BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22666_g1_i2 len=911 path=[803:0-230 644:231-336 1137:337-357
1158:358-412 1212:413-420 697:421-473 1272:474-572 1371:573-598
1397:599-740 1539:741-910]

Length=911
                                                                      Score     E

ref|XP_002264054.1|  PREDICTED: glutathione transferase GST 23          302   6e-99   Vitis vinifera
emb|CAN78656.1|  hypothetical protein VITISV_006850                     301   2e-98   Vitis vinifera
ref|XP_002264117.1|  PREDICTED: probable glutathione S-transferase      298   3e-97   Vitis vinifera
emb|CAN72240.1|  hypothetical protein VITISV_010777                     297   6e-97   Vitis vinifera
ref|XP_002264055.2|  PREDICTED: probable glutathione S-transferas...    295   3e-96   Vitis vinifera
ref|XP_010646030.1|  PREDICTED: probable glutathione S-transferase      294   9e-96   
ref|XP_010661155.1|  PREDICTED: probable glutathione S-transferas...    293   2e-95   
ref|XP_009790678.1|  PREDICTED: glutathione transferase GST 23-like     285   2e-92   
ref|XP_004133937.1|  PREDICTED: probable glutathione S-transferas...    284   7e-92   
ref|XP_006354574.1|  PREDICTED: glutathione transferase GST 23-like     283   1e-91   
ref|XP_011086578.1|  PREDICTED: glutathione transferase GST 23-like     283   3e-91   
gb|EYU26814.1|  hypothetical protein MIMGU_mgv1a013348mg                282   3e-91   
ref|XP_004229525.1|  PREDICTED: glutathione transferase GST 23-like     282   4e-91   
gb|KDP42499.1|  hypothetical protein JCGZ_00296                         281   2e-90   
ref|XP_006354571.1|  PREDICTED: glutathione transferase GST 23-li...    280   2e-90   
ref|XP_006354570.1|  PREDICTED: glutathione transferase GST 23-li...    280   2e-90   
ref|XP_002527848.1|  glutathione s-transferase, putative                280   3e-90   Ricinus communis
ref|XP_007220010.1|  hypothetical protein PRUPE_ppb024827mg             279   5e-90   
ref|XP_008438211.1|  PREDICTED: probable glutathione S-transferase      278   1e-89   
ref|XP_004229524.1|  PREDICTED: glutathione transferase GST 23-like     278   1e-89   
ref|XP_010067033.1|  PREDICTED: probable glutathione S-transferase      278   2e-89   
ref|XP_008232147.1|  PREDICTED: probable glutathione S-transferase      278   2e-89   
emb|CDP09302.1|  unnamed protein product                                275   2e-88   
gb|KDP42500.1|  hypothetical protein JCGZ_00297                         275   2e-88   
emb|CDP21862.1|  unnamed protein product                                275   3e-88   
emb|CDP19810.1|  unnamed protein product                                275   4e-88   
ref|XP_007218360.1|  hypothetical protein PRUPE_ppa011115mg             273   1e-87   
ref|XP_010097693.1|  putative glutathione S-transferase                 272   3e-87   
ref|XP_006484731.1|  PREDICTED: probable glutathione S-transferas...    272   4e-87   
ref|XP_006437360.1|  hypothetical protein CICLE_v10032686mg             271   6e-87   
ref|XP_010067034.1|  PREDICTED: glutathione transferase GST 23-like     271   1e-86   
gb|AFF18816.1|  glutathione transferase                                 271   1e-86   
gb|KDO46806.1|  hypothetical protein CISIN_1g027333mg                   270   2e-86   
ref|XP_008232144.1|  PREDICTED: probable glutathione S-transferase      270   3e-86   
ref|XP_002523997.1|  glutathione s-transferase, putative                270   3e-86   Ricinus communis
ref|XP_002523996.1|  glutathione s-transferase, putative                270   3e-86   Ricinus communis
ref|XP_006373657.1|  hypothetical protein POPTR_0016s02350g             269   5e-86   
ref|XP_009343223.1|  PREDICTED: probable glutathione S-transferas...    269   5e-86   
ref|XP_007029835.1|  Glutathione S-transferase TAU 8                    270   6e-86   
ref|XP_009335024.1|  PREDICTED: probable glutathione S-transferas...    268   1e-85   
ref|XP_009343224.1|  PREDICTED: probable glutathione S-transferas...    268   1e-85   
ref|XP_009606213.1|  PREDICTED: glutathione transferase GST 23-like     268   2e-85   
ref|XP_004307164.1|  PREDICTED: glutathione transferase GST 23-like     267   2e-85   
ref|XP_009335025.1|  PREDICTED: probable glutathione S-transferas...    267   2e-85   
ref|XP_009343222.1|  PREDICTED: glutathione transferase GST 23-li...    266   5e-85   
ref|XP_002307924.1|  hypothetical protein POPTR_0006s02510g             264   4e-84   Populus trichocarpa [western balsam poplar]
ref|XP_008346936.1|  PREDICTED: probable glutathione S-transferase      266   4e-84   
ref|XP_011010098.1|  PREDICTED: probable glutathione S-transferase      264   5e-84   
ref|XP_002322571.1|  hypothetical protein POPTR_0016s02370g             264   6e-84   Populus trichocarpa [western balsam poplar]
ref|XP_006437359.1|  hypothetical protein CICLE_v10032702mg             263   7e-84   
ref|XP_011004953.1|  PREDICTED: probable glutathione S-transferase      263   2e-83   
ref|XP_006484732.1|  PREDICTED: probable glutathione S-transferas...    261   4e-83   
ref|XP_011004483.1|  PREDICTED: probable glutathione S-transferase      261   5e-83   
ref|XP_009335026.1|  PREDICTED: probable glutathione S-transferas...    261   8e-83   
ref|XP_002319750.2|  hypothetical protein POPTR_0013s06950g             259   3e-82   Populus trichocarpa [western balsam poplar]
ref|XP_004307163.1|  PREDICTED: probable glutathione S-transferas...    259   6e-82   
ref|XP_009343225.1|  PREDICTED: probable glutathione S-transferas...    258   7e-82   
gb|ADB11367.1|  putative tau class glutathione transferase GSTU41       258   1e-81   Populus trichocarpa [western balsam poplar]
ref|XP_011040645.1|  PREDICTED: probable glutathione S-transferase      258   2e-81   
gb|KDP39591.1|  hypothetical protein JCGZ_02611                         257   2e-81   
gb|KCW65098.1|  hypothetical protein EUGRSUZ_G02603                     256   4e-81   
ref|XP_004297032.1|  PREDICTED: probable glutathione S-transferas...    254   3e-80   
gb|KCW65100.1|  hypothetical protein EUGRSUZ_G02605                     253   3e-79   
ref|XP_004299656.1|  PREDICTED: probable glutathione S-transferas...    249   3e-78   
ref|XP_007219176.1|  hypothetical protein PRUPE_ppa016653mg             246   5e-77   
ref|XP_010938159.1|  PREDICTED: glutathione transferase GST 23-like     245   1e-76   
emb|CBI38197.3|  unnamed protein product                                244   1e-75   
ref|XP_008793319.1|  PREDICTED: probable glutathione S-transferase      241   8e-75   
ref|XP_010922854.1|  PREDICTED: probable glutathione S-transferase      239   4e-74   
emb|CAN60447.1|  hypothetical protein VITISV_016434                     236   1e-73   Vitis vinifera
ref|XP_006437357.1|  hypothetical protein CICLE_v10032696mg             235   1e-72   
ref|XP_002266744.1|  PREDICTED: probable glutathione S-transferase      235   1e-72   Vitis vinifera
ref|XP_010279540.1|  PREDICTED: probable glutathione S-transferas...    223   5e-68   
ref|XP_002280676.1|  PREDICTED: probable glutathione S-transferase      223   8e-68   Vitis vinifera
ref|XP_007223941.1|  hypothetical protein PRUPE_ppa011108mg             222   1e-67   
ref|XP_010278876.1|  PREDICTED: probable glutathione S-transferase      222   1e-67   
ref|XP_004978487.1|  PREDICTED: glutathione transferase GST 23-like     222   2e-67   
ref|XP_008346920.1|  PREDICTED: glutathione transferase GST 23-like     222   3e-67   
ref|XP_010279423.1|  PREDICTED: probable glutathione S-transferase      221   4e-67   
ref|XP_004299558.1|  PREDICTED: probable glutathione S-transferas...    220   5e-67   
ref|XP_010264127.1|  PREDICTED: uncharacterized protein LOC104602212    228   6e-67   
ref|XP_010923032.1|  PREDICTED: probable glutathione S-transferase      220   6e-67   
ref|XP_010279542.1|  PREDICTED: probable glutathione S-transferas...    220   9e-67   
gb|ADB11374.1|  tau class glutathione transferase GSTU50                219   1e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010279541.1|  PREDICTED: probable glutathione S-transferas...    219   2e-66   
ref|XP_007026865.1|  Tau class glutathione transferase GSTU45           219   2e-66   
ref|XP_002280532.1|  PREDICTED: probable glutathione S-transferase      219   2e-66   Vitis vinifera
ref|XP_008219369.1|  PREDICTED: glutathione transferase GST 23-like     218   3e-66   
ref|XP_007159485.1|  hypothetical protein PHAVU_002G241400g             218   4e-66   
gb|AFK47124.1|  unknown                                                 218   5e-66   
ref|XP_004299207.1|  PREDICTED: glutathione transferase GST 23-like     217   8e-66   
ref|XP_006433894.1|  hypothetical protein CICLE_v10002406mg             217   8e-66   
gb|ADB11377.1|  putative tau class glutathione transferase GSTU53       217   8e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010060069.1|  PREDICTED: glutathione transferase GST 23-like     217   1e-65   
gb|KDO81087.1|  hypothetical protein CISIN_1g027498mg                   216   3e-65   
