELMO domain-containing protein A ...    385   4e-127   
ref|XP_004953303.1|  PREDICTED: ELMO domain-containing protein A-...    385   9e-127   
ref|XP_009388256.1|  PREDICTED: ELMO domain-containing protein A-...    384   3e-126   
ref|XP_002452823.1|  hypothetical protein SORBIDRAFT_04g033230          383   5e-126   Sorghum bicolor [broomcorn]
ref|XP_004953302.1|  PREDICTED: ELMO domain-containing protein A-...    385   5e-126   
ref|XP_009604046.1|  PREDICTED: ELMO domain-containing protein A-...    382   5e-126   
ref|NP_001047599.1|  Os02g0652300                                       383   9e-126   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001142177.1|  uncharacterized protein LOC100274345               382   1e-125   Zea mays [maize]
ref|XP_004492915.1|  PREDICTED: ELMO domain-containing protein A-...    380   3e-125   
ref|XP_009758301.1|  PREDICTED: ELMO domain-containing protein A-...    380   4e-125   
ref|XP_008681555.1|  PREDICTED: uncharacterized protein LOC100274...    381   1e-124   
dbj|BAJ88229.1|  predicted protein                                      380   1e-124   
ref|XP_009758304.1|  PREDICTED: ELMO domain-containing protein A-...    379   1e-124   
gb|EMT29368.1|  ELMO domain-containing protein A                        380   2e-124   
ref|XP_009758303.1|  PREDICTED: ELMO domain-containing protein A-...    379   2e-124   
emb|CDX71823.1|  BnaC08g30510D                                          379   3e-124   
ref|XP_011032431.1|  PREDICTED: ELMO domain-containing protein A-...    377   4e-124   
ref|XP_006648893.1|  PREDICTED: ELMO domain-containing protein A-...    379   6e-124   
ref|XP_006375164.1|  hypothetical protein POPTR_0014s04870g             376   1e-123   
emb|CDX89059.1|  BnaA04g01270D                                          377   2e-123   
gb|KEH23422.1|  ELMO/CED-12 family protein                              375   2e-123   
ref|XP_003569999.1|  PREDICTED: ELMO domain-containing protein A-...    376   3e-123   
gb|KHG04304.1|  ELMO domain-containing A                                377   5e-123   
gb|KCW76868.1|  hypothetical protein EUGRSUZ_D01221                     374   7e-123   
ref|XP_007134409.1|  hypothetical protein PHAVU_010G045300g             373   7e-123   
gb|KHG05886.1|  ELMO domain-containing A                                373   1e-122   
ref|XP_006653633.1|  PREDICTED: ELMO domain-containing protein A-...    370   5e-121   
ref|XP_009387888.1|  PREDICTED: ELMO domain-containing protein A-...    370   6e-121   
gb|KDO85482.1|  hypothetical protein CISIN_1g024106mg                   368   8e-121   
gb|KCW76869.1|  hypothetical protein EUGRSUZ_D01221                     369   8e-121   
emb|CAB87863.1|  putative protein                                       367   7e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138852.1|  PREDICTED: ELMO domain-containing protein A ...    368   2e-119   
ref|XP_009138850.1|  PREDICTED: ELMO domain-containing protein A ...    369   3e-119   
gb|KEH17883.1|  ELMO/CED-12 family protein                              365   3e-119   
ref|XP_010327663.1|  PREDICTED: ELMO domain-containing protein A-...    363   1e-118   
ref|NP_001053465.1|  Os04g0545100                                       363   2e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004956419.1|  PREDICTED: ELMO domain-containing protein A-...    363   2e-118   
gb|ACR37958.1|  unknown                                                 363   2e-118   Zea mays [maize]
ref|XP_003580265.1|  PREDICTED: ELMO domain-containing protein A-...    363   3e-118   
dbj|BAJ86083.1|  predicted protein                                      363   3e-118   
gb|KEH17884.1|  ELMO/CED-12 family protein                              361   4e-118   
ref|XP_002448269.1|  hypothetical protein SORBIDRAFT_06g024230          362   8e-118   Sorghum bicolor [broomcorn]
ref|XP_010327661.1|  PREDICTED: ELMO domain-containing protein A-...    363   9e-118   
ref|XP_009387889.1|  PREDICTED: ELMO domain-containing protein A-...    362   1e-117   
ref|XP_009389262.1|  PREDICTED: ELMO domain-containing protein A        362   2e-117   
ref|NP_001167675.1|  ELMO domain-containing protein 2                   361   2e-117   Zea mays [maize]
ref|XP_009384690.1|  PREDICTED: ELMO domain-containing protein A-...    359   2e-116   
ref|XP_009384689.1|  PREDICTED: ELMO domain-containing protein A-...    355   3e-115   
ref|NP_001146443.1|  hypothetical protein                               353   2e-114   Zea mays [maize]
ref|XP_008794921.1|  PREDICTED: ELMO domain-containing protein A-...    351   6e-114   
ref|XP_010518082.1|  PREDICTED: ELMO domain-containing protein C-...    351   7e-114   
gb|EEE61435.1|  hypothetical protein OsJ_15660                          367   1e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007052338.1|  ELMO/CED-12 domain-containing protein isoform 2    329   1e-105   
gb|ABR17334.1|  unknown                                                 321   5e-102   Picea sitchensis
ref|XP_002489147.1|  hypothetical protein SORBIDRAFT_0019s004720        311   3e-98    Sorghum bicolor [broomcorn]
ref|XP_002514926.1|  ELMO domain-containing protein, putative           310   8e-98    Ricinus communis
ref|XP_008676711.1|  PREDICTED: hypothetical protein isoform X3         310   9e-98    
ref|XP_011071222.1|  PREDICTED: ELMO domain-containing protein C ...    310   2e-97    
ref|XP_004979271.1|  PREDICTED: ELMO domain-containing protein A-...    308   3e-97    
ref|XP_007044043.1|  ELMO/CED-12 family protein isoform 2               309   3e-97    
ref|XP_008676709.1|  PREDICTED: hypothetical protein isoform X1         310   4e-97    
ref|XP_006438041.1|  hypothetical protein CICLE_v10032373mg             307   7e-97    
ref|NP_001067907.1|  Os11g0483900                                       307   7e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008676710.1|  PREDICTED: hypothetical protein isoform X2         308   9e-97    
ref|XP_006662939.1|  PREDICTED: ELMO domain-containing protein A-...    307   1e-96    
ref|XP_006484089.1|  PREDICTED: ELMO domain-containing protein A-...    308   1e-96    
ref|XP_010248986.1|  PREDICTED: ELMO domain-containing protein A-...    307   2e-96    
ref|XP_006438044.1|  hypothetical protein CICLE_v10032373mg             307   3e-96    
ref|XP_004979270.1|  PREDICTED: ELMO domain-containing protein A-...    307   3e-96    
ref|XP_003577574.1|  PREDICTED: ELMO domain-containing protein A-...    307   4e-96    
gb|ABA93689.2|  phagocytosis and cell motility protein ELMO1, put...    307   4e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007044042.1|  ELMO/CED-12 domain-containing protein isoform 1    308   5e-96    
gb|KDO81916.1|  hypothetical protein CISIN_1g023949mg                   305   6e-96    
ref|XP_007044044.1|  ELMO/CED-12 domain-containing protein isoform 3    306   6e-96    
emb|CDG49296.1|  ELMO domain containing protein                         305   8e-96    
ref|XP_010044800.1|  PREDICTED: ELMO domain-containing protein C ...    305   2e-95    
gb|KDO81915.1|  hypothetical protein CISIN_1g023949mg                   305   2e-95    
ref|XP_010044802.1|  PREDICTED: ELMO domain-containing protein C ...    303   2e-95    
gb|KDP26793.1|  hypothetical protein JCGZ_17951                         304   3e-95    
ref|XP_010905192.1|  PREDICTED: ELMO domain-containing protein A-...    304   3e-95    
ref|XP_010907561.1|  PREDICTED: ELMO domain-containing protein A-...    304   4e-95    
ref|XP_004310072.1|  PREDICTED: ELMO domain-containing protein A-...    303   5e-95    
ref|XP_008776244.1|  PREDICTED: ELMO domain-containing protein A-...    303   5e-95    
ref|XP_008446042.1|  PREDICTED: ELMO domain-containing protein A        303   9e-95    
ref|XP_004135318.1|  PREDICTED: ELMO domain-containing protein A-...    303   1e-94    
ref|XP_007052339.1|  ELMO/CED-12 family protein isoform 3               300   1e-94    
ref|XP_008811375.1|  PREDICTED: ELMO domain-containing protein A-...    302   2e-94    
ref|XP_008389851.1|  PREDICTED: ELMO domain-containing protein A ...    302   3e-94    
ref|XP_011029697.1|  PREDICTED: ELMO domain-containing protein C-...    301   3e-94    
ref|XP_007044045.1|  ELMO/CED-12 domain-containing protein isoform 4    301   4e-94    
ref|XP_006484090.1|  PREDICTED: ELMO domain-containing protein A-...    300   4e-94    
ref|XP_008389852.1|  PREDICTED: ELMO domain-containing protein A ...    300   4e-94    
ref|XP_011071223.1|  PREDICTED: ELMO domain-containing protein C ...    300   9e-94    
ref|XP_010655825.1|  PREDICTED: ELMO domain-containing protein A        300   2e-93    
ref|XP_011029695.1|  PREDICTED: ELMO domain-containing protein A-...    300   2e-93    
gb|EYU42095.1|  hypothetical protein MIMGU_mgv1a022810mg                298   3e-93    
ref|XP_009419376.1|  PREDICTED: ELMO domain-containing protein A ...    299   3e-93    
ref|XP_010531612.1|  PREDICTED: ELMO domain-containing protein A ...    299   3e-93    
ref|XP_010682784.1|  PREDICTED: ELMO domain-containing protein A ...    297   6e-93    
emb|CDY12643.1|  BnaA02g13110D                                          297   8e-93    
ref|XP_010250740.1|  PREDICTED: ELMO domain-containing protein A        297   1e-92    
ref|XP_009127552.1|  PREDICTED: ELMO domain-containing protein A ...    297   3e-92    
ref|XP_009127553.1|  PREDICTED: ELMO domain-containing protein A ...    296   3e-92    
gb|KGN51676.1|  hypothetical protein Csa_5G589930                       301   4e-92    
emb|CDY51346.1|  BnaC02g45750D                                          295   4e-92    
ref|XP_002315612.2|  hypothetical protein POPTR_0010s07040g             296   5e-92    Populus trichocarpa [western balsam poplar]
ref|XP_010531611.1|  PREDICTED: ELMO domain-containing protein A ...    294   2e-91    
ref|XP_010242015.1|  PREDICTED: ELMO domain-containing protein A-...    292   3e-91    
ref|XP_002888595.1|  predicted protein                                  295   4e-91    
ref|XP_010242014.1|  PREDICTED: ELMO domain-containing protein A-...    293   8e-91    
ref|NP_564897.2|  ELMO/CED-12 domain-containing protein                 291   3e-90    Arabidopsis thaliana [mouse-ear cress]
gb|KFK41143.1|  hypothetical protein AALP_AA2G091400                    291   5e-90    
gb|AAG00245.1|AC002130_10  F1N21.22                                     292   9e-90    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD42979.1|  unknown protein                                        291   9e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007163750.1|  hypothetical protein PHAVU_001G261100g             288   2e-89    
ref|XP_007163749.1|  hypothetical protein PHAVU_001G261100g             288   2e-89    
emb|CDP19894.1|  unnamed protein product                                288   3e-89    
ref|XP_008448272.1|  PREDICTED: ELMO domain-containing protein A ...    286   7e-89    
ref|XP_006601899.1|  PREDICTED: ELMO domain-containing protein A-...    286   7e-89    
ref|XP_006591458.1|  PREDICTED: ELMO domain-containing protein A-...    287   8e-89    
gb|KHG05195.1|  ELMO domain-containing A                                287   9e-89    
ref|XP_003552785.1|  PREDICTED: ELMO domain-containing protein A-...    287   9e-89    
ref|XP_006391284.1|  hypothetical protein EUTSA_v10018989mg             287   1e-88    
ref|XP_004139936.1|  PREDICTED: ELMO domain-containing protein A-...    285   1e-88    
ref|XP_006302643.1|  hypothetical protein CARUB_v10020755mg             287   2e-88    
ref|XP_003538552.1|  PREDICTED: ELMO domain-containing protein A-...    285   2e-88    
ref|XP_010511669.1|  PREDICTED: ELMO domain-containing protein A-...    287   2e-88    
ref|XP_010415316.1|  PREDICTED: ELMO domain-containing protein A-...    286   4e-88    
ref|XP_010470644.1|  PREDICTED: ELMO domain-containing protein A-...    286   4e-88    
ref|XP_010470645.1|  PREDICTED: ELMO domain-containing protein A-...    286   4e-88    
ref|XP_008448269.1|  PREDICTED: ELMO domain-containing protein A ...    286   5e-88    
gb|KDO85484.1|  hypothetical protein CISIN_1g024106mg                   281   6e-88    
ref|XP_010415315.1|  PREDICTED: ELMO domain-containing protein A-...    285   7e-88    
ref|XP_006592421.1|  PREDICTED: ELMO domain-containing protein A-...    283   1e-87    
gb|KGN46754.1|  hypothetical protein Csa_6G128640                       285   1e-87    
ref|XP_007132654.1|  hypothetical protein PHAVU_011G113500g             285   1e-87    
ref|XP_010105799.1|  ELMO domain-containing protein A                   285   2e-87    
ref|XP_004154602.1|  PREDICTED: ELMO domain-containing protein A-...    285   6e-87    
ref|XP_006592419.1|  PREDICTED: ELMO domain-containing protein A-...    283   1e-86    
ref|XP_011085337.1|  PREDICTED: ELMO domain-containing protein A ...    280   1e-86    
ref|XP_006418219.1|  hypothetical protein EUTSA_v10008491mg             281   1e-86    
ref|XP_002319363.1|  phagocytosis and cell motility protein ELMO1       280   2e-86    Populus trichocarpa [western balsam poplar]
ref|XP_006652067.1|  PREDICTED: ELMO domain-containing protein A-...    280   2e-86    
ref|XP_003539905.2|  PREDICTED: ELMO domain-containing protein A-...    281   3e-86    
ref|XP_006582328.1|  PREDICTED: ELMO domain-containing protein A-...    278   5e-86    
ref|NP_001051992.1|  Os04g0101700                                       278   6e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009608645.1|  PREDICTED: ELMO domain-containing protein A ...    278   6e-86    
ref|XP_010245326.1|  PREDICTED: ELMO domain-containing protein A-...    278   8e-86    
ref|XP_008667106.1|  PREDICTED: hypothetical protein isoform X1         278   9e-86    
ref|XP_011085336.1|  PREDICTED: ELMO domain-containing protein A ...    280   2e-85    
ref|XP_010559086.1|  PREDICTED: ELMO domain-containing protein A ...    277   2e-85    
ref|XP_006447337.1|  hypothetical protein CICLE_v10016313mg             278   2e-85    
ref|XP_006366018.1|  PREDICTED: ELMO domain-containing protein B-...    278   2e-85    
gb|ACU19203.1|  unknown                                                 274   3e-85    
ref|XP_010415314.1|  PREDICTED: ELMO domain-containing protein C-...    278   3e-85    
gb|KEH16257.1|  ELMO/CED-12 family protein                              278   3e-85    
gb|KDO48862.1|  hypothetical protein CISIN_1g048536mg                   278   3e-85    
ref|XP_007043545.1|  ELMO/CED-12 family protein isoform 1               276   4e-85    
ref|XP_006582327.1|  PREDICTED: ELMO domain-containing protein A-...    278   4e-85    
ref|XP_009608623.1|  PREDICTED: ELMO domain-containing protein A ...    278   5e-85    
ref|XP_010327066.1|  PREDICTED: ELMO domain-containing protein A ...    277   6e-85    
ref|XP_011045490.1|  PREDICTED: ELMO domain-containing protein B ...    278   6e-85    
ref|XP_006366016.1|  PREDICTED: ELMO domain-containing protein B-...    277   8e-85    
ref|XP_002961921.1|  hypothetical protein SELMODRAFT_76188              278   8e-85    
ref|XP_010248987.1|  PREDICTED: ELMO domain-containing protein A-...    276   8e-85    
ref|XP_009343385.1|  PREDICTED: ELMO domain-containing protein B-...    278   9e-85    
ref|XP_009381960.1|  PREDICTED: ELMO domain-containing protein A-...    276   1e-84    
ref|XP_006491654.1|  PREDICTED: ELMO domain-containing protein A-...    278   1e-84    
emb|CBI28897.3|  unnamed protein product                                275   1e-84    
gb|KDO81917.1|  hypothetical protein CISIN_1g023949mg                   274   2e-84    
ref|XP_006366019.1|  PREDICTED: ELMO domain-containing protein B-...    275   2e-84    
ref|XP_010051746.1|  PREDICTED: ELMO domain-containing protein B ...    275   2e-84    
ref|XP_010327067.1|  PREDICTED: ELMO domain-containing protein A ...    274   3e-84    
ref|XP_003580945.1|  PREDICTED: ELMO domain-containing protein A        276   3e-84    
ref|XP_006592420.1|  PREDICTED: ELMO domain-containing protein A-...    276   3e-84    
gb|ACG44854.1|  ELMO domain-containing protein 2                        274   4e-84    
ref|XP_008341896.1|  PREDICTED: ELMO domain-containing protein B ...    276   4e-84    
gb|ABK95725.1|  unknown                                                 271   4e-84    
gb|KEH16258.1|  ELMO/CED-12 family protein                              274   4e-84    
ref|NP_001137029.1|  hypothetical protein                               273   5e-84    
gb|KDP24162.1|  hypothetical protein JCGZ_25819                         277   5e-84    
ref|XP_009787031.1|  PREDICTED: ELMO domain-containing protein A ...    273   6e-84    
ref|XP_004173344.1|  PREDICTED: ELMO domain-containing protein A-...    270   7e-84    
ref|XP_002272217.3|  PREDICTED: ELMO domain-containing protein A ...    275   8e-84    
ref|XP_010909923.1|  PREDICTED: ELMO domain-containing protein A        273   9e-84    
ref|NP_171859.1|  ELMO/CED-12 family protein                            274   9e-84    
ref|XP_010905193.1|  PREDICTED: ELMO domain-containing protein B-...    273   1e-83    
gb|KEH16261.1|  ELMO/CED-12 family protein                              274   1e-83    
ref|XP_004974949.1|  PREDICTED: ELMO domain-containing protein A-...    273   1e-83    
ref|XP_002517956.1|  conserved hypothetical protein                     273   1e-83    
ref|XP_006366014.1|  PREDICTED: ELMO domain-containing protein B-...    274   2e-83    
ref|XP_009111148.1|  PREDICTED: ELMO domain-containing protein A ...    273   2e-83    
ref|XP_010327065.1|  PREDICTED: ELMO domain-containing protein A ...    274   2e-83    
ref|XP_009787028.1|  PREDICTED: ELMO domain-containing protein A ...    274   3e-83    
ref|XP_002892171.1|  predicted protein                                  273   3e-83    
ref|XP_010051768.1|  PREDICTED: ELMO domain-containing protein B ...    271   3e-83    
ref|XP_002971167.1|  hypothetical protein SELMODRAFT_95157              274   3e-83    
ref|XP_010327064.1|  PREDICTED: ELMO domain-containing protein A ...    273   3e-83    
ref|XP_006303276.1|  hypothetical protein CARUB_v10010027mg             273   4e-83    
ref|XP_009111147.1|  PREDICTED: ELMO domain-containing protein A ...    272   4e-83    
ref|XP_004502372.1|  PREDICTED: ELMO domain-containing protein A-...    275   4e-83    
ref|XP_004248156.2|  PREDICTED: ELMO domain-containing protein A ...    274   5e-83    
ref|XP_002312624.2|  phagocytosis and cell motility protein ELMO1       270   6e-83    
ref|XP_006836146.1|  hypothetical protein AMTR_s00101p00020000          275   6e-83    
gb|KEH35256.1|  ELMO/CED-12 family protein                              271   7e-83    
ref|XP_010276825.1|  PREDICTED: ELMO domain-containing protein A        273   9e-83    
ref|XP_009357070.1|  PREDICTED: ELMO domain-containing protein A        270   9e-83    
ref|XP_008341897.1|  PREDICTED: ELMO domain-containing protein B ...    272   9e-83    
ref|XP_001756777.1|  predicted protein                                  273   1e-82    
ref|XP_003601795.1|  ELMO domain-containing protein                     270   1e-82    
ref|XP_010525005.1|  PREDICTED: ELMO domain-containing protein B-...    273   1e-82    
ref|XP_007227163.1|  hypothetical protein PRUPE_ppa025471mg             269   2e-82    
gb|KEH17882.1|  ELMO/CED-12 family protein                              268   2e-82    
ref|XP_010657265.1|  PREDICTED: ELMO domain-containing protein A ...    270   2e-82    
gb|AFK45202.1|  unknown                                                 270   2e-82    
ref|XP_010051728.1|  PREDICTED: ELMO domain-containing protein B ...    271   2e-82    
ref|XP_007215915.1|  hypothetical protein PRUPE_ppa010864mg             269   2e-82    
gb|EYU26141.1|  hypothetical protein MIMGU_mgv1a012946mg                269   3e-82    
ref|XP_010051739.1|  PREDICTED: ELMO domain-containing protein B ...    271   3e-82    
emb|CDY51385.1|  BnaC08g46220D                                          270   5e-82    
ref|XP_010943660.1|  PREDICTED: ELMO domain-containing protein C ...    270   7e-82    
ref|XP_004294703.1|  PREDICTED: ELMO domain-containing protein A-...    271   7e-82    
emb|CAD41459.3|  OSJNBa0079A21.3                                        267   8e-82    
ref|XP_010657263.1|  PREDICTED: ELMO domain-containing protein B ...    270   8e-82    
ref|XP_006366015.1|  PREDICTED: ELMO domain-containing protein B-...    270   8e-82    
ref|XP_009387244.1|  PREDICTED: ELMO domain-containing protein A        268   9e-82    
ref|XP_008811376.1|  PREDICTED: ELMO domain-containing protein B-...    268   1e-81    
ref|XP_010943659.1|  PREDICTED: ELMO domain-containing protein C ...    270   1e-81    
ref|XP_010055226.1|  PREDICTED: ELMO domain-containing protein A        270   1e-81    
ref|XP_010457369.1|  PREDICTED: ELMO domain-containing protein A-...    268   2e-81    
ref|XP_008230408.1|  PREDICTED: ELMO domain-containing protein B        269   2e-81    
ref|XP_011079152.1|  PREDICTED: ELMO domain-containing protein A        270   2e-81    
ref|XP_010549724.1|  PREDICTED: ELMO domain-containing protein A        270   3e-81    
ref|XP_008661972.1|  PREDICTED: ELMO domain-containing protein 2 ...    266   4e-81    
emb|CDP14747.1|  unnamed protein product                                268   5e-81    
ref|XP_010457368.1|  PREDICTED: ELMO domain-containing protein A-...    267   1e-80    
ref|XP_009381584.1|  PREDICTED: ELMO domain-containing protein A        267   2e-80    
ref|XP_006438042.1|  hypothetical protein CICLE_v10032373mg             263   2e-80    
emb|CDX89878.1|  BnaA10g02040D                                          265   2e-80    
ref|XP_003554071.1|  PREDICTED: ELMO domain-containing protein A ...    267   2e-80    
ref|XP_010482305.1|  PREDICTED: ELMO domain-containing protein A ...    265   2e-80    
ref|XP_010474988.1|  PREDICTED: ELMO domain-containing protein A-...    265   2e-80    
ref|XP_003520766.1|  PREDICTED: ELMO domain-containing protein A-...    267   3e-80    
ref|XP_009419378.1|  PREDICTED: ELMO domain-containing protein A ...    264   3e-80    
emb|CDY18174.1|  BnaC05g01970D                                          265   3e-80    
gb|ACU24380.1|  unknown                                                 267   3e-80    
ref|XP_011047074.1|  PREDICTED: ELMO domain-containing protein A        266   4e-80    
ref|XP_002319208.1|  phagocytosis and cell motility protein ELMO1       266   4e-80    
emb|CDP11299.1|  unnamed protein product                                266   5e-80    
ref|XP_010051732.1|  PREDICTED: ELMO domain-containing protein B ...    265   5e-80    
ref|XP_002530961.1|  conserved hypothetical protein                     266   6e-80    
gb|KHG12289.1|  ELMO domain-containing A                                266   6e-80    
ref|XP_008812016.1|  PREDICTED: ELMO domain-containing protein A ...    266   7e-80    
gb|EPS71792.1|  hypothetical protein M569_02968                         263   8e-80    
gb|EEE60364.1|  hypothetical protein OsJ_13493                          261   1e-79    
gb|KCW89507.1|  hypothetical protein EUGRSUZ_A01798                     264   1e-79    
ref|XP_010689681.1|  PREDICTED: ELMO domain-containing protein B        262   1e-79    
ref|XP_010474987.1|  PREDICTED: ELMO domain-containing protein A-...    264   1e-79    
ref|XP_006437306.1|  hypothetical protein CICLE_v10032130mg             265   1e-79    
gb|EPS67405.1|  hypothetical protein M569_07369                         265   2e-79    
ref|XP_010482297.1|  PREDICTED: ELMO domain-containing protein A ...    264   2e-79    
ref|XP_010482290.1|  PREDICTED: ELMO domain-containing protein A ...    264   2e-79    
ref|XP_004506555.1|  PREDICTED: ELMO domain-containing protein A-...    261   2e-79    
emb|CDY29944.1|  BnaC01g40640D                                          265   2e-79    
gb|KDP39620.1|  hypothetical protein JCGZ_02640                         264   3e-79    
ref|XP_010474985.1|  PREDICTED: ELMO domain-containing protein A-...    264   3e-79    
ref|XP_010111285.1|  ELMO domain-containing protein A                   265   3e-79    
ref|XP_004493259.1|  PREDICTED: ELMO domain-containing protein A-...    264   3e-79    
ref|XP_004506553.1|  PREDICTED: ELMO domain-containing protein A-...    262   6e-79    
ref|XP_006408286.1|  hypothetical protein EUTSA_v10021157mg             263   6e-79    
ref|XP_002882299.1|  hypothetical protein ARALYDRAFT_477606             263   7e-79    
gb|KHG20014.1|  ELMO domain-containing A                                263   8e-79    
ref|XP_008367289.1|  PREDICTED: ELMO domain-containing protein A-...    263   8e-79    
ref|XP_006379928.1|  hypothetical protein POPTR_0008s17540g             258   1e-78    
ref|NP_566211.1|  ELMO/CED-12 family protein                            263   1e-78    
emb|CDY50653.1|  BnaC05g48130D                                          263   1e-78    
gb|AAM63875.1|  unknown                                                 263   1e-78    
ref|XP_009102059.1|  PREDICTED: ELMO domain-containing protein A-...    263   1e-78    
ref|XP_008812012.1|  PREDICTED: ELMO domain-containing protein A ...    262   1e-78    
ref|XP_008222149.1|  PREDICTED: ELMO domain-containing protein A        259   2e-78    
ref|XP_009102058.1|  PREDICTED: ELMO domain-containing protein A-...    262   2e-78    
ref|XP_010522618.1|  PREDICTED: ELMO domain-containing protein A ...    261   3e-78    
ref|XP_008240634.1|  PREDICTED: ELMO domain-containing protein A ...    261   3e-78    
ref|XP_009419377.1|  PREDICTED: ELMO domain-containing protein A ...    259   3e-78    
ref|XP_010228684.1|  PREDICTED: ELMO domain-containing protein A-...    259   4e-78    
ref|XP_009353040.1|  PREDICTED: ELMO domain-containing protein A-...    261   5e-78    
gb|EAZ26753.1|  hypothetical protein OsJ_10666                          261   5e-78    
ref|NP_001049969.1|  Os03g0322800                                       261   5e-78    
gb|EAY89814.1|  hypothetical protein OsI_11361                          261   6e-78    
ref|XP_003624785.1|  ELMO domain-containing protein A                   261   6e-78    
ref|XP_008448270.1|  PREDICTED: ELMO domain-containing protein A ...    259   7e-78    
ref|XP_011070001.1|  PREDICTED: ELMO domain-containing protein C-...    261   7e-78    
ref|XP_008655221.1|  PREDICTED: ELMO domain-containing protein C        260   8e-78    
ref|XP_009130378.1|  PREDICTED: ELMO domain-containing protein A-...    260   9e-78    
emb|CDY51759.1|  BnaA05g32830D                                          260   1e-77    
ref|XP_009387890.1|  PREDICTED: ELMO domain-containing protein A-...    258   1e-77    
ref|XP_010228685.1|  PREDICTED: ELMO domain-containing protein A-...    259   2e-77    
ref|XP_006298140.1|  hypothetical protein CARUB_v10014187mg             260   2e-77    
ref|XP_010463813.1|  PREDICTED: ELMO domain-containing protein A-...    260   2e-77    
ref|XP_010485704.1|  PREDICTED: ELMO domain-containing protein A-...    259   2e-77    
ref|XP_010512432.1|  PREDICTED: ELMO domain-containing protein A-...    259   2e-77    
ref|XP_008386911.1|  PREDICTED: ELMO domain-containing protein A ...    259   3e-77    
ref|XP_010512560.1|  PREDICTED: ELMO domain-containing protein A-...    259   3e-77    
ref|XP_007029898.1|  ELMO/CED-12 family protein isoform 1               259   4e-77    
ref|XP_008455764.1|  PREDICTED: ELMO domain-containing protein A        259   4e-77    
ref|XP_009119524.1|  PREDICTED: ELMO domain-containing protein A-...    256   4e-77    
ref|XP_002271601.1|  PREDICTED: ELMO domain-containing protein B ...    258   6e-77    
ref|XP_010653152.1|  PREDICTED: ELMO domain-containing protein B ...    257   1e-76    
ref|XP_003558018.1|  PREDICTED: ELMO domain-containing protein A-...    257   1e-76    
ref|XP_008240635.1|  PREDICTED: ELMO domain-containing protein A ...    257   2e-76    
ref|XP_004144309.1|  PREDICTED: ELMO domain-containing protein A-...    257   2e-76    
ref|XP_006339222.1|  PREDICTED: ELMO domain-containing protein A-...    256   2e-76    
gb|EYU20853.1|  hypothetical protein MIMGU_mgv1a010155mg                257   2e-76    
ref|XP_007202237.1|  hypothetical protein PRUPE_ppa008710mg             257   2e-76    
ref|XP_006650012.1|  PREDICTED: ELMO domain-containing protein A-...    256   3e-76    
ref|XP_007161847.1|  hypothetical protein PHAVU_001G103100g             256   3e-76    
ref|XP_009365297.1|  PREDICTED: ELMO domain-containing protein A-...    256   4e-76    
ref|XP_010512367.1|  PREDICTED: uncharacterized protein LOC104788...    258   4e-76    
ref|XP_004984541.1|  PREDICTED: ELMO domain-containing protein A-...    256   5e-76    
ref|XP_009619330.1|  PREDICTED: ELMO domain-containing protein A        256   6e-76    
ref|XP_010922933.1|  PREDICTED: ELMO domain-containing protein C-...    254   7e-76    
ref|XP_010922932.1|  PREDICTED: ELMO domain-containing protein C-...    255   9e-76    
ref|XP_002448930.1|  hypothetical protein SORBIDRAFT_05g001780          255   1e-75    
gb|AFW59056.1|  hypothetical protein ZEAMMB73_210148                    251   2e-75    
ref|XP_010922931.1|  PREDICTED: ELMO domain-containing protein C-...    255   2e-75    
ref|XP_004249353.1|  PREDICTED: ELMO domain-containing protein A        254   2e-75    
ref|XP_010922929.1|  PREDICTED: ELMO domain-containing protein A-...    255   3e-75    
ref|XP_010678186.1|  PREDICTED: ELMO domain-containing protein A        253   3e-75    
ref|XP_009774079.1|  PREDICTED: ELMO domain-containing protein A        253   5e-75    
gb|AAF86529.1|AC002560_22  F21B7.23                                     250   6e-75    
ref|NP_001131514.1|  hypothetical protein                               249   6e-75    
gb|KEH35258.1|  ELMO/CED-12 family protein                              248   9e-75    
ref|XP_009608632.1|  PREDICTED: uncharacterized protein LOC104102...    251   9e-75    
ref|XP_009608640.1|  PREDICTED: ELMO domain-containing protein A ...    247   1e-73    
ref|XP_009787030.1|  PREDICTED: ELMO domain-containing protein A ...    247   2e-73    
gb|EMS64430.1|  ELMO domain-containing protein A                        245   2e-73    
ref|XP_010522620.1|  PREDICTED: ELMO domain-containing protein A ...    247   3e-73    
ref|XP_006366017.1|  PREDICTED: ELMO domain-containing protein B-...    247   3e-73    
gb|KGN54658.1|  hypothetical protein Csa_4G417520                       248   4e-73    
ref|XP_009787029.1|  PREDICTED: uncharacterized protein LOC104235...    246   5e-73    
ref|XP_011045491.1|  PREDICTED: ELMO domain-containing protein B ...    246   7e-73    
ref|XP_010522616.1|  PREDICTED: ELMO domain-containing protein A ...    247   9e-73    
ref|XP_011045487.1|  PREDICTED: ELMO domain-containing protein B ...    248   9e-73    
gb|AAF03471.1|AC009327_10  hypothetical protein                         242   9e-73    
ref|XP_010522617.1|  PREDICTED: ELMO domain-containing protein A ...    247   1e-72    
ref|XP_004304127.1|  PREDICTED: ELMO domain-containing protein A-...    245   2e-72    
emb|CAE75985.1|  B1160F02.16                                            244   2e-72    
ref|XP_009401469.1|  PREDICTED: ELMO domain-containing protein B-...    244   9e-72    
ref|NP_001169373.1|  uncharacterized protein LOC100383240               244   2e-71    
ref|XP_007132655.1|  hypothetical protein PHAVU_011G113500g             241   3e-71    
ref|XP_010482322.1|  PREDICTED: ELMO domain-containing protein A-...    237   4e-71    
gb|KEH16262.1|  ELMO/CED-12 family protein                              240   6e-71    
gb|KEH16260.1|  ELMO/CED-12 family protein                              240   7e-71    
gb|KEH35257.1|  ELMO/CED-12 family protein                              236   5e-70    
ref|XP_008341898.1|  PREDICTED: ELMO domain-containing protein B ...    238   9e-70    
ref|XP_002445998.1|  hypothetical protein SORBIDRAFT_06g000270          235   1e-69    
ref|XP_009343386.1|  PREDICTED: ELMO domain-containing protein B-...    236   1e-69    
ref|XP_008341893.1|  PREDICTED: ELMO domain-containing protein B ...    238   1e-69    
ref|XP_004978460.1|  PREDICTED: ELMO domain-containing protein A-...    238   3e-69    
ref|XP_009401467.1|  PREDICTED: ELMO domain-containing protein C-...    238   4e-69    
ref|XP_008341901.1|  PREDICTED: ELMO domain-containing protein B ...    234   5e-69    
ref|XP_008341899.1|  PREDICTED: ELMO domain-containing protein B ...    235   6e-69    
dbj|BAJ92875.1|  predicted protein                                      237   6e-69    
gb|EMS51611.1|  ELMO domain-containing protein A                        248   9e-69    
ref|XP_006438043.1|  hypothetical protein CICLE_v10032373mg             232   2e-68    
ref|NP_001066048.1|  Os12g0126200                                       236   2e-68    
ref|XP_008341895.1|  PREDICTED: ELMO domain-containing protein B ...    234   3e-68    
gb|KDO81919.1|  hypothetical protein CISIN_1g023949mg                   231   5e-68    
ref|XP_006663778.1|  PREDICTED: ELMO domain-containing protein A-...    234   6e-68    
gb|KCW86909.1|  hypothetical protein EUGRSUZ_B03488                     231   7e-68    
ref|XP_011045488.1|  PREDICTED: ELMO domain-containing protein B ...    233   2e-67    
gb|KDO81918.1|  hypothetical protein CISIN_1g023949mg                   230   2e-67    
ref|XP_003577868.1|  PREDICTED: ELMO domain-containing protein A-...    234   3e-67    



>ref|XP_009623406.1| PREDICTED: ELMO domain-containing protein C-like isoform X2 [Nicotiana 
tomentosiformis]
Length=246

 Score =   454 bits (1168),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = +1

Query  340   MPNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISY  519
             MP CIDICAEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECL RLQSR+D++Y
Sbjct  1     MPTCIDICAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLLRLQSRIDVAY  60

Query  520   DRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYF  699
             D SIPEHQ AL+ALW AAFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYF
Sbjct  61    DSSIPEHQEALKALWKAAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYF  120

Query  700   ANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFL  879
             A NFP SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPRNLVGATFLKFL
Sbjct  121   ARNFPKSFQDLLRKQEGDRAIWEYPFAVAGVNITFMLIQMLDLEALKPRNLVGATFLKFL  180

Query  880   AENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             AENESAFDLLYCITFKLMDHQWL+MRASYMDFN+VMKATRRQLE+ELL EDITRLEDLP
Sbjct  181   AENESAFDLLYCITFKLMDHQWLAMRASYMDFNTVMKATRRQLEEELLQEDITRLEDLP  239



>ref|XP_009788778.1| PREDICTED: ELMO domain-containing protein C-like isoform X2 [Nicotiana 
sylvestris]
Length=246

 Score =   453 bits (1166),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 213/239 (89%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = +1

Query  340   MPNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISY  519
             MP CIDICAEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECL RLQSR+D++Y
Sbjct  1     MPTCIDICAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLLRLQSRIDVAY  60

Query  520   DRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYF  699
             D SIPEHQ AL+ALW  AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYF
Sbjct  61    DSSIPEHQEALKALWKVAFPEEELRSLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYF  120

Query  700   ANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFL  879
             A NFP SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPRNLVGATFLKFL
Sbjct  121   ARNFPKSFQDLLRKQEGDRAIWEYPFAVAGVNITFMLIQMLDLEALKPRNLVGATFLKFL  180

Query  880   AENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             AENESAFDLLYCITFKLMDHQWL+MRASYMDFN+VMKATRRQLE+ELL EDITRLEDLP
Sbjct  181   AENESAFDLLYCITFKLMDHQWLAMRASYMDFNTVMKATRRQLEEELLHEDITRLEDLP  239



>gb|KDP28872.1| hypothetical protein JCGZ_14643 [Jatropha curcas]
Length=267

 Score =   443 bits (1139),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 207/237 (87%), Positives = 223/237 (94%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RE+DARPSF+LTPAQEECLQRLQSR+D++YD 
Sbjct  24    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRENDARPSFDLTPAQEECLQRLQSRIDVAYDS  83

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEHQ ALRALWNAAFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  84    SIPEHQEALRALWNAAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  143

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLLQKREGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR +VGA FLKFL+E
Sbjct  144   NFPKSFQDLLQKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTMVGAIFLKFLSE  203

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFK+MDHQWL+M ASYMDFN+VMK+TRRQLE+ELLLEDITRLEDLP
Sbjct  204   NESAFDLLYCITFKMMDHQWLTMHASYMDFNTVMKSTRRQLERELLLEDITRLEDLP  260



>ref|XP_007052337.1| ELMO/CED-12 family protein isoform 1 [Theobroma cacao]
 gb|EOX96494.1| ELMO/CED-12 family protein isoform 1 [Theobroma cacao]
Length=266

 Score =   441 bits (1133),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 207/237 (87%), Positives = 226/237 (95%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQE+CLQRLQ+R+DI+YD 
Sbjct  23    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEDCLQRLQNRIDIAYDS  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEHQ+ALRALWNAAFPEE+LR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  83    SIPEHQNALRALWNAAFPEEQLRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  142

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             +FP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR +VGATFLKFL+E
Sbjct  143   SFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTMVGATFLKFLSE  202