ref|XP_010243637.1|  PREDICTED: probable glutathione S-transferase      216   3e-65   
ref|XP_007226235.1|  hypothetical protein PRUPE_ppa017218mg             216   3e-65   
ref|XP_007035122.1|  Glutathione S-transferase tau 7 isoform 2          216   4e-65   
ref|XP_010938160.1|  PREDICTED: glutathione transferase GST 23-like     216   4e-65   
ref|XP_009593034.1|  PREDICTED: glutathione transferase GST 23-like     215   6e-65   
ref|XP_002532523.1|  glutathione s-transferase, putative                215   6e-65   Ricinus communis
ref|XP_007035120.1|  Glutathione S-transferase tau 7                    216   7e-65   
ref|XP_007035121.1|  Glutathione S-transferase tau 7 isoform 1          216   7e-65   
ref|XP_002532525.1|  glutathione s-transferase, putative                214   9e-65   Ricinus communis
ref|XP_007026863.1|  Tau class glutathione transferase GSTU45           214   1e-64   
ref|XP_009372270.1|  PREDICTED: probable glutathione S-transferase      214   1e-64   
gb|AFK41941.1|  unknown                                                 214   1e-64   
ref|XP_008781207.1|  PREDICTED: probable glutathione S-transferase      214   1e-64   
gb|ADB11358.1|  tau class glutathione transferase GSTU26                214   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_007034526.1|  Glutathione S-transferase tau 7                    214   2e-64   
ref|XP_009764523.1|  PREDICTED: glutathione transferase GST 23-like     214   2e-64   
ref|XP_006472526.1|  PREDICTED: glutathione transferase GST 23-like     214   2e-64   
ref|XP_002318530.2|  hypothetical protein POPTR_0012s04770g             214   2e-64   Populus trichocarpa [western balsam poplar]
ref|XP_011030495.1|  PREDICTED: probable glutathione S-transferase      214   2e-64   
ref|XP_008793318.1|  PREDICTED: glutathione transferase GST 23-like     213   5e-64   
ref|NP_001234088.1|  uncharacterized protein LOC543815                  213   6e-64   
ref|XP_008224069.1|  PREDICTED: glutathione transferase GST 23-like     213   7e-64   
ref|XP_006378334.1|  hypothetical protein POPTR_0010s08170g             212   8e-64   
ref|XP_008346196.1|  PREDICTED: probable glutathione S-transferase      212   9e-64   
ref|XP_008781341.1|  PREDICTED: glutathione transferase GST 23-like     212   9e-64   
ref|XP_004292258.1|  PREDICTED: probable glutathione S-transferas...    212   1e-63   
ref|XP_006354565.1|  PREDICTED: glutathione transferase GST 23-li...    211   1e-63   
ref|XP_006489728.1|  PREDICTED: glutathione S-transferase U8-like       212   1e-63   
emb|CDO99237.1|  unnamed protein product                                211   2e-63   
ref|XP_006376726.1|  hypothetical protein POPTR_0012s04780g             211   2e-63   
ref|XP_007200430.1|  hypothetical protein PRUPE_ppa011142mg             211   2e-63   
gb|AGH14251.1|  glutathione S-transferase                               211   3e-63   
ref|XP_010243633.1|  PREDICTED: glutathione transferase GST 23-like     211   3e-63   
ref|XP_009399930.1|  PREDICTED: probable glutathione S-transferase      211   4e-63   
ref|XP_007134772.1|  hypothetical protein PHAVU_010G074600g             210   4e-63   
ref|XP_010271919.1|  PREDICTED: glutathione transferase GST 23-like     210   4e-63   
ref|XP_008224066.1|  PREDICTED: probable glutathione S-transferase      210   5e-63   
ref|XP_008382674.1|  PREDICTED: probable glutathione S-transferase      210   6e-63   
gb|AJE59670.1|  tau class glutathione S-transferase                     210   7e-63   
gb|AJE59654.1|  tau class glutathione S-transferase                     209   7e-63   
gb|KDO57583.1|  hypothetical protein CISIN_1g046710mg                   210   8e-63   
gb|KHN06423.1|  Putative glutathione S-transferase                      209   8e-63   
ref|XP_007034532.1|  Glutathione S-transferase tau 7                    210   9e-63   
ref|XP_010243636.1|  PREDICTED: probable glutathione S-transferase      209   9e-63   
ref|XP_004299557.1|  PREDICTED: probable glutathione S-transferas...    209   9e-63   
ref|XP_007201513.1|  hypothetical protein PRUPE_ppa015182mg             209   1e-62   
gb|AFF18812.1|  glutathione transferase                                 209   1e-62   
ref|XP_008224070.1|  PREDICTED: probable glutathione S-transferase      209   2e-62   
emb|CDP06552.1|  unnamed protein product                                209   2e-62   
ref|XP_007226313.1|  hypothetical protein PRUPE_ppa021702mg             209   2e-62   
gb|ADB11371.1|  putative tau class glutathione transferase GSTU47       208   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_010921338.1|  PREDICTED: glutathione transferase GST 23-like     209   2e-62   
gb|ACU20120.1|  unknown                                                 209   2e-62   Glycine max [soybeans]
gb|KHN48021.1|  Putative glutathione S-transferase                      210   2e-62   
ref|NP_001234957.1|  glutathione S-transferase GST 17                   208   3e-62   
gb|AFK45620.1|  unknown                                                 208   3e-62   
ref|XP_004302690.1|  PREDICTED: probable glutathione S-transferas...    208   3e-62   
ref|XP_010037769.1|  PREDICTED: probable glutathione S-transferase      208   3e-62   
gb|KHN06425.1|  Putative glutathione S-transferase                      208   3e-62   
ref|XP_011039096.1|  PREDICTED: probable glutathione S-transferase      208   3e-62   
gb|KDO66687.1|  hypothetical protein CISIN_1g041211mg                   207   4e-62   
ref|XP_010091847.1|  Glutathione transferase GST 23                     207   4e-62   
ref|XP_010243655.1|  PREDICTED: probable glutathione S-transferase      208   5e-62   
emb|CDP08010.1|  unnamed protein product                                207   5e-62   
ref|XP_010243635.1|  PREDICTED: glutathione transferase GST 23-like     207   5e-62   
ref|XP_002277724.2|  PREDICTED: glutathione transferase GST 23          207   6e-62   Vitis vinifera
ref|XP_006494129.1|  PREDICTED: probable glutathione S-transferas...    207   6e-62   
ref|NP_001238721.1|  glutathione S-transferase GST 13                   207   7e-62   
ref|XP_002524048.1|  glutathione s-transferase, putative                207   7e-62   Ricinus communis
ref|XP_010069088.1|  PREDICTED: glutathione transferase GST 23-like     207   8e-62   
gb|KDO36340.1|  hypothetical protein CISIN_1g027486mg                   207   8e-62   
ref|XP_002285212.1|  PREDICTED: glutathione transferase GST 23          207   8e-62   Vitis vinifera
ref|XP_008793317.1|  PREDICTED: probable glutathione S-transferase      207   9e-62   
ref|XP_010037776.1|  PREDICTED: probable glutathione S-transferase      206   1e-61   
ref|XP_010269443.1|  PREDICTED: probable glutathione S-transferase      206   1e-61   
gb|AFS51729.1|  tau class glutathione S-transferase                     206   1e-61   
gb|ADB11327.1|  tau class glutathione transferase GSTU45                206   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_002285214.1|  PREDICTED: glutathione transferase GST 23          206   2e-61   Vitis vinifera
gb|KHN48020.1|  Glutathione transferase GST 23                          206   2e-61   
ref|NP_001235279.1|  uncharacterized protein LOC100527381               206   2e-61   
ref|XP_011000057.1|  PREDICTED: probable glutathione S-transferase      206   2e-61   
ref|XP_008240197.1|  PREDICTED: probable glutathione S-transferase      206   2e-61   
gb|AFY26875.1|  glutathione-S-transferase                               206   2e-61   
ref|XP_008235548.1|  PREDICTED: probable glutathione S-transferase      206   2e-61   
ref|XP_003632026.2|  PREDICTED: probable glutathione S-transferase      206   3e-61   
ref|XP_007200426.1|  hypothetical protein PRUPE_ppa011079mg             206   3e-61   
ref|XP_007034533.1|  Glutathione S-transferase tau 7                    206   3e-61   
ref|XP_010037768.1|  PREDICTED: probable glutathione S-transferase      206   3e-61   
ref|XP_010037777.1|  PREDICTED: probable glutathione S-transferase      206   3e-61   
gb|EYU26623.1|  hypothetical protein MIMGU_mgv1a013321mg                205   3e-61   
ref|XP_008235550.1|  PREDICTED: probable glutathione S-transferase      205   3e-61   
ref|XP_002518188.1|  glutathione s-transferase, putative                205   3e-61   Ricinus communis
dbj|BAC21263.1|  glutathione S-transferase                              205   4e-61   Cucurbita maxima [Boston marrow]
gb|EYU26622.1|  hypothetical protein MIMGU_mgv1a013365mg                205   4e-61   
ref|XP_010069125.1|  PREDICTED: glutathione transferase GST 23-like     205   4e-61   
ref|XP_010025836.1|  PREDICTED: glutathione transferase GST 23-like     207   4e-61   
gb|ADD71974.1|  glutathione S-transferase                               205   4e-61   
gb|KDO57582.1|  hypothetical protein CISIN_1g043218mg                   205   4e-61   
ref|XP_002525352.1|  glutathione s-transferase, putative                205   5e-61   Ricinus communis
ref|XP_010042776.1|  PREDICTED: glutathione S-transferase U8-like       205   5e-61   
ref|XP_007050084.1|  Glutathione S-transferase tau 7                    205   6e-61   
ref|XP_010263987.1|  PREDICTED: probable glutathione S-transferase      204   6e-61   
ref|XP_002518184.1|  glutathione s-transferase, putative                204   6e-61   Ricinus communis
ref|XP_009778650.1|  PREDICTED: glutathione transferase GST 23-like     205   6e-61   
emb|CDP08048.1|  unnamed protein product                                206   7e-61   
gb|KDP40336.1|  hypothetical protein JCGZ_02334                         204   9e-61   
ref|XP_002285220.1|  PREDICTED: glutathione transferase GST 23          204   9e-61   Vitis vinifera
ref|XP_002524046.1|  glutathione s-transferase, putative                204   1e-60   Ricinus communis
ref|XP_004290016.1|  PREDICTED: glutathione transferase GST 23-li...    204   1e-60   
ref|XP_002266900.1|  PREDICTED: probable glutathione S-transferase      204   1e-60   Vitis vinifera
ref|XP_010037778.1|  PREDICTED: glutathione S-transferase U8-like       204   1e-60   
emb|CAN60691.1|  hypothetical protein VITISV_044168                     204   1e-60   Vitis vinifera
ref|XP_007221843.1|  hypothetical protein PRUPE_ppa024247mg             204   1e-60   
gb|ADB11369.1|  tau class glutathione transferase GSTU43                204   2e-60   Populus trichocarpa [western balsam poplar]
emb|CDP15482.1|  unnamed protein product                                203   2e-60   
ref|XP_004309296.1|  PREDICTED: glutathione transferase GST 23-like     203   2e-60   
ref|XP_002315607.2|  hypothetical protein POPTR_0010s07100g             204   2e-60   Populus trichocarpa [western balsam poplar]
emb|CBI26437.3|  unnamed protein product                                204   2e-60   
ref|XP_007034540.1|  Glutathione S-transferase tau 7                    203   2e-60   
ref|XP_004507184.1|  PREDICTED: probable glutathione S-transferas...    203   2e-60   
ref|XP_009370935.1|  PREDICTED: glutathione transferase GST 23-like     203   2e-60   
ref|XP_003632015.1|  PREDICTED: probable glutathione S-transferase      203   2e-60   
ref|XP_006420235.1|  hypothetical protein CICLE_v10006671mg             203   2e-60   
emb|CAN63628.1|  hypothetical protein VITISV_018696                     203   3e-60   Vitis vinifera
ref|XP_002275657.2|  PREDICTED: probable glutathione S-transferase      202   3e-60   Vitis vinifera
emb|CAN73675.1|  hypothetical protein VITISV_001110                     202   3e-60   Vitis vinifera
gb|KHG09979.1|  Glutathione S-transferase U8 -like protein              203   4e-60   
gb|KDP33368.1|  hypothetical protein JCGZ_12917                         202   4e-60   
ref|XP_008372419.1|  PREDICTED: glutathione transferase GST 23-like     202   4e-60   
ref|XP_007036677.1|  Tau class glutathione transferase GSTU26           202   4e-60   
ref|XP_008382671.1|  PREDICTED: glutathione transferase GST 23-like     202   4e-60   
ref|XP_009622502.1|  PREDICTED: glutathione transferase GST 23-like     202   4e-60   
ref|XP_011041491.1|  PREDICTED: probable glutathione S-transferase      202   5e-60   
ref|XP_006494139.1|  PREDICTED: probable glutathione S-transferas...    202   5e-60   
ref|XP_008374802.1|  PREDICTED: glutathione S-transferase U8-like       202   5e-60   
ref|XP_010938161.1|  PREDICTED: glutathione S-transferase U8-like       202   6e-60   
ref|XP_006480160.1|  PREDICTED: probable glutathione S-transferas...    202   6e-60   
ref|XP_008382670.1|  PREDICTED: glutathione transferase GST 23-like     202   6e-60   
ref|XP_008344765.1|  PREDICTED: glutathione S-transferase U8-like       202   6e-60   
ref|XP_006424949.1|  hypothetical protein CICLE_v10029241mg             202   7e-60   
gb|KDO66688.1|  hypothetical protein CISIN_1g038634mg                   202   8e-60   
ref|XP_009343408.1|  PREDICTED: probable glutathione S-transferase      202   8e-60   
ref|XP_010023536.1|  PREDICTED: glutathione transferase GST 23-like     202   8e-60   
ref|XP_004290013.1|  PREDICTED: glutathione transferase GST 23-like     202   9e-60   
ref|XP_006420441.1|  hypothetical protein CICLE_v10005837mg             202   9e-60   
gb|AFK40836.1|  unknown                                                 202   9e-60   
gb|KEH20685.1|  glutathione S-transferase                               202   9e-60   
ref|XP_011000484.1|  PREDICTED: probable glutathione S-transferase      201   1e-59   
ref|XP_011041493.1|  PREDICTED: probable glutathione S-transferas...    201   1e-59   
gb|KEH28979.1|  glutathione S-transferase, amino-terminal domain ...    201   1e-59   
gb|AEC32486.1|  tau class glutathione S-transferase                     201   1e-59   
ref|XP_006424951.1|  hypothetical protein CICLE_v10030408mg             202   1e-59   
gb|ACJ86006.1|  unknown                                                 201   1e-59   Medicago truncatula
ref|XP_010101874.1|  putative glutathione S-transferase                 201   1e-59   
ref|XP_008453455.1|  PREDICTED: probable glutathione S-transferase      201   1e-59   
ref|XP_006420457.1|  hypothetical protein CICLE_v10005843mg             201   1e-59   
gb|AAT94029.1|  putative glutathione s-transferase                      203   1e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002266994.1|  PREDICTED: probable glutathione S-transferase      201   1e-59   Vitis vinifera
emb|CDP10683.1|  unnamed protein product                                201   2e-59   
ref|XP_006572808.1|  PREDICTED: uncharacterized protein LOC100306...    201   2e-59   
ref|XP_008224067.1|  PREDICTED: glutathione transferase GST 23-like     201   2e-59   
ref|XP_010027076.1|  PREDICTED: probable glutathione S-transferase      201   2e-59   
ref|XP_002521517.1|  glutathione s-transferase, putative                201   2e-59   Ricinus communis
ref|NP_001238439.1|  probable glutathione S-transferase                 201   2e-59   
gb|EAY98043.1|  hypothetical protein OsI_19958                          202   2e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_006489727.1|  PREDICTED: probable glutathione S-transferas...    201   2e-59   
ref|XP_007034530.1|  Tau class glutathione transferase GSTU43           201   2e-59   
ref|XP_002267691.1|  PREDICTED: probable glutathione S-transferase      200   3e-59   Vitis vinifera
ref|XP_002268774.2|  PREDICTED: probable glutathione S-transferase      201   3e-59   Vitis vinifera
ref|XP_008438425.1|  PREDICTED: probable glutathione S-transferase      201   3e-59   
ref|XP_006494140.1|  PREDICTED: probable glutathione S-transferas...    200   3e-59   
ref|XP_007016281.1|  Glutathione S-transferase tau 7, putative          201   3e-59   
ref|XP_010939722.1|  PREDICTED: glutathione transferase GST 23-like     201   3e-59   
emb|CAN73419.1|  hypothetical protein VITISV_027346                     201   3e-59   Vitis vinifera
ref|XP_003529124.1|  PREDICTED: probable glutathione S-transferas...    200   3e-59   
emb|CBI26438.3|  unnamed protein product                                200   3e-59   
gb|KEH26957.1|  glutathione S-transferase                               200   4e-59   
emb|CDO99236.1|  unnamed protein product                                200   4e-59   
ref|XP_003524975.2|  PREDICTED: probable glutathione S-transferase      200   4e-59   
ref|XP_011041492.1|  PREDICTED: probable glutathione S-transferas...    200   5e-59   
ref|XP_008363401.1|  PREDICTED: glutathione S-transferase U8-like       200   5e-59   
ref|XP_004290018.1|  PREDICTED: glutathione transferase GST 23-li...    200   5e-59   
emb|CBI16040.3|  unnamed protein product                                204   6e-59   
gb|EYU26621.1|  hypothetical protein MIMGU_mgv1a013264mg                199   6e-59   
ref|XP_002520478.1|  glutathione s-transferase, putative                199   6e-59   
ref|XP_010037773.1|  PREDICTED: glutathione S-transferase U8-like       199   6e-59   
ref|XP_010684813.1|  PREDICTED: glutathione transferase GST 23-like     199   6e-59   
gb|KHN05112.1|  Putative glutathione S-transferase                      199   6e-59   
gb|AFK43265.1|  unknown                                                 199   6e-59   
gb|ADB11328.1|  tau class glutathione transferase GSTU46                199   6e-59   
ref|XP_008438431.1|  PREDICTED: probable glutathione S-transferase      199   7e-59   
ref|XP_008438427.1|  PREDICTED: probable glutathione S-transferas...    199   7e-59   
ref|XP_009347672.1|  PREDICTED: glutathione S-transferase U8-like       199   8e-59   
ref|XP_008358506.1|  PREDICTED: probable glutathione S-transferase      199   8e-59   
gb|ACU14737.1|  unknown                                                 200   9e-59   
ref|XP_008438428.1|  PREDICTED: probable glutathione S-transferas...    199   1e-58   
gb|ACJ83863.1|  unknown                                                 199   1e-58   
ref|XP_004137330.1|  PREDICTED: probable glutathione S-transferas...    199   1e-58   