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMDHQWL+MRASYMDFN+VMKATRRQLE+ELLLEDITRLEDLP
Sbjct  203   NESAFDLLYCITFKLMDHQWLAMRASYMDFNTVMKATRRQLERELLLEDITRLEDLP  259



>ref|XP_008232538.1| PREDICTED: ELMO domain-containing protein A isoform X3 [Prunus 
mume]
Length=247

 Score =   439 bits (1130),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 208/237 (88%), Positives = 223/237 (94%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             + +D CAEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECL RLQSR+D+ YD 
Sbjct  4     DILDCCAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPVQEECLLRLQSRIDVPYDS  63

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
              +PEHQ ALRALWNAAFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  64    LVPEHQEALRALWNAAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  123

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  124   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  183

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDL+YCITFKLMDHQWLSMRASYMDFN+VMK+TRRQLEKELL EDITRLEDLP
Sbjct  184   NESAFDLIYCITFKLMDHQWLSMRASYMDFNTVMKSTRRQLEKELLFEDITRLEDLP  240



>ref|XP_010325250.1| PREDICTED: ELMO domain-containing protein A isoform X3 [Solanum 
lycopersicum]
 ref|XP_010325251.1| PREDICTED: ELMO domain-containing protein A isoform X3 [Solanum 
lycopersicum]
Length=246

 Score =   439 bits (1129),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = +1

Query  340   MPNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISY  519
             MP CID+CAEVVAGSAAWLGRGLSC+C Q RESDARPSF+LTP+QEECL RLQ+R+D++Y
Sbjct  1     MPTCIDMCAEVVAGSAAWLGRGLSCVCVQRRESDARPSFDLTPSQEECLLRLQNRIDVAY  60

Query  520   DRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYF  699
             D  IPEHQ AL+ALW  AFPEE+LR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYF
Sbjct  61    DSLIPEHQEALKALWKVAFPEEQLRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYF  120

Query  700   ANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFL  879
             A NFP SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPRNLVGATFLKFL
Sbjct  121   ARNFPRSFQDLLRKQEGDRAIWEYPFAVAGVNITFMLIQMLDLEALKPRNLVGATFLKFL  180

Query  880   AENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             AENESAFDLLYCITFKLMD+QWL+MRASYMDFN+VMKATRRQLE+ELL EDITRLEDLP
Sbjct  181   AENESAFDLLYCITFKLMDNQWLAMRASYMDFNAVMKATRRQLEEELLQEDITRLEDLP  239



>ref|XP_009623404.1| PREDICTED: ELMO domain-containing protein C-like isoform X1 [Nicotiana 
tomentosiformis]
Length=266

 Score =   440 bits (1131),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 208/237 (88%), Positives = 223/237 (94%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECL RLQSR+D++YD 
Sbjct  23    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLLRLQSRIDVAYDS  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEHQ AL+ALW AAFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA 
Sbjct  83    SIPEHQEALKALWKAAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFAR  142

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPRNLVGATFLKFLAE
Sbjct  143   NFPKSFQDLLRKQEGDRAIWEYPFAVAGVNITFMLIQMLDLEALKPRNLVGATFLKFLAE  202

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMDHQWL+MRASYMDFN+VMKATRRQLE+ELL EDITRLEDLP
Sbjct  203   NESAFDLLYCITFKLMDHQWLAMRASYMDFNTVMKATRRQLEEELLQEDITRLEDLP  259



>ref|XP_002526467.1| ELMO domain-containing protein, putative [Ricinus communis]
 gb|EEF35858.1| ELMO domain-containing protein, putative [Ricinus communis]
Length=267

 Score =   439 bits (1129),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 207/237 (87%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LT  QEECLQRLQSR+D++YD 
Sbjct  24    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTLTQEECLQRLQSRIDVAYDS  83

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEHQ ALRALWNAAFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  84    SIPEHQEALRALWNAAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAK  143

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLLQKREGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR +VGA FLKFL E
Sbjct  144   NFPTSFQDLLQKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTMVGAVFLKFLTE  203

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMDHQWL+M ASYMDFN+VMK+TRRQLE+ELLLEDITRLEDLP
Sbjct  204   NESAFDLLYCITFKLMDHQWLNMHASYMDFNTVMKSTRRQLERELLLEDITRLEDLP  260



>gb|KDO85481.1| hypothetical protein CISIN_1g024106mg [Citrus sinensis]
Length=256

 Score =   439 bits (1128),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 205/232 (88%), Positives = 223/232 (96%), Gaps = 0/232 (0%)
 Frame = +1

Query  361   CAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEH  540
             CAEVVAGSAAWLGRGLSC+CAQ RESD RPSF+LTPAQEECLQRLQ R+D++YD SIPEH
Sbjct  18    CAEVVAGSAAWLGRGLSCVCAQRRESDPRPSFDLTPAQEECLQRLQLRIDVAYDSSIPEH  77

Query  541   QSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNS  720
             + ALRALWNAAFP+EELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLLY A NFP S
Sbjct  78    REALRALWNAAFPDEELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYLARNFPKS  137

Query  721   FQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAF  900
             FQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR +VGATFLKFL+ENESAF
Sbjct  138   FQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTMVGATFLKFLSENESAF  197

Query  901   DLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             DLLYCITFKLMDHQWL+MRASYMDFN+VMK+TRRQLE+ELLLED+TRLEDLP
Sbjct  198   DLLYCITFKLMDHQWLAMRASYMDFNTVMKSTRRQLERELLLEDVTRLEDLP  249



>ref|XP_009788777.1| PREDICTED: ELMO domain-containing protein C-like isoform X1 [Nicotiana 
sylvestris]
Length=266

 Score =   439 bits (1129),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 207/237 (87%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECL RLQSR+D++YD 
Sbjct  23    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLLRLQSRIDVAYDS  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEHQ AL+ALW  AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA 
Sbjct  83    SIPEHQEALKALWKVAFPEEELRSLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFAR  142

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPRNLVGATFLKFLAE
Sbjct  143   NFPKSFQDLLRKQEGDRAIWEYPFAVAGVNITFMLIQMLDLEALKPRNLVGATFLKFLAE  202

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMDHQWL+MRASYMDFN+VMKATRRQLE+ELL EDITRLEDLP
Sbjct  203   NESAFDLLYCITFKLMDHQWLAMRASYMDFNTVMKATRRQLEEELLHEDITRLEDLP  259



>ref|XP_006445444.1| hypothetical protein CICLE_v10021713mg [Citrus clementina]
 ref|XP_006464410.1| PREDICTED: ELMO domain-containing protein A-like [Citrus sinensis]
 gb|ESR58684.1| hypothetical protein CICLE_v10021713mg [Citrus clementina]
 gb|KDO85479.1| hypothetical protein CISIN_1g024106mg [Citrus sinensis]
Length=266

 Score =   439 bits (1128),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 205/237 (86%), Positives = 223/237 (94%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESD RPSF+LTPAQEECLQRLQ R+D++YD 
Sbjct  23    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDPRPSFDLTPAQEECLQRLQLRIDVAYDS  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEH+ ALRALWNAAFP+EELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLLY A 
Sbjct  83    SIPEHREALRALWNAAFPDEELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYLAR  142

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR +VGATFLKFL+E
Sbjct  143   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTMVGATFLKFLSE  202

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMDHQWL+MRASYMDFN+VMK+TRRQLE+ELLLED+TRLEDLP
Sbjct  203   NESAFDLLYCITFKLMDHQWLAMRASYMDFNTVMKSTRRQLERELLLEDVTRLEDLP  259



>ref|XP_008232536.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Prunus 
mume]
Length=269

 Score =   438 bits (1126),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 207/237 (87%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECL RLQSR+D+ YD 
Sbjct  26    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPVQEECLLRLQSRIDVPYDS  85

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
              +PEHQ ALRALWNAAFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  86    LVPEHQEALRALWNAAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  145

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  146   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  205

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDL+YCITFKLMDHQWLSMRASYMDFN+VMK+TRRQLEKELL EDITRLEDLP
Sbjct  206   NESAFDLIYCITFKLMDHQWLSMRASYMDFNTVMKSTRRQLEKELLFEDITRLEDLP  262



>ref|XP_009374117.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Pyrus 
x bretschneideri]
Length=271

 Score =   437 bits (1124),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 206/237 (87%), Positives = 221/237 (93%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECL RLQSR+D+SYD 
Sbjct  28    TCPSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPVQEECLIRLQSRIDVSYDS  87

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S+PEHQ ALRALWNA+FPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA 
Sbjct  88    SVPEHQEALRALWNASFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFAR  147

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
              FP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  148   TFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  207

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDL+YCITFKLMDHQWLSMRASYMDFN+VMK+TRRQLEKEL+LED+T LEDLP
Sbjct  208   NESAFDLIYCITFKLMDHQWLSMRASYMDFNTVMKSTRRQLEKELVLEDVTWLEDLP  264



>ref|XP_006347984.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Solanum 
tuberosum]
Length=246

 Score =   436 bits (1121),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  340   MPNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISY  519
             MP CID+CAEVVAGSAAWLGRGLSC+C Q RESDARPSF+LTP+QEECL RLQ+R+D++Y
Sbjct  1     MPTCIDMCAEVVAGSAAWLGRGLSCVCVQRRESDARPSFDLTPSQEECLLRLQNRIDVAY  60

Query  520   DRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYF  699
             D  I EHQ AL+ALW  AFPEE+LR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYF
Sbjct  61    DSLILEHQEALKALWKVAFPEEQLRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYF  120

Query  700   ANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFL  879
             A NFP SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPRNLVGATFLKFL
Sbjct  121   ARNFPKSFQDLLRKQEGDRAIWEYPFAVAGVNITFMLIQMLDLEALKPRNLVGATFLKFL  180

Query  880   AENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             AENESAFDLLYCITFKLMD+QWL+MRASYMDFN+VMKATRRQLE+ELL EDITRLEDLP
Sbjct  181   AENESAFDLLYCITFKLMDNQWLAMRASYMDFNAVMKATRRQLEEELLQEDITRLEDLP  239



>ref|XP_008374822.1| PREDICTED: ELMO domain-containing protein A-like [Malus domestica]
Length=271

 Score =   437 bits (1123),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGS AWLGRGLSC+CAQ RESDARPSF+LT  QEECL RLQSR+D+SYD 
Sbjct  28    TCQSTSAEVVAGSTAWLGRGLSCVCAQRRESDARPSFDLTTVQEECLIRLQSRIDVSYDS  87

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEHQ ALRALWNA+FPEEELR LIS+QWKEMGWQGKDP+TDFRGGGFISLENLLYFA 
Sbjct  88    SIPEHQEALRALWNASFPEEELRGLISDQWKEMGWQGKDPSTDFRGGGFISLENLLYFAR  147

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
              FP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR +VGATFLKFLAE
Sbjct  148   TFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTMVGATFLKFLAE  207

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDL+YCITFKLMDHQWLSMRASYMDFN+VMK+TRRQLEKEL+LED+TRLEDLP
Sbjct  208   NESAFDLIYCITFKLMDHQWLSMRASYMDFNTVMKSTRRQLEKELVLEDVTRLEDLP  264



>ref|XP_007220430.1| hypothetical protein PRUPE_ppa009980mg [Prunus persica]
 gb|EMJ21629.1| hypothetical protein PRUPE_ppa009980mg [Prunus persica]
Length=269

 Score =   436 bits (1122),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 206/237 (87%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECL RLQSR+D+ Y+ 
Sbjct  26    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPVQEECLLRLQSRIDVPYES  85

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
              +PEHQ ALRALWNAAFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  86    LVPEHQEALRALWNAAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  145

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  146   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  205

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDL+YCITFKLMDHQWLSMRASYMDFN+VMK+TRRQLEKELL EDITRLEDLP
Sbjct  206   NESAFDLIYCITFKLMDHQWLSMRASYMDFNTVMKSTRRQLEKELLFEDITRLEDLP  262



>ref|XP_009373207.1| PREDICTED: ELMO domain-containing protein A isoform X2 [Pyrus 
x bretschneideri]
Length=247

 Score =   435 bits (1118),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 207/237 (87%), Positives = 223/237 (94%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             + ID  AEVVAGSAAWLGRGLSC+CAQ RESD RPSF+LTP QEECL RLQSR+D+SYD 
Sbjct  4     DIIDCFAEVVAGSAAWLGRGLSCVCAQRRESDPRPSFDLTPVQEECLIRLQSRIDVSYDS  63

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S+PEHQ ALRALW+AAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  64    SVPEHQEALRALWSAAFPEEELCGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  123

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             +FP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  124   SFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  183

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDL+YCITFKLMDHQWLSMRASYMDFN+VMKATRRQLEKELLLED+TRLEDLP
Sbjct  184   NESAFDLIYCITFKLMDHQWLSMRASYMDFNTVMKATRRQLEKELLLEDVTRLEDLP  240



>ref|XP_009374118.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Pyrus 
x bretschneideri]
Length=242

 Score =   434 bits (1117),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 204/235 (87%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = +1

Query  352   IDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSI  531
             + + +EVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECL RLQSR+D+SYD S+
Sbjct  1     MQLLSEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPVQEECLIRLQSRIDVSYDSSV  60

Query  532   PEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNF  711
             PEHQ ALRALWNA+FPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA  F
Sbjct  61    PEHQEALRALWNASFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARTF  120

Query  712   PNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENE  891
             P SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAENE
Sbjct  121   PKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAENE  180

Query  892   SAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             SAFDL+YCITFKLMDHQWLSMRASYMDFN+VMK+TRRQLEKEL+LED+T LEDLP
Sbjct  181   SAFDLIYCITFKLMDHQWLSMRASYMDFNTVMKSTRRQLEKELVLEDVTWLEDLP  235



>ref|XP_009373205.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009373206.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Pyrus 
x bretschneideri]
Length=271

 Score =   435 bits (1118),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 206/237 (87%), Positives = 221/237 (93%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESD RPSF+LTP QEECL RLQSR+D+SYD 
Sbjct  28    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDPRPSFDLTPVQEECLIRLQSRIDVSYDS  87

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S+PEHQ ALRALW+AAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  88    SVPEHQEALRALWSAAFPEEELCGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  147

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             +FP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  148   SFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  207

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDL+YCITFKLMDHQWLSMRASYMDFN+VMKATRRQLEKELLLED+TRLEDLP
Sbjct  208   NESAFDLIYCITFKLMDHQWLSMRASYMDFNTVMKATRRQLEKELLLEDVTRLEDLP  264



>ref|XP_010086775.1| ELMO domain-containing protein A [Morus notabilis]
 gb|EXC35648.1| ELMO domain-containing protein A [Morus notabilis]
Length=268

 Score =   434 bits (1117),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LT +QEECLQRLQ+R+D+SYD 
Sbjct  25    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTASQEECLQRLQNRIDVSYDS  84

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEHQ ALRALWNAA+PEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  85    SIPEHQEALRALWNAAYPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  144

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLA+
Sbjct  145   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAD  204

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMDHQWL+MRASYMDFN+VMKATRRQ+EKELL ED+ RLE+LP
Sbjct  205   NESAFDLLYCITFKLMDHQWLTMRASYMDFNTVMKATRRQVEKELLNEDVLRLEELP  261



>gb|KDO85478.1| hypothetical protein CISIN_1g024106mg [Citrus sinensis]
Length=265

 Score =   434 bits (1116),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 205/237 (86%), Positives = 223/237 (94%), Gaps = 1/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESD RPSF+LTPAQEECLQRLQ R+D++YD 
Sbjct  23    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDPRPSFDLTPAQEECLQRLQLRIDVAYDS  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEH+ ALRALWNAAFP+EELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLLY A 
Sbjct  83    SIPEHREALRALWNAAFPDEELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYLAR  142

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR +VGATFLKFL+E
Sbjct  143   NFP-SFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTMVGATFLKFLSE  201

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMDHQWL+MRASYMDFN+VMK+TRRQLE+ELLLED+TRLEDLP
Sbjct  202   NESAFDLLYCITFKLMDHQWLAMRASYMDFNTVMKSTRRQLERELLLEDVTRLEDLP  258



>ref|XP_004306979.1| PREDICTED: ELMO domain-containing protein A-like [Fragaria vesca 
subsp. vesca]
Length=267

 Score =   434 bits (1115),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 221/237 (93%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECL +LQSR+DI+YD 
Sbjct  24    TCHSSSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLLKLQSRIDIAYDS  83

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S+PEHQ ALRALW+AAFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENL++FA 
Sbjct  84    SVPEHQEALRALWSAAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLMFFAR  143

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGA FLKFLAE
Sbjct  144   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGAIFLKFLAE  203

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDL+YCITFKLMDHQWLSMRASYMDFN+VMK+TRRQLEKELL ED+ RLEDLP
Sbjct  204   NESAFDLIYCITFKLMDHQWLSMRASYMDFNTVMKSTRRQLEKELLSEDVARLEDLP  260



>ref|XP_008459793.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Cucumis 
melo]
Length=267

 Score =   433 bits (1114),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 221/237 (93%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQ+R+DI+YD 
Sbjct  24    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQNRIDIAYDS  83

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SI EHQ ALR LWN AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  84    SITEHQEALRTLWNVAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAK  143

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  144   NFPKSFQDLLRKQEGDRSLWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  203

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             N+SAFDLLYCITFKLMDH+WL+M ASYMDFN+VMKATRRQLEKELL+EDI+RLE+LP
Sbjct  204   NDSAFDLLYCITFKLMDHEWLAMHASYMDFNTVMKATRRQLEKELLIEDISRLEELP  260



>ref|XP_008459794.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Cucumis 
melo]
Length=247

 Score =   432 bits (1112),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 223/236 (94%), Gaps = 1/236 (0%)
 Frame = +1

Query  352   IDIC-AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             I IC AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQ+R+DI+YD S
Sbjct  5     IQICFAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQNRIDIAYDSS  64

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             I EHQ ALR LWN AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA N
Sbjct  65    ITEHQEALRTLWNVAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAKN  124

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAEN
Sbjct  125   FPKSFQDLLRKQEGDRSLWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAEN  184

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +SAFDLLYCITFKLMDH+WL+M ASYMDFN+VMKATRRQLEKELL+EDI+RLE+LP
Sbjct  185   DSAFDLLYCITFKLMDHEWLAMHASYMDFNTVMKATRRQLEKELLIEDISRLEELP  240



>ref|XP_011017367.1| PREDICTED: ELMO domain-containing protein C-like isoform X1 [Populus 
euphratica]
 ref|XP_011017368.1| PREDICTED: ELMO domain-containing protein C-like isoform X1 [Populus 
euphratica]
 ref|XP_011017369.1| PREDICTED: ELMO domain-containing protein C-like isoform X1 [Populus 
euphratica]
 ref|XP_011017370.1| PREDICTED: ELMO domain-containing protein C-like isoform X1 [Populus 
euphratica]
Length=267

 Score =   432 bits (1110),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 203/237 (86%), Positives = 219/237 (92%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AE VAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECLQRLQSR+D+ YD 
Sbjct  24    TCHSTSAEAVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPVQEECLQRLQSRIDVPYDS  83

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S+ +HQ AL+ALWNAAFPEEEL DLISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  84    SVLDHQEALKALWNAAFPEEELHDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  143

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLLQKREGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  144   NFPKSFQDLLQKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  203

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             N+ AFDLLYCITFKLMDH+WL+MRASYMDFN+VMK+TRRQLE+ELL EDITRLEDLP
Sbjct  204   NDLAFDLLYCITFKLMDHEWLTMRASYMDFNAVMKSTRRQLERELLSEDITRLEDLP  260



>ref|XP_006375161.1| hypothetical protein POPTR_0014s04870g [Populus trichocarpa]
 gb|ERP52958.1| hypothetical protein POPTR_0014s04870g [Populus trichocarpa]
Length=247

 Score =   431 bits (1107),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 203/238 (85%), Positives = 221/238 (93%), Gaps = 0/238 (0%)
 Frame = +1

Query  343   PNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYD  522
             P+    CAEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECLQRLQSR+D++YD
Sbjct  3     PDIQICCAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPPQEECLQRLQSRIDVAYD  62

Query  523   RSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFA  702
              S+PEHQ AL+ALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA
Sbjct  63    SSVPEHQEALKALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFA  122

Query  703   NNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLA  882
              NFP SFQDLLQKREGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFL 
Sbjct  123   RNFPTSFQDLLQKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLE  182

Query  883   ENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             E++SAFD LYCITFKLMDH+WL MRASYMDFN+VMK+TRRQLE+ELL EDITRLE+LP
Sbjct  183   EDDSAFDRLYCITFKLMDHEWLDMRASYMDFNAVMKSTRRQLERELLSEDITRLEELP  240



>ref|XP_011032422.1| PREDICTED: ELMO domain-containing protein C-like isoform X1 [Populus 
euphratica]
Length=247

 Score =   430 bits (1106),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 203/238 (85%), Positives = 221/238 (93%), Gaps = 0/238 (0%)
 Frame = +1

Query  343   PNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYD  522
             P+    CAEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECLQRLQSR+D++YD
Sbjct  3     PDIQICCAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPPQEECLQRLQSRIDVAYD  62

Query  523   RSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFA  702
              S+PEHQ AL+ALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA
Sbjct  63    SSVPEHQEALKALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFA  122

Query  703   NNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLA  882
              NFP SFQDLLQKREGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLA
Sbjct  123   RNFPTSFQDLLQKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLA  182

Query  883   ENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             E++SAFD LYCITFKLMDH+WL M ASYMDFN+VMK+TRRQLE+ELL EDITRLE+LP
Sbjct  183   EDDSAFDRLYCITFKLMDHEWLDMHASYMDFNAVMKSTRRQLERELLSEDITRLEELP  240



>gb|KDO85480.1| hypothetical protein CISIN_1g024106mg [Citrus sinensis]
Length=272

 Score =   431 bits (1108),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 223/243 (92%), Gaps = 6/243 (2%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESD RPSF+LTPAQEECLQRLQ R+D++YD 
Sbjct  23    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDPRPSFDLTPAQEECLQRLQLRIDVAYDS  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEH+ ALRALWNAAFP+EELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLLY A 
Sbjct  83    SIPEHREALRALWNAAFPDEELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYLAR  142

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEA------VKPRNLVGATF  867
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEA      VKPR +VGATF
Sbjct  143   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAACFNFTVKPRTMVGATF  202

Query  868   LKFLAENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLE  1047
             LKFL+ENESAFDLLYCITFKLMDHQWL+MRASYMDFN+VMK+TRRQLE+ELLLED+TRLE
Sbjct  203   LKFLSENESAFDLLYCITFKLMDHQWLAMRASYMDFNTVMKSTRRQLERELLLEDVTRLE  262

Query  1048  DLP  1056
             DLP
Sbjct  263   DLP  265



>ref|XP_008375781.1| PREDICTED: ELMO domain-containing protein A isoform X2 [Malus 
domestica]
Length=247

 Score =   430 bits (1106),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/237 (86%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             + ID  AEVVAGSAAWLGRGLSC+CAQ RESD RPSF+LTP QEECL RLQSR+D+SYD 
Sbjct  4     DIIDCFAEVVAGSAAWLGRGLSCVCAQRRESDPRPSFDLTPVQEECLIRLQSRIDVSYDS  63

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S+PEHQ ALRALW+AAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  64    SVPEHQEALRALWSAAFPEEELCGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  123

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             +FP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  124   SFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  183

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
              ESAFDL+YCITFKLMDHQWLSMRASYMDFN+VMKATRRQLEKELLLED+TRLE+LP
Sbjct  184   XESAFDLIYCITFKLMDHQWLSMRASYMDFNTVMKATRRQLEKELLLEDVTRLEELP  240



>ref|XP_004140510.1| PREDICTED: ELMO domain-containing protein A-like [Cucumis sativus]
 gb|KGN46512.1| hypothetical protein Csa_6G105170 [Cucumis sativus]
Length=267

 Score =   431 bits (1107),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 203/237 (86%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECL RLQ+R+DI+YD 
Sbjct  24    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLLRLQNRIDIAYDS  83

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SI EHQ ALR LWN AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  84    SITEHQEALRTLWNVAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAK  143

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  144   NFPKSFQDLLRKQEGDRSLWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  203

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             N+SAFDLLYCITFKLMDH+WL+M ASYMDFN+VMKATRRQLEKELL+EDI+RLE+LP
Sbjct  204   NDSAFDLLYCITFKLMDHEWLAMHASYMDFNTVMKATRRQLEKELLIEDISRLEELP  260



>ref|XP_008375779.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Malus 
domestica]
 ref|XP_008375780.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Malus 
domestica]
Length=271

 Score =   431 bits (1108),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESD RPSF+LTP QEECL RLQSR+D+SYD 
Sbjct  28    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDPRPSFDLTPVQEECLIRLQSRIDVSYDS  87

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S+PEHQ ALRALW+AAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  88    SVPEHQEALRALWSAAFPEEELCGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  147

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             +FP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  148   SFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  207

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
              ESAFDL+YCITFKLMDHQWLSMRASYMDFN+VMKATRRQLEKELLLED+TRLE+LP
Sbjct  208   XESAFDLIYCITFKLMDHQWLSMRASYMDFNTVMKATRRQLEKELLLEDVTRLEELP  264



>ref|XP_006375162.1| hypothetical protein POPTR_0014s04870g [Populus trichocarpa]
 ref|XP_006375165.1| phagocytosis and cell motility protein ELMO1 [Populus trichocarpa]
 ref|XP_006375166.1| hypothetical protein POPTR_0014s04870g [Populus trichocarpa]
 gb|ERP52959.1| hypothetical protein POPTR_0014s04870g [Populus trichocarpa]
 gb|ERP52962.1| phagocytosis and cell motility protein ELMO1 [Populus trichocarpa]
 gb|ERP52963.1| hypothetical protein POPTR_0014s04870g [Populus trichocarpa]
Length=267

 Score =   429 bits (1104),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 219/237 (92%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECLQRLQSR+D++YD 
Sbjct  24    TCHSSSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPPQEECLQRLQSRIDVAYDS  83

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S+PEHQ AL+ALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  84    SVPEHQEALKALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  143

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLLQKREGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFL E
Sbjct  144   NFPTSFQDLLQKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLEE  203

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ++SAFD LYCITFKLMDH+WL MRASYMDFN+VMK+TRRQLE+ELL EDITRLE+LP
Sbjct  204   DDSAFDRLYCITFKLMDHEWLDMRASYMDFNAVMKSTRRQLERELLSEDITRLEELP  260



>gb|KDO85476.1| hypothetical protein CISIN_1g024106mg [Citrus sinensis]
Length=261

 Score =   427 bits (1099),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
              +GSAAWLGRGLSC+CAQ RESD RPSF+LTPAQEECLQRLQ R+D++YD SIPEH+ AL
Sbjct  27    TSGSAAWLGRGLSCVCAQRRESDPRPSFDLTPAQEECLQRLQLRIDVAYDSSIPEHREAL  86

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALWNAAFP+EELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLLY A NFP SFQDL
Sbjct  87    RALWNAAFPDEELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYLARNFPKSFQDL  146

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR +VGATFLKFL+ENESAFDLLY
Sbjct  147   LRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTMVGATFLKFLSENESAFDLLY  206

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             CITFKLMDHQWL+MRASYMDFN+VMK+TRRQLE+ELLLED+TRLEDLP
Sbjct  207   CITFKLMDHQWLAMRASYMDFNTVMKSTRRQLERELLLEDVTRLEDLP  254



>emb|CBI16679.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   428 bits (1101),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 203/241 (84%), Positives = 226/241 (94%), Gaps = 1/241 (0%)
 Frame = +1

Query  337   FMPNCIDIC-AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDI  513
             FM   I IC AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQSR+++
Sbjct  40    FMFTDIQICLAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQSRIEV  99

Query  514   SYDRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLL  693
             SYD SI EHQ ALRALWNA+FPEEELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLL
Sbjct  100   SYDSSISEHQEALRALWNASFPEEELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLL  159

Query  694   YFANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLK  873
             +FA N+P SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEAVKPR++ GA FLK
Sbjct  160   FFARNYPKSFQDLLRKQEGDRALWEYPFAVAGVNITFMLIQMLDLEAVKPRSMAGAIFLK  219

Query  874   FLAENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDL  1053
             FL+ENESAFDLLYCITFKLMD+QWL+M ASYMDFN+VMK+TR QLE+ELLLED++RLEDL
Sbjct  220   FLSENESAFDLLYCITFKLMDNQWLAMHASYMDFNTVMKSTRCQLERELLLEDVSRLEDL  279

Query  1054  P  1056
             P
Sbjct  280   P  280



>gb|KDO85477.1| hypothetical protein CISIN_1g024106mg [Citrus sinensis]
Length=262

 Score =   427 bits (1097),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 220/237 (93%), Gaps = 4/237 (2%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESD RPSF+LTPAQEECLQRLQ R+D++YD 
Sbjct  23    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDPRPSFDLTPAQEECLQRLQLRIDVAYDS  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEH+ ALRALWNAAFP+EELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLLY A 
Sbjct  83    SIPEHREALRALWNAAFPDEELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYLAR  142

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP    DLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR +VGATFLKFL+E
Sbjct  143   NFP----DLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTMVGATFLKFLSE  198

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMDHQWL+MRASYMDFN+VMK+TRRQLE+ELLLED+TRLEDLP
Sbjct  199   NESAFDLLYCITFKLMDHQWLAMRASYMDFNTVMKSTRRQLERELLLEDVTRLEDLP  255



>ref|XP_003534475.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Glycine 
max]
Length=266

 Score =   427 bits (1097),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 217/237 (92%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AE V GS AWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQSR+DI YD 
Sbjct  23    TCHSSSAEFVTGSTAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQSRIDIPYDG  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S+PEHQ ALR LWNAAFPEEEL  LISEQWK+MGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  83    SVPEHQDALRDLWNAAFPEEELHGLISEQWKDMGWQGKDPSTDFRGGGFISLENLLFFAR  142

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  143   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  202

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             N+SAFDLLYCITFK+MD QWLSMRASYMDFN+VMK+TRRQLEKELLLEDI RLED+P
Sbjct  203   NDSAFDLLYCITFKMMDQQWLSMRASYMDFNTVMKSTRRQLEKELLLEDIMRLEDVP  259



>ref|XP_011101856.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011101857.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Sesamum 
indicum]
Length=268

 Score =   426 bits (1096),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C     EVVAGSAAWLGRGLSC+CAQ R+SDARPSF+LT AQEECLQRLQ+R+DI+YD S
Sbjct  26    CHSTSVEVVAGSAAWLGRGLSCVCAQRRDSDARPSFDLTAAQEECLQRLQNRIDIAYDSS  85

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             +PEHQ ALRALW+ AFP EELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA N
Sbjct  86    VPEHQEALRALWHVAFPGEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARN  145

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFL EN
Sbjct  146   FPKSFQDLLRKKEGDRALWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLTEN  205

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCI FKLMDHQWL+M ASYMDFN+VMKATRRQLE+ELL ED+ RLEDLP
Sbjct  206   ESAFDLLYCIAFKLMDHQWLAMHASYMDFNTVMKATRRQLERELLQEDVARLEDLP  261



>ref|XP_002271650.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Vitis 
vinifera]
Length=267

 Score =   426 bits (1095),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQSR+++SYD 
Sbjct  24    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQSRIEVSYDS  83

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SI EHQ ALRALWNA+FPEEELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  84    SISEHQEALRALWNASFPEEELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  143

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             N+P SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEAVKPR++ GA FLKFL+E
Sbjct  144   NYPKSFQDLLRKQEGDRALWEYPFAVAGVNITFMLIQMLDLEAVKPRSMAGAIFLKFLSE  203

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMD+QWL+M ASYMDFN+VMK+TR QLE+ELLLED++RLEDLP
Sbjct  204   NESAFDLLYCITFKLMDNQWLAMHASYMDFNTVMKSTRCQLERELLLEDVSRLEDLP  260



>ref|XP_010661410.1| PREDICTED: ELMO domain-containing protein A isoform X3 [Vitis 
vinifera]
Length=247

 Score =   425 bits (1093),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 224/236 (95%), Gaps = 1/236 (0%)
 Frame = +1

Query  352   IDIC-AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             I IC AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQSR+++SYD S
Sbjct  5     IQICLAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQSRIEVSYDSS  64

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             I EHQ ALRALWNA+FPEEELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA N
Sbjct  65    ISEHQEALRALWNASFPEEELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARN  124

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             +P SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEAVKPR++ GA FLKFL+EN
Sbjct  125   YPKSFQDLLRKQEGDRALWEYPFAVAGVNITFMLIQMLDLEAVKPRSMAGAIFLKFLSEN  184

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCITFKLMD+QWL+M ASYMDFN+VMK+TR QLE+ELLLED++RLEDLP
Sbjct  185   ESAFDLLYCITFKLMDNQWLAMHASYMDFNTVMKSTRCQLERELLLEDVSRLEDLP  240



>ref|XP_004229736.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Solanum 
lycopersicum]
Length=266

 Score =   426 bits (1095),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 220/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C    AEVVAGSAAWLGRGLSC+C Q RESDARPSF+LTP+QEECL RLQ+R+D++YD  
Sbjct  24    CHTTSAEVVAGSAAWLGRGLSCVCVQRRESDARPSFDLTPSQEECLLRLQNRIDVAYDSL  83

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             IPEHQ AL+ALW  AFPEE+LR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA N
Sbjct  84    IPEHQEALKALWKVAFPEEQLRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARN  143

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPRNLVGATFLKFLAEN
Sbjct  144   FPRSFQDLLRKQEGDRAIWEYPFAVAGVNITFMLIQMLDLEALKPRNLVGATFLKFLAEN  203

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCITFKLMD+QWL+MRASYMDFN+VMKATRRQLE+ELL EDITRLEDLP
Sbjct  204   ESAFDLLYCITFKLMDNQWLAMRASYMDFNAVMKATRRQLEEELLQEDITRLEDLP  259



>ref|XP_003552489.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Glycine 
max]
 gb|KHN40538.1| ELMO domain-containing protein A [Glycine soja]
Length=266

 Score =   426 bits (1094),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 217/237 (92%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AE V GS AWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQ+R+DI YD 
Sbjct  23    TCHSSSAEFVTGSTAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQNRIDIPYDG  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEHQ ALRALW+AAFPEEEL  LISEQWK MGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  83    SIPEHQDALRALWSAAFPEEELHGLISEQWKNMGWQGKDPSTDFRGGGFISLENLLFFAR  142

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  143   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  202

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             N+SAFDLLYCITFK+MD QWLSMRASYMDFN+VMK+TRRQLEKELLLEDI RLED+P
Sbjct  203   NDSAFDLLYCITFKMMDQQWLSMRASYMDFNTVMKSTRRQLEKELLLEDIMRLEDVP  259



>gb|KHN11554.1| ELMO domain-containing protein A [Glycine soja]
Length=266

 Score =   425 bits (1093),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 201/237 (85%), Positives = 217/237 (92%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AE V GS AWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQ+R+DI YD 
Sbjct  23    TCHSSSAEFVTGSTAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQNRIDIPYDG  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S+PEHQ ALR LWNAAFPEEEL  LISEQWK+MGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  83    SVPEHQDALRDLWNAAFPEEELHGLISEQWKDMGWQGKDPSTDFRGGGFISLENLLFFAR  142

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  143   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  202

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             N+SAFDLLYCITFK+MD QWLSMRASYMDFN+VMK+TRRQLEKELLLEDI RLED+P
Sbjct  203   NDSAFDLLYCITFKMMDQQWLSMRASYMDFNTVMKSTRRQLEKELLLEDIMRLEDVP  259



>ref|XP_008232537.1| PREDICTED: ELMO domain-containing protein A isoform X2 [Prunus 
mume]
Length=265

 Score =   425 bits (1093),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 217/237 (92%), Gaps = 4/237 (2%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECL RLQSR+D+ YD 
Sbjct  26    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPVQEECLLRLQSRIDVPYDS  85

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
              +PEHQ ALRALWNAAFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  86    LVPEHQEALRALWNAAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  145

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP    DLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  146   NFP----DLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  201

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDL+YCITFKLMDHQWLSMRASYMDFN+VMK+TRRQLEKELL EDITRLEDLP
Sbjct  202   NESAFDLIYCITFKLMDHQWLSMRASYMDFNTVMKSTRRQLEKELLFEDITRLEDLP  258



>ref|XP_007139653.1| hypothetical protein PHAVU_008G048000g [Phaseolus vulgaris]
 gb|ESW11647.1| hypothetical protein PHAVU_008G048000g [Phaseolus vulgaris]
Length=266

 Score =   425 bits (1092),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 216/237 (91%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AE V GS AWLGRGLSC+C Q RESDARPSF+LTPAQEECL RLQSR+DI YD 
Sbjct  23    TCHSNSAEFVTGSTAWLGRGLSCVCVQRRESDARPSFDLTPAQEECLLRLQSRIDIPYDS  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
              IPEHQ ALRALWNAAFPEEEL  LISEQWK+MGWQGKDP+TDFRGGGFISLENLL+FA+
Sbjct  83    CIPEHQDALRALWNAAFPEEELHGLISEQWKDMGWQGKDPSTDFRGGGFISLENLLFFAH  142

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  143   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  202

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFK+MD QWLSMRASYMDFN+VMK+TRRQLEKELLLEDI RLED+P
Sbjct  203   NESAFDLLYCITFKMMDQQWLSMRASYMDFNTVMKSTRRQLEKELLLEDIMRLEDIP  259



>ref|XP_002301236.2| phagocytosis and cell motility protein ELMO1 [Populus trichocarpa]
 ref|XP_006386545.1| hypothetical protein POPTR_0002s13960g [Populus trichocarpa]
 gb|EEE80509.2| phagocytosis and cell motility protein ELMO1 [Populus trichocarpa]
 gb|ERP64342.1| hypothetical protein POPTR_0002s13960g [Populus trichocarpa]
Length=266

 Score =   425 bits (1092),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 218/237 (92%), Gaps = 1/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AE VAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECLQRLQSR+D+ YD 
Sbjct  24    TCHSTSAEAVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPVQEECLQRLQSRIDVPYDS  83

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S+ +HQ AL+ LWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  84    SVLDHQEALKTLWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  143

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLLQKREGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  144   NFP-SFQDLLQKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRALVGATFLKFLAE  202

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             N+SAFDLLYCITFKLMDH+WL+MRASYMDFN+VMK+TRRQLE+ELL EDITRLEDLP
Sbjct  203   NDSAFDLLYCITFKLMDHEWLTMRASYMDFNAVMKSTRRQLERELLSEDITRLEDLP  259



>ref|XP_010052792.1| PREDICTED: LOW QUALITY PROTEIN: ELMO domain-containing protein 
A [Eucalyptus grandis]
Length=271

 Score =   424 bits (1091),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 202/238 (85%), Positives = 222/238 (93%), Gaps = 5/238 (2%)
 Frame = +1

Query  358   ICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPE  537
             + AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEE LQRLQSR+D++YD SI E
Sbjct  27    VTAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEESLQRLQSRIDVAYDSSILE  86

Query  538   HQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPN  717
             HQ ALRALW+AAFPEEEL  LI+EQWKEMGWQGKDP+TDFRGGGFISLENLL+FA NFP 
Sbjct  87    HQEALRALWHAAFPEEELHGLITEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARNFPK  146

Query  718   SFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESA  897
             SFQDLL+K+EGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFL+ENESA
Sbjct  147   SFQDLLRKQEGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLSENESA  206

Query  898   FDLLYCITFKLMDHQW-----LSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             FDLLYCITFKLMD+QW     L+MRASYMDFN+VMK+TRRQ+E+ELLLED+TRLEDLP
Sbjct  207   FDLLYCITFKLMDNQWLAMRALAMRASYMDFNAVMKSTRRQMERELLLEDVTRLEDLP  264



>ref|XP_009603915.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Nicotiana 
tomentosiformis]
Length=279

 Score =   424 bits (1089),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 219/240 (91%), Gaps = 1/240 (0%)
 Frame = +1