ref|XP_006488417.1|  PREDICTED: glutathione S-transferase U7-like       199   1e-58   
ref|XP_006576598.1|  PREDICTED: probable glutathione S-transferas...    199   1e-58   
ref|XP_004160429.1|  PREDICTED: probable glutathione S-transferas...    199   1e-58   
ref|XP_002321502.2|  hypothetical protein POPTR_0015s04200g             199   1e-58   
ref|XP_007026866.1|  Tau class glutathione transferase GSTU45           199   1e-58   
gb|AFK49084.1|  unknown                                                 199   1e-58   
ref|XP_006420470.1|  hypothetical protein CICLE_v10006901mg             198   2e-58   
ref|XP_007034547.1|  Tau class glutathione transferase GSTU43           202   2e-58   
ref|XP_011041494.1|  PREDICTED: probable glutathione S-transferase      198   2e-58   
ref|XP_010039178.1|  PREDICTED: probable glutathione S-transferase      198   2e-58   
ref|XP_010031646.1|  PREDICTED: glutathione S-transferase U9-like       198   2e-58   
ref|XP_006494151.1|  PREDICTED: probable glutathione S-transferas...    198   2e-58   
ref|XP_002520473.1|  glutathione s-transferase, putative                199   2e-58   
ref|XP_010023538.1|  PREDICTED: probable glutathione S-transferase      198   2e-58   
ref|XP_008382801.1|  PREDICTED: probable glutathione S-transferase      198   2e-58   
ref|XP_003529123.1|  PREDICTED: probable glutathione S-transferas...    198   2e-58   
ref|XP_004134389.1|  PREDICTED: probable glutathione S-transferas...    198   2e-58   
ref|XP_003591644.1|  hypothetical protein MTR_1g090150                  198   2e-58   
gb|AFK35732.1|  unknown                                                 198   2e-58   
ref|XP_008391287.1|  PREDICTED: glutathione transferase GST 23-like     198   3e-58   
ref|XP_007134780.1|  hypothetical protein PHAVU_010G075400g             198   3e-58   
dbj|BAJ90384.1|  predicted protein                                      198   3e-58   
gb|AFK34634.1|  unknown                                                 198   3e-58   
ref|XP_004290017.1|  PREDICTED: glutathione transferase GST 23-li...    198   3e-58   
ref|XP_006488416.1|  PREDICTED: glutathione S-transferase U7-like       198   3e-58   
ref|XP_006367670.1|  PREDICTED: probable glutathione S-transferas...    197   3e-58   
ref|XP_004290015.1|  PREDICTED: glutathione transferase GST 23-like     198   3e-58   
ref|XP_010663654.1|  PREDICTED: probable glutathione S-transferase      197   3e-58   
gb|KHN47446.1|  Putative glutathione S-transferase                      197   4e-58   
ref|XP_006420237.1|  hypothetical protein CICLE_v10005779mg             198   4e-58   
gb|ACU15816.1|  unknown                                                 197   4e-58   
ref|XP_006420238.1|  hypothetical protein CICLE_v10005771mg             198   4e-58   
gb|AEB77869.1|  glutathione S-transferase protein                       197   4e-58   
ref|XP_002518186.1|  glutathione s-transferase, putative                197   5e-58   
ref|XP_009360111.1|  PREDICTED: glutathione S-transferase U8-like       197   5e-58   
ref|XP_006420440.1|  hypothetical protein CICLE_v10005850mg             197   6e-58   
ref|XP_002281694.2|  PREDICTED: uncharacterized protein LOC100246830    204   6e-58   
dbj|BAK02670.1|  predicted protein                                      197   6e-58   
gb|KDO66686.1|  hypothetical protein CISIN_1g041800mg                   197   7e-58   
ref|XP_010093877.1|  Glutathione transferase GST 23                     197   7e-58   
gb|KHG11257.1|  Glutathione transferase GST 23                          197   8e-58   
ref|XP_002267733.1|  PREDICTED: probable glutathione S-transferase      197   9e-58   
gb|KHG28543.1|  Glutathione S-transferase U8 -like protein              196   1e-57   
gb|AEB77872.1|  glutathione S-transferase protein                       196   1e-57   
gb|KHG11258.1|  putative glutathione S-transferase                      196   1e-57   
ref|XP_010037779.1|  PREDICTED: probable glutathione S-transferase      196   1e-57   
ref|XP_007016280.1|  Glutathione S-transferase tau 7, putative          196   2e-57   
gb|AAG34804.1|AF243369_1  glutathione S-transferase GST 14              196   2e-57   
ref|XP_002520474.1|  glutathione s-transferase, putative                196   2e-57   
emb|CDP06553.1|  unnamed protein product                                196   2e-57   
gb|EMT19525.1|  hypothetical protein F775_31981                         196   2e-57   
ref|XP_010101872.1|  putative glutathione S-transferase                 196   2e-57   
ref|XP_008438426.1|  PREDICTED: probable glutathione S-transferas...    196   2e-57   
ref|XP_002301833.2|  hypothetical protein POPTR_0002s25530g             196   2e-57   
ref|XP_004172389.1|  PREDICTED: probable glutathione S-transferas...    196   2e-57   
ref|XP_010276441.1|  PREDICTED: glutathione S-transferase U7-like       196   2e-57   
ref|XP_010024690.1|  PREDICTED: probable glutathione S-transferase      196   2e-57   
gb|KCW61132.1|  hypothetical protein EUGRSUZ_H03905                     196   2e-57   
ref|XP_006494137.1|  PREDICTED: probable glutathione S-transferas...    196   2e-57   
ref|XP_002281843.2|  PREDICTED: glutathione S-transferase U7            196   2e-57   
ref|XP_009782545.1|  PREDICTED: glutathione transferase GST 23-like     195   2e-57   
ref|XP_002315609.1|  hypothetical protein POPTR_0010s07170g             195   2e-57   
ref|XP_010939723.1|  PREDICTED: glutathione transferase GST 23-like     195   3e-57   
ref|XP_009776230.1|  PREDICTED: probable glutathione S-transferase      195   3e-57   
ref|NP_001238643.1|  glutathione S-transferase GST 6                    195   3e-57   
gb|ABW69659.2|  glutathione S-transferase                               195   3e-57   
ref|XP_006489726.1|  PREDICTED: probable glutathione S-transferas...    196   3e-57   
ref|XP_006420435.1|  hypothetical protein CICLE_v10005833mg             195   3e-57   
gb|KHN06986.1|  Putative glutathione S-transferase                      195   3e-57   
ref|XP_010069124.1|  PREDICTED: glutathione transferase GST 23-like     195   3e-57   
ref|XP_003532764.1|  PREDICTED: probable glutathione S-transferase      195   3e-57   
gb|ADB11372.1|  putative tau class glutathione transferase GSTU48       195   3e-57   
gb|ADB11325.1|  tau class glutathione transferase GSTU36                195   3e-57   
dbj|BAA78580.1|  Dcarg-1                                                195   3e-57   
ref|XP_006829814.1|  hypothetical protein AMTR_s00119p00077600          195   3e-57   
gb|KCW57371.1|  hypothetical protein EUGRSUZ_H00157                     194   3e-57   
gb|ADB11370.1|  tau class glutathione transferase GSTU44                195   4e-57   
ref|XP_002884725.1|  predicted protein                                  195   4e-57   
gb|AFF18814.1|  glutathione transferase                                 194   4e-57   
ref|XP_010029777.1|  PREDICTED: glutathione S-transferase U9-like       195   4e-57   
ref|XP_009370927.1|  PREDICTED: probable glutathione S-transferas...    194   5e-57   
ref|XP_003529121.1|  PREDICTED: probable glutathione S-transferas...    195   5e-57   
ref|XP_007034527.1|  Glutathione S-transferase tau 7                    194   6e-57   
gb|AJE59664.1|  tau class glutathione S-transferase                     194   7e-57   
ref|XP_002520472.1|  glutathione s-transferase, putative                194   7e-57   
ref|XP_002524047.1|  glutathione s-transferase, putative                194   7e-57   
ref|XP_008438430.1|  PREDICTED: probable glutathione S-transferase      194   7e-57   
ref|XP_009781771.1|  PREDICTED: probable glutathione S-transferase      194   7e-57   
ref|XP_004290012.1|  PREDICTED: glutathione transferase GST 23-like     194   7e-57   
ref|XP_002277759.2|  PREDICTED: probable glutathione S-transferase      194   7e-57   
ref|XP_006645391.1|  PREDICTED: probable glutathione S-transferas...    194   7e-57   
ref|NP_001063423.1|  Os09g0467200                                       194   7e-57   
gb|EYU40236.1|  hypothetical protein MIMGU_mgv1a020023mg                194   8e-57   
gb|AFP20277.1|  glutathione transferase 23                              194   8e-57   
ref|XP_004247117.1|  PREDICTED: probable glutathione S-transferase      194   8e-57   
ref|NP_001237698.1|  glutathione S-transferase GST 20                   194   8e-57   
ref|XP_007140454.1|  hypothetical protein PHAVU_008G113600g             194   8e-57   
ref|XP_010023537.1|  PREDICTED: probable glutathione S-transferase      194   8e-57   
ref|XP_010101873.1|  putative glutathione S-transferase                 194   8e-57   
gb|AJE59685.1|  tau class glutathione S-transferase                     194   9e-57   
ref|XP_006494143.1|  PREDICTED: probable glutathione S-transferas...    194   1e-56   
ref|XP_006494138.1|  PREDICTED: probable glutathione S-transferas...    194   1e-56   
ref|XP_006493982.1|  PREDICTED: probable glutathione S-transferas...    194   1e-56   
ref|XP_010029766.1|  PREDICTED: glutathione S-transferase U9-like       194   1e-56   
emb|CAN62219.1|  hypothetical protein VITISV_042912                     194   1e-56   
ref|XP_006480250.1|  PREDICTED: probable glutathione S-transferas...    194   1e-56   
gb|KHG01946.1|  Glutathione S-transferase U7 -like protein              193   1e-56   
emb|CAN73676.1|  hypothetical protein VITISV_001111                     193   1e-56   
ref|XP_010051837.1|  PREDICTED: glutathione transferase GST 23-li...    193   2e-56   
ref|NP_001237856.1|  uncharacterized protein LOC100500680               193   2e-56   
ref|XP_008372418.1|  PREDICTED: probable glutathione S-transferase      193   2e-56   
gb|KHN05113.1|  Putative glutathione S-transferase                      193   2e-56   
ref|XP_004157654.1|  PREDICTED: glutathione transferase GST 23-like     193   2e-56   
gb|KHG11259.1|  Glutathione transferase GST 23                          193   2e-56   
gb|ACU15611.1|  unknown                                                 193   2e-56   
ref|XP_004134026.1|  PREDICTED: glutathione transferase GST 23-like     193   2e-56   
ref|XP_010693951.1|  PREDICTED: glutathione S-transferase U7-like       193   2e-56   
ref|NP_001236169.1|  uncharacterized protein LOC100500052               193   2e-56   
ref|XP_010684816.1|  PREDICTED: glutathione transferase GST 23-like     193   2e-56   
gb|ADB11317.1|  tau class glutathione transferase GSTU14                193   2e-56   
ref|XP_010029753.1|  PREDICTED: glutathione S-transferase U10-like      193   2e-56   
ref|XP_006494141.1|  PREDICTED: glutathione transferase GST 23-like     192   3e-56   
ref|NP_001238659.1|  glutathione S-transferase GST 7                    193   3e-56   
gb|ADB11356.1|  putative tau class glutathione transferase GSTU23       194   3e-56   
ref|XP_006420466.1|  hypothetical protein CICLE_v10005851mg             192   3e-56   
ref|XP_010051838.1|  PREDICTED: probable glutathione S-transferas...    192   3e-56   
ref|XP_006378300.1|  hypothetical protein POPTR_0010s07150g             192   3e-56   
ref|NP_001237841.1|  uncharacterized protein LOC100306119               193   3e-56   
ref|XP_002314529.1|  hypothetical protein POPTR_0010s07070g             192   3e-56   
gb|KDP33367.1|  hypothetical protein JCGZ_12916                         192   4e-56   
gb|KHN25840.1|  Putative glutathione S-transferase                      192   4e-56   
ref|NP_001238675.1|  glutathione S-transferase GST 8                    192   4e-56   
ref|XP_008812228.1|  PREDICTED: glutathione transferase GST 23-like     192   4e-56   
ref|XP_006443688.1|  hypothetical protein CICLE_v10023959mg             194   4e-56   
ref|NP_001234082.1|  uncharacterized protein LOC543813                  192   4e-56   
gb|KGN56784.1|  hypothetical protein Csa_3G133350                       192   4e-56   
ref|XP_002315605.2|  hypothetical protein POPTR_0010s07150g             193   5e-56   
gb|KDO55702.1|  hypothetical protein CISIN_1g023929mg                   193   5e-56   
gb|ADB11365.1|  tau class glutathione transferase GSTU38                192   6e-56   
ref|XP_011091312.1|  PREDICTED: glutathione transferase GST 23-like     192   6e-56   
ref|XP_006340906.1|  PREDICTED: glutathione transferase GST 23-like     192   6e-56   
ref|XP_011029702.1|  PREDICTED: glutathione transferase GST 23-like     192   6e-56   
gb|AGV54744.1|  glutathione transferase                                 192   6e-56   
ref|NP_001234091.1|  uncharacterized protein LOC543816                  192   6e-56   
ref|NP_001234986.1|  glutathione S-transferase GST 19                   192   6e-56   
gb|AAO69664.1|  glutathione S-transferase                               192   7e-56   
gb|KHN05114.1|  Putative glutathione S-transferase                      192   7e-56   
ref|XP_011029699.1|  PREDICTED: probable glutathione S-transferase      191   7e-56   
gb|AFF18813.1|  glutathione transferase                                 191   7e-56   
ref|XP_002265084.1|  PREDICTED: glutathione transferase GST 23          192   7e-56   
ref|XP_003568453.1|  PREDICTED: glutathione transferase GST 23-like     193   7e-56   
ref|NP_001045404.1|  Os01g0950000                                       192   8e-56   
ref|XP_009596758.1|  PREDICTED: probable glutathione S-transferase      191   8e-56   
ref|XP_006655321.1|  PREDICTED: glutathione transferase GST 23-like     192   8e-56   
ref|XP_002315604.1|  hypothetical protein POPTR_0010s07180g             191   8e-56   
gb|KCW75661.1|  hypothetical protein EUGRSUZ_D00024                     194   9e-56   
emb|CDP11462.1|  unnamed protein product                                192   1e-55   
ref|XP_003632028.2|  PREDICTED: glutathione transferase GST 23-like     190   1e-55   
ref|XP_006365401.1|  PREDICTED: probable glutathione S-transferas...    191   1e-55   
ref|NP_187538.1|  glutathione S-transferase TAU 8                       191   1e-55   
ref|XP_004957087.1|  PREDICTED: glutathione transferase GST 23-like     191   1e-55   
ref|XP_002441097.1|  hypothetical protein SORBIDRAFT_09g020350          192   1e-55   
ref|XP_002314527.2|  hypothetical protein POPTR_0010s07090g             191   1e-55   
ref|XP_004504278.1|  PREDICTED: probable glutathione S-transferas...    191   2e-55   
gb|KDP38795.1|  hypothetical protein JCGZ_05131                         191   2e-55   
ref|XP_006378305.1|  hypothetical protein POPTR_0010s07210g             191   2e-55   
ref|XP_010029742.1|  PREDICTED: glutathione S-transferase U10-like      191   2e-55   
ref|XP_008224063.1|  PREDICTED: glutathione transferase GST 23-like     191   2e-55   
gb|ADB11315.1|  tau class glutathione transferase GSTU11                191   2e-55   
ref|XP_004971259.1|  PREDICTED: glutathione transferase GST 23-like     191   2e-55   
ref|XP_004962089.1|  PREDICTED: glutathione transferase GST 23-like     192   2e-55   
ref|XP_010685658.1|  PREDICTED: glutathione S-transferase U7-like       191   2e-55   
ref|NP_001104994.1|  glutathione transferase GST 23                     190   2e-55   
ref|XP_004249548.1|  PREDICTED: probable glutathione S-transferase      190   2e-55   
ref|XP_006849222.1|  hypothetical protein AMTR_s00027p00229840          190   2e-55   
ref|XP_004147908.1|  PREDICTED: probable glutathione S-transferas...    190   2e-55   
ref|XP_009606319.1|  PREDICTED: probable glutathione S-transferase      190   3e-55   
ref|XP_002282813.1|  PREDICTED: glutathione transferase GST 23          190   3e-55   
ref|XP_010051836.1|  PREDICTED: probable glutathione S-transferas...    190   3e-55   
gb|ABK27093.1|  unknown                                                 191   3e-55   
ref|XP_011041578.1|  PREDICTED: probable glutathione S-transferase      189   3e-55   
ref|XP_010258434.1|  PREDICTED: glutathione S-transferase U9            190   3e-55   
ref|XP_009767205.1|  PREDICTED: probable glutathione S-transferase      190   3e-55   
ref|XP_006660720.1|  PREDICTED: glutathione transferase GST 23-like     190   3e-55   
ref|NP_001234086.1|  uncharacterized protein LOC543814                  190   3e-55   
ref|XP_004492380.1|  PREDICTED: probable glutathione S-transferas...    190   3e-55   
ref|XP_011004746.1|  PREDICTED: probable glutathione S-transferase      190   3e-55   
ref|XP_004507183.1|  PREDICTED: probable glutathione S-transferas...    190   3e-55   
ref|XP_002275539.1|  PREDICTED: glutathione S-transferase U8            190   4e-55   
ref|XP_002518185.1|  glutathione s-transferase, putative                190   4e-55   
ref|XP_010674216.1|  PREDICTED: glutathione S-transferase U8-like       190   4e-55   
ref|XP_006366496.1|  PREDICTED: probable glutathione S-transferas...    190   4e-55   
ref|XP_002275435.3|  PREDICTED: glutathione S-transferase U8            190   4e-55   
tpg|DAA61851.1|  TPA: hypothetical protein ZEAMMB73_518022              190   4e-55   
ref|XP_003629836.1|  Receptor-like protein kinase                       201   4e-55   
emb|CAN73674.1|  hypothetical protein VITISV_001109                     193   4e-55   
ref|XP_006420236.1|  hypothetical protein CICLE_v10005779mg             190   4e-55   
emb|CBI18225.3|  unnamed protein product                                191   5e-55   
ref|XP_006494142.1|  PREDICTED: probable glutathione S-transferas...    189   5e-55   
ref|XP_002315608.2|  hypothetical protein POPTR_0010s07120g             189   5e-55   
ref|XP_006378176.1|  GLUTATHIONE S-TRANSFERASE 30 family protein        190   5e-55   
ref|XP_008364334.1|  PREDICTED: glutathione transferase GST 23-like     189   5e-55   
ref|XP_010023535.1|  PREDICTED: probable glutathione S-transferase      189   5e-55   
ref|XP_006387067.1|  hypothetical protein POPTR_1996s00210g             189   5e-55   
ref|XP_002269118.1|  PREDICTED: glutathione S-transferase U9            189   5e-55   
ref|XP_003529119.1|  PREDICTED: probable glutathione S-transferas...    189   5e-55   
gb|AAC32118.1|  probable glutathione S-transferase                      190   6e-55   