Query  337   FMPNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDIS  516
              M   IDIC EVVAGSAAWLGRGLSC+CAQ R+ DARPSF+LTP QEECL RLQ+R+D++
Sbjct  34    LMRANIDIC-EVVAGSAAWLGRGLSCVCAQTRDIDARPSFDLTPVQEECLLRLQNRIDVA  92

Query  517   YDRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLY  696
             YD SIPEHQ ALRALW AAFPEEEL  L+SEQWKEMGWQGKDP+TDFRG GFISLENLLY
Sbjct  93    YDSSIPEHQEALRALWKAAFPEEELHGLVSEQWKEMGWQGKDPSTDFRGAGFISLENLLY  152

Query  697   FANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKF  876
             F  NFP SFQDLLQK+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPRNLVGATFLKF
Sbjct  153   FVRNFPKSFQDLLQKQEGDRALWEYPFAVAGVNITFMLIQMLDLEAIKPRNLVGATFLKF  212

Query  877   LAENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LAENESAFDLLYCITFKLMD+QWL+M ASYMDFN+VMK+TRRQ+E+ELL EDI RLEDLP
Sbjct  213   LAENESAFDLLYCITFKLMDNQWLAMHASYMDFNTVMKSTRRQIERELLQEDIIRLEDLP  272



>ref|XP_010540214.1| PREDICTED: ELMO domain-containing protein A-like isoform X3 [Tarenaya 
hassleriana]
Length=265

 Score =   423 bits (1088),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/237 (84%), Positives = 215/237 (91%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGS AWLGRGLSC+CAQ RE ++RPSF+ TPAQEECLQRLQSR+D+ YD 
Sbjct  22    TCHFSSAEVVAGSTAWLGRGLSCVCAQRREHESRPSFDFTPAQEECLQRLQSRVDVPYDG  81

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIP+HQ ALRALW  AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGF+SLENLLYFA 
Sbjct  82    SIPQHQEALRALWKLAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFVSLENLLYFAR  141

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLLQK+ GDRS+WEYPFAVAGVNITFM+IQMLDLEAVKPR +VGATFLK LAE
Sbjct  142   NFPKSFQDLLQKQVGDRSVWEYPFAVAGVNITFMVIQMLDLEAVKPRTMVGATFLKLLAE  201

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCI FKLMDHQWL+ RASYMDFN+VMK+TRRQLEKELLLED+TRLEDLP
Sbjct  202   NESAFDLLYCIAFKLMDHQWLTKRASYMDFNTVMKSTRRQLEKELLLEDVTRLEDLP  258



>ref|XP_010325248.1| PREDICTED: ELMO domain-containing protein A isoform X2 [Solanum 
lycopersicum]
Length=250

 Score =   422 bits (1086),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/237 (85%), Positives = 222/237 (94%), Gaps = 2/237 (1%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             NC+   +EVVAGSAAWLGRGLSC+C Q RESDARPSF+LTP+QEECL RLQ+R+D++YD 
Sbjct  9     NCLG--SEVVAGSAAWLGRGLSCVCVQRRESDARPSFDLTPSQEECLLRLQNRIDVAYDS  66

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
              IPEHQ AL+ALW  AFPEE+LR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA 
Sbjct  67    LIPEHQEALKALWKVAFPEEQLRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFAR  126

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPRNLVGATFLKFLAE
Sbjct  127   NFPRSFQDLLRKQEGDRAIWEYPFAVAGVNITFMLIQMLDLEALKPRNLVGATFLKFLAE  186

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMD+QWL+MRASYMDFN+VMKATRRQLE+ELL EDITRLEDLP
Sbjct  187   NESAFDLLYCITFKLMDNQWLAMRASYMDFNAVMKATRRQLEEELLQEDITRLEDLP  243



>ref|XP_006347983.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Solanum 
tuberosum]
Length=266

 Score =   422 bits (1086),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 200/236 (85%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C    AEVVAGSAAWLGRGLSC+C Q RESDARPSF+LTP+QEECL RLQ+R+D++YD  
Sbjct  24    CHTTSAEVVAGSAAWLGRGLSCVCVQRRESDARPSFDLTPSQEECLLRLQNRIDVAYDSL  83

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             I EHQ AL+ALW  AFPEE+LR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA N
Sbjct  84    ILEHQEALKALWKVAFPEEQLRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARN  143

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPRNLVGATFLKFLAEN
Sbjct  144   FPKSFQDLLRKQEGDRAIWEYPFAVAGVNITFMLIQMLDLEALKPRNLVGATFLKFLAEN  203

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCITFKLMD+QWL+MRASYMDFN+VMKATRRQLE+ELL EDITRLEDLP
Sbjct  204   ESAFDLLYCITFKLMDNQWLAMRASYMDFNAVMKATRRQLEEELLQEDITRLEDLP  259



>ref|XP_009603976.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Nicotiana 
tomentosiformis]
Length=268

 Score =   422 bits (1085),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/237 (83%), Positives = 216/237 (91%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    +EVVAGSAAWLGRGLSC+CAQ R+ DARPSF+LTP QEECL RLQ+R+D++YD 
Sbjct  25    TCHSTSSEVVAGSAAWLGRGLSCVCAQTRDIDARPSFDLTPVQEECLLRLQNRIDVAYDS  84

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEHQ ALRALW AAFPEEEL  L+SEQWKEMGWQGKDP+TDFRG GFISLENLLYF  
Sbjct  85    SIPEHQEALRALWKAAFPEEELHGLVSEQWKEMGWQGKDPSTDFRGAGFISLENLLYFVR  144

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLLQK+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPRNLVGATFLKFLAE
Sbjct  145   NFPKSFQDLLQKQEGDRALWEYPFAVAGVNITFMLIQMLDLEAIKPRNLVGATFLKFLAE  204

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMD+QWL+M ASYMDFN+VMK+TRRQ+E+ELL EDI RLEDLP
Sbjct  205   NESAFDLLYCITFKLMDNQWLAMHASYMDFNTVMKSTRRQIERELLQEDIIRLEDLP  261



>emb|CDP09425.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   422 bits (1084),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 202/231 (87%), Positives = 215/231 (93%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQ+R+D+ YD S  EHQ
Sbjct  30    AEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQNRIDVPYDSSNVEHQ  89

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALRALW AAFP E+L  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NFP SF
Sbjct  90    EALRALWYAAFPGEQLHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFPKSF  149

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+EGDR+MWEYPFAVAGVNITFMLIQMLDLEAVKPRN VGATFLKFLAENESAFD
Sbjct  150   QDLLRKQEGDRAMWEYPFAVAGVNITFMLIQMLDLEAVKPRNFVGATFLKFLAENESAFD  209

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCITFKLMD+QWL+M ASYMDFN+VMKATRRQLE ELL EDITRLEDLP
Sbjct  210   LLYCITFKLMDNQWLTMHASYMDFNTVMKATRRQLENELLQEDITRLEDLP  260



>ref|XP_009758299.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Nicotiana 
sylvestris]
Length=279

 Score =   422 bits (1085),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 218/240 (91%), Gaps = 1/240 (0%)
 Frame = +1

Query  337   FMPNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDIS  516
              M   ID+C EVVAGSAAWLGRGLSC+CAQ R+ D RPSF+LTP QEECL RLQ+R+D++
Sbjct  34    LMRANIDVC-EVVAGSAAWLGRGLSCVCAQTRDIDTRPSFDLTPVQEECLLRLQNRIDVA  92

Query  517   YDRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLY  696
             YD SIPEHQ ALRALW AAFPEEEL  L+SEQWKEMGWQGKDP+TDFRG GFISLENLLY
Sbjct  93    YDSSIPEHQEALRALWKAAFPEEELHGLVSEQWKEMGWQGKDPSTDFRGAGFISLENLLY  152

Query  697   FANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKF  876
             F  NFP SFQDLLQK+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPR LVGATFLKF
Sbjct  153   FVRNFPKSFQDLLQKQEGDRALWEYPFAVAGVNITFMLIQMLDLEAIKPRTLVGATFLKF  212

Query  877   LAENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LAENESAFDLLYCITFKLMD+QWL+M ASYMDFN+VMK+TRRQ+E+ELL EDITRLEDLP
Sbjct  213   LAENESAFDLLYCITFKLMDNQWLAMHASYMDFNTVMKSTRRQIERELLQEDITRLEDLP  272



>ref|XP_009758300.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Nicotiana 
sylvestris]
Length=268

 Score =   421 bits (1082),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 195/237 (82%), Positives = 215/237 (91%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    +EVVAGSAAWLGRGLSC+CAQ R+ D RPSF+LTP QEECL RLQ+R+D++YD 
Sbjct  25    TCHSTSSEVVAGSAAWLGRGLSCVCAQTRDIDTRPSFDLTPVQEECLLRLQNRIDVAYDS  84

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEHQ ALRALW AAFPEEEL  L+SEQWKEMGWQGKDP+TDFRG GFISLENLLYF  
Sbjct  85    SIPEHQEALRALWKAAFPEEELHGLVSEQWKEMGWQGKDPSTDFRGAGFISLENLLYFVR  144

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLLQK+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPR LVGATFLKFLAE
Sbjct  145   NFPKSFQDLLQKQEGDRALWEYPFAVAGVNITFMLIQMLDLEAIKPRTLVGATFLKFLAE  204

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMD+QWL+M ASYMDFN+VMK+TRRQ+E+ELL EDITRLEDLP
Sbjct  205   NESAFDLLYCITFKLMDNQWLAMHASYMDFNTVMKSTRRQIERELLQEDITRLEDLP  261



>ref|XP_006375167.1| hypothetical protein POPTR_0014s04870g [Populus trichocarpa]
 gb|ERP52964.1| hypothetical protein POPTR_0014s04870g [Populus trichocarpa]
Length=262

 Score =   419 bits (1078),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 196/227 (86%), Positives = 214/227 (94%), Gaps = 0/227 (0%)
 Frame = +1

Query  376   AGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALR  555
             +GSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECLQRLQSR+D++YD S+PEHQ AL+
Sbjct  29    SGSAAWLGRGLSCVCAQRRESDARPSFDLTPPQEECLQRLQSRIDVAYDSSVPEHQEALK  88

Query  556   ALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLL  735
             ALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA NFP SFQDLL
Sbjct  89    ALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARNFPTSFQDLL  148

Query  736   QKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYC  915
             QKREGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFL E++SAFD LYC
Sbjct  149   QKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLEEDDSAFDRLYC  208

Query  916   ITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ITFKLMDH+WL MRASYMDFN+VMK+TRRQLE+ELL EDITRLE+LP
Sbjct  209   ITFKLMDHEWLDMRASYMDFNAVMKSTRRQLERELLSEDITRLEELP  255



>ref|XP_010692034.1| PREDICTED: ELMO domain-containing protein C [Beta vulgaris subsp. 
vulgaris]
Length=265

 Score =   419 bits (1078),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 196/237 (83%), Positives = 217/237 (92%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             +C    AEVVAGS AWLG+GLSC+CAQ R+SDARPSF+LTP+QEECLQRLQSR+D+ YD 
Sbjct  22    SCHSNSAEVVAGSTAWLGKGLSCVCAQRRDSDARPSFDLTPSQEECLQRLQSRIDVGYDS  81

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S PEHQ AL+ALWNAAFP EELRDL+SEQWKEMGWQGKDP+TDFRGGG+ISLENLL+FA 
Sbjct  82    SNPEHQEALKALWNAAFPGEELRDLVSEQWKEMGWQGKDPSTDFRGGGYISLENLLFFAR  141

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NF  SFQDLL+K+EG+R+MWEYPFAVAGVNITFMLIQMLDLEAVKPR LVGA FLKFLAE
Sbjct  142   NFQKSFQDLLRKQEGERAMWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGAIFLKFLAE  201

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKL+DH WL M ASYMDFNSVMKATRRQLE+E++LEDI RLEDLP
Sbjct  202   NESAFDLLYCITFKLLDHIWLEMHASYMDFNSVMKATRRQLEREMMLEDIVRLEDLP  258



>ref|XP_007134408.1| hypothetical protein PHAVU_010G045300g [Phaseolus vulgaris]
 gb|ESW06402.1| hypothetical protein PHAVU_010G045300g [Phaseolus vulgaris]
Length=245

 Score =   418 bits (1075),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 198/233 (85%), Positives = 214/233 (92%), Gaps = 0/233 (0%)
 Frame = +1

Query  358   ICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPE  537
             + AEVVAGSAAWLGRGLSC+C Q  +SDA  SF+LT AQEECL +LQ R+D+ YD SI E
Sbjct  6     VAAEVVAGSAAWLGRGLSCVCVQRTDSDASNSFDLTLAQEECLHKLQRRIDVPYDSSIIE  65

Query  538   HQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPN  717
             HQ ALRALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLEN LYFA NFP 
Sbjct  66    HQDALRALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLYFARNFPK  125

Query  718   SFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESA  897
             SFQDLL+K+EGDRS+WEYPFAVAGVNIT+MLIQ+LDLEAVKPRNLVGATFLKFLAENESA
Sbjct  126   SFQDLLRKQEGDRSVWEYPFAVAGVNITYMLIQLLDLEAVKPRNLVGATFLKFLAENESA  185

Query  898   FDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             FDLLYCITFKLMDHQWLSMRASYMDFN+VMKATRRQLEKE+L EDI+RLEDLP
Sbjct  186   FDLLYCITFKLMDHQWLSMRASYMDFNAVMKATRRQLEKEILFEDISRLEDLP  238



>ref|XP_011102321.1| PREDICTED: ELMO domain-containing protein A-like, partial [Sesamum 
indicum]
Length=257

 Score =   417 bits (1073),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 195/232 (84%), Positives = 212/232 (91%), Gaps = 0/232 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C     EVVAGSAAWLGRGLSC+CAQ R+SDARPSF+LT AQEECLQRLQ+R+DI+YD S
Sbjct  26    CHSTSVEVVAGSAAWLGRGLSCVCAQRRDSDARPSFDLTAAQEECLQRLQNRIDIAYDSS  85

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             +PEHQ ALRALW+ AFP EELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA N
Sbjct  86    VPEHQEALRALWHVAFPGEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARN  145

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFL EN
Sbjct  146   FPKSFQDLLRKKEGDRALWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLTEN  205

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRL  1044
             ESAFDLLYCI FKLMDHQWL+M ASYMDFN+VMKATRRQLE+ELL ED+ RL
Sbjct  206   ESAFDLLYCIAFKLMDHQWLAMHASYMDFNTVMKATRRQLERELLQEDVARL  257



>ref|XP_011101858.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Sesamum 
indicum]
Length=263

 Score =   417 bits (1072),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
              +GSAAWLGRGLSC+CAQ R+SDARPSF+LT AQEECLQRLQ+R+DI+YD S+PEHQ AL
Sbjct  29    TSGSAAWLGRGLSCVCAQRRDSDARPSFDLTAAQEECLQRLQNRIDIAYDSSVPEHQEAL  88

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+ AFP EELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NFP SFQDL
Sbjct  89    RALWHVAFPGEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFPKSFQDL  148

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFL ENESAFDLLY
Sbjct  149   LRKKEGDRALWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLTENESAFDLLY  208

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             CI FKLMDHQWL+M ASYMDFN+VMKATRRQLE+ELL ED+ RLEDLP
Sbjct  209   CIAFKLMDHQWLAMHASYMDFNTVMKATRRQLERELLQEDVARLEDLP  256



>ref|XP_010540212.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Tarenaya 
hassleriana]
Length=271

 Score =   417 bits (1072),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 198/243 (81%), Positives = 215/243 (88%), Gaps = 6/243 (2%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGS AWLGRGLSC+CAQ RE ++RPSF+ TPAQEECLQRLQSR+D+ YD 
Sbjct  22    TCHFSSAEVVAGSTAWLGRGLSCVCAQRREHESRPSFDFTPAQEECLQRLQSRVDVPYDG  81

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIP+HQ ALRALW  AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGF+SLENLLYFA 
Sbjct  82    SIPQHQEALRALWKLAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFVSLENLLYFAR  141

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLLQK+ GDRS+WEYPFAVAGVNITFM+IQMLDLEAVKPR +VGATFLK LAE
Sbjct  142   NFPKSFQDLLQKQVGDRSVWEYPFAVAGVNITFMVIQMLDLEAVKPRTMVGATFLKLLAE  201

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFN------SVMKATRRQLEKELLLEDITRLE  1047
             NESAFDLLYCI FKLMDHQWL+ RASYMDFN      +VMK+TRRQLEKELLLED+TRLE
Sbjct  202   NESAFDLLYCIAFKLMDHQWLTKRASYMDFNVRHLHLTVMKSTRRQLEKELLLEDVTRLE  261

Query  1048  DLP  1056
             DLP
Sbjct  262   DLP  264



>ref|XP_010258740.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010258741.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010258742.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010258743.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010258744.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Nelumbo 
nucifera]
Length=265

 Score =   417 bits (1071),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C    AEVVAGSAAWLGRGLSC+CAQ R+SD RPSF+LTPAQEECLQRLQSR+D++YD S
Sbjct  24    CHSTSAEVVAGSAAWLGRGLSCVCAQRRDSDTRPSFDLTPAQEECLQRLQSRIDVAYDSS  83

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
              PEHQ ALR+LWNA+FP EEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA N
Sbjct  84    NPEHQEALRSLWNASFPGEELCGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARN  143

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             +P SFQDLL+K+EGDR+MWEYPFAVAGVNITFMLIQMLDL+AVKPR ++GA FLK L EN
Sbjct  144   YPKSFQDLLRKQEGDRAMWEYPFAVAGVNITFMLIQMLDLQAVKPRTVLGAIFLKLLVEN  203

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCITFKLMD QWL+MRASYMDFN+VMK+TRRQLE+E LLEDITRLED+P
Sbjct  204   ESAFDLLYCITFKLMDQQWLAMRASYMDFNTVMKSTRRQLEREFLLEDITRLEDMP  259



>ref|XP_007134407.1| hypothetical protein PHAVU_010G045300g [Phaseolus vulgaris]
 gb|ESW06401.1| hypothetical protein PHAVU_010G045300g [Phaseolus vulgaris]
Length=239

 Score =   416 bits (1068),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 197/231 (85%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             +EVVAGSAAWLGRGLSC+C Q  +SDA  SF+LT AQEECL +LQ R+D+ YD SI EHQ
Sbjct  2     SEVVAGSAAWLGRGLSCVCVQRTDSDASNSFDLTLAQEECLHKLQRRIDVPYDSSIIEHQ  61

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALRALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLEN LYFA NFP SF
Sbjct  62    DALRALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLYFARNFPKSF  121

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+EGDRS+WEYPFAVAGVNIT+MLIQ+LDLEAVKPRNLVGATFLKFLAENESAFD
Sbjct  122   QDLLRKQEGDRSVWEYPFAVAGVNITYMLIQLLDLEAVKPRNLVGATFLKFLAENESAFD  181

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCITFKLMDHQWLSMRASYMDFN+VMKATRRQLEKE+L EDI+RLEDLP
Sbjct  182   LLYCITFKLMDHQWLSMRASYMDFNAVMKATRRQLEKEILFEDISRLEDLP  232



>ref|XP_003529029.1| PREDICTED: ELMO domain-containing protein A-like isoform 2 [Glycine 
max]
Length=247

 Score =   415 bits (1067),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 215/237 (91%), Gaps = 3/237 (1%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             NCI   AEVV GSAAWLGRGLSC+C Q R+SDA  +F+LT AQEECLQR+Q R+D+ YD 
Sbjct  7     NCI---AEVVVGSAAWLGRGLSCVCVQRRDSDASNTFDLTLAQEECLQRIQRRIDVPYDS  63

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SI EHQ ALRALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLEN L+FA 
Sbjct  64    SIIEHQDALRALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLFFAR  123

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNIT+MLIQMLDLEAVKPRNLVGATFLKFLAE
Sbjct  124   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITYMLIQMLDLEAVKPRNLVGATFLKFLAE  183

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMDHQWLSM ASYMDFN+VMK TRRQLEKELL+EDI +LEDLP
Sbjct  184   NESAFDLLYCITFKLMDHQWLSMHASYMDFNAVMKETRRQLEKELLVEDIAQLEDLP  240



>ref|XP_003529028.1| PREDICTED: ELMO domain-containing protein A-like isoform 1 [Glycine 
max]
 gb|KHN31821.1| ELMO domain-containing protein A [Glycine soja]
Length=262

 Score =   415 bits (1066),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 197/237 (83%), Positives = 213/237 (90%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVV GSAAWLGRGLSC+C Q R+SDA  +F+LT AQEECLQR+Q R+D+ YD 
Sbjct  19    TCHSNSAEVVVGSAAWLGRGLSCVCVQRRDSDASNTFDLTLAQEECLQRIQRRIDVPYDS  78

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SI EHQ ALRALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLEN L+FA 
Sbjct  79    SIIEHQDALRALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLFFAR  138

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNIT+MLIQMLDLEAVKPRNLVGATFLKFLAE
Sbjct  139   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITYMLIQMLDLEAVKPRNLVGATFLKFLAE  198

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMDHQWLSM ASYMDFN+VMK TRRQLEKELL+EDI +LEDLP
Sbjct  199   NESAFDLLYCITFKLMDHQWLSMHASYMDFNAVMKETRRQLEKELLVEDIAQLEDLP  255



>ref|XP_006602864.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Glycine 
max]
Length=283

 Score =   414 bits (1065),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 202/254 (80%), Positives = 217/254 (85%), Gaps = 17/254 (7%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AE V GS AWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQ+R+DI YD 
Sbjct  23    TCHSSSAEFVTGSTAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQNRIDIPYDG  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SIPEHQ ALRALW+AAFPEEEL  LISEQWK MGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  83    SIPEHQDALRALWSAAFPEEELHGLISEQWKNMGWQGKDPSTDFRGGGFISLENLLFFAR  142

Query  706   NFP-----------------NSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEA  834
             NFP                  SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEA
Sbjct  143   NFPVLPDTFFAFLLDPNSPRKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEA  202

Query  835   VKPRNLVGATFLKFLAENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEK  1014
             VKPR LVGATFLKFLAEN+SAFDLLYCITFK+MD QWLSMRASYMDFN+VMK+TRRQLEK
Sbjct  203   VKPRTLVGATFLKFLAENDSAFDLLYCITFKMMDQQWLSMRASYMDFNTVMKSTRRQLEK  262

Query  1015  ELLLEDITRLEDLP  1056
             ELLLEDI RLED+P
Sbjct  263   ELLLEDIMRLEDVP  276



>ref|XP_006576714.1| PREDICTED: ELMO domain-containing protein A-like isoform X3 [Glycine 
max]
Length=247

 Score =   412 bits (1060),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 198/237 (84%), Positives = 214/237 (90%), Gaps = 3/237 (1%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             NCI   AEVVAGSAAWLGRGLSC+C Q R+SD   +F+LT AQEECLQR+Q R+D+ YD 
Sbjct  7     NCI---AEVVAGSAAWLGRGLSCVCVQRRDSDVSNTFDLTLAQEECLQRIQRRIDVPYDS  63

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SI EHQ ALRALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLEN L+FA 
Sbjct  64    SIIEHQDALRALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLFFAR  123

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQ LL+K+EGDRS+WEYPFAVAGVNIT+MLIQMLDLEAVKPRNLVGATFLKFLAE
Sbjct  124   NFPKSFQVLLRKQEGDRSVWEYPFAVAGVNITYMLIQMLDLEAVKPRNLVGATFLKFLAE  183

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             N SAFDLLYCITFKLMDHQWL+MRASYMDFN+VMK TRRQLEKELL+EDI RLEDLP
Sbjct  184   NGSAFDLLYCITFKLMDHQWLTMRASYMDFNAVMKETRRQLEKELLIEDIARLEDLP  240



>ref|XP_010275485.1| PREDICTED: ELMO domain-containing protein A [Nelumbo nucifera]
 ref|XP_010275486.1| PREDICTED: ELMO domain-containing protein A [Nelumbo nucifera]
 ref|XP_010275487.1| PREDICTED: ELMO domain-containing protein A [Nelumbo nucifera]
 ref|XP_010275488.1| PREDICTED: ELMO domain-containing protein A [Nelumbo nucifera]
 ref|XP_010275489.1| PREDICTED: ELMO domain-containing protein A [Nelumbo nucifera]
Length=266

 Score =   412 bits (1060),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 211/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C    AEVVAGS AWLGRGLSC+C Q RESDARPSF LTPAQEECLQRLQ+R+D+ YD S
Sbjct  24    CQSTSAEVVAGSTAWLGRGLSCVCVQRRESDARPSFELTPAQEECLQRLQNRIDVVYDSS  83

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
              P+HQ  LRALWNA+FP EEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA N
Sbjct  84    NPQHQETLRALWNASFPGEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARN  143

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             +P SFQDLL+K EGDR++WEYPFAVAGVNITFMLIQMLDL+AVKP+ + GA FLK LAEN
Sbjct  144   YPKSFQDLLRKEEGDRAIWEYPFAVAGVNITFMLIQMLDLQAVKPQTMPGAVFLKLLAEN  203

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCITFKLMD QWL+MRASYMDFN VMK+TRRQLE+ELLLEDITRLEDLP
Sbjct  204   ESAFDLLYCITFKLMDQQWLAMRASYMDFNVVMKSTRRQLERELLLEDITRLEDLP  259



>ref|XP_006338906.1| PREDICTED: ELMO domain-containing protein A-like [Solanum tuberosum]
Length=265

 Score =   412 bits (1059),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 215/231 (93%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             +EV+AGS AWLGRGLSC+CAQ  + DARPSF+LTPAQEECLQ+LQ+R+D++YD SIPEHQ
Sbjct  29    SEVMAGSTAWLGRGLSCVCAQGTDIDARPSFDLTPAQEECLQKLQNRIDVAYDGSIPEHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALRALW AAFP EEL  LISEQWKEMGWQGKDP+TDFRG GFISLENLLYFA NFP SF
Sbjct  89    EALRALWKAAFPVEELHGLISEQWKEMGWQGKDPSTDFRGAGFISLENLLYFARNFPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLLQK+EGDR++WEYPFAVAGVNITFMLI++LD+EA+KPRNLVGA+FLKFLAENESAFD
Sbjct  149   QDLLQKQEGDRALWEYPFAVAGVNITFMLIEILDIEAIKPRNLVGASFLKFLAENESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCITFKLMDHQWL+M ASYMDFN+VMK+TRRQ+E+ELL E+I RLEDLP
Sbjct  209   LLYCITFKLMDHQWLAMHASYMDFNTVMKSTRRQIERELLEENIKRLEDLP  259



>ref|XP_003521062.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Glycine 
max]
 gb|KHN45228.1| ELMO domain-containing protein A [Glycine soja]
Length=262

 Score =   410 bits (1055),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 196/237 (83%), Positives = 212/237 (89%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+C Q R+SD   +F+LT AQEECLQR+Q R+D+ YD 
Sbjct  19    TCHPNSAEVVAGSAAWLGRGLSCVCVQRRDSDVSNTFDLTLAQEECLQRIQRRIDVPYDS  78

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SI EHQ ALRALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLEN L+FA 
Sbjct  79    SIIEHQDALRALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLFFAR  138

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQ LL+K+EGDRS+WEYPFAVAGVNIT+MLIQMLDLEAVKPRNLVGATFLKFLAE
Sbjct  139   NFPKSFQVLLRKQEGDRSVWEYPFAVAGVNITYMLIQMLDLEAVKPRNLVGATFLKFLAE  198

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             N SAFDLLYCITFKLMDHQWL+MRASYMDFN+VMK TRRQLEKELL+EDI RLEDLP
Sbjct  199   NGSAFDLLYCITFKLMDHQWLTMRASYMDFNAVMKETRRQLEKELLIEDIARLEDLP  255



>ref|XP_010413581.1| PREDICTED: ELMO domain-containing protein C-like [Camelina sativa]
Length=244

 Score =   410 bits (1053),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C+D+ +EVVAGSAAWLGRGLSC+CAQ R+SDARPSF+LTP+QE+CL+RLQ+R+D++YD S
Sbjct  2     CVDLLSEVVAGSAAWLGRGLSCVCAQGRDSDARPSFDLTPSQEDCLERLQNRIDVAYDSS  61

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             IP HQ AL+ LW  AFPE+EL  ++S QWKEMGWQGKDP+TDFRGGGFISLENLLYFA  
Sbjct  62    IPHHQEALKDLWKLAFPEQELHGVVSNQWKEMGWQGKDPSTDFRGGGFISLENLLYFARK  121

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FPNSFQDLL+K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAVKPR++VG TFL+FL+ N
Sbjct  122   FPNSFQDLLRKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAVKPRSVVGETFLRFLSVN  181

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDITRLEDLP
Sbjct  182   ESAFDLLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEDITRLEDLP  237



>ref|XP_010512336.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Camelina 
sativa]
Length=244

 Score =   409 bits (1052),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C+D+ +EVVAGSAAWLGRGLSC+CAQ R+SDARPSF+LTPAQE+CL+RLQ+R+D++YD S
Sbjct  2     CVDLLSEVVAGSAAWLGRGLSCVCAQGRDSDARPSFDLTPAQEDCLERLQNRIDVAYDSS  61

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             IP HQ AL+ LW  AFPE+EL  ++S QWKEMGWQGKDP+TDFRGGGFISLENLLYFA  
Sbjct  62    IPHHQEALKDLWKLAFPEKELHGVVSNQWKEMGWQGKDPSTDFRGGGFISLENLLYFARK  121

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SFQDLL+K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAVKPR++VG TFL+FL+ N
Sbjct  122   FPKSFQDLLRKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAVKPRSIVGETFLRFLSVN  181

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDITRLEDLP
Sbjct  182   ESAFDLLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEDITRLEDLP  237



>gb|EYU40351.1| hypothetical protein MIMGU_mgv1a012020mg [Erythranthe guttata]
Length=264

 Score =   410 bits (1053),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
              +GSAAWLGRGLSC+CAQ R+SDARPSF+LT +QEECL RLQSR+D++YD S+ EHQ AL
Sbjct  30    TSGSAAWLGRGLSCVCAQRRDSDARPSFDLTASQEECLHRLQSRIDVAYDSSVREHQEAL  89

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+AAFP EEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYF  NFP SFQDL
Sbjct  90    RALWHAAFPGEELCGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFGRNFPKSFQDL  149

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+EGDR+MWEYPFAVAGVNITFMLIQ+LDLEAVKPR LVGATFLKFLAENE+AFDLLY
Sbjct  150   LRKKEGDRAMWEYPFAVAGVNITFMLIQILDLEAVKPRTLVGATFLKFLAENEAAFDLLY  209

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             CITFKLMDHQWL+M ASYMDFN+VMKATRRQLE+ELL EDI RLEDLP
Sbjct  210   CITFKLMDHQWLAMHASYMDFNTVMKATRRQLERELLQEDIARLEDLP  257



>gb|EYU42340.1| hypothetical protein MIMGU_mgv1a011776mg [Erythranthe guttata]
Length=246

 Score =   409 bits (1051),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  340   MPNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISY  519
             M  C +I AEVVAGS AWLG+GLSC+CAQ  E+DARPSF+LT AQEECL+RLQ+R+D +Y
Sbjct  1     MATCFEIFAEVVAGSTAWLGKGLSCVCAQGGENDARPSFDLTTAQEECLERLQNRLDAAY  60

Query  520   DRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYF  699
             D SIP HQ ALRALWNAAFP +EL  LIS+QWKEMGWQGKDP+TDFRGGGFISLENLLYF
Sbjct  61    DSSIPVHQEALRALWNAAFPGQELHGLISDQWKEMGWQGKDPSTDFRGGGFISLENLLYF  120

Query  700   ANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFL  879
             A NFP SFQ LL K+EGDR++WEYPFAVAGVNITFMLIQ+LDLEAVKPR LVGATFLKFL
Sbjct  121   ARNFPKSFQSLLWKQEGDRALWEYPFAVAGVNITFMLIQILDLEAVKPRTLVGATFLKFL  180

Query  880   AENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             A NESAFDLLYCI FKLMD QWL+MRASYMDFN+VMKATRR+LE+ELL EDI RLEDLP
Sbjct  181   AVNESAFDLLYCIAFKLMDQQWLAMRASYMDFNAVMKATRRELERELLQEDIKRLEDLP  239



>ref|XP_006576713.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Glycine 
max]
Length=261

 Score =   409 bits (1051),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             +EVVAGSAAWLGRGLSC+C Q R+SD   +F+LT AQEECLQR+Q R+D+ YD SI EHQ
Sbjct  24    SEVVAGSAAWLGRGLSCVCVQRRDSDVSNTFDLTLAQEECLQRIQRRIDVPYDSSIIEHQ  83

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALRALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLEN L+FA NFP SF
Sbjct  84    DALRALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLFFARNFPKSF  143

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q LL+K+EGDRS+WEYPFAVAGVNIT+MLIQMLDLEAVKPRNLVGATFLKFLAEN SAFD
Sbjct  144   QVLLRKQEGDRSVWEYPFAVAGVNITYMLIQMLDLEAVKPRNLVGATFLKFLAENGSAFD  203

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCITFKLMDHQWL+MRASYMDFN+VMK TRRQLEKELL+EDI RLEDLP
Sbjct  204   LLYCITFKLMDHQWLTMRASYMDFNAVMKETRRQLEKELLIEDIARLEDLP  254



>ref|XP_010540213.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Tarenaya 
hassleriana]
Length=266

 Score =   408 bits (1048),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 192/233 (82%), Positives = 210/233 (90%), Gaps = 6/233 (3%)
 Frame = +1

Query  376   AGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALR  555
             +GS AWLGRGLSC+CAQ RE ++RPSF+ TPAQEECLQRLQSR+D+ YD SIP+HQ ALR
Sbjct  27    SGSTAWLGRGLSCVCAQRREHESRPSFDFTPAQEECLQRLQSRVDVPYDGSIPQHQEALR  86

Query  556   ALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLL  735
             ALW  AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGF+SLENLLYFA NFP SFQDLL
Sbjct  87    ALWKLAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFVSLENLLYFARNFPKSFQDLL  146

Query  736   QKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYC  915
             QK+ GDRS+WEYPFAVAGVNITFM+IQMLDLEAVKPR +VGATFLK LAENESAFDLLYC
Sbjct  147   QKQVGDRSVWEYPFAVAGVNITFMVIQMLDLEAVKPRTMVGATFLKLLAENESAFDLLYC  206

Query  916   ITFKLMDHQWLSMRASYMDFN------SVMKATRRQLEKELLLEDITRLEDLP  1056
             I FKLMDHQWL+ RASYMDFN      +VMK+TRRQLEKELLLED+TRLEDLP
Sbjct  207   IAFKLMDHQWLTKRASYMDFNVRHLHLTVMKSTRRQLEKELLLEDVTRLEDLP  259



>ref|XP_010559084.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010559085.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Tarenaya 
hassleriana]
Length=266

 Score =   408 bits (1048),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 186/231 (81%), Positives = 215/231 (93%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVVAGSAAWLG+GLSC+CAQ R+SDA  SF+LTPAQEECLQRLQ+R+D++YD SIP+HQ
Sbjct  29    AEVVAGSAAWLGKGLSCVCAQRRDSDANSSFDLTPAQEECLQRLQNRIDVAYDGSIPQHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALRALW  AFPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA NFP +F
Sbjct  89    EALRALWKLAFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARNFPKTF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAV+PR +VGATFLK  AE+ESAFD
Sbjct  149   QDLLRKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAVRPRTVVGATFLKLFAEDESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMDHQWL+MRASYM+FN+VMK+TRRQLE+EL+++DITRLEDLP
Sbjct  209   LLYCIAFKLMDHQWLAMRASYMEFNTVMKSTRRQLERELMIDDITRLEDLP  259



>ref|XP_010258745.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Nelumbo 
nucifera]
Length=260

 Score =   405 bits (1042),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
              +GSAAWLGRGLSC+CAQ R+SD RPSF+LTPAQEECLQRLQSR+D++YD S PEHQ AL
Sbjct  27    TSGSAAWLGRGLSCVCAQRRDSDTRPSFDLTPAQEECLQRLQSRIDVAYDSSNPEHQEAL  86

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             R+LWNA+FP EEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA N+P SFQDL
Sbjct  87    RSLWNASFPGEELCGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARNYPKSFQDL  146

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+EGDR+MWEYPFAVAGVNITFMLIQMLDL+AVKPR ++GA FLK L ENESAFDLLY
Sbjct  147   LRKQEGDRAMWEYPFAVAGVNITFMLIQMLDLQAVKPRTVLGAIFLKLLVENESAFDLLY  206

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             CITFKLMD QWL+MRASYMDFN+VMK+TRRQLE+E LLEDITRLED+P
Sbjct  207   CITFKLMDQQWLAMRASYMDFNTVMKSTRRQLEREFLLEDITRLEDMP  254



>ref|XP_006838580.1| hypothetical protein AMTR_s00002p00213620 [Amborella trichopoda]
 gb|ERN01149.1| hypothetical protein AMTR_s00002p00213620 [Amborella trichopoda]
Length=266

 Score =   406 bits (1043),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C    AEVVAGSAAW+GRGLSC+CAQ +ESD R SF LTP QEECLQRLQSR++++YD S
Sbjct  24    CHTSSAEVVAGSAAWIGRGLSCVCAQRQESDERGSFELTPLQEECLQRLQSRIEVTYDSS  83

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
              PEHQ ALRALWNAAFP+EELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA  
Sbjct  84    RPEHQEALRALWNAAFPDEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAKT  143

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SFQDLL+K++G+R+MWEYPFAVAGVNITFMLIQMLDL+AVKPR L+GATFLK L+EN
Sbjct  144   FPKSFQDLLRKQDGNRAMWEYPFAVAGVNITFMLIQMLDLQAVKPRTLMGATFLKLLSEN  203

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             E AFDLLYCITFKLMD QWL+M ASYMDFNSVMK+TR QLE+EL+ EDITRLED+P
Sbjct  204   EHAFDLLYCITFKLMDQQWLAMHASYMDFNSVMKSTRLQLERELVPEDITRLEDMP  259



>ref|XP_004492914.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Cicer 
arietinum]
Length=266

 Score =   405 bits (1042),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 200/231 (87%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE V GS AWLGRGLSC+CAQ RESDARPSF+LTP+QEECLQRLQSR+D+ YD SIP HQ
Sbjct  29    AEYVTGSTAWLGRGLSCVCAQRRESDARPSFDLTPSQEECLQRLQSRIDVPYDSSIPAHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              +LRALWNAAFPEEELR LISEQWK+MGWQGKDP+TDFRGGG+ISLENLL+FA NFP SF
Sbjct  89    ESLRALWNAAFPEEELRGLISEQWKDMGWQGKDPSTDFRGGGYISLENLLFFARNFPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAENESAFD
Sbjct  149   QDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAENESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCITFKLMD+QWL MRASYMDFN+VMK+TRRQLEKELLLED+TRLED+P
Sbjct  209   LLYCITFKLMDNQWLLMRASYMDFNTVMKSTRRQLEKELLLEDLTRLEDVP  259



>ref|NP_001030900.1| ELMO/CED-12 domain-containing protein [Arabidopsis thaliana]
 gb|AEE80034.1| ELMO/CED-12 domain-containing protein [Arabidopsis thaliana]
Length=244

 Score =   405 bits (1040),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 183/236 (78%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C+D+ +EVVAGSAAWLGRGLSC+C Q R+ D RPSF+LTPAQEECLQRLQSR+D++YD S
Sbjct  2     CVDLLSEVVAGSAAWLGRGLSCVCVQGRDGDPRPSFDLTPAQEECLQRLQSRIDVAYDSS  61

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             IP+HQ AL+ LW  AFPEEEL  ++S+QWKEMGWQGKDP+TDFRGGGFISLENLLYFA  
Sbjct  62    IPQHQEALKDLWKLAFPEEELHGIVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFARK  121

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SF  LL+K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAVKPR++VG TFL+FL+ N
Sbjct  122   FPKSFHGLLRKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAVKPRSIVGETFLRFLSVN  181

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDIT LEDLP
Sbjct  182   ESAFDLLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMIEDITSLEDLP  237



>gb|AFK41607.1| unknown [Lotus japonicus]
Length=247

 Score =   404 bits (1039),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 211/236 (89%), Gaps = 1/236 (0%)
 Frame = +1

Query  352   IDIC-AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             I  C +E VAGSAAWLG+GLSC+C Q R+SDA  SF+LT AQEE LQRLQ R+D+ YD S
Sbjct  5     IHTCISEAVAGSAAWLGKGLSCVCVQRRDSDASSSFDLTLAQEESLQRLQKRIDVPYDSS  64

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             I +HQ ALRALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLEN L+F+ N
Sbjct  65    IVQHQDALRALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLFFSRN  124

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SFQDLL K+EGDRS+WEYPFAVAGVNITFMLIQMLDLE+VKP  LVGATF+K LAEN
Sbjct  125   FPKSFQDLLWKQEGDRSVWEYPFAVAGVNITFMLIQMLDLESVKPHTLVGATFVKLLAEN  184

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCI FKLMDHQWLSMRASYMDFN+VMK+TRRQLEKELLLEDIT+LEDLP
Sbjct  185   ESAFDLLYCIAFKLMDHQWLSMRASYMDFNTVMKSTRRQLEKELLLEDITQLEDLP  240



>ref|XP_010512335.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Camelina 
sativa]
Length=266

 Score =   404 bits (1039),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVVAGSAAWLGRGLSC+CAQ R+SDARPSF+LTPAQE+CL+RLQ+R+D++YD SIP HQ
Sbjct  29    AEVVAGSAAWLGRGLSCVCAQGRDSDARPSFDLTPAQEDCLERLQNRIDVAYDSSIPHHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ LW  AFPE+EL  ++S QWKEMGWQGKDP+TDFRGGGFISLENLLYFA  FP SF
Sbjct  89    EALKDLWKLAFPEKELHGVVSNQWKEMGWQGKDPSTDFRGGGFISLENLLYFARKFPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAVKPR++VG TFL+FL+ NESAFD
Sbjct  149   QDLLRKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAVKPRSIVGETFLRFLSVNESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDITRLEDLP
Sbjct  209   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEDITRLEDLP  259



>dbj|BAH20005.1| AT3G60260 [Arabidopsis thaliana]
Length=244

 Score =   403 bits (1036),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 182/236 (77%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C+D+ +EVVAGSAAWLGRGLSC+C Q R+ D RPSF+LTPAQEECLQRLQSR+D++YD S
Sbjct  2     CVDLLSEVVAGSAAWLGRGLSCVCVQGRDGDPRPSFDLTPAQEECLQRLQSRIDVAYDSS  61

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             IP+HQ AL+ LW  AFPEEEL  ++S+QWKEMGWQGKDP+TDFRGGGFISLENLLYFA  
Sbjct  62    IPQHQEALKDLWKLAFPEEELHGIVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFARK  121

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SF  LL+K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAVKPR++VG TFL+FL+ N
Sbjct  122   FPKSFHGLLRKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAVKPRSIVGETFLRFLSVN  181

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+++++EDIT LEDLP
Sbjct  182   ESAFDLLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERDIMIEDITSLEDLP  237



>gb|EPS57180.1| hypothetical protein M569_17641, partial [Genlisea aurea]
Length=267

 Score =   404 bits (1038),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C    AEVVAGSAAWLGRGLSC+CAQ RESD+RPSF+LTP QEECLQRLQ+R+DI+YD S
Sbjct  25    CHSTSAEVVAGSAAWLGRGLSCVCAQRRESDSRPSFDLTPLQEECLQRLQNRIDIAYDGS  84

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             I EHQ  LRALW AAFP EEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA N
Sbjct  85    IREHQETLRALWCAAFPGEELSGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARN  144

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SFQDLL+KREGDR++WEYPFAVAGVNITFMLIQMLDLEAVKPR L GATFLKFLAEN
Sbjct  145   FPKSFQDLLRKREGDRALWEYPFAVAGVNITFMLIQMLDLEAVKPRTLAGATFLKFLAEN  204

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             E AFDLLYCITFK+MDHQWL M ASYMDFNSVMKATRR+LEKELLLED+T+LEDLP
Sbjct  205   ELAFDLLYCITFKMMDHQWLEMHASYMDFNSVMKATRRELEKELLLEDVTQLEDLP  260



>ref|XP_006291683.1| hypothetical protein CARUB_v10017843mg [Capsella rubella]
 gb|EOA24581.1| hypothetical protein CARUB_v10017843mg [Capsella rubella]
Length=266

 Score =   404 bits (1037),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVVAGSAAWLGRGLSC+CAQ R+SDARPSF+LTPAQEECLQRLQ+R+D++Y+ SIP+HQ
Sbjct  29    AEVVAGSAAWLGRGLSCVCAQGRDSDARPSFDLTPAQEECLQRLQNRIDVAYESSIPQHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ LW  AFPEEEL  ++SEQWK+MGWQGKDP+TDFRGGGFISLENLLYFA  FP SF
Sbjct  89    EALKDLWKLAFPEEELHGIVSEQWKQMGWQGKDPSTDFRGGGFISLENLLYFARKFPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAVKPR++VG TFL+FL+ NESAFD
Sbjct  149   QDLLWKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAVKPRSIVGETFLRFLSVNESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E++++DITRLE+LP
Sbjct  209   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMIKDITRLEELP  259



>gb|EYU42341.1| hypothetical protein MIMGU_mgv1a011776mg [Erythranthe guttata]
Length=271

 Score =   404 bits (1037),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 211/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C    AEVVAGS AWLG+GLSC+CAQ  E+DARPSF+LT AQEECL+RLQ+R+D +YD S
Sbjct  29    CHSTSAEVVAGSTAWLGKGLSCVCAQGGENDARPSFDLTTAQEECLERLQNRLDAAYDSS  88

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             IP HQ ALRALWNAAFP +EL  LIS+QWKEMGWQGKDP+TDFRGGGFISLENLLYFA N
Sbjct  89    IPVHQEALRALWNAAFPGQELHGLISDQWKEMGWQGKDPSTDFRGGGFISLENLLYFARN  148

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SFQ LL K+EGDR++WEYPFAVAGVNITFMLIQ+LDLEAVKPR LVGATFLKFLA N
Sbjct  149   FPKSFQSLLWKQEGDRALWEYPFAVAGVNITFMLIQILDLEAVKPRTLVGATFLKFLAVN  208

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCI FKLMD QWL+MRASYMDFN+VMKATRR+LE+ELL EDI RLEDLP
Sbjct  209   ESAFDLLYCIAFKLMDQQWLAMRASYMDFNAVMKATRRELERELLQEDIKRLEDLP  264



>ref|XP_010469207.1| PREDICTED: ELMO domain-containing protein A-like [Camelina sativa]
Length=267

 Score =   403 bits (1035),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVVAGSAAWLGRGLSC+CAQ R+SDARPSF+LTPAQE+CL+RLQ+R+D+SYD SIP HQ
Sbjct  30    AEVVAGSAAWLGRGLSCVCAQGRDSDARPSFDLTPAQEDCLERLQNRIDVSYDSSIPHHQ  89

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ LW  AFPE+EL  ++S QWKEMGWQGKDP+TDFRGGGFISLENLLYFA  F  SF
Sbjct  90    EALKDLWKLAFPEQELHGVVSNQWKEMGWQGKDPSTDFRGGGFISLENLLYFARKFSKSF  149

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAVKPR++VG TFL+FL+ NESAFD
Sbjct  150   QDLLRKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAVKPRSVVGETFLRFLSVNESAFD  209

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDITRLEDLP
Sbjct  210   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEDITRLEDLP  260



>ref|XP_004248988.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Solanum 
lycopersicum]
Length=265

 Score =   401 bits (1031),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 186/231 (81%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             +EV+AGS AWLGRGLSC+CAQ  + D R SF++TPAQEECLQ+LQ+R+D++YD SIPEHQ
Sbjct  29    SEVMAGSTAWLGRGLSCVCAQGTDIDTRRSFDVTPAQEECLQKLQNRIDVAYDGSIPEHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALRALW AAFP EEL  LISEQWK+MGWQGKDP+TDFRG GFISLENLLYFA NF  SF
Sbjct  89    EALRALWKAAFPVEELHGLISEQWKDMGWQGKDPSTDFRGAGFISLENLLYFARNFQKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLLQK+EGDR++WEYPFAVAGVNITFMLIQ+LD+EA+KPRNLVGATFLKFLAENESAFD
Sbjct  149   QDLLQKQEGDRALWEYPFAVAGVNITFMLIQILDIEAIKPRNLVGATFLKFLAENESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCITFKLMD+QWL+M ASYMDFN+VMK+TRRQ+E+ELL E+I RLEDLP
Sbjct  209   LLYCITFKLMDYQWLAMHASYMDFNTVMKSTRRQIERELLEENIKRLEDLP  259



>ref|XP_006397658.1| hypothetical protein EUTSA_v10001587mg [Eutrema salsugineum]
 gb|ESQ39111.1| hypothetical protein EUTSA_v10001587mg [Eutrema salsugineum]
Length=266

 Score =   401 bits (1031),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 188/231 (81%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE V GSAAWLGRGLSC+CAQ R+SDA  +F+LTPAQEECLQ LQ+R+D++YD +IP HQ
Sbjct  29    AEGVPGSAAWLGRGLSCVCAQRRDSDAHSTFDLTPAQEECLQSLQNRIDVAYDSTIPLHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALR LW  AFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NF  SF
Sbjct  89    EALRDLWKLAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFQKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAVKPR +VGATFLKFL+ENESAFD
Sbjct  149   QDLLRKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAVKPRTIVGATFLKFLSENESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LEDIT LEDLP
Sbjct  209   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDITHLEDLP  259



>ref|XP_006402600.1| hypothetical protein EUTSA_v10006159mg [Eutrema salsugineum]
 gb|ESQ44053.1| hypothetical protein EUTSA_v10006159mg [Eutrema salsugineum]
Length=274

 Score =   401 bits (1031),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             A+VVAGSAAWLGRGLSC+CAQ R+ DARPSF+LTPAQEECLQRLQ+R+DI+YD SI +HQ
Sbjct  29    ADVVAGSAAWLGRGLSCVCAQGRDGDARPSFDLTPAQEECLQRLQNRIDIAYDSSISQHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ LW  AFPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGFISLENLLY A NFP +F
Sbjct  89    EALKDLWKLAFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFISLENLLYLARNFPKAF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
              DLL+K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAVKPR++VG TFL+FL  NESAFD
Sbjct  149   HDLLRKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAVKPRSIVGETFLRFLTVNESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++E ITRLEDLP
Sbjct  209   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEGITRLEDLP  259



>ref|XP_002876544.1| hypothetical protein ARALYDRAFT_486497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52803.1| hypothetical protein ARALYDRAFT_486497 [Arabidopsis lyrata subsp. 
lyrata]
Length=266

 Score =   400 bits (1029),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVVAGSAAWLGRGLSC+C Q R+ D RPSF+LTPAQEECLQRLQSR+D++YD SI +HQ
Sbjct  29    AEVVAGSAAWLGRGLSCVCVQGRDGDPRPSFDLTPAQEECLQRLQSRIDVAYDSSISQHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ LW  AFPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA  FP SF
Sbjct  89    EALKDLWKLAFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARQFPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAVKPR++VG TFL+FL+ NESAFD
Sbjct  149   QDLLRKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAVKPRSIVGETFLRFLSVNESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDIT LEDLP
Sbjct  209   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEDITCLEDLP  259



>ref|NP_567097.1| ELMO/CED-12 domain-containing protein [Arabidopsis thaliana]
 ref|NP_850727.1| ELMO/CED-12 domain-containing protein [Arabidopsis thaliana]
 ref|NP_001078320.1| ELMO/CED-12 domain-containing protein [Arabidopsis thaliana]
 gb|AAL38361.1| putative protein [Arabidopsis thaliana]
 gb|AAM10226.1| putative protein [Arabidopsis thaliana]
 gb|AAM60921.1| unknown [Arabidopsis thaliana]
 gb|AEE80032.1| ELMO/CED-12 domain-containing protein [Arabidopsis thaliana]
 gb|AEE80033.1| ELMO/CED-12 domain-containing protein [Arabidopsis thaliana]
 gb|AEE80035.1| ELMO/CED-12 domain-containing protein [Arabidopsis thaliana]
Length=266

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVVAGSAAWLGRGLSC+C Q R+ D RPSF+LTPAQEECLQRLQSR+D++YD SIP+HQ
Sbjct  29    AEVVAGSAAWLGRGLSCVCVQGRDGDPRPSFDLTPAQEECLQRLQSRIDVAYDSSIPQHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ LW  AFPEEEL  ++S+QWKEMGWQGKDP+TDFRGGGFISLENLLYFA  FP SF
Sbjct  89    EALKDLWKLAFPEEELHGIVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFARKFPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
               LL+K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAVKPR++VG TFL+FL+ NESAFD
Sbjct  149   HGLLRKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAVKPRSIVGETFLRFLSVNESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDIT LEDLP
Sbjct  209   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMIEDITSLEDLP  259



>ref|XP_011093232.1| PREDICTED: ELMO domain-containing protein A-like [Sesamum indicum]
Length=265

 Score =   400 bits (1027),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 211/236 (89%), Gaps = 4/236 (2%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C    AE VAGSAAWLGRGLSC+CAQ R+SDAR SF+LTP QEECL+RLQ+R+D++YD S
Sbjct  27    CHSTSAEAVAGSAAWLGRGLSCVCAQRRDSDARASFDLTPGQEECLERLQNRLDVAYDSS  86

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             IPEHQ AL ALW+AAFP EEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA N
Sbjct  87    IPEHQEALWALWHAAFPGEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARN  146

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SFQ+LL K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLA  
Sbjct  147   FPKSFQELLWKQEGDRSLWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLA--  204

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
               AFDLLYCITFKL+DH+WL+MRASYMDFN+VMKATRRQLE ELL EDIT LE+LP
Sbjct  205   --AFDLLYCITFKLLDHEWLAMRASYMDFNAVMKATRRQLETELLQEDITCLEELP  258



>ref|XP_003624290.1| ELMO domain-containing protein A [Medicago truncatula]
 gb|ABN05917.1| Engulfment and cell motility, ELM [Medicago truncatula]
 gb|AES80508.1| ELMO/CED-12 family protein [Medicago truncatula]
Length=266

 Score =   399 bits (1026),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 197/231 (85%), Positives = 217/231 (94%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE V GS AW+GRGLSC+CAQ RESDAR SF+LTP QEECLQRLQSR+D+ YD SIPEHQ
Sbjct  29    AEFVTGSTAWIGRGLSCVCAQRRESDARLSFDLTPYQEECLQRLQSRIDVPYDSSIPEHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
             ++LRALWNAAFPEEEL  LISEQWK+MGWQGKDP+TDFRGGG+ISLENLL+FA NFP SF
Sbjct  89    ASLRALWNAAFPEEELNGLISEQWKDMGWQGKDPSTDFRGGGYISLENLLFFARNFPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAENESAFD
Sbjct  149   QDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAENESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCITFKLMD+QWLSM ASYMDFN+VMK+TRRQLEKELLLED+T+LED+P
Sbjct  209   LLYCITFKLMDNQWLSMHASYMDFNTVMKSTRRQLEKELLLEDLTQLEDVP  259



>ref|XP_010919756.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Elaeis 
guineensis]
Length=262

 Score =   399 bits (1025),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 209/237 (88%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVV GS AW+GRGLSC+CAQ RESDAR SF+LTP+QEECLQRLQSR++++YD 
Sbjct  19    GCHSSPAEVVTGSTAWIGRGLSCVCAQRRESDARLSFDLTPSQEECLQRLQSRIEVTYDG  78

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S  EHQ ALRALW AA+P  ELR L+SEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  79    SKKEHQEALRALWYAAYPGVELRGLVSEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAK  138

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             N+P SFQDLLQK+EGDR++WEYPFAVAGVNITFMLIQMLDL+A KPR L+GA FLK L E
Sbjct  139   NYPKSFQDLLQKQEGDRAIWEYPFAVAGVNITFMLIQMLDLQAAKPRTLMGAIFLKLLLE  198

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NE AFDLLYC+TFKLMD QWL+M ASYMDFNSVMKATRRQLE+ELLLEDI R+ED+P
Sbjct  199   NERAFDLLYCVTFKLMDQQWLAMHASYMDFNSVMKATRRQLERELLLEDIQRIEDMP  255



>ref|XP_009104257.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Brassica 
rapa]
Length=244

 Score =   398 bits (1022),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 182/236 (77%), Positives = 211/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             C+D+ +EVVAGSAAWLGRGLSC+CAQ    D R SF+LTPAQEECL RLQSR+D++YD S
Sbjct  2     CVDLLSEVVAGSAAWLGRGLSCVCAQGSNGDTRLSFDLTPAQEECLLRLQSRIDVAYDSS  61

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
             IP HQ AL+ LW  AFPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA N
Sbjct  62    IPHHQEALKDLWKLAFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFISLENLLYFAKN  121

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             FP SFQDLL+K+ GDRS+WEYPFAVAGVNITFMLIQML LEAVKPR++VG TFL+FL+ N
Sbjct  122   FPKSFQDLLRKQVGDRSVWEYPFAVAGVNITFMLIQMLGLEAVKPRSIVGETFLRFLSVN  181

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ESAFDLLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++E+IT +ED+P
Sbjct  182   ESAFDLLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEEITCIEDMP  237



>emb|CDY42685.1| BnaC04g22210D [Brassica napus]
Length=269

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE VAGSAAWLGRGLSC+C Q R+  +RPSF+LTPAQEECLQRLQ+RM+++YD SIP+HQ
Sbjct  31    AEAVAGSAAWLGRGLSCVCVQGRDGASRPSFDLTPAQEECLQRLQNRMEVAYDTSIPQHQ  90

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ LW  +FPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA  FP SF
Sbjct  91    EALKGLWKLSFPEEELHAIVSEQWKEMGWQGKDPSTDFRGGGFISLENLLYFAKRFPKSF  150

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+NITFMLIQML LEAVKPR++VG TFL+FL+ NESAFD
Sbjct  151   QDLLRKQVGDRSVWEYPFAVAGINITFMLIQMLGLEAVKPRSIVGETFLRFLSVNESAFD  210

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCI FKLMDHQWLSMRASYM+FN+VMK+TRRQLE+E+++EDIT +ED+P
Sbjct  211   ILYCIAFKLMDHQWLSMRASYMEFNTVMKSTRRQLEREIMVEDITYIEDMP  261



>ref|NP_566027.1| ELMO/CED-12 domain-containing protein [Arabidopsis thaliana]
 gb|AAC27479.2| expressed protein [Arabidopsis thaliana]
 gb|AAM65146.1| unknown [Arabidopsis thaliana]
 gb|AEC10466.1| ELMO/CED-12 domain-containing protein [Arabidopsis thaliana]
Length=266

 Score =   397 bits (1021),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE V GSAAWLGRGLSC+CAQ R+SDA  +F+LTPAQEECLQ LQ+R+D++YD +IP HQ
Sbjct  29    AEAVPGSAAWLGRGLSCVCAQRRDSDANSTFDLTPAQEECLQSLQNRIDVAYDSTIPLHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALR LW  +FPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NF  SF
Sbjct  89    EALRELWKLSFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFQKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+N+TFMLIQMLDLEAVKPR +VGATFLKFL+ENESAFD
Sbjct  149   QDLLRKQVGDRSVWEYPFAVAGINLTFMLIQMLDLEAVKPRTIVGATFLKFLSENESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LEDI  LEDLP
Sbjct  209   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDIMHLEDLP  259



>gb|KEH17885.1| ELMO/CED-12 family protein [Medicago truncatula]
Length=257

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/246 (77%), Positives = 215/246 (87%), Gaps = 1/246 (0%)
 Frame = +1

Query  319   NWKLAWFMPNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQ  498
             N+ ++    + +   AE VAGSAAWLGRGLSC+CAQ R+SDA   F+LT AQEECL+RLQ
Sbjct  6     NYFISMIGADILSCIAEAVAGSAAWLGRGLSCVCAQRRDSDAGSFFDLTLAQEECLERLQ  65

Query  499   SRMDISYDRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFIS  678
              R+++ YD SI EHQ AL+ALW  AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFIS
Sbjct  66    RRIEVPYDGSIVEHQEALKALWKVAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFIS  125

Query  679   LENLLYFANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVG  858
             LEN L+FA NFP SFQDLL KREGDRS+WEYPFAVAGVNITFML+QMLDLEAVKPR LVG
Sbjct  126   LENFLFFARNFPKSFQDLLWKREGDRSVWEYPFAVAGVNITFMLVQMLDLEAVKPRTLVG  185

Query  859   ATFLKFLAENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDIT  1038
             ATFLKFL ENESAFDLLYCI FKLMDHQWLSMRASYMDFN+VMK+TR++LEKE LL++++
Sbjct  186   ATFLKFLEENESAFDLLYCIAFKLMDHQWLSMRASYMDFNTVMKSTRQELEKE-LLQEVS  244

Query  1039  RLEDLP  1056
             RLEDLP
Sbjct  245   RLEDLP  250



>gb|KEH17881.1| ELMO/CED-12 family protein [Medicago truncatula]
Length=262

 Score =   395 bits (1016),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 190/237 (80%), Positives = 210/237 (89%), Gaps = 1/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AE VAGSAAWLGRGLSC+CAQ R+SDA   F+LT AQEECL+RLQ R+++ YD 
Sbjct  20    TCNSNSAEAVAGSAAWLGRGLSCVCAQRRDSDAGSFFDLTLAQEECLERLQRRIEVPYDG  79

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SI EHQ AL+ALW  AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLEN L+FA 
Sbjct  80    SIVEHQEALKALWKVAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLFFAR  139

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL KREGDRS+WEYPFAVAGVNITFML+QMLDLEAVKPR LVGATFLKFL E
Sbjct  140   NFPKSFQDLLWKREGDRSVWEYPFAVAGVNITFMLVQMLDLEAVKPRTLVGATFLKFLEE  199

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCI FKLMDHQWLSMRASYMDFN+VMK+TR++LEKE LL++++RLEDLP
Sbjct  200   NESAFDLLYCIAFKLMDHQWLSMRASYMDFNTVMKSTRQELEKE-LLQEVSRLEDLP  255



>emb|CAN74275.1| hypothetical protein VITISV_036799 [Vitis vinifera]
Length=251

 Score =   395 bits (1015),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 209/237 (88%), Gaps = 16/237 (7%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQSR+++SYD 
Sbjct  24    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQSRIEVSYDS  83

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SI EHQ ALRALWNA+FPEEELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  84    SISEHQEALRALWNASFPEEELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  143

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             N+P SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLE                AE
Sbjct  144   NYPKSFQDLLRKQEGDRALWEYPFAVAGVNITFMLIQMLDLE----------------AE  187

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMD+QWL+M ASYMDFN+VMK+TRRQLE+ELLLED++RLEDLP
Sbjct  188   NESAFDLLYCITFKLMDNQWLAMHASYMDFNTVMKSTRRQLERELLLEDVSRLEDLP  244



>ref|XP_006294803.1| hypothetical protein CARUB_v10023854mg [Capsella rubella]
 gb|EOA27701.1| hypothetical protein CARUB_v10023854mg [Capsella rubella]
Length=266

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE V GSAAWLGRGLSC+CAQ R+SDA  +F+LTPAQEECL  LQSR+D++YD +IP HQ
Sbjct  29    AEAVPGSAAWLGRGLSCVCAQRRDSDANSTFDLTPAQEECLLSLQSRIDVAYDSTIPRHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALR LW  AFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NF  SF
Sbjct  89    EALRELWKLAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFQKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+N+TFMLIQMLDLEAVKPR +VGATFLKFL+ENE AFD
Sbjct  149   QDLLRKQVGDRSVWEYPFAVAGINLTFMLIQMLDLEAVKPRTIVGATFLKFLSENEYAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LED+  LEDLP
Sbjct  209   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDVMHLEDLP  259



>gb|AAL51113.1|AF458341_1 At2g44770/F16B22.26 [Arabidopsis thaliana]
 gb|AAL06934.1| At2g44770/F16B22.26 [Arabidopsis thaliana]
Length=266

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE V GSAAWLGRGLSC+CAQ R+SDA  +F+LTPAQEECLQ LQ+R+D++YD +IP HQ
Sbjct  29    AEAVPGSAAWLGRGLSCVCAQRRDSDANSTFDLTPAQEECLQSLQNRIDVAYDSTIPLHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALR LW  +FPEEEL  LISEQWKEMGWQGKD +TDFRGGGFISLENLLYFA NF  SF
Sbjct  89    EALRELWKLSFPEEELHGLISEQWKEMGWQGKDQSTDFRGGGFISLENLLYFARNFQKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+N+TFMLIQMLDLEAVKPR +VGATFLKFL+ENESAFD
Sbjct  149   QDLLRKQVGDRSVWEYPFAVAGINLTFMLIQMLDLEAVKPRTIVGATFLKFLSENESAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LEDI  LEDLP
Sbjct  209   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDIMHLEDLP  259



>emb|CDX67822.1| BnaA07g18620D [Brassica napus]
Length=270

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 207/230 (90%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             EVVAGSAAWLGRGLSC+CAQ    D R SF+LTPAQEECL RLQSR+D++YD SIP+HQ 
Sbjct  34    EVVAGSAAWLGRGLSCVCAQGSNGDTRLSFDLTPAQEECLLRLQSRIDVAYDSSIPQHQE  93

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             AL+ LW  AFPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NFP SFQ
Sbjct  94    ALKDLWKLAFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFISLENLLYFAKNFPKSFQ  153

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
             DLL+K+ GDRS+WEYPFAVAGVNITFMLIQML LEAVKPR++VG TFL+FL+ NESAFDL
Sbjct  154   DLLRKQVGDRSVWEYPFAVAGVNITFMLIQMLGLEAVKPRSVVGETFLRFLSVNESAFDL  213

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDIT +ED+P
Sbjct  214   LYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEDITGIEDMP  263



>ref|XP_008794920.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Phoenix 
dactylifera]
Length=262

 Score =   394 bits (1011),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 207/237 (87%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVV GS AW+GRGLSC+CAQ RESDAR SF+LTP+QEECLQRLQSR+ ++YD 
Sbjct  19    GCHSSPAEVVTGSTAWIGRGLSCVCAQRRESDARLSFDLTPSQEECLQRLQSRIQVAYDG  78

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S  EHQ ALRALW AA+P  ELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  79    SKKEHQEALRALWYAAYPGVELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAK  138

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             N+P SFQDLL+K+EGDR+MWEYPFAVAGVNITFMLIQMLDL   KPR ++GA FLK  +E
Sbjct  139   NYPKSFQDLLRKQEGDRAMWEYPFAVAGVNITFMLIQMLDLPCAKPRTMMGAIFLKLFSE  198

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NE AFDLLYC+TFKLMD QWL+MRASYMDFNSVMKATRRQLE+ELLL+DI R+ED+P
Sbjct  199   NERAFDLLYCVTFKLMDQQWLAMRASYMDFNSVMKATRRQLEQELLLDDIQRIEDMP  255



>emb|CDY64764.1| BnaC06g42810D [Brassica napus]
Length=269

 Score =   394 bits (1011),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVVAGSAAWLGRGLSC+CAQ    D R SF+LTPAQEECL RLQSR+D++YD SIP+HQ
Sbjct  32    AEVVAGSAAWLGRGLSCVCAQGSNGDTRLSFDLTPAQEECLLRLQSRIDVAYDSSIPQHQ  91

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALR LW  AFPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA NFP SF
Sbjct  92    EALRDLWKLAFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAKNFPKSF  151

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             +DLL+K+ GDRS+WEYPFAVAGVNITFMLIQML LEAVKPR++VG TFL+FL+ NESAFD
Sbjct  152   RDLLRKQVGDRSVWEYPFAVAGVNITFMLIQMLGLEAVKPRSIVGETFLRFLSVNESAFD  211

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDIT +ED+P
Sbjct  212   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEDITGIEDMP  262



>ref|XP_002862539.1| hypothetical protein ARALYDRAFT_497408 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002880136.1| hypothetical protein ARALYDRAFT_483606 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38797.1| hypothetical protein ARALYDRAFT_497408 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56395.1| hypothetical protein ARALYDRAFT_483606 [Arabidopsis lyrata subsp. 
lyrata]
Length=266

 Score =   393 bits (1010),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 206/232 (89%), Gaps = 0/232 (0%)
 Frame = +1

Query  361   CAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEH  540
              AE V GSAAWLGRGLSC+CAQ R+SDA  +F+LTPAQEE LQ LQ+R+D++YD +IP H
Sbjct  28    SAEAVPGSAAWLGRGLSCVCAQRRDSDANSTFDLTPAQEESLQNLQNRIDVAYDSTIPLH  87

Query  541   QSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNS  720
             Q ALR LW  AFPEEEL  LISEQWKEMGWQGKDP+TDFRGGG ISLENLLYFA NF  S
Sbjct  88    QEALRDLWKLAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGLISLENLLYFARNFQKS  147

Query  721   FQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAF  900
             FQDLL+K+ GDRS+WEYPFAVAG+N+TFMLIQMLDLEAVKPR +VGATFLKFL+ENESAF
Sbjct  148   FQDLLRKQVGDRSVWEYPFAVAGINLTFMLIQMLDLEAVKPRTIVGATFLKFLSENESAF  207

Query  901   DLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             DLLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LEDI  LEDLP
Sbjct  208   DLLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDIMHLEDLP  259



>ref|XP_004515336.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Cicer 
arietinum]
Length=263

 Score =   392 bits (1008),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 194/237 (82%), Positives = 211/237 (89%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AE VAGSAAWLGRGLSC+C Q R+SDA  +F+ T AQEECLQRLQ R+++ YD 
Sbjct  20    TCNSNSAEAVAGSAAWLGRGLSCVCVQRRDSDASSTFDFTLAQEECLQRLQRRIEVPYDS  79

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SI EHQ ALRALWN AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLEN L+FA 
Sbjct  80    SIIEHQEALRALWNVAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLFFAR  139

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL KREGDRS+WEYPFAVAGVNITFML+QMLDLEAVKPR LVGATF+KFL E
Sbjct  140   NFPKSFQDLLWKREGDRSVWEYPFAVAGVNITFMLVQMLDLEAVKPRTLVGATFVKFLEE  199

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCI FKLMDHQWLSMRASYMDFN+VMK+TRRQLEKELLLE+++RLEDLP
Sbjct  200   NESAFDLLYCIAFKLMDHQWLSMRASYMDFNTVMKSTRRQLEKELLLEEVSRLEDLP  256



>ref|XP_004515337.1| PREDICTED: ELMO domain-containing protein A-like isoform X3 [Cicer 
arietinum]
Length=247

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/237 (82%), Positives = 213/237 (90%), Gaps = 3/237 (1%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             +CI   AE VAGSAAWLGRGLSC+C Q R+SDA  +F+ T AQEECLQRLQ R+++ YD 
Sbjct  7     SCI---AEAVAGSAAWLGRGLSCVCVQRRDSDASSTFDFTLAQEECLQRLQRRIEVPYDS  63

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SI EHQ ALRALWN AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLEN L+FA 
Sbjct  64    SIIEHQEALRALWNVAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLFFAR  123

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL KREGDRS+WEYPFAVAGVNITFML+QMLDLEAVKPR LVGATF+KFL E
Sbjct  124   NFPKSFQDLLWKREGDRSVWEYPFAVAGVNITFMLVQMLDLEAVKPRTLVGATFVKFLEE  183

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCI FKLMDHQWLSMRASYMDFN+VMK+TRRQLEKELLLE+++RLEDLP
Sbjct  184   NESAFDLLYCIAFKLMDHQWLSMRASYMDFNTVMKSTRRQLEKELLLEEVSRLEDLP  240



>ref|XP_010919754.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010919755.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Elaeis 
guineensis]
Length=270

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/245 (76%), Positives = 209/245 (85%), Gaps = 8/245 (3%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVV GS AW+GRGLSC+CAQ RESDAR SF+LTP+QEECLQRLQSR++++YD 
Sbjct  19    GCHSSPAEVVTGSTAWIGRGLSCVCAQRRESDARLSFDLTPSQEECLQRLQSRIEVTYDG  78

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRG--------GGFISL  681
             S  EHQ ALRALW AA+P  ELR L+SEQWKEMGWQGKDP+TDFRG        GGFISL
Sbjct  79    SKKEHQEALRALWYAAYPGVELRGLVSEQWKEMGWQGKDPSTDFRGSSLLDCRGGGFISL  138

Query  682   ENLLYFANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGA  861
             ENLL+FA N+P SFQDLLQK+EGDR++WEYPFAVAGVNITFMLIQMLDL+A KPR L+GA
Sbjct  139   ENLLFFAKNYPKSFQDLLQKQEGDRAIWEYPFAVAGVNITFMLIQMLDLQAAKPRTLMGA  198

Query  862   TFLKFLAENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITR  1041
              FLK L ENE AFDLLYC+TFKLMD QWL+M ASYMDFNSVMKATRRQLE+ELLLEDI R
Sbjct  199   IFLKLLLENERAFDLLYCVTFKLMDQQWLAMHASYMDFNSVMKATRRQLERELLLEDIQR  258

Query  1042  LEDLP  1056
             +ED+P
Sbjct  259   IEDMP  263



>ref|XP_009142280.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Brassica 
rapa]
Length=266

 Score =   391 bits (1005),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = +1

Query  361   CAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEH  540
              AE V GSAAWLGRGLSC+CAQ R+SD   +F+LTPAQEE LQ LQ+R+D++YD +IP H
Sbjct  28    SAEGVPGSAAWLGRGLSCVCAQRRDSDTNSTFDLTPAQEESLQSLQNRIDVAYDSTIPLH  87

Query  541   QSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNS  720
             Q ALR LW  AFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NF  S
Sbjct  88    QEALRDLWKLAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFQKS  147

Query  721   FQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAF  900
             FQDLL+K+ GDRS+WEYPFAVAG+N+TFMLIQMLDLEAVKPR +VG TFLKFL+ENESAF
Sbjct  148   FQDLLRKQVGDRSVWEYPFAVAGINLTFMLIQMLDLEAVKPRTVVGGTFLKFLSENESAF  207

Query  901   DLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             DLLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LEDI  LEDLP
Sbjct  208   DLLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDIMHLEDLP  259



>ref|XP_009133688.1| PREDICTED: ELMO domain-containing protein A-like [Brassica rapa]
Length=263

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
              E V GSAAWLGRGLSC+CAQ R+SDA  +F+LTPAQEECLQRLQ+R+D++YD +IP HQ
Sbjct  26    VEGVPGSAAWLGRGLSCVCAQRRDSDAHSTFDLTPAQEECLQRLQNRIDVAYDTTIPLHQ  85

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALR LW  +FPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENL+YFA     SF
Sbjct  86    EALRNLWKLSFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLMYFARMLQKSF  145

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ G+RS+WEYPFAVAG+NITFMLIQMLDLEAVKPR +VGATFLKFL+ENESAFD
Sbjct  146   QDLLRKQVGERSVWEYPFAVAGINITFMLIQMLDLEAVKPRTIVGATFLKFLSENESAFD  205

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCI FKLMD QWLSM ASYM+FN+VMK+TRRQLE+EL+LEDIT LEDLP
Sbjct  206   ILYCIAFKLMDQQWLSMHASYMEFNTVMKSTRRQLERELMLEDITHLEDLP  256



>ref|XP_009104256.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Brassica 
rapa]
Length=270

 Score =   391 bits (1004),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 206/230 (90%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             EVVAGSAAWLGRGLSC+CAQ    D R SF+LTPAQEECL RLQSR+D++YD SIP HQ 
Sbjct  34    EVVAGSAAWLGRGLSCVCAQGSNGDTRLSFDLTPAQEECLLRLQSRIDVAYDSSIPHHQE  93

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             AL+ LW  AFPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NFP SFQ
Sbjct  94    ALKDLWKLAFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFISLENLLYFAKNFPKSFQ  153

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
             DLL+K+ GDRS+WEYPFAVAGVNITFMLIQML LEAVKPR++VG TFL+FL+ NESAFDL
Sbjct  154   DLLRKQVGDRSVWEYPFAVAGVNITFMLIQMLGLEAVKPRSIVGETFLRFLSVNESAFDL  213

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++E+IT +ED+P
Sbjct  214   LYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEEITCIEDMP  263



>ref|XP_009116710.1| PREDICTED: ELMO domain-containing protein A-like [Brassica rapa]
 ref|XP_009116711.1| PREDICTED: ELMO domain-containing protein A-like [Brassica rapa]
Length=270

 Score =   391 bits (1004),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE VAGSAAWLGRGLSC+C Q    DARPSF+LTPAQEE LQRLQSRMD++YD SIP HQ
Sbjct  33    AEAVAGSAAWLGRGLSCVCVQGSHGDARPSFDLTPAQEEGLQRLQSRMDVAYDSSIPHHQ  92

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ LW  AFPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA +FP SF
Sbjct  93    EALKDLWKLAFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARSFPKSF  152

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+NITFMLIQML LEAVKP+++VG TFL+FL+ NESAFD
Sbjct  153   QDLLRKQVGDRSVWEYPFAVAGINITFMLIQMLGLEAVKPQSIVGETFLRFLSVNESAFD  212

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSM ASYM+FN+VMK+TRRQLE+E++++DIT +ED+P
Sbjct  213   LLYCIAFKLMDQQWLSMHASYMEFNTVMKSTRRQLEREIMVKDITGIEDMP  263



>ref|XP_010506412.1| PREDICTED: ELMO domain-containing protein A-like [Camelina sativa]
 ref|XP_010508252.1| PREDICTED: ELMO domain-containing protein A-like [Camelina sativa]
Length=265

 Score =   390 bits (1003),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 206/231 (89%), Gaps = 1/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE V  SAAWLGRGLSC+CAQ R+SDA  +F+LTPAQEECLQ LQSR+D++YD +IP HQ
Sbjct  29    AEAVP-SAAWLGRGLSCVCAQRRDSDANSTFDLTPAQEECLQSLQSRIDVAYDSTIPLHQ  87

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALR LW  AFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NF  SF
Sbjct  88    EALRELWKLAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFQKSF  147

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+N+TFMLIQMLDLEAVKPR +VGATFLKFL+ENE AFD
Sbjct  148   QDLLRKQVGDRSVWEYPFAVAGINLTFMLIQMLDLEAVKPRTIVGATFLKFLSENEYAFD  207

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LEDI  LEDLP
Sbjct  208   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDIMHLEDLP  258



>ref|XP_006587780.1| PREDICTED: ELMO domain-containing protein A isoform X2 [Glycine 
max]
Length=251

 Score =   390 bits (1002),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 203/237 (86%), Gaps = 15/237 (6%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AE V GS AWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQSR+DI YD 
Sbjct  23    TCHSSSAEFVTGSTAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQSRIDIPYDG  82

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S+PEHQ ALR LWNAAFPEEEL  LISEQWK+MGWQGKDP+TDFR               
Sbjct  83    SVPEHQDALRDLWNAAFPEEELHGLISEQWKDMGWQGKDPSTDFR---------------  127

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  128   NFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  187

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             N+SAFDLLYCITFK+MD QWLSMRASYMDFN+VMK+TRRQLEKELLLEDI RLED+P
Sbjct  188   NDSAFDLLYCITFKMMDQQWLSMRASYMDFNTVMKSTRRQLEKELLLEDIMRLEDVP  244



>ref|XP_010518081.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Camelina 
sativa]
Length=268

 Score =   390 bits (1003),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 206/231 (89%), Gaps = 1/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE V  SAAWLGRGLSC+CAQ R+SDA  +F+LTPAQEECLQ LQSR+D++YD +IP HQ
Sbjct  29    AEAVP-SAAWLGRGLSCVCAQRRDSDANSTFDLTPAQEECLQSLQSRIDVAYDSTIPLHQ  87