>ref|XP_002264054.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=228

 Score =   302 bits (774),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 174/217 (80%), Gaps = 1/217 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL+RTWSSP+ LR VWAL IK I YETI EDL+NKS  LL+YNPV+KK+PVL+H 
Sbjct  1    MAEEVKLFRTWSSPFALRAVWALKIKGIDYETIFEDLSNKSPSLLQYNPVYKKVPVLVHK  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEYI++TW   PLLP+ P +RA  RFWAKF EDK+L SI S +  +GKEQ
Sbjct  61   GKPIAESLVILEYIDETWKQAPLLPEDPHERATARFWAKFGEDKVLTSIWSVFIKQGKEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            EE +V AL+NLK +EE+L  GK+FFGG+ IGF+D+ LGWL NL S+ EEI GLK++D EK
Sbjct  121  EEAMVPALENLKFLEEELK-GKKFFGGETIGFVDLALGWLGNLISILEEIVGLKVVDGEK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            FP+LS WM +F + P I D+WPPRD+MI KFQA+ +A
Sbjct  180  FPLLSAWMQDFADAPIIKDNWPPRDRMIVKFQALRDA  216



>emb|CAN78656.1| hypothetical protein VITISV_006850 [Vitis vinifera]
Length=228

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 175/217 (81%), Gaps = 1/217 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL+RTWSSP+ LR VWAL IK I YETI EDL+NKS  LL+YNPV KK+PVL+HN
Sbjct  1    MAEEVKLFRTWSSPFALRAVWALKIKGIDYETIFEDLSNKSPLLLQYNPVFKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEYI++TW + PLLP+ P +RA  RFWAKF EDK+L SI S +  +GKEQ
Sbjct  61   GKPIAESLVILEYIDETWKHAPLLPEDPHERATARFWAKFGEDKVLTSIWSVFIKQGKEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            EE +V AL+NLK +EE+L  GK+FFGG+ IGF+D+ LGWL NL S+ EEI GLK++D EK
Sbjct  121  EEAMVPALENLKFLEEELK-GKKFFGGETIGFVDLALGWLGNLISILEEIVGLKVVDGEK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            FP+LS WM +F + P I D+WPPRD+MI KFQA+ +A
Sbjct  180  FPLLSAWMQDFADAPIIKDNWPPRDRMIVKFQALRDA  216



>ref|XP_002264117.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 179/218 (82%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEE+KL+RTWSS + LR+VWAL IK ++YETI EDL+NKS  LL+YNPVHKK+PVL+HN
Sbjct  1    MAEELKLFRTWSSVFALRIVWALKIKGVEYETIFEDLSNKSPSLLQYNPVHKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIR-SSYFMKGKE  485
            GKPI ESLVILEYI++TW  TPLLP+ P +RA  RFWAKF +DK+L SI    +F +GKE
Sbjct  61   GKPIAESLVILEYIDETWRETPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFFKEGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QEE +++A+++L+ +E++L  GKRFFGG+ IGF+D+ LGWLAN+ S+FEE+ GLK++D +
Sbjct  121  QEEAMLEAMEHLQFLEDELK-GKRFFGGERIGFVDLALGWLANMISIFEEVAGLKMVDED  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            KFP+L+ WM  F + P I D+WPPRDKMI KFQA+ +A
Sbjct  180  KFPLLAAWMQEFADSPIIKDNWPPRDKMIAKFQALRDA  217



>emb|CAN72240.1| hypothetical protein VITISV_010777 [Vitis vinifera]
Length=225

 Score =   297 bits (760),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 179/218 (82%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEE+KL+RTWSS + LR+VWAL IK ++YETI EDL+NKS  LL+YNPVHKK+PVL+HN
Sbjct  1    MAEELKLFRTWSSVFALRIVWALKIKGVEYETIFEDLSNKSPSLLQYNPVHKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIR-SSYFMKGKE  485
            GKPI ESLVILEYI++TW  TPLLP+ P +RA  RFWAKF +DK+L SI    +F +GKE
Sbjct  61   GKPIAESLVILEYIDETWRETPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFFKEGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QEE +++A+++L+ +E++L  GKRFFGG+ IGF+D+ LGWLAN+ S+FEE+ GLK++D +
Sbjct  121  QEEAMLEAMEHLQFLEDELK-GKRFFGGERIGFVDLALGWLANMISIFEEVAGLKMVDED  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            KFP+L+ WM  F + P I D+WPPRDKMI KFQA+ +A
Sbjct  180  KFPLLAAWMQEFADSPIIKDNWPPRDKMIXKFQALRDA  217



>ref|XP_002264055.2| PREDICTED: probable glutathione S-transferase isoform X1 [Vitis 
vinifera]
Length=225

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 175/218 (80%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL+RTWS+P+ LR+VWAL IK ++YETI EDL NKS  LL+YNP HKK+PVL+HN
Sbjct  1    MAEEVKLFRTWSTPFALRIVWALKIKGVEYETIFEDLYNKSPSLLQYNPAHKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKE  485
            GKPI ES VILEYI++TW  TPLLP+ P +RA  RFWAKF +DK+  SI    F+K GKE
Sbjct  61   GKPISESYVILEYIDETWKETPLLPEDPYERAMARFWAKFGDDKVFTSIFGGVFVKEGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QEE +V+A++NL+ +EE+L  GK+FFGG+ IGF+D+ LGWLANL S+ E++ GLK++  +
Sbjct  121  QEEAMVEAMENLQFLEEELR-GKKFFGGERIGFVDLALGWLANLISILEDVAGLKIVGED  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            KFP+LS WM +F + P I D+WPPRDKMI KFQA+ +A
Sbjct  180  KFPLLSAWMKDFADSPIIKDNWPPRDKMIAKFQALRDA  217



>ref|XP_010646030.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=231

 Score =   294 bits (753),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 176/218 (81%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL+RTWSSP+ LR+VWAL IK ++YETI EDL++KS  LL+YNP HKKIPVL+H+
Sbjct  1    MAEEVKLFRTWSSPFALRIVWALKIKGVEYETIFEDLSDKSPSLLQYNPAHKKIPVLVHS  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKE  485
            GKPI ES VILEYI++TW  TPLLP+ P +RA  RFWAKF +DK+L SI    F+K G E
Sbjct  61   GKPIAESYVILEYIDETWKETPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFIKEGNE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QEE +V+A+ NL L+EE+L  GK+FFGG+ IGF+D+ LGWLANL S+ E++ GLK++D +
Sbjct  121  QEEAMVEAMKNLWLLEEELR-GKKFFGGERIGFVDLALGWLANLISILEDVAGLKIVDED  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            KFP+LS WM +F + P I D+WPPRDKMI KFQA+ +A
Sbjct  180  KFPLLSAWMKDFADSPIIKDNWPPRDKMIAKFQALRDA  217



>ref|XP_010661155.1| PREDICTED: probable glutathione S-transferase isoform X2 [Vitis 
vinifera]
Length=225

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 175/218 (80%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL+RTWS+P+ LR+VWAL IK ++YETI EDL NKS  LL+YNP HKK+PVL+HN
Sbjct  1    MAEEVKLFRTWSTPFALRIVWALKIKGVEYETIFEDLYNKSPSLLQYNPAHKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKE  485
            GKPI ES VILEYI++TW  TPLLP+ P +RA  RFWAKF +DK+  SI    F+K GKE
Sbjct  61   GKPISESYVILEYIDETWKETPLLPEDPYERAMARFWAKFGDDKVFTSIFWGVFVKEGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QEE +V+A++NL+ +EE+L  GK+FFGG+ IGF+D+ LGWLANL S+ E++ GLK++  +
Sbjct  121  QEEAMVEAMENLQFLEEELR-GKKFFGGERIGFVDLALGWLANLISILEDVAGLKIVGED  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            KFP+LS WM +F + P I D+WPPRDKMI KFQA+ +A
Sbjct  180  KFPLLSTWMKDFADSPIIKDNWPPRDKMIAKFQALRDA  217



>ref|XP_009790678.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana sylvestris]
Length=224

 Score =   285 bits (730),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 171/214 (80%), Gaps = 1/214 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEE+KL+RTWSSP+GLR VWAL+IK IQY+TI EDL+ KS  LL++NPVHKKIPVL+H 
Sbjct  1    MAEELKLHRTWSSPFGLRAVWALHIKGIQYDTIYEDLSQKSPELLQHNPVHKKIPVLVHK  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPICESLVILEYI++TW   PLLPQ P ++A +RFWAKF E+KLLPSI S +  +G E+
Sbjct  61   GKPICESLVILEYIDETWKEAPLLPQDPYEKATVRFWAKFGEEKLLPSIWSVFTGQGNEK  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
             E +  A+ NL+L EEQL   K+FFGG+ IG+LD+ LGWLA L  VFEE+  LKL DA K
Sbjct  121  NEALGPAVQNLELFEEQLK-EKKFFGGEEIGYLDLSLGWLAYLLDVFEEVIDLKLFDAAK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
             P+LS WM+NFY+ P I +HWPPRDK++TKFQ +
Sbjct  180  LPLLSAWMNNFYDAPVIKEHWPPRDKLVTKFQLL  213



>ref|XP_004133937.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 ref|XP_004155775.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN56630.1| hypothetical protein Csa_3G126940 [Cucumis sativus]
Length=222