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALR LW  AFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NF  SF
Sbjct  88    EALRELWKLAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFQKSF  147

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+N+TFMLIQMLDLEAVKPR +VGATFLKFL+ENE AFD
Sbjct  148   QDLLRKQVGDRSVWEYPFAVAGINLTFMLIQMLDLEAVKPRTIVGATFLKFLSENEYAFD  207

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LEDI  LEDLP
Sbjct  208   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDIMHLEDLP  258



>emb|CDX83414.1| BnaA03g20920D [Brassica napus]
Length=267

 Score =   390 bits (1003),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 208/231 (90%), Gaps = 1/231 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             E V GSAAWLGRGLSC+CAQ R+SDA  +F+LTPAQEECLQRLQ+R+D++YD +IP HQ 
Sbjct  30    EGVPGSAAWLGRGLSCVCAQRRDSDAHSTFDLTPAQEECLQRLQNRIDVAYDTTIPLHQE  89

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             ALR LW  AFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NF  SFQ
Sbjct  90    ALRNLWKLAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFQKSFQ  149

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFL-AENESAFD  903
             DLL+K+ G+RS+WEYPFAVAG+N+TFMLIQM+DLEAVKPR +VGATFLKFL AE+ESAFD
Sbjct  150   DLLRKQVGERSVWEYPFAVAGINLTFMLIQMVDLEAVKPRTIVGATFLKFLSAESESAFD  209

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
              LYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LEDIT LEDLP
Sbjct  210   SLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDITHLEDLP  260



>ref|XP_004515335.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Cicer 
arietinum]
Length=264

 Score =   390 bits (1002),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 192/231 (83%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
              E VAGSAAWLGRGLSC+C Q R+SDA  +F+ T AQEECLQRLQ R+++ YD SI EHQ
Sbjct  27    TEAVAGSAAWLGRGLSCVCVQRRDSDASSTFDFTLAQEECLQRLQRRIEVPYDSSIIEHQ  86

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALRALWN AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLEN L+FA NFP SF
Sbjct  87    EALRALWNVAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLFFARNFPKSF  146

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL KREGDRS+WEYPFAVAGVNITFML+QMLDLEAVKPR LVGATF+KFL ENESAFD
Sbjct  147   QDLLWKREGDRSVWEYPFAVAGVNITFMLVQMLDLEAVKPRTLVGATFVKFLEENESAFD  206

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMDHQWLSMRASYMDFN+VMK+TRRQLEKELLLE+++RLEDLP
Sbjct  207   LLYCIAFKLMDHQWLSMRASYMDFNTVMKSTRRQLEKELLLEEVSRLEDLP  257



>ref|XP_009142281.1| PREDICTED: ELMO domain-containing protein A isoform X2 [Brassica 
rapa]
Length=265

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = +1

Query  361   CAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEH  540
              +E V GSAAWLGRGLSC+CAQ R+SD   +F+LTPAQEE LQ LQ+R+D++YD +IP H
Sbjct  27    SSEGVPGSAAWLGRGLSCVCAQRRDSDTNSTFDLTPAQEESLQSLQNRIDVAYDSTIPLH  86

Query  541   QSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNS  720
             Q ALR LW  AFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NF  S
Sbjct  87    QEALRDLWKLAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFQKS  146

Query  721   FQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAF  900
             FQDLL+K+ GDRS+WEYPFAVAG+N+TFMLIQMLDLEAVKPR +VG TFLKFL+ENESAF
Sbjct  147   FQDLLRKQVGDRSVWEYPFAVAGINLTFMLIQMLDLEAVKPRTVVGGTFLKFLSENESAF  206

Query  901   DLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             DLLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LEDI  LEDLP
Sbjct  207   DLLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDIMHLEDLP  258



>ref|XP_009388250.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=265

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 207/230 (90%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             EVV GS AW+G+G SC+CAQ RESDAR SF+LTP+QEECL RLQ R+D+SYD S  EHQ 
Sbjct  29    EVVTGSTAWIGKGFSCVCAQGRESDARVSFDLTPSQEECLHRLQYRLDVSYDSSKKEHQE  88

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             ALR LW AA+P  ELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA N+P SFQ
Sbjct  89    ALRGLWYAAYPGIELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARNYPKSFQ  148

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
             DLL+K++GDR++WEYPFAVAGVNITFMLIQMLDL+A KPR+++GA FLK L+EN+ AFD+
Sbjct  149   DLLRKQDGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPRSIIGAIFLKLLSENDRAFDV  208

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYCITFKLMD QWL+MRASYMDFN+VMK+TR QLE+EL+LED++R+EDLP
Sbjct  209   LYCITFKLMDQQWLAMRASYMDFNTVMKSTRHQLEQELVLEDVSRIEDLP  258



>ref|XP_010661409.1| PREDICTED: ELMO domain-containing protein A isoform X2 [Vitis 
vinifera]
Length=252

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 208/237 (88%), Gaps = 15/237 (6%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQSR+++SYD 
Sbjct  24    TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQSRIEVSYDS  83

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             SI EHQ ALRALWNA+FPEEELRDLISEQWKEMGWQGKDP+TDFR               
Sbjct  84    SISEHQEALRALWNASFPEEELRDLISEQWKEMGWQGKDPSTDFR---------------  128

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             N+P SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEAVKPR++ GA FLKFL+E
Sbjct  129   NYPKSFQDLLRKQEGDRALWEYPFAVAGVNITFMLIQMLDLEAVKPRSMAGAIFLKFLSE  188

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NESAFDLLYCITFKLMD+QWL+M ASYMDFN+VMK+TR QLE+ELLLED++RLEDLP
Sbjct  189   NESAFDLLYCITFKLMDNQWLAMHASYMDFNTVMKSTRCQLERELLLEDVSRLEDLP  245



>emb|CDY23455.1| BnaC04g49830D [Brassica napus]
Length=267

 Score =   389 bits (998),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/232 (80%), Positives = 205/232 (88%), Gaps = 1/232 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE V GSAAWLGRGLSC+CAQ R+SD   +F+LTPAQEECLQ LQ+R+D++YD +IP HQ
Sbjct  29    AEGVPGSAAWLGRGLSCVCAQRRDSDTNSTFDLTPAQEECLQSLQNRIDVAYDSTIPLHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALR LW  AFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NF  SF
Sbjct  89    EALRDLWKLAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFQKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFL-AENESAF  900
             QDLL+K+ GDRS+WEYPFAVAG+N+TFMLIQMLDLEAVKPR  VGATFLKFL AEN SAF
Sbjct  149   QDLLRKQVGDRSVWEYPFAVAGINLTFMLIQMLDLEAVKPRTAVGATFLKFLSAENVSAF  208

Query  901   DLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             DLLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LEDI  LEDLP
Sbjct  209   DLLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDIMHLEDLP  260



>emb|CDY41180.1| BnaA09g38350D [Brassica napus]
Length=270

 Score =   389 bits (998),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE VAGSAAWLGRGLSC+C Q    DARPSF+LTPAQEE LQRLQSRMD++YD SIP HQ
Sbjct  33    AEAVAGSAAWLGRGLSCVCVQGSHGDARPSFDLTPAQEEGLQRLQSRMDVAYDSSIPHHQ  92

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ LW  AFPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA +FP  F
Sbjct  93    EALKDLWKLAFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARSFPKCF  152

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+NITFMLIQML LEAVKP+++VG TFL+FL+ NESAFD
Sbjct  153   QDLLRKQVGDRSVWEYPFAVAGINITFMLIQMLGLEAVKPQSIVGETFLRFLSVNESAFD  212

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSM ASYM+FN+VMK+TRRQLE+E++++DIT +ED+P
Sbjct  213   LLYCIAFKLMDQQWLSMHASYMEFNTVMKSTRRQLEREIMVKDITGIEDMP  263



>ref|XP_011017372.1| PREDICTED: ELMO domain-containing protein C-like isoform X2 [Populus 
euphratica]
 ref|XP_011017373.1| PREDICTED: ELMO domain-containing protein C-like isoform X2 [Populus 
euphratica]
Length=240

 Score =   387 bits (994),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +1

Query  346  NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             C    AE VAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECLQRLQSR+D+ YD 
Sbjct  24   TCHSTSAEAVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPVQEECLQRLQSRIDVPYDS  83

Query  526  SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
            S+ +HQ AL+ALWNAAFPEEEL DLISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  84   SVLDHQEALKALWNAAFPEEELHDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  143

Query  706  NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
            NFP SFQDLLQKREGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAE
Sbjct  144  NFPKSFQDLLQKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAE  203

Query  886  NESAFDLLYCITFKLMDHQWLSMRASYMDFN  978
            N+ AFDLLYCITFKLMDH+WL+MRASYMDFN
Sbjct  204  NDLAFDLLYCITFKLMDHEWLTMRASYMDFN  234



>emb|CDY30485.1| BnaA04g25860D [Brassica napus]
Length=267

 Score =   388 bits (997),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 206/233 (88%), Gaps = 1/233 (0%)
 Frame = +1

Query  361   CAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEH  540
              AE V GSAAWLGRGLSC+CAQ R+SD   +F+LTPAQEE LQ LQ+R+D++YD +IP H
Sbjct  28    SAEGVPGSAAWLGRGLSCVCAQRRDSDTNSTFDLTPAQEESLQSLQNRIDVAYDSTIPLH  87

Query  541   QSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNS  720
             Q AL+ LW  AFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NF  S
Sbjct  88    QEALKDLWKLAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFQKS  147

Query  721   FQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFL-AENESA  897
             FQDLL+K+ GDRS+WEYPFAVAG+N+TFMLIQMLDLEAVKPR +VGATFLKFL AENESA
Sbjct  148   FQDLLRKQVGDRSVWEYPFAVAGINLTFMLIQMLDLEAVKPRTVVGATFLKFLSAENESA  207

Query  898   FDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             FDLLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LEDI  LEDLP
Sbjct  208   FDLLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDIMHLEDLP  260



>ref|XP_006375163.1| hypothetical protein POPTR_0014s04870g [Populus trichocarpa]
 gb|ERP52960.1| hypothetical protein POPTR_0014s04870g [Populus trichocarpa]
Length=240

 Score =   385 bits (990),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +1

Query  346  NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QEECLQRLQSR+D++YD 
Sbjct  24   TCHSSSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPPQEECLQRLQSRIDVAYDS  83

Query  526  SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
            S+PEHQ AL+ALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  84   SVPEHQEALKALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  143

Query  706  NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
            NFP SFQDLLQKREGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFL E
Sbjct  144  NFPTSFQDLLQKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLEE  203

Query  886  NESAFDLLYCITFKLMDHQWLSMRASYMDFN  978
            ++SAFD LYCITFKLMDH+WL MRASYMDFN
Sbjct  204  DDSAFDRLYCITFKLMDHEWLDMRASYMDFN  234



>ref|XP_010661411.1| PREDICTED: ELMO domain-containing protein A isoform X4 [Vitis 
vinifera]
Length=234

 Score =   385 bits (988),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +1

Query  346  NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEECLQRLQSR+++SYD 
Sbjct  24   TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEECLQRLQSRIEVSYDS  83

Query  526  SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
            SI EHQ ALRALWNA+FPEEELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  84   SISEHQEALRALWNASFPEEELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  143

Query  706  NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
            N+P SFQDLL+K+EGDR++WEYPFAVAGVNITFMLIQMLDLEAVKPR++ GA FLKFL+E
Sbjct  144  NYPKSFQDLLRKQEGDRALWEYPFAVAGVNITFMLIQMLDLEAVKPRSMAGAIFLKFLSE  203

Query  886  NESAFDLLYCITFKLMDHQWLSMRASYMDFN  978
            NESAFDLLYCITFKLMD+QWL+M ASYMDFN
Sbjct  204  NESAFDLLYCITFKLMDNQWLAMHASYMDFN  234



>ref|XP_004953303.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Setaria 
italica]
Length=266

 Score =   385 bits (989),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV GS AW+GRGLSC+CAQ R+SDAR SF+LTP QEECLQRLQ+R+++ YD S  EHQ
Sbjct  29    AEVVTGSTAWIGRGLSCVCAQRRDSDARLSFDLTPMQEECLQRLQNRIEVQYDSSNREHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL ALW A+FP  ELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA N+P SF
Sbjct  89    EALHALWCASFPGTELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARNYPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL+AVKPR+L GA FLKFL+EN+ AFD
Sbjct  149   QELLRKQNGDRAIWEYPFAVAGVNITFMLIQMLDLQAVKPRSLFGAVFLKFLSENDQAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ++YCITFKLMD QWL M A+YMDFN+VMK+TRRQLE+ELL+EDI R+EDLP
Sbjct  209   IIYCITFKLMDQQWLDMHATYMDFNTVMKSTRRQLERELLIEDIQRIEDLP  259



>ref|XP_009388256.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=261

 Score =   384 bits (985),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +1

Query  379   GSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRA  558
             GS AW+G+G SC+CAQ RESDAR SF+LTP+QEECL RLQ R+D+SYD S  EHQ ALR 
Sbjct  29    GSTAWIGKGFSCVCAQGRESDARVSFDLTPSQEECLHRLQYRLDVSYDSSKKEHQEALRG  88

Query  559   LWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQ  738
             LW AA+P  ELRDLISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA N+P SFQDLL+
Sbjct  89    LWYAAYPGIELRDLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARNYPKSFQDLLR  148

Query  739   KREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCI  918
             K++GDR++WEYPFAVAGVNITFMLIQMLDL+A KPR+++GA FLK L+EN+ AFD+LYCI
Sbjct  149   KQDGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPRSIIGAIFLKLLSENDRAFDVLYCI  208

Query  919   TFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             TFKLMD QWL+MRASYMDFN+VMK+TR QLE+EL+LED++R+EDLP
Sbjct  209   TFKLMDQQWLAMRASYMDFNTVMKSTRHQLEQELVLEDVSRIEDLP  254



>ref|XP_002452823.1| hypothetical protein SORBIDRAFT_04g033230 [Sorghum bicolor]
 gb|EES05799.1| hypothetical protein SORBIDRAFT_04g033230 [Sorghum bicolor]
Length=266

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV GS+AW+GRGLSC+CAQ R+SDAR SF+LTP QEECLQRLQ+R+++ YD +  EHQ
Sbjct  29    AEVVTGSSAWIGRGLSCVCAQRRDSDARLSFDLTPVQEECLQRLQNRIEVQYDSANREHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ALW A+FP  ELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYF+ N+P SF
Sbjct  89    EALQALWCASFPGTELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFSRNYPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL+AVKPR+L GA FLK L+EN+ AFD
Sbjct  149   QELLRKQNGDRAIWEYPFAVAGVNITFMLIQMLDLQAVKPRSLFGAVFLKLLSENDRAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMD QWL M A+YMDFN+VMK+TRRQLE+ELL+EDI R+ED+P
Sbjct  209   ILYCITFKLMDQQWLDMHATYMDFNTVMKSTRRQLERELLIEDIQRIEDMP  259



>ref|XP_004953302.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Setaria 
italica]
Length=308

 Score =   385 bits (988),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV GS AW+GRGLSC+CAQ R+SDAR SF+LTP QEECLQRLQ+R+++ YD S  EHQ
Sbjct  71    AEVVTGSTAWIGRGLSCVCAQRRDSDARLSFDLTPMQEECLQRLQNRIEVQYDSSNREHQ  130

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL ALW A+FP  ELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA N+P SF
Sbjct  131   EALHALWCASFPGTELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARNYPKSF  190

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL+AVKPR+L GA FLKFL+EN+ AFD
Sbjct  191   QELLRKQNGDRAIWEYPFAVAGVNITFMLIQMLDLQAVKPRSLFGAVFLKFLSENDQAFD  250

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ++YCITFKLMD QWL M A+YMDFN+VMK+TRRQLE+ELL+EDI R+EDLP
Sbjct  251   IIYCITFKLMDQQWLDMHATYMDFNTVMKSTRRQLERELLIEDIQRIEDLP  301



>ref|XP_009604046.1| PREDICTED: ELMO domain-containing protein A-like isoform X3 [Nicotiana 
tomentosiformis]
Length=247

 Score =   382 bits (982),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = +1

Query  352  IDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSI  531
            IDIC EVVAGSAAWLGRGLSC+CAQ R+ DARPSF+LTP QEECL RLQ+R+D++YD SI
Sbjct  39   IDIC-EVVAGSAAWLGRGLSCVCAQTRDIDARPSFDLTPVQEECLLRLQNRIDVAYDSSI  97

Query  532  PEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNF  711
            PEHQ ALRALW AAFPEEEL  L+SEQWKEMGWQGKDP+TDFRG GFISLENLLYF  NF
Sbjct  98   PEHQEALRALWKAAFPEEELHGLVSEQWKEMGWQGKDPSTDFRGAGFISLENLLYFVRNF  157

Query  712  PNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENE  891
            P SFQDLLQK+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPRNLVGATFLKFLAENE
Sbjct  158  PKSFQDLLQKQEGDRALWEYPFAVAGVNITFMLIQMLDLEAIKPRNLVGATFLKFLAENE  217

Query  892  SAFDLLYCITFKLMDHQWLSMRASYMDFN  978
            SAFDLLYCITFKLMD+QWL+M ASYMDFN
Sbjct  218  SAFDLLYCITFKLMDNQWLAMHASYMDFN  246



>ref|NP_001047599.1| Os02g0652300 [Oryza sativa Japonica Group]
 emb|CAC39036.1| putative protein [Oryza sativa]
 dbj|BAD24972.1| phagocytosis and cell motility protein ELMO1-like [Oryza sativa 
Japonica Group]
 dbj|BAF09513.1| Os02g0652300 [Oryza sativa Japonica Group]
 dbj|BAG91455.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73705.1| hypothetical protein OsI_08302 [Oryza sativa Indica Group]
 gb|EEE57486.1| hypothetical protein OsJ_07760 [Oryza sativa Japonica Group]
Length=269

 Score =   383 bits (983),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV GS AW+G+GLSC+CAQ R+SDAR SF+LTP QEECLQRLQ+R+++ YD S  +HQ
Sbjct  32    AEVVTGSTAWIGKGLSCVCAQRRDSDARLSFDLTPVQEECLQRLQNRLEVQYDSSNSDHQ  91

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ LW A+FP  ELR LISEQWKEMGWQGKDP+TDFRGGGFISLENL+YF+ NFP SF
Sbjct  92    EALKDLWRASFPGAELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLVYFSKNFPKSF  151

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL++VKPR+ +GA FLK L+EN+ AFD
Sbjct  152   QELLRKQNGDRAIWEYPFAVAGVNITFMLIQMLDLQSVKPRSFIGAVFLKLLSENDQAFD  211

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMD QWL M A+YMDFN+VMK+TRRQLE+ELLLEDI R+ED+P
Sbjct  212   ILYCITFKLMDQQWLDMHATYMDFNTVMKSTRRQLERELLLEDIQRIEDMP  262



>ref|NP_001142177.1| uncharacterized protein LOC100274345 [Zea mays]
 gb|ACF87828.1| unknown [Zea mays]
 gb|ACG41448.1| ELMO domain-containing protein 2 [Zea mays]
 gb|AFW72579.1| ELMO domain-containing protein 2 [Zea mays]
Length=266

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV GS AW+GRGLSC+CAQ R+SDAR SF+LTP QEECLQRLQ+R+++ YD +  EHQ
Sbjct  29    AEVVTGSTAWIGRGLSCVCAQRRDSDARLSFDLTPVQEECLQRLQNRIEVQYDSANREHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL++LW A+FP  ELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA N+P SF
Sbjct  89    EALQSLWCASFPGTELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNYPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL++VKPR+L GA FLK L+EN+ AFD
Sbjct  149   QELLRKQNGDRAIWEYPFAVAGVNITFMLIQMLDLQSVKPRSLFGAVFLKLLSENDQAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMD QWL M A+YMDFN+VMK+TRRQLE+ELL+EDI R+ED+P
Sbjct  209   ILYCITFKLMDQQWLDMHATYMDFNTVMKSTRRQLERELLIEDIQRIEDMP  259



>ref|XP_004492915.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Cicer 
arietinum]
Length=233

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = +1

Query  364  AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
            AE V GS AWLGRGLSC+CAQ RESDARPSF+LTP+QEECLQRLQSR+D+ YD SIP HQ
Sbjct  29   AEYVTGSTAWLGRGLSCVCAQRRESDARPSFDLTPSQEECLQRLQSRIDVPYDSSIPAHQ  88

Query  544  SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
             +LRALWNAAFPEEELR LISEQWK+MGWQGKDP+TDFRGGG+ISLENLL+FA NFP SF
Sbjct  89   ESLRALWNAAFPEEELRGLISEQWKDMGWQGKDPSTDFRGGGYISLENLLFFARNFPKSF  148

Query  724  QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
            QDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAENESAFD
Sbjct  149  QDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAENESAFD  208

Query  904  LLYCITFKLMDHQWLSMRASYMDFN  978
            LLYCITFKLMD+QWL MRASYMDFN
Sbjct  209  LLYCITFKLMDNQWLLMRASYMDFN  233



>ref|XP_009758301.1| PREDICTED: ELMO domain-containing protein A-like isoform X3 [Nicotiana 
sylvestris]
Length=263

 Score =   380 bits (977),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 183/240 (76%), Positives = 203/240 (85%), Gaps = 17/240 (7%)
 Frame = +1

Query  337   FMPNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDIS  516
              M   ID+C EVVAGSAAWLGRGLSC+CAQ R+ D RPSF+LTP QEECL RLQ+R+D++
Sbjct  34    LMRANIDVC-EVVAGSAAWLGRGLSCVCAQTRDIDTRPSFDLTPVQEECLLRLQNRIDVA  92

Query  517   YDRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLY  696
             YD SIPEHQ ALRALW AAFPEEEL  L+SEQWKEMGWQGKDP+TDFRG GFISLENLLY
Sbjct  93    YDSSIPEHQEALRALWKAAFPEEELHGLVSEQWKEMGWQGKDPSTDFRGAGFISLENLLY  152

Query  697   FANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKF  876
             F  NFP SFQDLLQK+EGDR++WEYPFAVAGVNITFMLIQMLDLE               
Sbjct  153   FVRNFPKSFQDLLQKQEGDRALWEYPFAVAGVNITFMLIQMLDLE---------------  197

Query  877   LAENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
              A+NESAFDLLYCITFKLMD+QWL+M ASYMDFN+VMK+TRRQ+E+ELL EDITRLEDLP
Sbjct  198   -AKNESAFDLLYCITFKLMDNQWLAMHASYMDFNTVMKSTRRQIERELLQEDITRLEDLP  256



>ref|XP_008681555.1| PREDICTED: uncharacterized protein LOC100274345 isoform X1 [Zea 
mays]
 gb|ACN30790.1| unknown [Zea mays]
 gb|AFW72578.1| hypothetical protein ZEAMMB73_000126 [Zea mays]
Length=312

 Score =   381 bits (979),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV GS AW+GRGLSC+CAQ R+SDAR SF+LTP QEECLQRLQ+R+++ YD +  EHQ
Sbjct  75    AEVVTGSTAWIGRGLSCVCAQRRDSDARLSFDLTPVQEECLQRLQNRIEVQYDSANREHQ  134

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL++LW A+FP  ELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA N+P SF
Sbjct  135   EALQSLWCASFPGTELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNYPKSF  194

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL++VKPR+L GA FLK L+EN+ AFD
Sbjct  195   QELLRKQNGDRAIWEYPFAVAGVNITFMLIQMLDLQSVKPRSLFGAVFLKLLSENDQAFD  254

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMD QWL M A+YMDFN+VMK+TRRQLE+ELL+EDI R+ED+P
Sbjct  255   ILYCITFKLMDQQWLDMHATYMDFNTVMKSTRRQLERELLIEDIQRIEDMP  305



>dbj|BAJ88229.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=269

 Score =   380 bits (975),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 204/231 (88%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV GS AW+GRGLSC+C Q+R+SDAR SF+LTP QEECL RLQ+R++I YD S  EHQ
Sbjct  32    AEVVTGSTAWIGRGLSCVCVQSRDSDARLSFDLTPVQEECLLRLQNRIEIQYDSSNIEHQ  91

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
               L+ALW A+FP  ELR L+SEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA N+P SF
Sbjct  92    DELKALWCASFPGTELRGLVSEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARNYPKSF  151

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL+AVKPR+L GA FLK L+EN+ AFD
Sbjct  152   QELLRKQNGDRAIWEYPFAVAGVNITFMLIQMLDLQAVKPRSLFGAVFLKLLSENDRAFD  211

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMD QWL M A+YMDFN+VMK+TRRQLE+ELLLEDI R+ED+P
Sbjct  212   ILYCITFKLMDQQWLDMHATYMDFNTVMKSTRRQLERELLLEDIQRVEDMP  262



>ref|XP_009758304.1| PREDICTED: ELMO domain-containing protein A-like isoform X5 [Nicotiana 
sylvestris]
Length=247

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 192/209 (92%), Gaps = 1/209 (0%)
 Frame = +1

Query  352  IDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSI  531
            ID+C EVVAGSAAWLGRGLSC+CAQ R+ D RPSF+LTP QEECL RLQ+R+D++YD SI
Sbjct  39   IDVC-EVVAGSAAWLGRGLSCVCAQTRDIDTRPSFDLTPVQEECLLRLQNRIDVAYDSSI  97

Query  532  PEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNF  711
            PEHQ ALRALW AAFPEEEL  L+SEQWKEMGWQGKDP+TDFRG GFISLENLLYF  NF
Sbjct  98   PEHQEALRALWKAAFPEEELHGLVSEQWKEMGWQGKDPSTDFRGAGFISLENLLYFVRNF  157

Query  712  PNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENE  891
            P SFQDLLQK+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPR LVGATFLKFLAENE
Sbjct  158  PKSFQDLLQKQEGDRALWEYPFAVAGVNITFMLIQMLDLEAIKPRTLVGATFLKFLAENE  217

Query  892  SAFDLLYCITFKLMDHQWLSMRASYMDFN  978
            SAFDLLYCITFKLMD+QWL+M ASYMDFN
Sbjct  218  SAFDLLYCITFKLMDNQWLAMHASYMDFN  246



>gb|EMT29368.1| ELMO domain-containing protein A [Aegilops tauschii]
Length=292

 Score =   380 bits (976),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV GS AW+GRGLSC+C Q+R+SDAR SF+LTP QEECL RLQ+R++I YD S  EHQ
Sbjct  55    AEVVTGSTAWIGRGLSCVCVQSRDSDARLSFDLTPVQEECLLRLQNRIEIQYDSSNIEHQ  114

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
               L+ALW A+FP  ELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA N+P SF
Sbjct  115   EELKALWCASFPGTELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARNYPKSF  174

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL+AVKPR+L+GA FLK L+EN+ AFD
Sbjct  175   QELLRKQNGDRAIWEYPFAVAGVNITFMLIQMLDLQAVKPRSLLGAVFLKLLSENDRAFD  234

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMD QWL M A+YMDFN+VMK+TRRQLE+ELL+EDI R+ED+P
Sbjct  235   ILYCITFKLMDQQWLDMHATYMDFNTVMKSTRRQLERELLIEDIQRVEDMP  285



>ref|XP_009758303.1| PREDICTED: ELMO domain-containing protein A-like isoform X4 [Nicotiana 
sylvestris]
Length=254

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 192/209 (92%), Gaps = 1/209 (0%)
 Frame = +1

Query  352  IDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSI  531
            ID+C EVVAGSAAWLGRGLSC+CAQ R+ D RPSF+LTP QEECL RLQ+R+D++YD SI
Sbjct  39   IDVC-EVVAGSAAWLGRGLSCVCAQTRDIDTRPSFDLTPVQEECLLRLQNRIDVAYDSSI  97

Query  532  PEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNF  711
            PEHQ ALRALW AAFPEEEL  L+SEQWKEMGWQGKDP+TDFRG GFISLENLLYF  NF
Sbjct  98   PEHQEALRALWKAAFPEEELHGLVSEQWKEMGWQGKDPSTDFRGAGFISLENLLYFVRNF  157

Query  712  PNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENE  891
            P SFQDLLQK+EGDR++WEYPFAVAGVNITFMLIQMLDLEA+KPR LVGATFLKFLAENE
Sbjct  158  PKSFQDLLQKQEGDRALWEYPFAVAGVNITFMLIQMLDLEAIKPRTLVGATFLKFLAENE  217

Query  892  SAFDLLYCITFKLMDHQWLSMRASYMDFN  978
            SAFDLLYCITFKLMD+QWL+M ASYMDFN
Sbjct  218  SAFDLLYCITFKLMDNQWLAMHASYMDFN  246



>emb|CDX71823.1| BnaC08g30510D [Brassica napus]
Length=268

 Score =   379 bits (972),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 170/222 (77%), Positives = 199/222 (90%), Gaps = 0/222 (0%)
 Frame = +1

Query  391   WLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRALWNA  570
             WLGRGLSC+C Q    DARPSF+LTP+QEECLQRLQSRMD++YD SIP+HQ AL+ LW  
Sbjct  40    WLGRGLSCVCVQGSHGDARPSFDLTPSQEECLQRLQSRMDVAYDSSIPQHQEALKDLWKL  99

Query  571   AFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQKREG  750
             AFPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA +FP SFQDLL+K+ G
Sbjct  100   AFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARSFPKSFQDLLRKQVG  159

Query  751   DRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCITFKL  930
             DRS+WEYPFAVAG+NITFMLIQML LEAVKPR++VG TFL+FL+ NE AFDLLYCI FKL
Sbjct  160   DRSVWEYPFAVAGINITFMLIQMLGLEAVKPRSIVGETFLRFLSVNEYAFDLLYCIAFKL  219

Query  931   MDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             MD QWLSM ASYM+FN+VMK+TRRQLE+E++++DIT +ED+P
Sbjct  220   MDQQWLSMHASYMEFNTVMKSTRRQLEREIMVKDITGIEDMP  261



>ref|XP_011032431.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Populus 
euphratica]
Length=224

 Score =   377 bits (967),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 186/238 (78%), Positives = 200/238 (84%), Gaps = 23/238 (10%)
 Frame = +1

Query  343   PNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYD  522
             P+    CAEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QE               
Sbjct  3     PDIQICCAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPPQE---------------  47

Query  523   RSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFA  702
                     AL+ALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA
Sbjct  48    --------ALKALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFA  99

Query  703   NNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLA  882
              NFP SFQDLLQKREGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLA
Sbjct  100   RNFPTSFQDLLQKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLA  159

Query  883   ENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             E++SAFD LYCITFKLMDH+WL M ASYMDFN+VMK+TRRQLE+ELL EDITRLE+LP
Sbjct  160   EDDSAFDRLYCITFKLMDHEWLDMHASYMDFNAVMKSTRRQLERELLSEDITRLEELP  217



>ref|XP_006648893.1| PREDICTED: ELMO domain-containing protein A-like [Oryza brachyantha]
Length=294

 Score =   379 bits (973),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 205/230 (89%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             EVV GS AW+G+GLSC+CAQ R+SDAR SF+LTP QEECLQRLQ+R+++ YD S  +HQ 
Sbjct  58    EVVTGSTAWIGKGLSCVCAQRRDSDARLSFDLTPVQEECLQRLQNRLEVQYDSSNSDHQE  117

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             AL+ LW+A+FP  ELR LISEQWKEMGWQGKDP+TDFRGGGFISLENL+YF+ NFP SF+
Sbjct  118   ALKDLWHASFPGAELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLVYFSKNFPKSFE  177

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
             +LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL++VKPR+ +GA FLK L+EN+ AFD+
Sbjct  178   ELLRKQNGDRAIWEYPFAVAGVNITFMLIQMLDLQSVKPRSFIGAVFLKLLSENDQAFDI  237

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYCITFKLMD QWL M A+YMDFN+VMK+TRRQLE+ELLLEDI R+ED+P
Sbjct  238   LYCITFKLMDQQWLDMHATYMDFNTVMKSTRRQLERELLLEDIQRIEDMP  287



>ref|XP_006375164.1| hypothetical protein POPTR_0014s04870g [Populus trichocarpa]
 gb|ERP52961.1| hypothetical protein POPTR_0014s04870g [Populus trichocarpa]
Length=244

 Score =   376 bits (965),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 198/237 (84%), Gaps = 23/237 (10%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP QE                
Sbjct  24    TCHSSSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPPQE----------------  67

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
                    AL+ALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  68    -------ALKALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  120

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             NFP SFQDLLQKREGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFL E
Sbjct  121   NFPTSFQDLLQKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLEE  180

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ++SAFD LYCITFKLMDH+WL MRASYMDFN+VMK+TRRQLE+ELL EDITRLE+LP
Sbjct  181   DDSAFDRLYCITFKLMDHEWLDMRASYMDFNAVMKSTRRQLERELLSEDITRLEELP  237



>emb|CDX89059.1| BnaA04g01270D [Brassica napus]
Length=270

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 168/222 (76%), Positives = 198/222 (89%), Gaps = 0/222 (0%)
 Frame = +1

Query  391   WLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRALWNA  570
             WLGRGLSC+C Q R+  +RPS +LTPAQEECLQRLQSR+D++YD SI +HQ AL+ LW  
Sbjct  41    WLGRGLSCVCVQGRDGASRPSLDLTPAQEECLQRLQSRIDVAYDTSITQHQEALKGLWKL  100

Query  571   AFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQKREG  750
              FPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA  FP SFQDLL+K+ G
Sbjct  101   VFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFISLENLLYFAKRFPKSFQDLLRKQVG  160

Query  751   DRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCITFKL  930
             DRS+WEYPFAVAG+NITFMLIQML LEAVKPR++VG TFL+FL+ NESAFD+LYCI FKL
Sbjct  161   DRSVWEYPFAVAGINITFMLIQMLGLEAVKPRSIVGETFLRFLSVNESAFDILYCIAFKL  220

Query  931   MDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             MD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDIT +ED+P
Sbjct  221   MDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEDITYIEDMP  262



>gb|KEH23422.1| ELMO/CED-12 family protein [Medicago truncatula]
Length=233

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = +1

Query  364  AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
            AE V GS AW+GRGLSC+CAQ RESDAR SF+LTP QEECLQRLQSR+D+ YD SIPEHQ
Sbjct  29   AEFVTGSTAWIGRGLSCVCAQRRESDARLSFDLTPYQEECLQRLQSRIDVPYDSSIPEHQ  88

Query  544  SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
            ++LRALWNAAFPEEEL  LISEQWK+MGWQGKDP+TDFRGGG+ISLENLL+FA NFP SF
Sbjct  89   ASLRALWNAAFPEEELNGLISEQWKDMGWQGKDPSTDFRGGGYISLENLLFFARNFPKSF  148

Query  724  QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
            QDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFLAENESAFD
Sbjct  149  QDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAENESAFD  208

Query  904  LLYCITFKLMDHQWLSMRASYMDFN  978
            LLYCITFKLMD+QWLSM ASYMDFN
Sbjct  209  LLYCITFKLMDNQWLSMHASYMDFN  233



>ref|XP_003569999.1| PREDICTED: ELMO domain-containing protein A-like [Brachypodium 
distachyon]
Length=269

 Score =   376 bits (966),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 204/231 (88%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV GS AW+GRGLSC+CAQ R+SDAR SF+LTP QEECL RLQ+R+++ YD S  EHQ
Sbjct  32    AEVVTGSTAWIGRGLSCVCAQGRDSDARLSFDLTPVQEECLLRLQNRIEVQYDSSNREHQ  91

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
               L+ALW A+FP  EL+ LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA N+P SF
Sbjct  92    EELKALWCASFPGIELQGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARNYPKSF  151

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL+AVKPR+L GA FLK L+EN+ AFD
Sbjct  152   QELLRKQNGDRAIWEYPFAVAGVNITFMLIQMLDLQAVKPRSLFGAVFLKLLSENDRAFD  211

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             ++YC+TFK+MD QWL M A+YMDFN+VMKATRRQ+E+ELLLEDI R+ED+P
Sbjct  212   IIYCVTFKVMDQQWLDMHATYMDFNTVMKATRRQIERELLLEDILRIEDMP  262



>gb|KHG04304.1| ELMO domain-containing A [Gossypium arboreum]
Length=318

 Score =   377 bits (969),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = +1

Query  364  AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
            AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTP++EECLQRLQ+R+DI+YD SIPEHQ
Sbjct  45   AEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPSEEECLQRLQNRIDIAYDSSIPEHQ  104

Query  544  SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
             ALRALWNA FPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA +FP SF
Sbjct  105  EALRALWNAVFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARHFPKSF  164

Query  724  QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
            +DLL K+EGDRS WEYPFAVAGVNITFMLIQMLDLEAVKPR +VGA FLKFL+ENESAFD
Sbjct  165  KDLLWKQEGDRSAWEYPFAVAGVNITFMLIQMLDLEAVKPRTMVGAIFLKFLSENESAFD  224

Query  904  LLYCITFKLMDHQWLSMRASYMDFN  978
            +LYCI FKLMD QWL+MRASYMDFN
Sbjct  225  ILYCIAFKLMDRQWLAMRASYMDFN  249



>gb|KCW76868.1| hypothetical protein EUGRSUZ_D01221 [Eucalyptus grandis]
Length=237

 Score =   374 bits (960),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +1

Query  346  NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEE LQRLQSR+D++YD 
Sbjct  23   TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEESLQRLQSRIDVAYDS  82

Query  526  SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
            SI EHQ ALRALW+AAFPEEEL  LI+EQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  83   SILEHQEALRALWHAAFPEEELHGLITEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  142

Query  706  NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
            NFP SFQDLL+K+EGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFL+E
Sbjct  143  NFPKSFQDLLRKQEGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLSE  202

Query  886  NESAFDLLYCITFKLMDHQWLSMRAS  963
            NESAFDLLYCITFKLMD+QWL+MRAS
Sbjct  203  NESAFDLLYCITFKLMDNQWLAMRAS  228



>ref|XP_007134409.1| hypothetical protein PHAVU_010G045300g [Phaseolus vulgaris]
 gb|ESW06403.1| hypothetical protein PHAVU_010G045300g [Phaseolus vulgaris]
Length=212

 Score =   373 bits (957),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  358  ICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPE  537
            + AEVVAGSAAWLGRGLSC+C Q  +SDA  SF+LT AQEECL +LQ R+D+ YD SI E
Sbjct  6    VAAEVVAGSAAWLGRGLSCVCVQRTDSDASNSFDLTLAQEECLHKLQRRIDVPYDSSIIE  65

Query  538  HQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPN  717
            HQ ALRALWNAAFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLEN LYFA NFP 
Sbjct  66   HQDALRALWNAAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLYFARNFPK  125

Query  718  SFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESA  897
            SFQDLL+K+EGDRS+WEYPFAVAGVNIT+MLIQ+LDLEAVKPRNLVGATFLKFLAENESA
Sbjct  126  SFQDLLRKQEGDRSVWEYPFAVAGVNITYMLIQLLDLEAVKPRNLVGATFLKFLAENESA  185

Query  898  FDLLYCITFKLMDHQWLSMRASYMDFN  978
            FDLLYCITFKLMDHQWLSMRASYMDFN
Sbjct  186  FDLLYCITFKLMDHQWLSMRASYMDFN  212



>gb|KHG05886.1| ELMO domain-containing A [Gossypium arboreum]
Length=235

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/246 (76%), Positives = 202/246 (82%), Gaps = 32/246 (13%)
 Frame = +1

Query  337   FMPNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDIS  516
             F+  C     EVVAGS AWLGRGLSC+CAQ+RESDARPSF+LTP+QE             
Sbjct  9     FLTGC---TPEVVAGSTAWLGRGLSCVCAQSRESDARPSFDLTPSQE-------------  52

Query  517   YDRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLY  696
                       ALRALWNAAFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+
Sbjct  53    ----------ALRALWNAAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLF  102

Query  697   FANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEA------VKPRNLVG  858
             FA NFP SF+DLL K EGDRS+WEYPFAVAGVNITFMLIQMLDLEA      VKPR +VG
Sbjct  103   FATNFPKSFKDLLWKLEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVSFNSTVKPRTMVG  162

Query  859   ATFLKFLAENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDIT  1038
             A FLKFL+ENESAFDLLYCITFKLMDHQWL+MRASYMDFN+VMKATRRQLE+ELLLEDIT
Sbjct  163   AVFLKFLSENESAFDLLYCITFKLMDHQWLAMRASYMDFNTVMKATRRQLERELLLEDIT  222

Query  1039  RLEDLP  1056
             RLEDLP
Sbjct  223   RLEDLP  228



>ref|XP_006653633.1| PREDICTED: ELMO domain-containing protein A-like [Oryza brachyantha]
Length=266

 Score =   370 bits (951),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 201/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV GS AW+GRG SC+CAQ RESD R SF+L+PAQEECLQRLQ+R+++ YD S  EHQ
Sbjct  29    AEVVTGSTAWIGRGFSCVCAQRRESDQRISFDLSPAQEECLQRLQNRIEVPYDSSNGEHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL++LW+ +FP  EL  L+S+QWKEMGWQGKDP+TDFRGGGFISLENLLYFA N+  SF
Sbjct  89    EALKSLWHVSFPGTELLGLVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFATNYTKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL KR GDR++WEYPFAVAGVNITFMLIQMLDL+A KPR+L+GA FL  L EN+ AFD
Sbjct  149   QELLCKRIGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPRSLIGAVFLNLLLENDRAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMDH+WL M A+YMDFNSV+K+TRRQLE+EL+LEDI R+ED+P
Sbjct  209   ILYCITFKLMDHKWLEMHANYMDFNSVIKSTRRQLERELVLEDIQRIEDMP  259



>ref|XP_009387888.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   370 bits (950),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 171/237 (72%), Positives = 204/237 (86%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVV GS AW+GRGLSC+CAQ R+++ R  F+LTP+QEECL+RLQSR+D++YD 
Sbjct  26    GCRSSPAEVVTGSTAWIGRGLSCVCAQRRDNNTRLLFDLTPSQEECLRRLQSRIDVAYDS  85

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S  EHQ AL ALW AA+P  EL  +IS+QWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  86    SKKEHQEALWALWYAAYPGVELYGIISDQWKEMGWQGKDPSTDFRGGGFISLENLLFFAK  145

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             N+P SFQDLLQKREG R+MWEYPFAVAGVNITFMLIQMLDL+A KP +++ + FLK L+E
Sbjct  146   NYPKSFQDLLQKREGVRAMWEYPFAVAGVNITFMLIQMLDLQAAKPTSMMASVFLKLLSE  205

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NE AFD+LYC++FK+MD QWL+MRASYMDFN VMK+TRRQLE+ELLLEDI R+ED+P
Sbjct  206   NERAFDMLYCMSFKMMDQQWLAMRASYMDFNLVMKSTRRQLEQELLLEDIQRIEDMP  262



>gb|KDO85482.1| hypothetical protein CISIN_1g024106mg [Citrus sinensis]
 gb|KDO85483.1| hypothetical protein CISIN_1g024106mg [Citrus sinensis]
Length=211

 Score =   368 bits (944),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  451   SFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGW  630
             +F+    QEECLQRLQ R+D++YD SIPEH+ ALRALWNAAFP+EELRDLISEQWKEMGW
Sbjct  3     NFHFWCCQEECLQRLQLRIDVAYDSSIPEHREALRALWNAAFPDEELRDLISEQWKEMGW  62

Query  631   QGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFML  810
             QGKDP+TDFRGGGFISLENLLY A NFP SFQDLL+K+EGDRS+WEYPFAVAGVNITFML
Sbjct  63    QGKDPSTDFRGGGFISLENLLYLARNFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFML  122

Query  811   IQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMK  990
             IQMLDLEAVKPR +VGATFLKFL+ENESAFDLLYCITFKLMDHQWL+MRASYMDFN+VMK
Sbjct  123   IQMLDLEAVKPRTMVGATFLKFLSENESAFDLLYCITFKLMDHQWLAMRASYMDFNTVMK  182

Query  991   ATRRQLEKELLLEDITRLEDLP  1056
             +TRRQLE+ELLLED+TRLEDLP
Sbjct  183   STRRQLERELLLEDVTRLEDLP  204



>gb|KCW76869.1| hypothetical protein EUGRSUZ_D01221 [Eucalyptus grandis]
Length=241

 Score =   369 bits (947),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 191/210 (91%), Gaps = 4/210 (2%)
 Frame = +1

Query  346  NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQEE LQRLQSR+D++YD 
Sbjct  23   TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEESLQRLQSRIDVAYDS  82

Query  526  SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
            SI EHQ ALRALW+AAFPEEEL  LI+EQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  83   SILEHQEALRALWHAAFPEEELHGLITEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  142

Query  706  NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLA-  882
            NFP SFQDLL+K+EGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPR LVGATFLKFL+ 
Sbjct  143  NFPKSFQDLLRKQEGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLSV  202

Query  883  ---ENESAFDLLYCITFKLMDHQWLSMRAS  963
               ENESAFDLLYCITFKLMD+QWL+MRAS
Sbjct  203  HLTENESAFDLLYCITFKLMDNQWLAMRAS  232



>emb|CAB87863.1| putative protein [Arabidopsis thaliana]
Length=250

 Score =   367 bits (941),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 195/231 (84%), Gaps = 16/231 (7%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVVAGSAAWLGRGLSC+C Q R+ D RPSF+LTPAQEECLQRLQSR+D++YD SIP+HQ
Sbjct  29    AEVVAGSAAWLGRGLSCVCVQGRDGDPRPSFDLTPAQEECLQRLQSRIDVAYDSSIPQHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ LW  AFPEEEL  ++S+QWKEMGWQGKDP+TDFRGGGFISLENLLYFA  FP SF
Sbjct  89    EALKDLWKLAFPEEELHGIVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFARKFPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
               LL+K+ GDRS+WEYPFAVAG+NITFMLIQMLDLEAV                NESAFD
Sbjct  149   HGLLRKQVGDRSVWEYPFAVAGINITFMLIQMLDLEAV----------------NESAFD  192

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDIT LEDLP
Sbjct  193   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLEREIMIEDITSLEDLP  243



>ref|XP_009138852.1| PREDICTED: ELMO domain-containing protein A isoform X2 [Brassica 
rapa]
Length=321

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 197/222 (89%), Gaps = 1/222 (0%)
 Frame = +1

Query  391   WLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRALWNA  570
             WLGRGLSC+C Q R+  +RPS +LTPAQE CLQRLQSR+D++YD SI +HQ AL+ LW  
Sbjct  93    WLGRGLSCVCVQGRDGASRPSLDLTPAQE-CLQRLQSRIDVAYDTSITQHQEALKGLWKL  151

Query  571   AFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQKREG  750
              FPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGF+SLENLLYFA  FP SFQDLL+K+ G
Sbjct  152   VFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFLSLENLLYFAKRFPKSFQDLLRKQVG  211

Query  751   DRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCITFKL  930
             DRS+WEYPFAVAG+NITFMLIQML LEAVKPR++VG TFL+FL+ NESAFD+LYCI FKL
Sbjct  212   DRSVWEYPFAVAGINITFMLIQMLGLEAVKPRSIVGETFLRFLSVNESAFDILYCIAFKL  271

Query  931   MDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             MD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDIT +ED+P
Sbjct  272   MDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEDITYIEDMP  313



>ref|XP_009138850.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Brassica 
rapa]
Length=345

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 197/222 (89%), Gaps = 1/222 (0%)
 Frame = +1

Query  391   WLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRALWNA  570
             WLGRGLSC+C Q R+  +RPS +LTPAQE CLQRLQSR+D++YD SI +HQ AL+ LW  
Sbjct  117   WLGRGLSCVCVQGRDGASRPSLDLTPAQE-CLQRLQSRIDVAYDTSITQHQEALKGLWKL  175

Query  571   AFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQKREG  750
              FPEEEL  ++SEQWKEMGWQGKDP+TDFRGGGF+SLENLLYFA  FP SFQDLL+K+ G
Sbjct  176   VFPEEELHGIVSEQWKEMGWQGKDPSTDFRGGGFLSLENLLYFAKRFPKSFQDLLRKQVG  235

Query  751   DRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCITFKL  930
             DRS+WEYPFAVAG+NITFMLIQML LEAVKPR++VG TFL+FL+ NESAFD+LYCI FKL
Sbjct  236   DRSVWEYPFAVAGINITFMLIQMLGLEAVKPRSIVGETFLRFLSVNESAFDILYCIAFKL  295

Query  931   MDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             MD QWLSMRASYM+FN+VMK+TRRQLE+E+++EDIT +ED+P
Sbjct  296   MDQQWLSMRASYMEFNTVMKSTRRQLEREIMVEDITYIEDMP  337



>gb|KEH17883.1| ELMO/CED-12 family protein [Medicago truncatula]
Length=234

 Score =   365 bits (936),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 187/215 (87%), Gaps = 0/215 (0%)
 Frame = +1

Query  346  NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             C    AE VAGSAAWLGRGLSC+CAQ R+SDA   F+LT AQEECL+RLQ R+++ YD 
Sbjct  20   TCNSNSAEAVAGSAAWLGRGLSCVCAQRRDSDAGSFFDLTLAQEECLERLQRRIEVPYDG  79

Query  526  SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
            SI EHQ AL+ALW  AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLEN L+FA 
Sbjct  80   SIVEHQEALKALWKVAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLFFAR  139

Query  706  NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
            NFP SFQDLL KREGDRS+WEYPFAVAGVNITFML+QMLDLEAVKPR LVGATFLKFL E
Sbjct  140  NFPKSFQDLLWKREGDRSVWEYPFAVAGVNITFMLVQMLDLEAVKPRTLVGATFLKFLEE  199

Query  886  NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMK  990
            NESAFDLLYCI FKLMDHQWLSMRASYMDFN  +K
Sbjct  200  NESAFDLLYCIAFKLMDHQWLSMRASYMDFNETIK  234



>ref|XP_010327663.1| PREDICTED: ELMO domain-containing protein A-like isoform X3 [Solanum 
lycopersicum]
Length=234

 Score =   363 bits (931),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = +1

Query  364  AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
            +EV+AGS AWLGRGLSC+CAQ  + D R SF++TPAQEECLQ+LQ+R+D++YD SIPEHQ
Sbjct  29   SEVMAGSTAWLGRGLSCVCAQGTDIDTRRSFDVTPAQEECLQKLQNRIDVAYDGSIPEHQ  88

Query  544  SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
             ALRALW AAFP EEL  LISEQWK+MGWQGKDP+TDFRG GFISLENLLYFA NF  SF
Sbjct  89   EALRALWKAAFPVEELHGLISEQWKDMGWQGKDPSTDFRGAGFISLENLLYFARNFQKSF  148

Query  724  QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
            QDLLQK+EGDR++WEYPFAVAGVNITFMLIQ+LD+EA+KPRNLVGATFLKFLAENESAFD
Sbjct  149  QDLLQKQEGDRALWEYPFAVAGVNITFMLIQILDIEAIKPRNLVGATFLKFLAENESAFD  208

Query  904  LLYCITFKLMDHQWLSMRASYMDFN  978
            LLYCITFKLMD+QWL+M ASYMDFN
Sbjct  209  LLYCITFKLMDYQWLAMHASYMDFN  233



>ref|NP_001053465.1| Os04g0545100 [Oryza sativa Japonica Group]
 emb|CAE04350.2| OSJNBb0038F03.14 [Oryza sativa Japonica Group]
 dbj|BAF15379.1| Os04g0545100 [Oryza sativa Japonica Group]
 emb|CAH67251.1| OSIGBa0101C23.3 [Oryza sativa Indica Group]
 dbj|BAG92503.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77742.1| hypothetical protein OsI_16858 [Oryza sativa Indica Group]
Length=266

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVVAGS AW+GRG SC+CAQ R+SD R SF+L+PAQE CLQRLQ+R+++ YD S  EHQ
Sbjct  29    AEVVAGSTAWIGRGFSCVCAQRRDSDQRISFDLSPAQECCLQRLQNRIEVPYDGSNGEHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ LW+ +FP  EL  L+S+QWKEMGWQGKDP+TDFRGGGFISLENLLYFA N+  SF
Sbjct  89    EALKTLWHVSFPGTELLGLVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFAKNYTKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL K+ GDR++WEYPFAVAGVNITFMLIQMLDL+A KPR+L+G+ FL  L EN+ AFD
Sbjct  149   QELLCKQNGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPRSLIGSVFLNLLLENDRAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMDH+WL M A+YMDFN+V+K+TRRQLE+ELLLEDI R+ED+P
Sbjct  209   ILYCITFKLMDHKWLEMHANYMDFNAVIKSTRRQLERELLLEDIQRIEDMP  259



>ref|XP_004956419.1| PREDICTED: ELMO domain-containing protein A-like [Setaria italica]
Length=267

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 199/231 (86%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV  S AW+GRGLSC+CAQ R+SDAR SF+L+P QEECLQRLQ+R+++ YD S  EHQ
Sbjct  30    AEVVGVSTAWIGRGLSCVCAQRRDSDARLSFDLSPIQEECLQRLQNRIEVQYDSSNLEHQ  89

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ALW A+FP  EL  L+S+QWKEMGWQGKDP+TDFRGGG+ISLENLLYF+  +P SF
Sbjct  90    KALKALWRASFPGTELLGLVSDQWKEMGWQGKDPSTDFRGGGYISLENLLYFSRTYPKSF  149

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL K+ GDR++WEYPFAVAGVNITFMLIQMLDL+A KP +L+GA FL  L EN+ AFD
Sbjct  150   QELLCKKNGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPTSLIGAVFLNLLLENDRAFD  209

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMD +WL M A+YMDFNSV+K+TRRQLE+ELLLEDI R+ED+P
Sbjct  210   ILYCITFKLMDQKWLDMHATYMDFNSVIKSTRRQLERELLLEDIQRIEDMP  260



>gb|ACR37958.1| unknown [Zea mays]
 gb|AFW59057.1| ELMO domain-containing protein 2 [Zea mays]
Length=266

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV  S AWLG+GLSC+CAQ RESD R SF+L+P QEECL RLQ+R+++ YD S  EHQ
Sbjct  29    AEVVGVSTAWLGKGLSCVCAQRRESDVRLSFDLSPIQEECLNRLQNRIEVQYDGSNLEHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL ALW ++FP  EL  L+S+QWKEMGWQGKDP+TDFRGGGFISLENLLYF+ N+P SF
Sbjct  89    KALEALWRSSFPGTELLGLVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFSRNYPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL+A KP +LVGA FL  L EN+ AFD
Sbjct  149   QELLRKQNGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPTSLVGAVFLNLLLENDRAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMD +WL M ASYMDFN+V+K+TRRQLE+ELLLEDI R+ED+P
Sbjct  209   ILYCITFKLMDQKWLEMHASYMDFNTVIKSTRRQLERELLLEDIQRIEDMP  259



>ref|XP_003580265.1| PREDICTED: ELMO domain-containing protein A-like [Brachypodium 
distachyon]
Length=259

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             A+VV+GS AW+GRG SC+C Q R+SD R SF+LTP QEECLQRLQ+R+++ YD    EHQ
Sbjct  22    ADVVSGSTAWIGRGFSCVCVQRRDSDTRISFDLTPIQEECLQRLQNRIEVPYDSKNREHQ  81

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ALW+A+FP  EL  L+S+QWKEMGWQGKDP+TDFRGGGFISLENLLYFA N+P SF
Sbjct  82    EALKALWHASFPGTELLGLVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNYPKSF  141

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             ++LL K+ GDR++WEYPFAVAGVNITFMLIQMLDL+A KPR+L+GA FL  L EN+ AFD
Sbjct  142   EELLCKQNGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPRSLIGAVFLNLLIENDRAFD  201

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMD +WL M A+YMDFN+V+K+TRRQLE+ELLLEDI ++ED+P
Sbjct  202   ILYCITFKLMDRKWLEMHATYMDFNAVIKSTRRQLERELLLEDIQQIEDMP  252



>dbj|BAJ86083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=260

 Score =   363 bits (931),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             A+VV+GS AW+GRG SC+C Q R+SDAR SF+LTP QEECLQRLQ+R+++ YD    EHQ
Sbjct  23    ADVVSGSTAWIGRGFSCVCVQRRDSDARISFDLTPIQEECLQRLQNRIEVPYDSQNREHQ  82

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL+ALW+A+FP  EL  L+S+QWKEMGWQGKDP+TDFRGGGFISLE LLYFA N+P SF
Sbjct  83    EALKALWHASFPGTELLGLVSDQWKEMGWQGKDPSTDFRGGGFISLEKLLYFAKNYPKSF  142

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             ++LL K+ GDR++WEYPFAVAGVNITFMLIQMLDL+A KPR+L+GA FL  L EN+ AFD
Sbjct  143   EELLCKQNGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPRSLIGAVFLNLLIENDRAFD  202

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMD +WL M A+YMDFN+V+K+TRRQLE+ELLLEDI ++ED+P
Sbjct  203   ILYCITFKLMDQKWLEMHATYMDFNTVIKSTRRQLERELLLEDIQQIEDMP  253



>gb|KEH17884.1| ELMO/CED-12 family protein [Medicago truncatula]
Length=230

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = +1

Query  346  NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             C    AE VAGSAAWLGRGLSC+CAQ R+SDA   F+LT AQEECL+RLQ R+++ YD 
Sbjct  20   TCNSNSAEAVAGSAAWLGRGLSCVCAQRRDSDAGSFFDLTLAQEECLERLQRRIEVPYDG  79

Query  526  SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
            SI EHQ AL+ALW  AFPEEELR LISEQWKEMGWQGKDP+TDFRGGGFISLEN L+FA 
Sbjct  80   SIVEHQEALKALWKVAFPEEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLFFAR  139

Query  706  NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
            NFP SFQDLL KREGDRS+WEYPFAVAGVNITFML+QMLDLEAVKPR LVGATFLKFL E
Sbjct  140  NFPKSFQDLLWKREGDRSVWEYPFAVAGVNITFMLVQMLDLEAVKPRTLVGATFLKFLEE  199

Query  886  NESAFDLLYCITFKLMDHQWLSMRASYMDFN  978
            NESAFDLLYCI FKLMDHQWLSMRASYMDFN
Sbjct  200  NESAFDLLYCIAFKLMDHQWLSMRASYMDFN  230



>ref|XP_002448269.1| hypothetical protein SORBIDRAFT_06g024230 [Sorghum bicolor]
 gb|EES12597.1| hypothetical protein SORBIDRAFT_06g024230 [Sorghum bicolor]
Length=266

 Score =   362 bits (929),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 197/231 (85%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV  S AWLG+GLSC+CAQ RE+DAR SF+L+P QEEC  RLQ+R+++ YD S  EHQ
Sbjct  29    AEVVGVSTAWLGKGLSCVCAQRRETDARLSFDLSPIQEECFHRLQNRIEVQYDGSNLEHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL ALW A+FP  EL  L+S+QWKEMGWQGKDP+TDFRGGGFISLENLLYF+ N+P SF
Sbjct  89    KALEALWRASFPGTELLGLVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFSRNYPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL K+ GDR++WEYPFAVAGVNITFMLIQMLDL+A KP +L+GA FL  L EN+ AFD
Sbjct  149   QELLCKKNGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPTSLIGAVFLNLLLENDRAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMD +WL M ASYMDFN+V+K+TRRQLE+ELLLEDI R+ED+P
Sbjct  209   ILYCITFKLMDQKWLEMHASYMDFNTVIKSTRRQLERELLLEDIQRIEDMP  259



>ref|XP_010327661.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327662.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Solanum 
lycopersicum]
Length=292

 Score =   363 bits (932),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  364  AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
            +EV+AGS AWLGRGLSC+CAQ  + D R SF++TPAQEECLQ+LQ+R+D++YD SIPEHQ
Sbjct  29   SEVMAGSTAWLGRGLSCVCAQGTDIDTRRSFDVTPAQEECLQKLQNRIDVAYDGSIPEHQ  88

Query  544  SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
             ALRALW AAFP EEL  LISEQWK+MGWQGKDP+TDFRG GFISLENLLYFA NF  SF
Sbjct  89   EALRALWKAAFPVEELHGLISEQWKDMGWQGKDPSTDFRGAGFISLENLLYFARNFQKSF  148

Query  724  QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
            QDLLQK+EGDR++WEYPFAVAGVNITFMLIQ+LD+EA+KPRNLVGATFLKFLAENESAFD
Sbjct  149  QDLLQKQEGDRALWEYPFAVAGVNITFMLIQILDIEAIKPRNLVGATFLKFLAENESAFD  208

Query  904  LLYCITFKLMDHQWLSMRASYMDFNSV  984
            LLYCITFKLMD+QWL+M ASYMDFN +
Sbjct  209  LLYCITFKLMDYQWLAMHASYMDFNFI  235



>ref|XP_009387889.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=264

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = +1

Query  379   GSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRA  558
             GS AW+GRGLSC+CAQ R+++ R  F+LTP+QEECL+RLQSR+D++YD S  EHQ AL A
Sbjct  32    GSTAWIGRGLSCVCAQRRDNNTRLLFDLTPSQEECLRRLQSRIDVAYDSSKKEHQEALWA  91

Query  559   LWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQ  738
             LW AA+P  EL  +IS+QWKEMGWQGKDP+TDFRGGGFISLENLL+FA N+P SFQDLLQ
Sbjct  92    LWYAAYPGVELYGIISDQWKEMGWQGKDPSTDFRGGGFISLENLLFFAKNYPKSFQDLLQ  151

Query  739   KREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCI  918
             KREG R+MWEYPFAVAGVNITFMLIQMLDL+A KP +++ + FLK L+ENE AFD+LYC+
Sbjct  152   KREGVRAMWEYPFAVAGVNITFMLIQMLDLQAAKPTSMMASVFLKLLSENERAFDMLYCM  211

Query  919   TFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +FK+MD QWL+MRASYMDFN VMK+TRRQLE+ELLLEDI R+ED+P
Sbjct  212   SFKMMDQQWLAMRASYMDFNLVMKSTRRQLEQELLLEDIQRIEDMP  257



>ref|XP_009389262.1| PREDICTED: ELMO domain-containing protein A [Musa acuminata subsp. 
malaccensis]
Length=269

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 195/237 (82%), Gaps = 0/237 (0%)
 Frame = +1

Query  346   NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
              C    AEVV GS AWLGRGL+C+CAQ RE D R   NLTP+QEECL+RLQSR+ ++YD 
Sbjct  26    GCHSSHAEVVTGSTAWLGRGLACVCAQRREIDGRLLLNLTPSQEECLRRLQSRIIVTYDS  85

Query  526   SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
             S  EHQ AL ALW  A+P  EL  LIS QWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  86    SNKEHQEALWALWYYAYPGVELHGLISNQWKEMGWQGKDPSTDFRGGGFISLENLLFFAK  145

Query  706   NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
             N+P SF  LL+K+EG R+MWEYPF+VAGVNITFMLIQM DL+A +PR++VGA FLK L E
Sbjct  146   NYPKSFHALLRKQEGVRAMWEYPFSVAGVNITFMLIQMFDLQAGRPRSMVGAIFLKLLLE  205

Query  886   NESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             NE AFD+LYCITFK+MD QWL+M ASYMDFN VMK+TRRQLE+ELLLED  R+ED+P
Sbjct  206   NERAFDMLYCITFKMMDQQWLAMHASYMDFNLVMKSTRRQLERELLLEDTQRIEDMP  262



>ref|NP_001167675.1| ELMO domain-containing protein 2 [Zea mays]
 gb|ACG34428.1| ELMO domain-containing protein 2 [Zea mays]
Length=266

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 197/231 (85%), Gaps = 0/231 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AEVV  S AWLG+GLSC+CAQ RESD R SF+L+P QEECL RLQ+R+++ YD S  EHQ
Sbjct  29    AEVVGVSTAWLGKGLSCVCAQRRESDVRLSFDLSPIQEECLNRLQNRIEVQYDGSNLEHQ  88

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              AL ALW ++FP  EL  L+S+QWKEMGWQGKDP+TDFRGGGFISLENLLYF+ N+P SF
Sbjct  89    KALEALWRSSFPGTELLGLVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFSRNYPKSF  148

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q+LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL+A KP +LVGA FL  L EN+ AFD
Sbjct  149   QELLRKQNGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPTSLVGAVFLNLLLENDRAFD  208

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +LYCITFKLMD +WL M ASYMDFN+ +K+TRRQLE+ELLLEDI R+ED+P
Sbjct  209   ILYCITFKLMDQKWLEMHASYMDFNTXIKSTRRQLERELLLEDIQRIEDMP  259



>ref|XP_009384690.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=271

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             EVVAGS AW+G+G SC+CAQ  +SDAR SF+LTP QEECL++LQ R+D++Y+ S  EHQ 
Sbjct  29    EVVAGSTAWIGKGFSCVCAQGIDSDARLSFDLTPCQEECLRKLQCRVDVAYESSKKEHQE  88

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
              LR LW AA+P  +L  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA  +P SFQ
Sbjct  89    TLRTLWYAAYPGVKLHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARRYPKSFQ  148

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
             DLL+K+EG+R++ EYPFAVAG+N+TFMLIQMLDL+  KPR++VGA FL  L+EN+ AFD+
Sbjct  149   DLLRKQEGNRALCEYPFAVAGINVTFMLIQMLDLQVAKPRSIVGAIFLNLLSENDWAFDI  208

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYCI FKLMD QWL+M ASYMDFN+VMK+TRRQLE+ELLLE+++R+EDLP
Sbjct  209   LYCIAFKLMDQQWLAMHASYMDFNTVMKSTRRQLEQELLLENVSRIEDLP  258



>ref|XP_009384689.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=273

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 200/232 (86%), Gaps = 2/232 (1%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             EVVAGS AW+G+G SC+CAQ  +SDAR SF+LTP QEECL++LQ R+D++Y+ S  EHQ 
Sbjct  29    EVVAGSTAWIGKGFSCVCAQGIDSDARLSFDLTPCQEECLRKLQCRVDVAYESSKKEHQE  88

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
              LR LW AA+P  +L  LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA  +P SFQ
Sbjct  89    TLRTLWYAAYPGVKLHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARRYPKSFQ  148

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAV--KPRNLVGATFLKFLAENESAF  900
             DLL+K+EG+R++ EYPFAVAG+N+TFMLIQMLDL+ V  KPR++VGA FL  L+EN+ AF
Sbjct  149   DLLRKQEGNRALCEYPFAVAGINVTFMLIQMLDLQVVAAKPRSIVGAIFLNLLSENDWAF  208

Query  901   DLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             D+LYCI FKLMD QWL+M ASYMDFN+VMK+TRRQLE+ELLLE+++R+EDLP
Sbjct  209   DILYCIAFKLMDQQWLAMHASYMDFNTVMKSTRRQLEQELLLENVSRIEDLP  260



>ref|NP_001146443.1| hypothetical protein [Zea mays]
 gb|ACF84505.1| unknown [Zea mays]
 gb|ACL53847.1| unknown [Zea mays]
 gb|ACL53999.1| unknown [Zea mays]
 tpg|DAA36633.1| TPA: hypothetical protein ZEAMMB73_196629 [Zea mays]
Length=267

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 195/232 (84%), Gaps = 1/232 (0%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGL-SCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEH  540
             AEVV  S AW+G+GL SC+CAQ  ESD R SF+L+P QEECL RLQ+R+++ YD S  EH
Sbjct  29    AEVVGVSTAWIGKGLTSCVCAQGTESDGRLSFDLSPIQEECLHRLQNRIEVQYDGSNLEH  88

Query  541   QSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNS  720
             Q AL ALW+A+FP  EL  L+S+QWKEMGWQGKDP+TDFRGGGFISLENLLYF+  +P S
Sbjct  89    QKALVALWHASFPGTELLGLVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFSKKYPKS  148

Query  721   FQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAF  900
             F +LL+K+ GDR++WEYPFAVAGVNITFMLIQMLDL+A KP +LVGA FL  L EN+ AF
Sbjct  149   FHELLRKQNGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPTSLVGAVFLNLLLENDRAF  208

Query  901   DLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             D+LYCITFKLMD +WL M ASYMDFN V+K+TRRQLE+ELLLEDI R++D+P
Sbjct  209   DILYCITFKLMDQKWLEMHASYMDFNVVIKSTRRQLERELLLEDIQRIQDMP  260



>ref|XP_008794921.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Phoenix 
dactylifera]
Length=230

 Score =   351 bits (900),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = +1

Query  346  NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             C    AEVV GS AW+GRGLSC+CAQ RESDAR SF+LTP+QEECLQRLQSR+ ++YD 
Sbjct  19   GCHSSPAEVVTGSTAWIGRGLSCVCAQRRESDARLSFDLTPSQEECLQRLQSRIQVAYDG  78

Query  526  SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
            S  EHQ ALRALW AA+P  ELR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  79   SKKEHQEALRALWYAAYPGVELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAK  138

Query  706  NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
            N+P SFQDLL+K+EGDR+MWEYPFAVAGVNITFMLIQMLDL   KPR ++GA FLK  +E
Sbjct  139  NYPKSFQDLLRKQEGDRAMWEYPFAVAGVNITFMLIQMLDLPCAKPRTMMGAIFLKLFSE  198

Query  886  NESAFDLLYCITFKLMDHQWLSMRASYMDFN  978
            NE AFDLLYC+TFKLMD QWL+MRASYMDFN
Sbjct  199  NERAFDLLYCVTFKLMDQQWLAMRASYMDFN  229



>ref|XP_010518082.1| PREDICTED: ELMO domain-containing protein C-like isoform X2 [Camelina 
sativa]
Length=252

 Score =   351 bits (901),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 191/231 (83%), Gaps = 17/231 (7%)
 Frame = +1

Query  364   AEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             AE V  SAAWLGRGLSC+CAQ R+SDA  +F+LTPAQEECLQ LQSR+D++YD +IP HQ
Sbjct  29    AEAVP-SAAWLGRGLSCVCAQRRDSDANSTFDLTPAQEECLQSLQSRIDVAYDSTIPLHQ  87

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALR LW  AFPEEEL  LISEQWKEMGWQGKDP+TDFRGGGFISLENLLYFA NF  SF
Sbjct  88    EALRELWKLAFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNFQKSF  147

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             QDLL+K+ GDRS+WEYPFAVAG+N+TFMLIQMLDLE                AENE AFD
Sbjct  148   QDLLRKQVGDRSVWEYPFAVAGINLTFMLIQMLDLE----------------AENEYAFD  191

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYCI FKLMD QWLSMRASYM+FN+VMK+TRRQLE+EL+LEDI  LEDLP
Sbjct  192   LLYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELMLEDIMHLEDLP  242



>gb|EEE61435.1| hypothetical protein OsJ_15660 [Oryza sativa Japonica Group]
Length=747

 Score =   367 bits (943),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/234 (71%), Positives = 201/234 (86%), Gaps = 0/234 (0%)
 Frame = +1

Query  355   DICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIP  534
             D  AEVVAGS AW+GRG SC+CAQ R+SD R SF+L+PAQE CLQRLQ+R+++ YD S  
Sbjct  507   DYAAEVVAGSTAWIGRGFSCVCAQRRDSDQRISFDLSPAQECCLQRLQNRIEVPYDGSNG  566

Query  535   EHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFP  714
             EHQ AL+ LW+ +FP  EL  L+S+QWKEMGWQGKDP+TDFRGGGFISLENLLYFA N+ 
Sbjct  567   EHQEALKTLWHVSFPGTELLGLVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFAKNYT  626

Query  715   NSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENES  894
              SFQ+LL K+ GDR++WEYPFAVAGVNITFMLIQMLDL+A KPR+L+G+ FL  L EN+ 
Sbjct  627   KSFQELLCKQNGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPRSLIGSVFLNLLLENDR  686

Query  895   AFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             AFD+LYCITFKLMDH+WL M A+YMDFN+V+K+TRRQLE+ELLLEDI R+ED+P
Sbjct  687   AFDILYCITFKLMDHKWLEMHANYMDFNAVIKSTRRQLERELLLEDIQRIEDMP  740



>ref|XP_007052338.1| ELMO/CED-12 domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOX96495.1| ELMO/CED-12 domain-containing protein isoform 2 [Theobroma cacao]
Length=229

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = +1

Query  346  NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQE+CLQRLQ+R+DI+YD 
Sbjct  23   TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEDCLQRLQNRIDIAYDS  82

Query  526  SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
            SIPEHQ+ALRALWNAAFPEE+LR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  83   SIPEHQNALRALWNAAFPEEQLRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  142

Query  706  NFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAE  885
            +FP SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR +VGATFLKFL+ 
Sbjct  143  SFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTMVGATFLKFLSG  202

Query  886  NESAFDLLY  912
            N S   +L+
Sbjct  203  NASFPVILF  211



>gb|ABR17334.1| unknown [Picea sitchensis]
Length=264

 Score =   321 bits (823),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 189/230 (82%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             EVV GSAAW+GRGLSC+CAQ   ++ R S  LTP +E  LQRLQ R++ S+D +  +HQ 
Sbjct  28    EVVVGSAAWIGRGLSCVCAQRTSTNDRVSITLTPFEERRLQRLQRRIEASFDGTRSDHQE  87

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             AL+ LW+AAFP  EL  LISEQWKEMGWQG+DP+TDFRGGG ISLENLL+FA  +P  FQ
Sbjct  88    ALKDLWHAAFPGRELHSLISEQWKEMGWQGRDPSTDFRGGGLISLENLLFFAKTYPKPFQ  147

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LLQK++GDRSMWEYPFA+AGVNITFMLIQMLDL + KP  + GA FLK L+ +E AFD 
Sbjct  148   RLLQKQQGDRSMWEYPFAIAGVNITFMLIQMLDLRSAKPSTIAGAVFLKMLSGDEWAFDF  207

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYCI F++MD QWL+MRASYMDFN+V+K+TR QLEKE+L+E+I+R+EDLP
Sbjct  208   LYCIAFEVMDAQWLAMRASYMDFNAVLKSTRAQLEKEMLIEEISRIEDLP  257



>ref|XP_002489147.1| hypothetical protein SORBIDRAFT_0019s004720 [Sorghum bicolor]
 gb|EES20391.1| hypothetical protein SORBIDRAFT_0019s004720 [Sorghum bicolor]
Length=249

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 183/233 (79%), Gaps = 0/233 (0%)
 Frame = +1

Query  358   ICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPE  537
             I  E   GS  W+GRGLSC+C + + +  R   NLTP QEE LQRL+ RM + +D S  +
Sbjct  11    IANEASCGSPRWIGRGLSCVCIKRKGTYERICMNLTPVQEERLQRLKHRMKVYFDPSRRD  70

Query  538   HQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPN  717
             HQ AL+ALW+A +P++EL+ LISEQWK+MGWQG+DP+TDFRG GFISLENLL+FA  F  
Sbjct  71    HQEALKALWHATYPDQELQGLISEQWKDMGWQGRDPSTDFRGAGFISLENLLFFAKTFSA  130

Query  718   SFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESA  897
             SFQ LL+K+ G+R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E A
Sbjct  131   SFQRLLKKQCGNRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAIFIQMLSEDEWA  190

Query  898   FDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             FDLLYC+ F +MD QWL   ASYMDFN V+K+TR QLE+EL+L+D+ R+ED+P
Sbjct  191   FDLLYCVAFVVMDKQWLDKNASYMDFNEVLKSTRAQLERELMLDDVIRIEDMP  243



>ref|XP_002514926.1| ELMO domain-containing protein, putative [Ricinus communis]
 gb|EEF47480.1| ELMO domain-containing protein, putative [Ricinus communis]
Length=259

 Score =   310 bits (795),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 181/230 (79%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             +   G+  W+G+GL+C+C + + +  R   NLTP QEE L+RL+ RM I +D S P+HQ 
Sbjct  24    DATCGTPTWIGKGLTCVCFKRKGAYERICINLTPHQEERLKRLRHRMKIYFDASRPDHQE  83

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             ALRALW+A +P+++LR LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  84    ALRALWSATYPDQQLRGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQ  143

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL+K+ G RS WEYPFAVAGVN+TFM++QMLDL+A KPR  V + FL+ L+ENE AFDL
Sbjct  144   RLLKKQGGKRSAWEYPFAVAGVNVTFMIMQMLDLDASKPRTFVRSVFLQMLSENEWAFDL  203

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC+ F +MD QWL   A+YM+FN V+K TR Q+E+ELL++D+ R+ED+P
Sbjct  204   LYCVAFVVMDKQWLERNATYMEFNDVLKCTRAQVERELLMDDVLRIEDMP  253



>ref|XP_008676711.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=249

 Score =   310 bits (793),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 181/233 (78%), Gaps = 0/233 (0%)
 Frame = +1

Query  358   ICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPE  537
             I  E   GS  W+GRGLSC+C + + +  R   NLTP QEE LQRL+ RM + +D S  +
Sbjct  11    IANETSCGSPRWIGRGLSCVCIKRKGTYERICMNLTPVQEERLQRLKHRMKVYFDPSRRD  70

Query  538   HQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPN  717
             HQ AL+ALW+A +P++EL  LISEQWK+MGWQG+DP+TDFRG GFISLENLL+FA  F  
Sbjct  71    HQEALKALWHATYPDQELEGLISEQWKDMGWQGRDPSTDFRGAGFISLENLLFFAKTFSA  130

Query  718   SFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESA  897
             SFQ LL K+ G+R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E A
Sbjct  131   SFQRLLNKQCGNRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAIFIQMLSEDEWA  190

Query  898   FDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             FDLLYC+ F +MD QWL   ASYMDFN V+K+TR QLE+EL+L+D+ R+ED+P
Sbjct  191   FDLLYCVAFVVMDKQWLDKNASYMDFNEVLKSTRAQLERELMLDDVIRIEDMP  243



>ref|XP_011071222.1| PREDICTED: ELMO domain-containing protein C isoform X1 [Sesamum 
indicum]
Length=270

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 179/228 (79%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
               G+  W G+ L+C+C + + S AR   NLTP QEE L+RL+ R  + +D S PEHQ AL
Sbjct  37    TCGTPVWRGKALTCVCFKGKGSHARVCVNLTPLQEERLKRLRHRTKVQFDASRPEHQEAL  96

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW A +P++EL+ L+S+QWK+MGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  97    RALWYATYPDQELQCLVSDQWKQMGWQGKDPSTDFRGAGFISLENLLFFAKTFSLSFQGL  156

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+EG R++WEYPFAVAGVNITFM++QMLDL+A KPR  + A FL+ L+ENE AFDLLY
Sbjct  157   LRKQEGKRAIWEYPFAVAGVNITFMIMQMLDLDATKPRTFIRAVFLQMLSENEWAFDLLY  216

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD  WL   A+YM+FN ++K+TR QLEKELL+ED+ R+ED+P
Sbjct  217   CVAFMIMDKLWLEKNATYMEFNDILKSTRSQLEKELLMEDVLRIEDMP  264



>ref|XP_004979271.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Setaria 
italica]
Length=249

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 182/233 (78%), Gaps = 0/233 (0%)
 Frame = +1

Query  358   ICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPE  537
             I  E   GS  W+GR LSC+C + + +  R   NLTP QEE LQRL+ RM + +D S  +
Sbjct  11    IANEASCGSPRWIGRSLSCVCIKRKGAYERICMNLTPVQEERLQRLKHRMKVYFDPSRRD  70

Query  538   HQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPN  717
             HQ AL+ALW+A +P++EL+ LISEQWK+MGWQG+DP+TDFRG GFISLENLL+FA  F  
Sbjct  71    HQEALKALWHATYPDQELQGLISEQWKDMGWQGRDPSTDFRGAGFISLENLLFFAKTFSA  130