 Score =   284 bits (727),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 170/217 (78%), Gaps = 1/217 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EE+KL+RTWSSP+ LR+VWAL +K I+YET+ EDL NKS  LL YNP+HKK+PVL+H 
Sbjct  1    MEEELKLFRTWSSPFPLRIVWALKLKGIEYETVYEDLANKSPLLLEYNPIHKKVPVLVHG  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEYIE+TW   PLLPQ P  RA  RFWAKF +DK+L SI+  +  +GK +
Sbjct  61   GKPIAESLVILEYIEETWKQNPLLPQDPYQRAVARFWAKFGDDKVLESIKKVFMNQGKVR  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            EEGV +A++NLK +EE+L  GKRFFGG+ IGF+DI +GWLAN+ SV EE+ GL+LI  E+
Sbjct  121  EEGVEEAMENLKHLEEELK-GKRFFGGEAIGFVDIAVGWLANIVSVMEEVVGLELITEER  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            FP+LS+W   F   P I ++WPPRDK+ITK+QA++  
Sbjct  180  FPLLSKWTKEFAAAPIINENWPPRDKLITKYQALYQT  216



>ref|XP_006354574.1| PREDICTED: glutathione transferase GST 23-like [Solanum tuberosum]
Length=223

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 172/214 (80%), Gaps = 3/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MA+EVKLYRTWSSP+GLR+VWAL+IK I+YE I EDLT KS  LL+YNPVHKKIPVL+H 
Sbjct  1    MADEVKLYRTWSSPFGLRIVWALHIKGIEYEAIFEDLTQKSSELLQYNPVHKKIPVLVHK  60

Query  661  GKPICESLVILEYIEDTWHNT-PLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            GKPICESLVILEYI++TW+ T PLLPQ P ++A  RFWAKF +DKLLPS+ S +  KG E
Sbjct  61   GKPICESLVILEYIDETWNETAPLLPQDPYEKAMARFWAKFVDDKLLPSVWSIFTEKGDE  120

Query  484  -QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA  308
             ++E  V A+ NL++IEEQL   K+FFGG++IG++D+ LGW+A L  VFEE+  LKL DA
Sbjct  121  AKKEAFVPAVQNLEIIEEQLK-EKKFFGGESIGYVDLALGWMAYLLDVFEEVMDLKLFDA  179

Query  307  EKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
             KFP+LS WM NF + PAI  H PPRDK++TKFQ
Sbjct  180  HKFPLLSGWMKNFCDAPAIKQHLPPRDKLVTKFQ  213



>ref|XP_011086578.1| PREDICTED: glutathione transferase GST 23-like [Sesamum indicum]
Length=222

 Score =   283 bits (723),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 166/214 (78%), Gaps = 1/214 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEE+KL+RTWSSPY LRVV AL IK ++YETILEDL NKS  LL YNP +KK+PVL+HN
Sbjct  1    MAEELKLFRTWSSPYSLRVVHALKIKGLKYETILEDLKNKSASLLEYNPTYKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPICESL+ILEYI++TW   PL PQ P  +A  RFWAKF +DK+LPSI S +  +GKEQ
Sbjct  61   GKPICESLLILEYIDETWKQHPLFPQDPYQKAMARFWAKFGDDKVLPSIWSVFISQGKEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            EE +  A  NLK +E+ L  GK+FFGG+ IG+LD+  GW+ANL S+ EEI  LKLID E 
Sbjct  121  EEAIAPAAGNLKFLEDLLK-GKKFFGGETIGYLDLAFGWMANLISILEEIIDLKLIDPEN  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            FP+LS WM++F + P I + WPPRDKM+ KF+A+
Sbjct  180  FPLLSAWMNSFSDDPVIKEFWPPRDKMVEKFKAM  213



>gb|EYU26814.1| hypothetical protein MIMGU_mgv1a013348mg [Erythranthe guttata]
Length=223

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 168/212 (79%), Gaps = 1/212 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EE+KL+R+WSSP+G+RVV AL IK +QYETILEDL+NKS  LL YNP+HKKIPV +HNG 
Sbjct  4    EEMKLFRSWSSPFGMRVVHALKIKGLQYETILEDLSNKSASLLNYNPIHKKIPVFVHNGN  63

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PICESLVILEYI++TW  +PLLPQ P  ++  RFWAKF +DK++PSI S +  +G  +EE
Sbjct  64   PICESLVILEYIDETWTQSPLLPQDPYAKSTARFWAKFGDDKVMPSIWSVFTSQGDAREE  123

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             +VQA  NL+ +EE++  GK+FFGG+ IG++D+  GW+ANL  + EEI  LKL+DAEKFP
Sbjct  124  AIVQAKTNLEFLEEEIK-GKKFFGGEAIGYVDLAFGWMANLIGILEEIIDLKLVDAEKFP  182

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
             LS WM NFY+ PAI + WP RD+M+ KF+A+
Sbjct  183  FLSAWMSNFYDDPAIKEFWPNRDRMVEKFKAM  214



>ref|XP_004229525.1| PREDICTED: glutathione transferase GST 23-like [Solanum lycopersicum]
Length=223

 Score =   282 bits (722),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 173/214 (81%), Gaps = 3/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MA+EVKLYRTWSSP+GLR+VWAL+IK I+YE I EDL+ KS  LL+YNPVHKKIPVL+H 
Sbjct  1    MADEVKLYRTWSSPFGLRIVWALHIKGIEYEAIFEDLSQKSPQLLQYNPVHKKIPVLVHK  60

Query  661  GKPICESLVILEYIEDTWHNT-PLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            GKPICESLVILEYI++TW  T PLLPQ P ++A  RFWAKF EDKLLPS+ S +  +G +
Sbjct  61   GKPICESLVILEYIDETWKETAPLLPQDPYEKAMARFWAKFVEDKLLPSVWSIFTEQGYD  120

Query  484  -QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA  308
             ++E  V A+ NL++IEEQL   K+FFGG++IG++D+VLGW+A L  VFEE+  LKL DA
Sbjct  121  AKKEAFVPAVQNLEIIEEQLK-EKKFFGGESIGYVDLVLGWMAYLLDVFEEVLDLKLFDA  179

Query  307  EKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            +KFP+LS WM NF + PAI  H PPRDK++TKFQ
Sbjct  180  DKFPLLSGWMKNFCDAPAIKQHLPPRDKLVTKFQ  213



>gb|KDP42499.1| hypothetical protein JCGZ_00296 [Jatropha curcas]
Length=224

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 169/214 (79%), Gaps = 2/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EE+K++RTWSSP+ LRVVWAL +K I+YET+ EDL+NKS  LL+YNPV+KK+PVLLHN
Sbjct  1    MGEELKVFRTWSSPFALRVVWALKLKGIEYETVYEDLSNKSPLLLQYNPVYKKVPVLLHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKE  485
            GKP+CESLVILEYI++TW   PLLP+ PL+RA  RFWAKFC+DK+  +I +  F+K GKE
Sbjct  61   GKPLCESLVILEYIDETWKQNPLLPEDPLERARARFWAKFCDDKVAQTIFNGVFLKEGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QEE +  A++NLK +E++L  GK+FFGGD IG +D+ LGWLA+   VFEEI G KLID E
Sbjct  121  QEEAIPLAIENLKHLEKELR-GKKFFGGDKIGLVDLALGWLAHYNGVFEEILGFKLIDQE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
             FP+L +W+  F N P I D+WP RDK++ KF A
Sbjct  180  NFPLLVKWIQEFANAPVIQDNWPSRDKLVAKFLA  213



>ref|XP_006354571.1| PREDICTED: glutathione transferase GST 23-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006354572.1| PREDICTED: glutathione transferase GST 23-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006354573.1| PREDICTED: glutathione transferase GST 23-like isoform X4 [Solanum 
tuberosum]
Length=223

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 172/214 (80%), Gaps = 3/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MA+EVKLYRTWSSPYGLR+VWA++IK I+YE + EDL+ KS  LL+YNPVHKKIPVL+H 
Sbjct  1    MADEVKLYRTWSSPYGLRIVWAMHIKGIEYENVFEDLSQKSPQLLQYNPVHKKIPVLVHK  60

Query  661  GKPICESLVILEYIEDTW-HNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            GKPICESLVILEYI++TW   TPLLPQ P ++A  RFWAKF +DKLLPS+ S +  KG E
Sbjct  61   GKPICESLVILEYIDETWKETTPLLPQDPYEKAMARFWAKFVDDKLLPSVWSVFTEKGYE  120

Query  484  -QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA  308
             ++E +V A+ NL++IEEQL   K+FFGG++IG++D+ LGW+A L  VFEE+  LKL DA
Sbjct  121  AKKEALVPAVQNLEIIEEQLK-EKKFFGGESIGYVDLALGWVAYLLDVFEEVIDLKLFDA  179

Query  307  EKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
             KFP+LS WM NF + PAI  H PPRDK++T+FQ
Sbjct  180  HKFPLLSGWMKNFCDAPAIKQHLPPRDKLVTRFQ  213



>ref|XP_006354570.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Solanum 
tuberosum]
Length=225

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 173/215 (80%), Gaps = 4/215 (2%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MA+EVKLYRTWSS + LR+VWAL+IK I+YE I EDL++KS  LL+YNPVHKK+PVL+H 
Sbjct  1    MADEVKLYRTWSSRFSLRIVWALHIKGIEYEAIFEDLSHKSPQLLQYNPVHKKVPVLVHQ  60

Query  661  GKPICESLVILEYIEDTW--HNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGK  488
            GKPICESLVILEYI++TW    TPLLPQ P ++A  RFWAKF +DKLLPS+ S +  KG 
Sbjct  61   GKPICESLVILEYIDETWKKETTPLLPQDPYEKAMARFWAKFVDDKLLPSVTSVFTEKGY  120

Query  487  E-QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLID  311
            E ++E +V A+ NL+LIEEQL  GK+FFGG++IG++D+VLGW+A L  VFEE+  LKL D
Sbjct  121  EAKKEALVPAVQNLELIEEQLK-GKKFFGGESIGYVDLVLGWMAFLLDVFEEVIDLKLFD  179