Query  718   SFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESA  897
             SFQ LL+K+ G+R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E A
Sbjct  131   SFQRLLKKQCGNRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAIFIQMLSEDEWA  190

Query  898   FDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             FDLLYC+ F +MD QWL   ASYMDFN V+K+TR QLE+EL+L+D+ R+ED+P
Sbjct  191   FDLLYCVAFVVMDKQWLDKNASYMDFNEVLKSTRTQLERELMLDDVMRIEDMP  243



>ref|XP_007044043.1| ELMO/CED-12 family protein isoform 2 [Theobroma cacao]
 gb|EOX99874.1| ELMO/CED-12 family protein isoform 2 [Theobroma cacao]
Length=269

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 181/229 (79%), Gaps = 0/229 (0%)
 Frame = +1

Query  370   VVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSA  549
                G+ AW+G+GL+C+C + + +  R   NLTP QEE L+RL+ RM + +D S P+HQ A
Sbjct  35    ATCGTPAWIGKGLTCVCFKRKGAYERICINLTPLQEERLKRLKHRMKVYFDGSRPDHQEA  94

Query  550   LRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQD  729
             LRALW+A +P +EL+ LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ 
Sbjct  95    LRALWSATYPGQELQGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQR  154

Query  730   LLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLL  909
             LL+K+ G R+ WEYPFAVAGVNITFM++QMLDL+A KPR  + + FL+ L+ENE AFDLL
Sbjct  155   LLKKQGGKRAAWEYPFAVAGVNITFMIMQMLDLDASKPRTFIRSVFLQMLSENEWAFDLL  214

Query  910   YCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             YC+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ R+ED+P
Sbjct  215   YCVAFMVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMP  263



>ref|XP_008676709.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=289

 Score =   310 bits (793),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 180/230 (78%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             E   GS  W+GRGLSC+C + + +  R   NLTP QEE LQRL+ RM + +D S  +HQ 
Sbjct  54    ETSCGSPRWIGRGLSCVCIKRKGTYERICMNLTPVQEERLQRLKHRMKVYFDPSRRDHQE  113

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             AL+ALW+A +P++EL  LISEQWK+MGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  114   ALKALWHATYPDQELEGLISEQWKDMGWQGRDPSTDFRGAGFISLENLLFFAKTFSASFQ  173

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL K+ G+R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E AFDL
Sbjct  174   RLLNKQCGNRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAIFIQMLSEDEWAFDL  233

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC+ F +MD QWL   ASYMDFN V+K+TR QLE+EL+L+D+ R+ED+P
Sbjct  234   LYCVAFVVMDKQWLDKNASYMDFNEVLKSTRAQLERELMLDDVIRIEDMP  283



>ref|XP_006438041.1| hypothetical protein CICLE_v10032373mg [Citrus clementina]
 gb|ESR51281.1| hypothetical protein CICLE_v10032373mg [Citrus clementina]
Length=240

 Score =   307 bits (787),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 182/234 (78%), Gaps = 1/234 (0%)
 Frame = +1

Query  358   ICAE-VVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIP  534
             +CA+    G+  W+G+GL+C+C + + +  R   NLTP QEE L+RL+ RM + +D S P
Sbjct  1     MCADDATCGTPTWIGKGLTCVCFKRKGTYERICINLTPQQEERLRRLKHRMKVYFDASRP  60

Query  535   EHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFP  714
             +HQ ALRALW A +P+ EL  LIS+QWKEMGWQGKDP+TDFRG GFISLENLL+FA  F 
Sbjct  61    DHQEALRALWAATYPDRELHGLISDQWKEMGWQGKDPSTDFRGAGFISLENLLFFAKTFS  120

Query  715   NSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENES  894
              SFQ LL+K+ G R+ WEYPFAVAGVNITFML+QMLDLEA KPR  V + FL+ L++NE 
Sbjct  121   TSFQRLLRKQGGKRAAWEYPFAVAGVNITFMLMQMLDLEATKPRTFVRSVFLQMLSDNEW  180

Query  895   AFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             AFDLLYC+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ ++E++P
Sbjct  181   AFDLLYCVAFVVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLQIEEMP  234



>ref|NP_001067907.1| Os11g0483900 [Oryza sativa Japonica Group]
 gb|ABG22490.1| phagocytosis and cell motility protein ELMO1, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF28270.1| Os11g0483900 [Oryza sativa Japonica Group]
 dbj|BAG91897.1| unnamed protein product [Oryza sativa Japonica Group]
Length=250

 Score =   307 bits (787),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/233 (60%), Positives = 182/233 (78%), Gaps = 0/233 (0%)
 Frame = +1

Query  358   ICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPE  537
             I  E   GS  W+G+ LSC+C + + +  R   NLTP QEE LQRL+ RM + +D S  +
Sbjct  12    IANEASCGSPRWIGKSLSCVCIKRKGAYERICMNLTPVQEERLQRLRHRMKVYFDPSRRD  71

Query  538   HQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPN  717
             HQ AL+ALW+A +P++EL+ LISEQWK+MGWQG+DP+TDFRG GFISLENLL+FA  F  
Sbjct  72    HQEALKALWHATYPDQELQGLISEQWKDMGWQGRDPSTDFRGAGFISLENLLFFAKTFSA  131

Query  718   SFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESA  897
             SFQ LL+K+ G+R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E A
Sbjct  132   SFQRLLKKQCGNRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAVFIQMLSEDEWA  191

Query  898   FDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             FDLLYC+ F +MD QWL   ASYMDFN ++K+TR QLE+ELLL+D+ R+ED+P
Sbjct  192   FDLLYCVAFVVMDKQWLDKNASYMDFNEILKSTRTQLERELLLDDVMRIEDMP  244



>ref|XP_008676710.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACF81077.1| unknown [Zea mays]
 gb|AFW60778.1| hypothetical protein ZEAMMB73_514808 [Zea mays]
Length=287

 Score =   308 bits (790),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 180/230 (78%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             E   GS  W+GRGLSC+C + + +  R   NLTP QEE LQRL+ RM + +D S  +HQ 
Sbjct  52    ETSCGSPRWIGRGLSCVCIKRKGTYERICMNLTPVQEERLQRLKHRMKVYFDPSRRDHQE  111

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             AL+ALW+A +P++EL  LISEQWK+MGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  112   ALKALWHATYPDQELEGLISEQWKDMGWQGRDPSTDFRGAGFISLENLLFFAKTFSASFQ  171

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL K+ G+R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E AFDL
Sbjct  172   RLLNKQCGNRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAIFIQMLSEDEWAFDL  231

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC+ F +MD QWL   ASYMDFN V+K+TR QLE+EL+L+D+ R+ED+P
Sbjct  232   LYCVAFVVMDKQWLDKNASYMDFNEVLKSTRAQLERELMLDDVIRIEDMP  281



>ref|XP_006662939.1| PREDICTED: ELMO domain-containing protein A-like [Oryza brachyantha]
Length=249

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/233 (60%), Positives = 182/233 (78%), Gaps = 0/233 (0%)
 Frame = +1

Query  358   ICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPE  537
             I  E   GS  W+G+ LSC+C + + +  R   NLTP QEE LQRL+ RM + +D S  +
Sbjct  11    IANEASCGSPRWIGKSLSCVCIKRKGAYERICMNLTPVQEERLQRLRHRMKVYFDPSRRD  70

Query  538   HQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPN  717
             HQ AL+ALW+A +P++EL+ LISEQWK+MGWQG+DP+TDFRG GFISLENLL+FA  F  
Sbjct  71    HQEALKALWHATYPDQELQGLISEQWKDMGWQGRDPSTDFRGAGFISLENLLFFAKTFSA  130

Query  718   SFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESA  897
             SFQ LL+K+ G+R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E A
Sbjct  131   SFQRLLKKQCGNRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAVFIQMLSEDEWA  190

Query  898   FDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             FDLLYC+ F +MD QWL   ASYMDFN ++K+TR QLE+ELLL+D+ R+ED+P
Sbjct  191   FDLLYCVAFVVMDKQWLDKNASYMDFNEILKSTRAQLERELLLDDVMRIEDMP  243



>ref|XP_006484089.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Citrus 
sinensis]
Length=275

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 180/230 (78%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             +   G+  W+G+GL+C+C + + +  R   NLTP QEE L+RL+ RM + +D S P+HQ 
Sbjct  40    DATCGTPTWIGKGLTCVCFKRKGTYERICINLTPQQEERLRRLKHRMKVYFDASRPDHQE  99

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             ALRALW A +P++EL  LIS+QWKEMGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  100   ALRALWAATYPDQELHGLISDQWKEMGWQGKDPSTDFRGAGFISLENLLFFAKTFSTSFQ  159

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL+K+ G R+ WEYPFAVAGVNITFML+QMLDLEA KPR  V + FL+ L++NE AFDL
Sbjct  160   RLLRKQGGKRAAWEYPFAVAGVNITFMLMQMLDLEATKPRTFVRSVFLQMLSDNEWAFDL  219

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ ++E++P
Sbjct  220   LYCVAFVVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLQIEEMP  269



>ref|XP_010248986.1| PREDICTED: ELMO domain-containing protein A-like isoform X7 [Nelumbo 
nucifera]
Length=269

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 180/231 (78%), Gaps = 1/231 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQAR-ESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             + + G+  W+GRGL+C+C + + E+  R   NLTP QEE LQRL+ RM I +D S P+HQ
Sbjct  33    DAMCGTPTWIGRGLTCVCFKRKGEAYERICMNLTPLQEERLQRLKHRMKIYFDASRPDHQ  92

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALRALW+A +P +EL  LISEQWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SF
Sbjct  93    DALRALWSATYPGQELHGLISEQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSF  152

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q LL K+ G R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+ENE AFD
Sbjct  153   QRLLNKQGGKRATWEYPFAVAGVNITFMIMQMLDLDSSKPRTFVRAVFIQMLSENEWAFD  212

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYC+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL+ ++ R+ED+P
Sbjct  213   LLYCVAFMVMDKQWLEKNATYMEFNDVLKSTRAQLERELLMNEVLRIEDMP  263



>ref|XP_006438044.1| hypothetical protein CICLE_v10032373mg [Citrus clementina]
 gb|ESR51284.1| hypothetical protein CICLE_v10032373mg [Citrus clementina]
Length=275

 Score =   307 bits (786),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 179/230 (78%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             +   G+  W+G+GL+C+C + + +  R   NLTP QEE L+RL+ RM + +D S P+HQ 
Sbjct  40    DATCGTPTWIGKGLTCVCFKRKGTYERICINLTPQQEERLRRLKHRMKVYFDASRPDHQE  99

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             ALRALW A +P+ EL  LIS+QWKEMGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  100   ALRALWAATYPDRELHGLISDQWKEMGWQGKDPSTDFRGAGFISLENLLFFAKTFSTSFQ  159

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL+K+ G R+ WEYPFAVAGVNITFML+QMLDLEA KPR  V + FL+ L++NE AFDL
Sbjct  160   RLLRKQGGKRAAWEYPFAVAGVNITFMLMQMLDLEATKPRTFVRSVFLQMLSDNEWAFDL  219

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ ++E++P
Sbjct  220   LYCVAFVVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLQIEEMP  269



>ref|XP_004979270.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Setaria 
italica]
Length=285

 Score =   307 bits (786),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 181/230 (79%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             E   GS  W+GR LSC+C + + +  R   NLTP QEE LQRL+ RM + +D S  +HQ 
Sbjct  50    EASCGSPRWIGRSLSCVCIKRKGAYERICMNLTPVQEERLQRLKHRMKVYFDPSRRDHQE  109

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             AL+ALW+A +P++EL+ LISEQWK+MGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  110   ALKALWHATYPDQELQGLISEQWKDMGWQGRDPSTDFRGAGFISLENLLFFAKTFSASFQ  169

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL+K+ G+R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E AFDL
Sbjct  170   RLLKKQCGNRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAIFIQMLSEDEWAFDL  229

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC+ F +MD QWL   ASYMDFN V+K+TR QLE+EL+L+D+ R+ED+P
Sbjct  230   LYCVAFVVMDKQWLDKNASYMDFNEVLKSTRTQLERELMLDDVMRIEDMP  279



>ref|XP_003577574.1| PREDICTED: ELMO domain-containing protein A-like [Brachypodium 
distachyon]
Length=282

 Score =   307 bits (786),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 179/230 (78%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             E   GS  W+ +GLSC+C + R +  R   NLTP QE+ LQRL+ RM + +D S   HQ 
Sbjct  47    EASCGSPKWIEKGLSCVCIKRRGAYERICMNLTPLQEQRLQRLRHRMKVYFDPSRRNHQE  106

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             ALRALW A +P++EL+ LISEQWK+MGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  107   ALRALWYATYPDQELQGLISEQWKDMGWQGRDPSTDFRGAGFISLENLLFFAKTFSASFQ  166

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL+K+ G+R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E AFDL
Sbjct  167   RLLKKQSGNRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAVFIQMLSEDEWAFDL  226

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC+ F +MD QWL   ASYMDFN ++K+TR QLE+ELLLED+ R+ED+P
Sbjct  227   LYCVAFLVMDKQWLEKNASYMDFNEILKSTRTQLERELLLEDVMRIEDMP  276



>gb|ABA93689.2| phagocytosis and cell motility protein ELMO1, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEC68171.1| hypothetical protein OsI_36117 [Oryza sativa Indica Group]
 gb|EEE52105.1| hypothetical protein OsJ_33903 [Oryza sativa Japonica Group]
Length=285

 Score =   307 bits (786),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 181/230 (79%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             E   GS  W+G+ LSC+C + + +  R   NLTP QEE LQRL+ RM + +D S  +HQ 
Sbjct  50    EASCGSPRWIGKSLSCVCIKRKGAYERICMNLTPVQEERLQRLRHRMKVYFDPSRRDHQE  109

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             AL+ALW+A +P++EL+ LISEQWK+MGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  110   ALKALWHATYPDQELQGLISEQWKDMGWQGRDPSTDFRGAGFISLENLLFFAKTFSASFQ  169

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL+K+ G+R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E AFDL
Sbjct  170   RLLKKQCGNRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAVFIQMLSEDEWAFDL  229

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC+ F +MD QWL   ASYMDFN ++K+TR QLE+ELLL+D+ R+ED+P
Sbjct  230   LYCVAFVVMDKQWLDKNASYMDFNEILKSTRTQLERELLLDDVMRIEDMP  279



>ref|XP_007044042.1| ELMO/CED-12 domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOX99873.1| ELMO/CED-12 domain-containing protein isoform 1 [Theobroma cacao]
Length=326

 Score =   308 bits (789),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 181/228 (79%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
               G+ AW+G+GL+C+C + + +  R   NLTP QEE L+RL+ RM + +D S P+HQ AL
Sbjct  93    TCGTPAWIGKGLTCVCFKRKGAYERICINLTPLQEERLKRLKHRMKVYFDGSRPDHQEAL  152

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+A +P +EL+ LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  153   RALWSATYPGQELQGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQRL  212

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+ G R+ WEYPFAVAGVNITFM++QMLDL+A KPR  + + FL+ L+ENE AFDLLY
Sbjct  213   LKKQGGKRAAWEYPFAVAGVNITFMIMQMLDLDASKPRTFIRSVFLQMLSENEWAFDLLY  272

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ R+ED+P
Sbjct  273   CVAFMVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMP  320



>gb|KDO81916.1| hypothetical protein CISIN_1g023949mg [Citrus sinensis]
Length=240

 Score =   305 bits (780),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 182/234 (78%), Gaps = 1/234 (0%)
 Frame = +1

Query  358   ICAE-VVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIP  534
             +CA+    G+  W+G+GL+C+C + + +  R   NLTP Q E L+RL+ RM + +D S P
Sbjct  1     MCADDATCGTPTWIGKGLTCVCFKRKGTYERICINLTPQQAERLRRLKHRMKVYFDASRP  60

Query  535   EHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFP  714
             +HQ ALRALW A +P++EL  LIS+QWKEMGWQGKDP+TDFRG GFISLENLL+FA  F 
Sbjct  61    DHQEALRALWAATYPDQELHGLISDQWKEMGWQGKDPSTDFRGAGFISLENLLFFAKTFS  120

Query  715   NSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENES  894
              SFQ LL+K+ G R+ WEYPFAVAGVNITFML+QMLDLEA KPR  V + FL+ L++NE 
Sbjct  121   TSFQRLLRKQGGKRADWEYPFAVAGVNITFMLMQMLDLEATKPRTFVRSVFLQMLSDNEW  180

Query  895   AFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             AFDLLYC+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ ++E++P
Sbjct  181   AFDLLYCVAFVVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLQIEEMP  234



>ref|XP_007044044.1| ELMO/CED-12 domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOX99875.1| ELMO/CED-12 domain-containing protein isoform 3 [Theobroma cacao]
Length=269

 Score =   306 bits (783),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = +1

Query  370   VVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSA  549
                G+ AW+G+GL+C+C + + +  R   NLTP Q + L+RL+ RM + +D S P+HQ A
Sbjct  35    ATCGTPAWIGKGLTCVCFKRKGAYERICINLTPLQAKRLKRLKHRMKVYFDGSRPDHQEA  94

Query  550   LRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQD  729
             LRALW+A +P +EL+ LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ 
Sbjct  95    LRALWSATYPGQELQGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQR  154

Query  730   LLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLL  909
             LL+K+ G R+ WEYPFAVAGVNITFM++QMLDL+A KPR  + + FL+ L+ENE AFDLL
Sbjct  155   LLKKQGGKRAAWEYPFAVAGVNITFMIMQMLDLDASKPRTFIRSVFLQMLSENEWAFDLL  214

Query  910   YCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             YC+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ R+ED+P
Sbjct  215   YCVAFMVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMP  263



>emb|CDG49296.1| ELMO domain containing protein [Hordeum vulgare]
Length=254

 Score =   305 bits (781),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = +1

Query  379   GSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRA  558
             GS  W+G+ LSC+C + + +  R   NLTP QE+ LQRL+ RM + +D S  +HQ ALRA
Sbjct  23    GSPRWIGKSLSCVCIKRKGAYERICVNLTPVQEQRLQRLRHRMKVYFDHSRRDHQEALRA  82

Query  559   LWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQ  738
             LW A +P++EL+ L+SEQWK+MGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ LLQ
Sbjct  83    LWYATYPDQELQGLVSEQWKDMGWQGRDPSTDFRGAGFISLENLLFFAKTFSASFQRLLQ  142

Query  739   KREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCI  918
             K+ G+R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E AFDLLYC+
Sbjct  143   KQCGNRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVKAVFVQMLSEDEWAFDLLYCV  202

Query  919   TFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
              F +MD QW+   ASYMDFN ++K+TR QLE+ELLL+D+ R+ED+P
Sbjct  203   AFLVMDKQWVEKNASYMDFNEILKSTRAQLERELLLDDVMRIEDMP  248



>ref|XP_010044800.1| PREDICTED: ELMO domain-containing protein C isoform X1 [Eucalyptus 
grandis]
 gb|KCW86908.1| hypothetical protein EUGRSUZ_B03488 [Eucalyptus grandis]
Length=280

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/228 (60%), Positives = 181/228 (79%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
               G+  W+G+GL+C+C + + +  R  F+LTP QEE L+RL+ RM + +D S P+HQ AL
Sbjct  47    TCGAPNWIGKGLTCVCFKRKGTYERICFHLTPIQEERLKRLKCRMKVFFDASRPDHQEAL  106

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+A +P+EEL+ LIS+QWK+MGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  107   RALWSATYPDEELQGLISDQWKKMGWQGKDPSTDFRGAGFISLENLLFFAKTFSISFQHL  166

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+ G R+ WEYPFAVAGVNITFM++QMLDL+A KPR  V   FL+ L+EN+ AFDLLY
Sbjct  167   LEKQGGKRAAWEYPFAVAGVNITFMIMQMLDLDASKPRKFVRGVFLQMLSENQWAFDLLY  226

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QW+   A+YM+FN V+K+TR QLE+ELL++++ R+ED+P
Sbjct  227   CVAFMIMDKQWVERNATYMEFNDVLKSTRAQLERELLMDEVLRIEDMP  274



>gb|KDO81915.1| hypothetical protein CISIN_1g023949mg [Citrus sinensis]
Length=275

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 179/230 (78%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             +   G+  W+G+GL+C+C + + +  R   NLTP Q E L+RL+ RM + +D S P+HQ 
Sbjct  40    DATCGTPTWIGKGLTCVCFKRKGTYERICINLTPQQAERLRRLKHRMKVYFDASRPDHQE  99

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             ALRALW A +P++EL  LIS+QWKEMGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  100   ALRALWAATYPDQELHGLISDQWKEMGWQGKDPSTDFRGAGFISLENLLFFAKTFSTSFQ  159

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL+K+ G R+ WEYPFAVAGVNITFML+QMLDLEA KPR  V + FL+ L++NE AFDL
Sbjct  160   RLLRKQGGKRADWEYPFAVAGVNITFMLMQMLDLEATKPRTFVRSVFLQMLSDNEWAFDL  219

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ ++E++P
Sbjct  220   LYCVAFVVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLQIEEMP  269



>ref|XP_010044802.1| PREDICTED: ELMO domain-containing protein C isoform X2 [Eucalyptus 
grandis]
Length=250

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/228 (60%), Positives = 181/228 (79%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
               G+  W+G+GL+C+C + + +  R  F+LTP QEE L+RL+ RM + +D S P+HQ AL
Sbjct  17    TCGAPNWIGKGLTCVCFKRKGTYERICFHLTPIQEERLKRLKCRMKVFFDASRPDHQEAL  76

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+A +P+EEL+ LIS+QWK+MGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  77    RALWSATYPDEELQGLISDQWKKMGWQGKDPSTDFRGAGFISLENLLFFAKTFSISFQHL  136

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+ G R+ WEYPFAVAGVNITFM++QMLDL+A KPR  V   FL+ L+EN+ AFDLLY
Sbjct  137   LEKQGGKRAAWEYPFAVAGVNITFMIMQMLDLDASKPRKFVRGVFLQMLSENQWAFDLLY  196

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QW+   A+YM+FN V+K+TR QLE+ELL++++ R+ED+P
Sbjct  197   CVAFMIMDKQWVERNATYMEFNDVLKSTRAQLERELLMDEVLRIEDMP  244



>gb|KDP26793.1| hypothetical protein JCGZ_17951 [Jatropha curcas]
Length=271

 Score =   304 bits (779),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 175/228 (77%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
               G+  W+G+GL+C+C + +    R   NLTP QEE L+RL+ RM + +D S P+HQ AL
Sbjct  38    TCGTPTWIGKGLTCVCFKRKGIFERICINLTPLQEERLKRLKHRMKVYFDGSRPDHQEAL  97

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+A +P+ EL  LIS QWKEMGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  98    RALWSATYPDRELHGLISNQWKEMGWQGKDPSTDFRGAGFISLENLLFFAKTFSISFQHL  157

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+ G RS WEYPFAVAGVNITFM+ QMLDL+A KPR  V + FL+ L+ENE AFDLLY
Sbjct  158   LKKQGGKRSAWEYPFAVAGVNITFMIKQMLDLDASKPRTFVRSVFLQMLSENEWAFDLLY  217

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   A+YM+FN V+K TR Q+E+ELL++D+ R+ED+P
Sbjct  218   CVAFVVMDKQWLQKNATYMEFNDVLKCTRAQVERELLMDDVLRIEDMP  265



>ref|XP_010905192.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Elaeis 
guineensis]
Length=270

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 177/228 (78%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
               GS  W+GRGLSC+C + + +  R   NLTP QEE LQRL+ RM + +D    +HQ AL
Sbjct  37    TCGSPRWIGRGLSCVCMKRKVTYERICVNLTPLQEERLQRLKHRMKVYFDPLRRDHQEAL  96

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW A +P++EL  LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  97    RALWYATYPDQELHGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQRL  156

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+ G R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E AFDLLY
Sbjct  157   LKKQGGKRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAVFIQMLSEDEWAFDLLY  216

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   ASYM+FN V+++TR QLE+ELLL+D+ R+ED+P
Sbjct  217   CVAFVVMDKQWLEKNASYMEFNEVLRSTRAQLERELLLDDVMRIEDMP  264



>ref|XP_010907561.1| PREDICTED: ELMO domain-containing protein A-like [Elaeis guineensis]
Length=270

 Score =   304 bits (778),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 177/226 (78%), Gaps = 0/226 (0%)
 Frame = +1

Query  379   GSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRA  558
             GS  W+GRGLSC+C + +    R   NL+P QEE LQRL+ RM+I +D S  +HQ ALRA
Sbjct  39    GSPRWIGRGLSCVCMKRKGIYERICVNLSPLQEERLQRLKHRMNIYFDPSRRDHQEALRA  98

Query  559   LWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQ  738
             LW A +P++EL  LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ LL 
Sbjct  99    LWYATYPDQELHGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQRLLN  158

Query  739   KREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCI  918
             K+ G R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E AFDLLYC+
Sbjct  159   KQGGKRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAVFIQMLSEDEWAFDLLYCV  218

Query  919   TFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
              F +MD QWL   ASYM+FN V+++TR QLE+ELLL+D+ R+ED+P
Sbjct  219   AFLVMDKQWLEKNASYMEFNEVLRSTRAQLERELLLDDVMRIEDMP  264



>ref|XP_004310072.1| PREDICTED: ELMO domain-containing protein A-like [Fragaria vesca 
subsp. vesca]
Length=261

 Score =   303 bits (776),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 179/229 (78%), Gaps = 0/229 (0%)
 Frame = +1

Query  370   VVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSA  549
             V  G+ AW+G+GL+C+C +A+ S+ +   NLTP QEE ++RLQ RM I +D +  +HQ A
Sbjct  27    VNCGTPAWIGKGLTCVCFKAKGSNEKVCLNLTPLQEERMRRLQRRMKIYFDSARTDHQEA  86

Query  550   LRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQD  729
             LRALW A +P +EL  L+S+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ 
Sbjct  87    LRALWYATYPGQELHGLVSDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQC  146

Query  730   LLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLL  909
             LL K+ G  + WEYPFAVAGVNITFM++QMLDLEA KPR+ + + FL+ L E+E AFDLL
Sbjct  147   LLNKQGGKPAAWEYPFAVAGVNITFMIMQMLDLEATKPRSFIRSVFLQMLLESEWAFDLL  206

Query  910   YCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             YC+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ R+ED+P
Sbjct  207   YCVAFMVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMP  255



>ref|XP_008776244.1| PREDICTED: ELMO domain-containing protein A-like [Phoenix dactylifera]
 ref|XP_008776245.1| PREDICTED: ELMO domain-containing protein A-like [Phoenix dactylifera]
Length=270

 Score =   303 bits (777),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 177/226 (78%), Gaps = 0/226 (0%)
 Frame = +1

Query  379   GSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRA  558
             GS  W+GRGLSC+C + +    R   NL+P QEE LQRL+ RM+I +D +  +HQ ALRA
Sbjct  39    GSPRWIGRGLSCVCMKRKGIYERICVNLSPLQEERLQRLKHRMNIYFDPTRRDHQEALRA  98

Query  559   LWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQ  738
             LW A +P++EL  LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ LL 
Sbjct  99    LWYATYPDQELHGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQRLLN  158

Query  739   KREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCI  918
             K+ G R+ WEYPFAVAGVNITFM++QMLDL++ KPR  V A F++ L+E+E AFDLLYC+
Sbjct  159   KQGGKRATWEYPFAVAGVNITFMIMQMLDLQSTKPRTFVRAVFIQMLSEDEWAFDLLYCV  218

Query  919   TFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
              F +MD QWL   ASYM+FN V+++TR QLE+ELLL+D+ R+ED+P
Sbjct  219   AFVVMDKQWLEKNASYMEFNEVLRSTRAQLERELLLDDVMRIEDMP  264



>ref|XP_008446042.1| PREDICTED: ELMO domain-containing protein A [Cucumis melo]
Length=276

 Score =   303 bits (776),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 179/229 (78%), Gaps = 0/229 (0%)
 Frame = +1

Query  370   VVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSA  549
             V  G+  W+G+G++CIC + + S  R   NLTP QE+ L+RL+ RM + +D S  +HQ A
Sbjct  37    VTCGTPTWIGKGITCICFKRKGSFERICINLTPVQEDRLRRLKHRMKVYFDGSRIDHQEA  96

Query  550   LRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQD  729
             LRALW AA+P +EL+ L+S+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ 
Sbjct  97    LRALWYAAYPGQELQALVSDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQL  156

Query  730   LLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLL  909
             LL+K+ G  + WEYPFAVAGVNITFM++QMLDL+A KPR  + + FL+ L+ENE AFDLL
Sbjct  157   LLRKQGGKPAAWEYPFAVAGVNITFMIMQMLDLDASKPRTFIRSVFLQMLSENEWAFDLL  216

Query  910   YCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             YC+ F +MD QWL   A+YM+FN V+K+TR QLEKELL+ED+ R+ED+P
Sbjct  217   YCVAFVVMDKQWLERNATYMEFNDVLKSTRAQLEKELLMEDVFRIEDMP  265



>ref|XP_004135318.1| PREDICTED: ELMO domain-containing protein A-like [Cucumis sativus]
 ref|XP_004159681.1| PREDICTED: ELMO domain-containing protein A-like [Cucumis sativus]
Length=276

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 178/229 (78%), Gaps = 0/229 (0%)
 Frame = +1

Query  370   VVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSA  549
             V  G+  W+G+G++CIC + + S  R   NLTP QE+ L+RL+ RM + +D S   HQ A
Sbjct  37    VTCGTPTWIGKGITCICFKRKGSLERICINLTPVQEDRLRRLKHRMKVYFDGSRINHQEA  96

Query  550   LRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQD  729
             LRALW AA+P +EL+ L+S+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ 
Sbjct  97    LRALWYAAYPGQELQALVSDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQL  156

Query  730   LLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLL  909
             LL+K+ G  + WEYPFAVAGVNITFM++QMLDL+A KPR  + + FL+ L+ENE AFDLL
Sbjct  157   LLRKQGGKPAAWEYPFAVAGVNITFMIMQMLDLDASKPRTFIRSVFLQMLSENEWAFDLL  216

Query  910   YCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             YC+ F +MD QWL   A+YM+FN V+K+TR QLEKELL+ED+ R+ED+P
Sbjct  217   YCVAFVVMDKQWLERNATYMEFNDVLKSTRAQLEKELLMEDVLRIEDMP  265



>ref|XP_007052339.1| ELMO/CED-12 family protein isoform 3, partial [Theobroma cacao]
 gb|EOX96496.1| ELMO/CED-12 family protein isoform 3, partial [Theobroma cacao]
Length=197

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 157/175 (90%), Gaps = 8/175 (5%)
 Frame = +1

Query  346  NCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDR  525
             C    AEVVAGSAAWLGRGLSC+CAQ RESDARPSF+LTPAQE+CLQRLQ+R+DI+YD 
Sbjct  23   TCHSTSAEVVAGSAAWLGRGLSCVCAQRRESDARPSFDLTPAQEDCLQRLQNRIDIAYDS  82

Query  526  SIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFAN  705
            SIPEHQ+ALRALWNAAFPEE+LR LISEQWKEMGWQGKDP+TDFRGGGFISLENLL+FA 
Sbjct  83   SIPEHQNALRALWNAAFPEEQLRGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFAR  142

Query  706  NFP--------NSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPR  846
            +FP         SFQDLL+K+EGDRS+WEYPFAVAGVNITFMLIQMLDLEAVKPR
Sbjct  143  SFPVLINISMQKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPR  197



>ref|XP_008811375.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Phoenix 
dactylifera]
Length=270

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 176/226 (78%), Gaps = 0/226 (0%)
 Frame = +1

Query  379   GSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRA  558
             GS  W+GRGLSC+C + + +  R   NLTP QEE LQRL+ RM + +D    +HQ ALRA
Sbjct  39    GSPRWIGRGLSCVCMKRKVTYERICINLTPLQEERLQRLKHRMKVYFDSLRRDHQEALRA  98

Query  559   LWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQ  738
             LW A +P++EL  LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ LL+
Sbjct  99    LWYATYPDQELHGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQRLLK  158

Query  739   KREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCI  918
             K+ G R+ WEYPFAVAGVNITFM++QMLDL++ K R  V A F++ L+E+E AFDLLYC+
Sbjct  159   KQGGKRATWEYPFAVAGVNITFMIMQMLDLQSTKRRTFVRAVFIQMLSEDEWAFDLLYCV  218

Query  919   TFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
              F +MD QWL   ASYM+FN V+++TR QLE+ELLL+D+ R+ED+P
Sbjct  219   AFVVMDKQWLEKNASYMEFNEVLRSTRAQLERELLLDDVMRIEDMP  264



>ref|XP_008389851.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Malus 
domestica]
Length=278

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/228 (60%), Positives = 175/228 (77%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
               GS  W+G+GL+C+C + + +  R   NLTP QEE + RL+ RM + +D + P+HQ AL
Sbjct  45    TCGSPKWIGKGLTCVCFKRKGNYQRICMNLTPLQEERMGRLKQRMKVYFDATRPDHQEAL  104

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW A FP +EL+ LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  105   RALWYATFPGQELKGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSASFQCL  164

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+ G R+ WEYPFAVAGVNITFM++QMLDL+A KPR  +   FL+ L ENE  FDLLY
Sbjct  165   LKKQRGKRAAWEYPFAVAGVNITFMIMQMLDLDARKPRTFIRTVFLQMLLENEWTFDLLY  224

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ R+ED+P
Sbjct  225   CVAFMVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMP  272



>ref|XP_011029697.1| PREDICTED: ELMO domain-containing protein C-like isoform X2 [Populus 
euphratica]
 ref|XP_011013460.1| PREDICTED: ELMO domain-containing protein C-like isoform X2 [Populus 
euphratica]
Length=272

 Score =   301 bits (772),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 180/231 (78%), Gaps = 1/231 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             +   G+  W+G+GL+C+C + + +  R   NLTP QEE  +RL+ RM + +D S P+HQ 
Sbjct  36    DATCGTPTWIGKGLTCVCFKRKGAYERICINLTPRQEERFKRLKHRMKVYFDASRPDHQD  95

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             ALRALW+A +P++EL  LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  96    ALRALWSATYPDQELNGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQ  155

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKP-RNLVGATFLKFLAENESAFD  903
              LL+K+ G RS WEYPFAVAGVNITFM++QMLDL+A+K  R  V + FL+ L+ENE AFD
Sbjct  156   HLLKKQGGKRSAWEYPFAVAGVNITFMIMQMLDLDALKTRRTFVRSVFLQMLSENEWAFD  215

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYC+ F +MD QWL   A+YM+FN ++K+TR Q+E+ELL++D+ R+ED+P
Sbjct  216   LLYCVAFVVMDKQWLERNATYMEFNDILKSTRAQVERELLMDDVLRIEDMP  266



>ref|XP_007044045.1| ELMO/CED-12 domain-containing protein isoform 4 [Theobroma cacao]
 gb|EOX99876.1| ELMO/CED-12 domain-containing protein isoform 4 [Theobroma cacao]
Length=270

 Score =   301 bits (771),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 180/230 (78%), Gaps = 1/230 (0%)
 Frame = +1

Query  370   VVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSA  549
                G+ AW+G+GL+C+C + + +  R   NLTP Q + L+RL+ RM + +D S P+HQ A
Sbjct  35    ATCGTPAWIGKGLTCVCFKRKGAYERICINLTPLQAKRLKRLKHRMKVYFDGSRPDHQEA  94

Query  550   LRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDF-RGGGFISLENLLYFANNFPNSFQ  726
             LRALW+A +P +EL+ LIS+QWKEMGWQG+DP+TDF RG GFISLENLL+FA  F  SFQ
Sbjct  95    LRALWSATYPGQELQGLISDQWKEMGWQGRDPSTDFSRGAGFISLENLLFFAKTFSTSFQ  154

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL+K+ G R+ WEYPFAVAGVNITFM++QMLDL+A KPR  + + FL+ L+ENE AFDL
Sbjct  155   RLLKKQGGKRAAWEYPFAVAGVNITFMIMQMLDLDASKPRTFIRSVFLQMLSENEWAFDL  214

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ R+ED+P
Sbjct  215   LYCVAFMVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMP  264



>ref|XP_006484090.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Citrus 
sinensis]
Length=250

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 183/244 (75%), Gaps = 11/244 (5%)
 Frame = +1

Query  358   ICAE-VVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIP  534
             +CA+    G+  W+G+GL+C+C + + +  R   NLTP QEE L+RL+ RM + +D S P
Sbjct  1     MCADDATCGTPTWIGKGLTCVCFKRKGTYERICINLTPQQEERLRRLKHRMKVYFDASRP  60

Query  535   EHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFP  714
             +HQ ALRALW A +P++EL  LIS+QWKEMGWQGKDP+TDFRG GFISLENLL+FA  F 
Sbjct  61    DHQEALRALWAATYPDQELHGLISDQWKEMGWQGKDPSTDFRGAGFISLENLLFFAKTFS  120

Query  715   NSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFL-----  879
              SFQ LL+K+ G R+ WEYPFAVAGVNITFML+QMLDLEA KPR  V + FL+ L     
Sbjct  121   TSFQRLLRKQGGKRAAWEYPFAVAGVNITFMLMQMLDLEATKPRTFVRSVFLQMLSALVI  180

Query  880   -----AENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRL  1044
                  ++NE AFDLLYC+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ ++
Sbjct  181   LKRVVSDNEWAFDLLYCVAFVVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLQI  240

Query  1045  EDLP  1056
             E++P
Sbjct  241   EEMP  244



>ref|XP_008389852.1| PREDICTED: ELMO domain-containing protein A isoform X2 [Malus 
domestica]
Length=250

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/228 (60%), Positives = 175/228 (77%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
               GS  W+G+GL+C+C + + +  R   NLTP QEE + RL+ RM + +D + P+HQ AL
Sbjct  17    TCGSPKWIGKGLTCVCFKRKGNYQRICMNLTPLQEERMGRLKQRMKVYFDATRPDHQEAL  76

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW A FP +EL+ LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  77    RALWYATFPGQELKGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSASFQCL  136

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+ G R+ WEYPFAVAGVNITFM++QMLDL+A KPR  +   FL+ L ENE  FDLLY
Sbjct  137   LKKQRGKRAAWEYPFAVAGVNITFMIMQMLDLDARKPRTFIRTVFLQMLLENEWTFDLLY  196

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ R+ED+P
Sbjct  197   CVAFMVMDKQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMP  244



>ref|XP_011071223.1| PREDICTED: ELMO domain-containing protein C isoform X2 [Sesamum 
indicum]
Length=266

 Score =   300 bits (768),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/228 (60%), Positives = 177/228 (78%), Gaps = 4/228 (2%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
               G+  W G+ L+C+C + + S AR   NLTP QEE L+RL+ R  + +D S PEHQ AL
Sbjct  37    TCGTPVWRGKALTCVCFKGKGSHARVCVNLTPLQEERLKRLRHRTKVQFDASRPEHQEAL  96

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW A +P++EL+ L+S+QWK+MGWQGKDP+TDFRG GFISLENLL+FA     +F  L
Sbjct  97    RALWYATYPDQELQCLVSDQWKQMGWQGKDPSTDFRGAGFISLENLLFFAK----TFSGL  152

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+EG R++WEYPFAVAGVNITFM++QMLDL+A KPR  + A FL+ L+ENE AFDLLY
Sbjct  153   LRKQEGKRAIWEYPFAVAGVNITFMIMQMLDLDATKPRTFIRAVFLQMLSENEWAFDLLY  212

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD  WL   A+YM+FN ++K+TR QLEKELL+ED+ R+ED+P
Sbjct  213   CVAFMIMDKLWLEKNATYMEFNDILKSTRSQLEKELLMEDVLRIEDMP  260



>ref|XP_010655825.1| PREDICTED: ELMO domain-containing protein A [Vitis vinifera]
 emb|CBI27646.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   300 bits (767),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/230 (62%), Positives = 181/230 (79%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             +V  G+  W+GRGL+C+C + + +  R   NLTP QEE L+RL+ RM + +D S P+HQ 
Sbjct  34    DVTCGTPTWIGRGLTCVCFKRKGTYERICINLTPHQEERLRRLRHRMKVYFDASRPDHQE  93

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             ALRALW+A +P +EL  LISEQWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  94    ALRALWSATYPGQELHGLISEQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSISFQ  153

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL+K+ G R+ WEYPFAVAGVNITFM++QMLDL+A KPR  V A FL+ L+ENE AFDL
Sbjct  154   LLLKKQRGKRAAWEYPFAVAGVNITFMIMQMLDLDASKPRTFVRAVFLQMLSENEWAFDL  213

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC+ F +MD QWL   A+YM+FN V+K+TR QLEKELL++D+ R+ED+P
Sbjct  214   LYCVAFMVMDKQWLDRNATYMEFNDVLKSTRAQLEKELLMDDVLRIEDMP  263



>ref|XP_011029695.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Populus 
euphratica]
 ref|XP_011013459.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Populus 
euphratica]
Length=291

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 180/231 (78%), Gaps = 1/231 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             +   G+  W+G+GL+C+C + + +  R   NLTP QEE  +RL+ RM + +D S P+HQ 
Sbjct  55    DATCGTPTWIGKGLTCVCFKRKGAYERICINLTPRQEERFKRLKHRMKVYFDASRPDHQD  114

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             ALRALW+A +P++EL  LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  115   ALRALWSATYPDQELNGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQ  174

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKP-RNLVGATFLKFLAENESAFD  903
              LL+K+ G RS WEYPFAVAGVNITFM++QMLDL+A+K  R  V + FL+ L+ENE AFD
Sbjct  175   HLLKKQGGKRSAWEYPFAVAGVNITFMIMQMLDLDALKTRRTFVRSVFLQMLSENEWAFD  234

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYC+ F +MD QWL   A+YM+FN ++K+TR Q+E+ELL++D+ R+ED+P
Sbjct  235   LLYCVAFVVMDKQWLERNATYMEFNDILKSTRAQVERELLMDDVLRIEDMP  285



>gb|EYU42095.1| hypothetical protein MIMGU_mgv1a022810mg, partial [Erythranthe 
guttata]
Length=237

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 174/226 (77%), Gaps = 0/226 (0%)
 Frame = +1

Query  379   GSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRA  558
             G+  W  +GL+C+C + + S AR   NLT  QE+ L RL+ R  I +D S  +HQ ALRA
Sbjct  6     GTPVWRAKGLTCVCFKPKGSHARICINLTSQQEQRLNRLKHRTKIQFDASRQDHQEALRA  65

Query  559   LWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQ  738
             LW+A +P +EL+ L+S+QWKEMGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ LL+
Sbjct  66    LWSATYPGQELQSLVSDQWKEMGWQGKDPSTDFRGAGFISLENLLFFAKTFSISFQSLLR  125

Query  739   KREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCI  918
             K+ G R++WEYPFAVAGVN+TFM++QMLDL+A+KPR  + A FL+ L+ENE AFDLLYC+
Sbjct  126   KQAGKRAVWEYPFAVAGVNVTFMIVQMLDLDAIKPRTFIRAVFLQMLSENEWAFDLLYCV  185

Query  919   TFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
              F +MD  WL   ASYM+FN ++K TR QLEKE L++D+ R+ED+P
Sbjct  186   AFMIMDKLWLDRNASYMEFNDILKLTRCQLEKEFLMDDVLRIEDMP  231



>ref|XP_009419376.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=270

 Score =   299 bits (765),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 175/228 (77%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
               GS  W+ +GLSC+C + + +  R   NLTP QEE LQRL+ RM++ +D    EHQ AL
Sbjct  37    TCGSPRWIEKGLSCVCMKRKGTYERICINLTPLQEERLQRLKHRMNVYFDALRREHQEAL  96

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW A +P +EL  LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F NSFQ L
Sbjct  97    RALWYATYPNKELSGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSNSFQRL  156

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L K+ G R+ WEYPFAVAGVNITFM++QMLDL++ K R  V A F++ L+E+E AFDLLY
Sbjct  157   LNKQCGKRATWEYPFAVAGVNITFMIMQMLDLQSTKARTFVRAVFIQMLSEDEWAFDLLY  216

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   ASYM+FN V+K+TR QLE+ELL++D+ R+ED+P
Sbjct  217   CVAFMVMDKQWLERNASYMEFNEVLKSTRAQLERELLMDDVMRIEDMP  264



>ref|XP_010531612.1| PREDICTED: ELMO domain-containing protein A isoform X2 [Tarenaya 
hassleriana]
Length=279

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/231 (59%), Positives = 178/231 (77%), Gaps = 1/231 (0%)
 Frame = +1

Query  367   EVVAGSAAW-LGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQ  543
             +   G+  W +G+ L+C+C + + +  R   NLTP QEE L+RL+ RM + +D S P+HQ
Sbjct  43    DTTCGTPTWRIGKTLTCVCFKRKGAYQRICSNLTPLQEERLKRLKHRMKVYFDASRPDHQ  102

Query  544   SALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSF  723
              ALRALW+A +P +EL  LISEQWKEMGWQG+DP+TDFRG GFISLENLL+FA  FP SF
Sbjct  103   EALRALWSATYPGQELSGLISEQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFPTSF  162

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q LL K+ G R+ WEYPFAVAGVN+TFM++QMLDL+A KPR  V + FL+ L+ENE AFD
Sbjct  163   QRLLNKQGGKRAAWEYPFAVAGVNVTFMIMQMLDLDASKPRTFVRSVFLQILSENEWAFD  222

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYC+ F +MD QWL   A+YM+FN V++ TR Q+E+ELL++D+ R+ED+P
Sbjct  223   LLYCVAFVVMDKQWLDRNATYMEFNDVLRYTRAQVERELLMDDVFRIEDMP  273



>ref|XP_010682784.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=252

 Score =   297 bits (761),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 176/236 (75%), Gaps = 0/236 (0%)
 Frame = +1

Query  349   CIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRS  528
             CI    +   G+  W+G+GL+C C + + S  R    LTP QE+ L RL+ RM I +D S
Sbjct  11    CIVASHDATCGAPTWIGKGLTCYCFKRKGSYERICITLTPLQEQRLNRLKHRMKIYFDSS  70

Query  529   IPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANN  708
               +HQ ALRALW A +P+++L  LISEQWKEMGWQG+DP+TDFRG GFISLENLL+FA  
Sbjct  71    RSDHQEALRALWYATYPDQQLHALISEQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKT  130

Query  709   FPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAEN  888
             F  S+Q L++K+ G R+ WEYPFAVAGVNITFMLIQML+L+A K RN V A FL+ L+EN
Sbjct  131   FSTSYQHLVKKQGGKRATWEYPFAVAGVNITFMLIQMLNLDAPKGRNFVRAVFLQMLSEN  190

Query  889   ESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
               AFDLLYC+ F +MD QWL   ASYM+FN V+K+TR QLE+ELL++++  +ED+P
Sbjct  191   HWAFDLLYCVAFAVMDKQWLEKNASYMEFNEVLKSTRAQLEQELLMDEVLGIEDMP  246



>emb|CDY12643.1| BnaA02g13110D [Brassica napus]
Length=258

 Score =   297 bits (761),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 174/221 (79%), Gaps = 0/221 (0%)
 Frame = +1

Query  394   LGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRALWNAA  573
             + + L+C+C   + +  R   NLTP QEE L+RL  RM+  +D S P+HQ ALRALW+A 
Sbjct  32    IKKRLTCVCFYRKRAYERICSNLTPLQEERLKRLTKRMNNCFDASRPDHQDALRALWSAT  91

Query  574   FPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQKREGD  753
             +PE++L  LIS+QWK+MGWQGKDP+TDFRGGGFISLENLL+FA  FP SFQ LL K+ G 
Sbjct  92    YPEKKLEALISDQWKDMGWQGKDPSTDFRGGGFISLENLLFFAKTFPTSFQRLLNKQGGK  151

Query  754   RSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCITFKLM  933
             R+ WEYPFAVAGVNITFM++QMLDLEA KPR  VG+ FL+ L+ENE AFDLLYC+ F +M
Sbjct  152   RAAWEYPFAVAGVNITFMIMQMLDLEASKPRTFVGSVFLQMLSENEWAFDLLYCVAFAVM  211

Query  934   DHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             D QWL   A+YM+FN V++ TR QLE+EL+++D+ R+ED+P
Sbjct  212   DKQWLDRNATYMEFNDVLRCTRAQLERELMMDDVFRIEDMP  252



>ref|XP_010250740.1| PREDICTED: ELMO domain-containing protein A [Nelumbo nucifera]
Length=267

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 175/223 (78%), Gaps = 1/223 (0%)
 Frame = +1

Query  388   AWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRALWN  567
             AW+GRGL+CIC + + +  R   NLTP QEE LQRL+ RM + +D + P+HQ ALRALW+
Sbjct  40    AWIGRGLTCICFKRKGAYERLCTNLTPLQEERLQRLKHRMKVYFDGTRPDHQDALRALWS  99

Query  568   AAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQKRE  747
             A +P +EL  LISEQWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ L+ K+ 
Sbjct  100   ATYPGKELHGLISEQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQHLVNKQG  159

Query  748   GDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCITFK  927
             G R+ WEYPFAVAGVNITFM++QMLDL++ KPR LV   F++ L+ENE AFDLLYC+ F 
Sbjct  160   GKRATWEYPFAVAGVNITFMIMQMLDLDSSKPRTLVRDAFIQMLSENEWAFDLLYCVAFV  219

Query  928   LMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LMD QWL   A+YM+FN V+K+TR QLE+E L +++ R+ED+P
Sbjct  220   LMDKQWLEKNATYMEFNDVLKSTRAQLERE-LSDEVLRIEDMP  261



>ref|XP_009127552.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Brassica 
rapa]
Length=281

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 175/221 (79%), Gaps = 0/221 (0%)
 Frame = +1

Query  394   LGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRALWNAA  573
             + + L+C+C   + +  R   NLTP QEE L+RL  RM+  +D S P+HQ ALRALW+A 
Sbjct  55    IKKRLTCVCFYRKRAYERICSNLTPLQEERLKRLTKRMNNCFDASRPDHQDALRALWSAT  114

Query  574   FPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQKREGD  753
             +PE++L  LIS+QWK+MGWQG+DP+TDFRGGGFISLENLL+FA  FP SFQ LL+K+ G 
Sbjct  115   YPEKKLEALISDQWKDMGWQGRDPSTDFRGGGFISLENLLFFAKTFPTSFQRLLKKQGGK  174

Query  754   RSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCITFKLM  933
             R+ WEYPFAVAGVNITFM++QMLDLEA KPR  +G+ FL+ L+ENE AFDLLYC+ F +M
Sbjct  175   RAAWEYPFAVAGVNITFMIMQMLDLEASKPRTFIGSVFLQMLSENEWAFDLLYCVAFAVM  234

Query  934   DHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             D QWL   A+YM+FN V++ TR QLE+EL+++D+ R+ED+P
Sbjct  235   DKQWLDRNATYMEFNDVLRCTRAQLERELMMDDVFRIEDMP  275



>ref|XP_009127553.1| PREDICTED: ELMO domain-containing protein A isoform X2 [Brassica 
rapa]
Length=276

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 175/221 (79%), Gaps = 0/221 (0%)
 Frame = +1

Query  394   LGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRALWNAA  573
             + + L+C+C   + +  R   NLTP QEE L+RL  RM+  +D S P+HQ ALRALW+A 
Sbjct  50    IKKRLTCVCFYRKRAYERICSNLTPLQEERLKRLTKRMNNCFDASRPDHQDALRALWSAT  109

Query  574   FPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQKREGD  753
             +PE++L  LIS+QWK+MGWQG+DP+TDFRGGGFISLENLL+FA  FP SFQ LL+K+ G 
Sbjct  110   YPEKKLEALISDQWKDMGWQGRDPSTDFRGGGFISLENLLFFAKTFPTSFQRLLKKQGGK  169

Query  754   RSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCITFKLM  933
             R+ WEYPFAVAGVNITFM++QMLDLEA KPR  +G+ FL+ L+ENE AFDLLYC+ F +M
Sbjct  170   RAAWEYPFAVAGVNITFMIMQMLDLEASKPRTFIGSVFLQMLSENEWAFDLLYCVAFAVM  229

Query  934   DHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             D QWL   A+YM+FN V++ TR QLE+EL+++D+ R+ED+P
Sbjct  230   DKQWLDRNATYMEFNDVLRCTRAQLERELMMDDVFRIEDMP  270



>gb|KGN51676.1| hypothetical protein Csa_5G589930 [Cucumis sativus]
Length=432

 Score =   301 bits (772),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 178/229 (78%), Gaps = 0/229 (0%)
 Frame = +1

Query  370   VVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSA  549
             V  G+  W+G+G++CIC + + S  R   NLTP QE+ L+RL+ RM + +D S   HQ A
Sbjct  37    VTCGTPTWIGKGITCICFKRKGSLERICINLTPVQEDRLRRLKHRMKVYFDGSRINHQEA  96

Query  550   LRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQD  729
             LRALW AA+P +EL+ L+S+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ 
Sbjct  97    LRALWYAAYPGQELQALVSDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQL  156

Query  730   LLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLL  909
             LL+K+ G  + WEYPFAVAGVNITFM++QMLDL+A KPR  + + FL+ L+ENE AFDLL
Sbjct  157   LLRKQGGKPAAWEYPFAVAGVNITFMIMQMLDLDASKPRTFIRSVFLQMLSENEWAFDLL  216

Query  910   YCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             YC+ F +MD QWL   A+YM+FN V+K+TR QLEKELL+ED+ R+ED+P
Sbjct  217   YCVAFVVMDKQWLERNATYMEFNDVLKSTRAQLEKELLMEDVLRIEDMP  265



>emb|CDY51346.1| BnaC02g45750D [Brassica napus]
Length=258

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 174/221 (79%), Gaps = 0/221 (0%)
 Frame = +1

Query  394   LGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRALWNAA  573
             + + L+C+C   + +  R   NLTP QEE L+RL  RM+  +D S P+HQ ALRALW+A 
Sbjct  32    IKKRLTCVCFYRKRAYERICSNLTPLQEERLKRLTKRMNNCFDASRPDHQDALRALWSAT  91

Query  574   FPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQKREGD  753
             +PE++L  LIS+QWK+MGWQGKDP+TDFRGGGFISLENLL+FA  FP SFQ LL+K+ G 
Sbjct  92    YPEKKLEALISDQWKDMGWQGKDPSTDFRGGGFISLENLLFFAKTFPTSFQSLLKKQGGK  151

Query  754   RSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCITFKLM  933
             R+ WEYPFAVAGVNITFM++QMLDLEA KPR  V + FL+ L+ENE AFDLLYC+ F +M
Sbjct  152   RAAWEYPFAVAGVNITFMIMQMLDLEASKPRTFVRSVFLQMLSENEWAFDLLYCVAFAVM  211

Query  934   DHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             D QWL   A+YM+FN V++ TR QLE+EL+++D+ R+ED+P
Sbjct  212   DKQWLDRNATYMEFNDVLRCTRAQLERELMMDDVFRIEDMP  252



>ref|XP_002315612.2| hypothetical protein POPTR_0010s07040g [Populus trichocarpa]
 gb|EEF01783.2| hypothetical protein POPTR_0010s07040g [Populus trichocarpa]
Length=285

 Score =   296 bits (758),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 180/231 (78%), Gaps = 1/231 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
             +   GS  W+G+GL+C+C + + +  R   NLTP Q + L+RL+ RM + +D S P+HQ 
Sbjct  49    DATCGSPTWIGKGLTCVCFKRKGAYERICINLTPQQAKRLKRLKDRMKVYFDASRPDHQD  108

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFR-GGGFISLENLLYFANNFPNSF  723
             ALRALW+A +P+ EL  LIS+QWKEMGWQG+DP+TDFR G GF+SLENL++FA  F  SF
Sbjct  109   ALRALWSATYPDRELSGLISDQWKEMGWQGRDPSTDFRLGAGFLSLENLVFFAKTFSISF  168

Query  724   QDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFD  903
             Q LL+K+ G RS WEYPFAVAGVNITFM++QMLDL+A+KPR  V   FL+ L+E+E AFD
Sbjct  169   QHLLRKQGGKRSAWEYPFAVAGVNITFMIMQMLDLDAMKPRTFVRPVFLQILSESEWAFD  228

Query  904   LLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LLYC+ F +MD+QWL   A+YM+FN V+K+TR Q+E+ELL++D+ R+ED+P
Sbjct  229   LLYCVAFVVMDNQWLHRNATYMEFNDVLKSTRAQVERELLMDDVLRIEDMP  279



>ref|XP_010531611.1| PREDICTED: ELMO domain-containing protein A isoform X1 [Tarenaya 
hassleriana]
Length=280

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 178/232 (77%), Gaps = 2/232 (1%)
 Frame = +1

Query  367   EVVAGSAAW-LGRGLSCICAQARESDARPSFNLTPAQ-EECLQRLQSRMDISYDRSIPEH  540
             +   G+  W +G+ L+C+C + + +  R   NLTP Q EE L+RL+ RM + +D S P+H
Sbjct  43    DTTCGTPTWRIGKTLTCVCFKRKGAYQRICSNLTPLQVEERLKRLKHRMKVYFDASRPDH  102

Query  541   QSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNS  720
             Q ALRALW+A +P +EL  LISEQWKEMGWQG+DP+TDFRG GFISLENLL+FA  FP S
Sbjct  103   QEALRALWSATYPGQELSGLISEQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFPTS  162

Query  721   FQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAF  900
             FQ LL K+ G R+ WEYPFAVAGVN+TFM++QMLDL+A KPR  V + FL+ L+ENE AF
Sbjct  163   FQRLLNKQGGKRAAWEYPFAVAGVNVTFMIMQMLDLDASKPRTFVRSVFLQILSENEWAF  222

Query  901   DLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             DLLYC+ F +MD QWL   A+YM+FN V++ TR Q+E+ELL++D+ R+ED+P
Sbjct  223   DLLYCVAFVVMDKQWLDRNATYMEFNDVLRYTRAQVERELLMDDVFRIEDMP  274



>ref|XP_010242015.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010242016.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Nelumbo 
nucifera]
Length=234

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/228 (59%), Positives = 178/228 (78%), Gaps = 1/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
             + GS +W+G  LS      R  D  P + ++P QEE LQRLQ R+ I +D + P+HQ AL
Sbjct  1     MVGSRSWIGALLSR-TGNRRHVDKIPDYTMSPLQEERLQRLQERLQIPFDETRPDHQEAL  59

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+AAFP+  L+ +ISEQWK+MGWQG +P+TDFRG GFISLENLL+FA  +P +F  L
Sbjct  60    RALWHAAFPDVYLKGMISEQWKDMGWQGTNPSTDFRGCGFISLENLLFFARTYPAAFHRL  119

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L K++G+RS WEYPFAVAG+N++FMLIQMLDL + KP+ + GA F+K L+E+E AFD+LY
Sbjct  120   LFKQDGERSTWEYPFAVAGINVSFMLIQMLDLYSAKPKCIPGANFIKILSEDEEAFDVLY  179

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             CI F++MD QWL+M ASYM+FN V+KATR QLE+EL L+D+ R++DLP
Sbjct  180   CIAFEMMDAQWLAMHASYMEFNEVLKATRTQLERELSLDDVRRIQDLP  227



>ref|XP_002888595.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64854.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=304

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/228 (59%), Positives = 177/228 (78%), Gaps = 1/228 (0%)
 Frame = +1

Query  376   AGSAAW-LGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
             + + +W + + L+C+C   + +  R   NLTP QEE L+RL+ RM   +D S P+HQ AL
Sbjct  71    SSTPSWRIKKSLTCVCFNRKRAYERICSNLTPLQEERLKRLRKRMKNYFDASRPDHQDAL  130

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+A +P E+L+DLIS+QWK MGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  131   RALWSATYPSEKLQDLISDQWKNMGWQGKDPSTDFRGAGFISLENLLFFAKTFSTSFQRL  190

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+ G R+ WEYPFAVAGVNITFM++QMLDLEA KPR+ +   FL+ L+ENE AFDLLY
Sbjct  191   LKKQGGKRAAWEYPFAVAGVNITFMIMQMLDLEASKPRSFIRLVFLQMLSENEWAFDLLY  250

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   A+YM+FN V+++TR QLEKEL+++D+ R+ED+P
Sbjct  251   CVAFVVMDKQWLDKNATYMEFNDVLRSTRGQLEKELMMDDVFRIEDMP  298



>ref|XP_010242014.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Nelumbo 
nucifera]
Length=288

 Score =   293 bits (750),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 182/243 (75%), Gaps = 1/243 (0%)
 Frame = +1

Query  328   LAWFMPNCIDICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRM  507
              A  +   +   +  + GS +W+G  LS      R  D  P + ++P QEE LQRLQ R+
Sbjct  40    FAHVISQSVQCFSNAMVGSRSWIGALLS-RTGNRRHVDKIPDYTMSPLQEERLQRLQERL  98

Query  508   DISYDRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLEN  687
              I +D + P+HQ ALRALW+AAFP+  L+ +ISEQWK+MGWQG +P+TDFRG GFISLEN
Sbjct  99    QIPFDETRPDHQEALRALWHAAFPDVYLKGMISEQWKDMGWQGTNPSTDFRGCGFISLEN  158

Query  688   LLYFANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATF  867
             LL+FA  +P +F  LL K++G+RS WEYPFAVAG+N++FMLIQMLDL + KP+ + GA F
Sbjct  159   LLFFARTYPAAFHRLLFKQDGERSTWEYPFAVAGINVSFMLIQMLDLYSAKPKCIPGANF  218

Query  868   LKFLAENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLE  1047
             +K L+E+E AFD+LYCI F++MD QWL+M ASYM+FN V+KATR QLE+EL L+D+ R++
Sbjct  219   IKILSEDEEAFDVLYCIAFEMMDAQWLAMHASYMEFNEVLKATRTQLERELSLDDVRRIQ  278

Query  1048  DLP  1056
             DLP
Sbjct  279   DLP  281



>ref|NP_564897.2| ELMO/CED-12 domain-containing protein [Arabidopsis thaliana]
 gb|AEE34640.1| ELMO/CED-12 domain-containing protein [Arabidopsis thaliana]
Length=281

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 176/228 (77%), Gaps = 1/228 (0%)
 Frame = +1

Query  376   AGSAAW-LGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
             + + +W + + L+C+C   + +  R   NLTP QEE L+RL+ RM   YD S P+HQ AL
Sbjct  48    SSTPSWRIKKSLTCVCFNRKRAYERICSNLTPLQEERLKRLRKRMKNYYDASRPDHQDAL  107

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+A +P+E+L+DLIS+QWK MGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  108   RALWSATYPDEKLQDLISDQWKNMGWQGKDPSTDFRGAGFISLENLLFFAKTFSTSFQRL  167

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L K+ G R+ WEYPFAVAGVNITFM++QMLDLEA KPR+ +   FL+ L+E+E AFDLLY
Sbjct  168   LNKQGGKRAAWEYPFAVAGVNITFMIMQMLDLEASKPRSFIRLVFLQMLSESEWAFDLLY  227

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   A+YM+FN V++ TR QLE+EL+++D+ R+ED+P
Sbjct  228   CVAFVVMDKQWLDKNATYMEFNDVLRCTRGQLERELMMDDVFRIEDMP  275



>gb|KFK41143.1| hypothetical protein AALP_AA2G091400 [Arabis alpina]
Length=280

 Score =   291 bits (744),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 176/228 (77%), Gaps = 1/228 (0%)
 Frame = +1

Query  376   AGSAAW-LGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
              G+ +W + + L+C+C   + +  R   NLTP QEE L+RL+ RM   +D + P+HQ AL
Sbjct  47    GGTPSWRIKKSLTCVCFNRKRAYERICSNLTPLQEERLKRLRKRMKNYFDAARPDHQDAL  106

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+A +P E+L  LIS+QWK+MGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  107   RALWSATYPGEKLEALISDQWKDMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQRL  166

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+ G R+ WEYPFAVAGVNITFM++QMLDLEA KPR+ V + FL+ L+ENE AFDLLY
Sbjct  167   LKKQGGKRAAWEYPFAVAGVNITFMIMQMLDLEASKPRSFVRSIFLQMLSENEWAFDLLY  226

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   A+YM+FN V++ TR QLEKEL+++D+ R+ED+P
Sbjct  227   CVAFAVMDKQWLDKNATYMEFNDVLRCTRGQLEKELIMDDVFRIEDMP  274



>gb|AAG00245.1|AC002130_10 F1N21.22 [Arabidopsis thaliana]
Length=328

 Score =   292 bits (747),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 176/228 (77%), Gaps = 1/228 (0%)
 Frame = +1

Query  376   AGSAAW-LGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
             + + +W + + L+C+C   + +  R   NLTP QEE L+RL+ RM   YD S P+HQ AL
Sbjct  95    SSTPSWRIKKSLTCVCFNRKRAYERICSNLTPLQEERLKRLRKRMKNYYDASRPDHQDAL  154

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+A +P+E+L+DLIS+QWK MGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  155   RALWSATYPDEKLQDLISDQWKNMGWQGKDPSTDFRGAGFISLENLLFFAKTFSTSFQRL  214

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L K+ G R+ WEYPFAVAGVNITFM++QMLDLEA KPR+ +   FL+ L+E+E AFDLLY
Sbjct  215   LNKQGGKRAAWEYPFAVAGVNITFMIMQMLDLEASKPRSFIRLVFLQMLSESEWAFDLLY  274

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   A+YM+FN V++ TR QLE+EL+++D+ R+ED+P
Sbjct  275   CVAFVVMDKQWLDKNATYMEFNDVLRCTRGQLERELMMDDVFRIEDMP  322



>dbj|BAD42979.1| unknown protein [Arabidopsis thaliana]
Length=304

 Score =   291 bits (745),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 176/228 (77%), Gaps = 1/228 (0%)
 Frame = +1

Query  376   AGSAAW-LGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
             + + +W + + L+C+C   + +  R   NLTP QEE L+RL+ RM   YD S P+HQ AL
Sbjct  71    SSTPSWRIKKSLTCVCFNRKRAYERICSNLTPLQEERLKRLRKRMKNYYDASRPDHQDAL  130

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+A +P+E+L+DLIS+QWK MGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  131   RALWSATYPDEKLQDLISDQWKNMGWQGKDPSTDFRGAGFISLENLLFFAKTFSTSFQRL  190

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L K+ G R+ W+YPFAVAGVNITFM++QMLDLEA KPR+ +   FL+ L+E+E AFDLLY
Sbjct  191   LNKQGGKRAAWKYPFAVAGVNITFMIMQMLDLEASKPRSFIRLVFLQMLSESEWAFDLLY  250

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   A+YM+FN V++ TR QLE+EL+++D+ R+ED+P
Sbjct  251   CVAFVVMDKQWLDKNATYMEFNDVLRCTRGQLERELMMDDVFRIEDMP  298



>ref|XP_007163750.1| hypothetical protein PHAVU_001G261100g [Phaseolus vulgaris]
 gb|ESW35744.1| hypothetical protein PHAVU_001G261100g [Phaseolus vulgaris]
Length=247

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 183/229 (80%), Gaps = 0/229 (0%)
 Frame = +1

Query  370   VVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSA  549
             V  GS AW+G+GL+C+C + + +  R   +LTP QEE L+RL+ RM + +D S  +HQ A
Sbjct  13    VTCGSPAWIGKGLTCVCFKRKGNCQRICISLTPLQEERLRRLKRRMKVYFDGSKLDHQEA  72

Query  550   LRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQD  729
             LRALW+A+FP +EL+ LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ 
Sbjct  73    LRALWSASFPGQELQGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSISFQT  132

Query  730   LLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLL  909
             +L+K+ G  ++WEYPFAVAGVNITFM+IQMLDL+A KPR+ V A FL+ L+ENE AFDLL
Sbjct  133   ILKKQGGKEAVWEYPFAVAGVNITFMIIQMLDLDATKPRSFVRAVFLQMLSENEWAFDLL  192

Query  910   YCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             YC+ F +MD QW   +A+YM+FN V+K+TR Q+EKELL++D+ R+ED+P
Sbjct  193   YCVAFVVMDKQWQERKATYMEFNDVLKSTRVQIEKELLMDDVLRIEDMP  241



>ref|XP_007163749.1| hypothetical protein PHAVU_001G261100g [Phaseolus vulgaris]
 gb|ESW35743.1| hypothetical protein PHAVU_001G261100g [Phaseolus vulgaris]
Length=263

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/233 (60%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = +1

Query  358   ICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPE  537
             I   V  GS AW+G+GL+C+C + + +  R   +LTP QEE L+RL+ RM + +D S  +
Sbjct  25    IADNVTCGSPAWIGKGLTCVCFKRKGNCQRICISLTPLQEERLRRLKRRMKVYFDGSKLD  84

Query  538   HQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPN  717
             HQ ALRALW+A+FP +EL+ LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  
Sbjct  85    HQEALRALWSASFPGQELQGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSI  144

Query  718   SFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESA  897
             SFQ +L+K+ G  ++WEYPFAVAGVNITFM+IQMLDL+A KPR+ V A FL+ L+ENE A
Sbjct  145   SFQTILKKQGGKEAVWEYPFAVAGVNITFMIIQMLDLDATKPRSFVRAVFLQMLSENEWA  204

Query  898   FDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             FDLLYC+ F +MD QW   +A+YM+FN V+K+TR Q+EKELL++D+ R+ED+P
Sbjct  205   FDLLYCVAFVVMDKQWQERKATYMEFNDVLKSTRVQIEKELLMDDVLRIEDMP  257



>emb|CDP19894.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/228 (59%), Positives = 177/228 (78%), Gaps = 0/228 (0%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
               G+  W+G+GL+C+C + + +  R  F+LTP QEE L+RL+ RM I +D S  EHQ AL
Sbjct  39    TCGAPIWMGKGLTCVCFKRKGTYERIFFDLTPQQEERLRRLKRRMRICFDGSKVEHQEAL  98

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+A +P +EL  L+S+QWK+MGWQG+DP+TDFRG GF+SLENLL+FA  F  SFQ L
Sbjct  99    RALWHATYPGQELISLVSDQWKDMGWQGRDPSTDFRGAGFVSLENLLFFAKTFSTSFQQL  158

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K  G+R+ WEYPFAV GVNITFML+QMLDL+++KPR  V   FL+ L+ENE AFDLLY
Sbjct  159   LKKEGGNRATWEYPFAVGGVNITFMLMQMLDLDSLKPRTFVRPVFLQMLSENEWAFDLLY  218

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   A+YM+FN V++ TR QLEKELL++D+ R+ED+P
Sbjct  219   CVAFVVMDKQWLERNATYMEFNDVLRTTRSQLEKELLMDDVLRIEDMP  266



>ref|XP_008448272.1| PREDICTED: ELMO domain-containing protein A isoform X4 [Cucumis 
melo]
 ref|XP_008448273.1| PREDICTED: ELMO domain-containing protein A isoform X4 [Cucumis 
melo]
 ref|XP_008448274.1| PREDICTED: ELMO domain-containing protein A isoform X4 [Cucumis 
melo]
 ref|XP_008448275.1| PREDICTED: ELMO domain-containing protein A isoform X4 [Cucumis 
melo]
Length=233

 Score =   286 bits (732),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 167/209 (80%), Gaps = 0/209 (0%)
 Frame = +1

Query  430   RESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSALRALWNAAFPEEELRDLISE  609
             R+SD    + L+P QEE LQRLQ RM I +D +  +HQ ALRALWNAA+P  EL+ +ISE
Sbjct  18    RKSDKFLQYPLSPLQEERLQRLQHRMHIPFDETCVDHQEALRALWNAAYPNIELKGMISE  77

Query  610   QWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDLLQKREGDRSMWEYPFAVAG  789
             QWKEMGWQG +P+TDFRG GFISLENLL+F+  FP SF+ LL K +G+R+ WEYPFAVAG
Sbjct  78    QWKEMGWQGPNPSTDFRGCGFISLENLLFFSRMFPASFRRLLLKEDGNRATWEYPFAVAG  137

Query  790   VNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLYCITFKLMDHQWLSMRASYM  969
             +N++FMLIQMLDL A KPRNL G  F++ L ENE AFD+LYC+ F++MD QWL+M ASYM
Sbjct  138   INVSFMLIQMLDLNAEKPRNLPGLNFVRLLGENEEAFDVLYCVAFEMMDAQWLAMHASYM  197

Query  970   DFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             +FN V++ TR QLE+EL LED+ R++DLP
Sbjct  198   EFNEVLQVTRTQLERELSLEDVHRIQDLP  226



>ref|XP_006601899.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Glycine 
max]
 gb|KHN24073.1| ELMO domain-containing protein A [Glycine soja]
Length=247

 Score =   286 bits (733),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 180/230 (78%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
                 GS AW+G+GL+C+C + + +  R   +LTP QEE L+RL+ RM + +D S  EHQ 
Sbjct  12    HATCGSPAWIGKGLTCVCFKRKGNCQRICISLTPLQEERLRRLKRRMKVYFDASKLEHQE  71

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             ALRALW+A+FP++EL+ LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  72    ALRALWSASFPDQELQSLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQ  131

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL+K+ G  ++WEYPFAVAGVNITFM++QMLDL+A KPR  V A FL+ L+ENE AFDL
Sbjct  132   RLLKKQGGKGAVWEYPFAVAGVNITFMIMQMLDLDATKPRTFVRAVFLQMLSENEWAFDL  191

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC  F +MD  WL   A+YM+FN V+K+TR QLEKELL++D+ R+ED+P
Sbjct  192   LYCAAFVVMDKLWLERNATYMEFNDVLKSTRVQLEKELLMDDVLRIEDMP  241



>ref|XP_006591458.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Glycine 
max]
Length=262

 Score =   287 bits (735),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 188/249 (76%), Gaps = 7/249 (3%)
 Frame = +1

Query  331   AWFMPNCI-------DICAEVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQ  489
             A F+P C        D      + ++AW+G+GL+C+C + + +  R   +LTP QEE L+
Sbjct  8     ATFVPICASSTSHASDHATTCGSPASAWIGKGLTCVCFKRKGNCQRICISLTPLQEERLR  67

Query  490   RLQSRMDISYDRSIPEHQSALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGG  669
             RL+ RM + +D S  EHQ ALRALW+A+FP++EL+ LIS+QWKEMGWQG+DP+TDFRG G
Sbjct  68    RLKRRMKVYFDASKLEHQEALRALWSASFPDQELQSLISDQWKEMGWQGRDPSTDFRGAG  127

Query  670   FISLENLLYFANNFPNSFQDLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRN  849
             FISLENLL+FA  F  SFQ LL+K+ G  ++WEYPFAVAGVNITFM++QMLDL+A KPR 
Sbjct  128   FISLENLLFFAKTFSTSFQRLLKKQGGKGAVWEYPFAVAGVNITFMIMQMLDLDATKPRT  187

Query  850   LVGATFLKFLAENESAFDLLYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLE  1029
              V A FL+ L+ENE AFDLLYC+ F +MD  WL   A+YM+FN V+K+TR QLEKELL++
Sbjct  188   FVRAVFLQMLSENEWAFDLLYCVAFVVMDKLWLERNATYMEFNDVLKSTRVQLEKELLMD  247

Query  1030  DITRLEDLP  1056
             D+ R+ED+P
Sbjct  248   DVLRIEDMP  256



>gb|KHG05195.1| ELMO domain-containing A [Gossypium arboreum]
Length=257

 Score =   287 bits (734),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 172/228 (75%), Gaps = 13/228 (6%)
 Frame = +1

Query  373   VAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
               G  AW+G+ L+C+C + +              EE L RL+ RM + +D S P+HQ AL
Sbjct  37    TCGRPAWIGKRLTCVCFKRK-------------GEERLNRLRHRMKVYFDGSRPDHQEAL  83

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+A +P +EL  LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  84    RALWSATYPGKELHGLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQCL  143

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+ G+RS WEYPFAVAGVNITFM++QMLDL+A+KPR  + + FL+ L+ENE AFDLLY
Sbjct  144   LKKQGGNRSAWEYPFAVAGVNITFMIMQMLDLDALKPRTFIRSVFLQMLSENEWAFDLLY  203

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   A+YM+FN V+K+TR QLE+ELL++D+ R+ED+P
Sbjct  204   CVAFVVMDKQWLEKNATYMEFNEVLKSTRTQLERELLMDDVLRIEDMP  251



>ref|XP_003552785.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Glycine 
max]
Length=262

 Score =   287 bits (734),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 180/230 (78%), Gaps = 0/230 (0%)
 Frame = +1

Query  367   EVVAGSAAWLGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQS  546
                 GS AW+G+GL+C+C + + +  R   +LTP QEE L+RL+ RM + +D S  EHQ 
Sbjct  27    HATCGSPAWIGKGLTCVCFKRKGNCQRICISLTPLQEERLRRLKRRMKVYFDASKLEHQE  86

Query  547   ALRALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQ  726
             ALRALW+A+FP++EL+ LIS+QWKEMGWQG+DP+TDFRG GFISLENLL+FA  F  SFQ
Sbjct  87    ALRALWSASFPDQELQSLISDQWKEMGWQGRDPSTDFRGAGFISLENLLFFAKTFSTSFQ  146

Query  727   DLLQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDL  906
              LL+K+ G  ++WEYPFAVAGVNITFM++QMLDL+A KPR  V A FL+ L+ENE AFDL
Sbjct  147   RLLKKQGGKGAVWEYPFAVAGVNITFMIMQMLDLDATKPRTFVRAVFLQMLSENEWAFDL  206

Query  907   LYCITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             LYC  F +MD  WL   A+YM+FN V+K+TR QLEKELL++D+ R+ED+P
Sbjct  207   LYCAAFVVMDKLWLERNATYMEFNDVLKSTRVQLEKELLMDDVLRIEDMP  256



>ref|XP_006391284.1| hypothetical protein EUTSA_v10018989mg [Eutrema salsugineum]
 gb|ESQ28570.1| hypothetical protein EUTSA_v10018989mg [Eutrema salsugineum]
Length=276

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/228 (59%), Positives = 174/228 (76%), Gaps = 1/228 (0%)
 Frame = +1

Query  376   AGSAAW-LGRGLSCICAQARESDARPSFNLTPAQEECLQRLQSRMDISYDRSIPEHQSAL  552
              G+ +W + + L+C+C   +        NLTP QEE L+RL+ RM   +D S P+HQ AL
Sbjct  43    GGTPSWRIKKRLTCVCFIRKRPYELICSNLTPLQEERLKRLRKRMKNCFDASRPDHQDAL  102

Query  553   RALWNAAFPEEELRDLISEQWKEMGWQGKDPATDFRGGGFISLENLLYFANNFPNSFQDL  732
             RALW+A +P E+L+DLIS QWK+MGWQGKDP+TDFRG GFISLENLL+FA  F  SFQ L
Sbjct  103   RALWSATYPGEKLQDLISNQWKDMGWQGKDPSTDFRGAGFISLENLLFFAKTFSTSFQRL  162

Query  733   LQKREGDRSMWEYPFAVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLAENESAFDLLY  912
             L+K+ G R+ WEYPFAVAGVNITFM++QMLDLEA KPR  V + FL+ L+ENE AFDLLY
Sbjct  163   LKKQGGKRADWEYPFAVAGVNITFMIMQMLDLEASKPRTFVRSIFLQMLSENEWAFDLLY  222

Query  913   CITFKLMDHQWLSMRASYMDFNSVMKATRRQLEKELLLEDITRLEDLP  1056
             C+ F +MD QWL   A+YM+FN V++ TR QLE+EL+++D+ R+ED+P
Sbjct  223   CVAFAVMDKQWLDKNATYMEFNDVLRCTRGQLERELMMDDVFRIEDMP  270



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5027111451418