Query  310  AEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            A KFP+LS WM NF + PAI  H PPRD+++TK+Q
Sbjct  180  AHKFPLLSGWMKNFCDAPAIKQHLPPRDRLVTKYQ  214



>ref|XP_002527848.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF34551.1| glutathione s-transferase, putative [Ricinus communis]
Length=225

 Score =   280 bits (716),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 170/214 (79%), Gaps = 2/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVK++RTWSSP+ LRV+WAL +K I+YETI EDL++KS  L++YNPVHKK+PVL+HN
Sbjct  1    MAEEVKIFRTWSSPFALRVIWALKLKGIEYETIYEDLSSKSPLLVQYNPVHKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKE  485
            GK I ESLVILEY+++TW   PLLPQ P +RA  RFWAKF +DK+L SI    F+K GKE
Sbjct  61   GKAISESLVILEYMDETWKQYPLLPQDPHERARARFWAKFGDDKVLQSIFYGTFLKQGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
             EEG+  A +NL+ +EE+L  GK+FFGGDNIG +D+ LGWLA+  SVFEEI GLK+ID E
Sbjct  121  LEEGLASATENLQCLEEELK-GKKFFGGDNIGVVDLALGWLAHYNSVFEEIIGLKIIDQE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            KFP+LSEW   F + P I ++WPPRDK++ KF A
Sbjct  180  KFPLLSEWKQAFASVPIIQENWPPRDKLVAKFVA  213



>ref|XP_007220010.1| hypothetical protein PRUPE_ppb024827mg [Prunus persica]
 gb|EMJ21209.1| hypothetical protein PRUPE_ppb024827mg [Prunus persica]
Length=224

 Score =   279 bits (714),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 168/212 (79%), Gaps = 2/212 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+RTWSSP+ LR+VWAL +K + YETI EDL+NKS  LL+YNP+HKK+PVL+HNGKP
Sbjct  3    EVKLFRTWSSPFALRIVWALKLKGVPYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ES V+LEYI++TW   PLLP+ PL+RA  RFWAKF +DK+LPSI  S+   GKEQEE 
Sbjct  63   IVESFVVLEYIDETWKENPLLPEDPLERAAARFWAKFGDDKVLPSIWESFTSDGKEQEEA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANL-PSVFEEITGLKLIDAEKFP  296
            +V+A +NLK +EE+L  GK+FFGG+ +GF+DI LGWLA    SVFE++TG+KL+  E+FP
Sbjct  123  IVKAKENLKYLEEELK-GKKFFGGEKLGFVDIALGWLAQYESSVFEDVTGMKLLTEEEFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            +LS W   F + P I D+WP RDK++ KFQAI
Sbjct  182  LLSAWKLTFADAPIIKDNWPSRDKLVAKFQAI  213



>ref|XP_008438211.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=222

 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EE+KL+RTWSSP+ LR+VWAL +K I+Y+T+ EDL NKS  LL YNP++KK+PVL+H 
Sbjct  1    MEEELKLFRTWSSPFPLRIVWALKLKGIEYDTVYEDLANKSPLLLEYNPIYKKVPVLVHG  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEYIE+TW   PLLPQ P  RA  RFWAKF +DK+L SI+  +  +GK +
Sbjct  61   GKPIAESLVILEYIEETWKQNPLLPQDPYQRAVARFWAKFGDDKVLESIKKVFMNQGKVR  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            EEGV +AL+NLK +EE+L  GKRFFGG+ IGF+DI +GWLANL SV EE+ GL+LI  E+
Sbjct  121  EEGVEEALENLKHLEEELK-GKRFFGGEAIGFVDIAVGWLANLVSVIEEVVGLELITEER  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            FP+LS+W   F   P I ++WPPRDK+I K+QA+
Sbjct  180  FPLLSKWTKEFAAAPIINENWPPRDKLIAKYQAL  213



>ref|XP_004229524.1| PREDICTED: glutathione transferase GST 23-like [Solanum lycopersicum]
 ref|XP_010323325.1| PREDICTED: glutathione transferase GST 23-like [Solanum lycopersicum]
Length=223

 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 170/214 (79%), Gaps = 3/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MA+EVK+YR WSSPYGLRVVWAL+IK I+YE I EDL+ KS  LL+YNPVHKKIPVL+H 
Sbjct  1    MADEVKIYRNWSSPYGLRVVWALDIKGIEYENIFEDLSQKSPQLLQYNPVHKKIPVLVHK  60

Query  661  GKPICESLVILEYIEDTW-HNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            GKPICESLVILEYI++TW   TPLLP+ P ++A  RFWAKF +DKLLPSI S +  K  E
Sbjct  61   GKPICESLVILEYIDETWKETTPLLPKDPYEKAIARFWAKFVDDKLLPSIWSVFTEKRYE  120

Query  484  -QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA  308
             ++E +V A+ NL+ IEEQL  GK+FFGG++IG++D+ LGW+A L  VFEE+  LKL DA
Sbjct  121  AKKEALVPAMQNLEFIEEQLK-GKKFFGGESIGYVDLALGWMAYLLDVFEEVLDLKLFDA  179

Query  307  EKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            +KFP+LS W  NF + PAI  H PPRDK++TKFQ
Sbjct  180  DKFPLLSGWTKNFCDAPAIKQHLPPRDKLVTKFQ  213



>ref|XP_010067033.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW65099.1| hypothetical protein EUGRSUZ_G02604 [Eucalyptus grandis]
Length=224

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 168/213 (79%), Gaps = 1/213 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL++T SSP+ LRV WAL +K IQYE++LEDL+ KS  LL+YNPV+KK+PVLLHN
Sbjct  1    MAEEVKLFKTLSSPFALRVDWALRLKGIQYESVLEDLSEKSDLLLQYNPVYKKVPVLLHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            G+ I ESL+ILEYIE+TW   PLLPQ P  RA  RFWAKF +DK+LPS+ +++  +GKEQ
Sbjct  61   GRSISESLIILEYIEETWKQDPLLPQDPYARARARFWAKFGDDKVLPSLWTAFISEGKEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E  + +A +NL+ +E +LN GK+FFGGDNIG+LDI LGWLANL +VFEEI+ LKL+D E+
Sbjct  121  EAALAEASENLQKLEGELN-GKKFFGGDNIGYLDIALGWLANLITVFEEISSLKLVDGER  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            FP+L  WM  F + P I D WPP DK+I +F A
Sbjct  180  FPLLLAWMKEFSDVPLIKDCWPPHDKLIPRFIA  212



>ref|XP_008232147.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=224

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 168/212 (79%), Gaps = 2/212 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+RTWSSP+ LR+VWAL +K + YETI EDL+NKS  LL+YNP+HKK+PVL+HNGKP
Sbjct  3    EVKLFRTWSSPFALRIVWALKLKGVPYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ES V+LEYI++TW   PLLP+ PL+RA  RFWAKF +DK+LPSI  S+   GKEQEE 
Sbjct  63   IVESFVVLEYIDETWKENPLLPEDPLERAAARFWAKFGDDKVLPSIWESFTNDGKEQEEA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANL-PSVFEEITGLKLIDAEKFP  296
            +V+A +NLK +EE+L  GK+FFGG+ +GF+DI LGWL+    SVFE++TG+KL+  E+FP
Sbjct  123  IVKAKENLKYLEEELK-GKKFFGGEKLGFVDIALGWLSQYESSVFEDVTGMKLLTEEEFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            +LS W   F + P I D+WP RDK++ KFQAI
Sbjct  182  LLSAWKLTFADAPIIKDNWPSRDKLVAKFQAI  213



>emb|CDP09302.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 164/214 (77%), Gaps = 1/214 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL+RTWSSPY LR+VWAL +K I+YETI EDLTNKS  LL+YNP H K+PVL+ +
Sbjct  1    MAEEVKLFRTWSSPYALRIVWALKLKGIEYETIFEDLTNKSPSLLQYNPTHGKVPVLVRD  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKP+CESLVILEY+++TW + PLLPQ P +++  RFWA F +DKL+ SI   +    K+Q
Sbjct  61   GKPVCESLVILEYVDETWKHNPLLPQDPYEKSMARFWANFGDDKLMKSIWQLFIAHEKDQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            +   V AL+NLK++EEQL  GK+FF G+ IG+LD+  GW+ANL S+ EEI  LKL+D E+
Sbjct  121  DVAAVAALENLKIVEEQLK-GKKFFHGETIGYLDLAFGWIANLVSILEEIMSLKLVDGER  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            FP LS W+ +F + P I D WPPRDKMI KFQ +
Sbjct  180  FPHLSSWIQHFIDAPVIRDCWPPRDKMIIKFQVM  213



>gb|KDP42500.1| hypothetical protein JCGZ_00297 [Jatropha curcas]
Length=221

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 169/215 (79%), Gaps = 2/215 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M E++K++RTWSS + LR VWAL +K I+YET+ EDL+NKS  LL+YNPV+KK+PVLLHN
Sbjct  1    MGEDLKVFRTWSSSFALRAVWALKLKGIEYETVYEDLSNKSPLLLQYNPVYKKVPVLLHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKE  485
            GKP+CESLVILEYI++TW   PLLP+ PL+RA  RFWAKF +DK+  SI    F+K GKE
Sbjct  61   GKPLCESLVILEYIDETWKQNPLLPEDPLERARARFWAKFGDDKVFQSIVYGIFLKQGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QEE +  A++NLK +E++L  GK+FFGG+ IG LD+ LGWLA+   VFEEI G KLID +
Sbjct  121  QEEAIPLAIENLKHLEKELR-GKKFFGGEKIGLLDLALGWLAHHNGVFEEILGFKLIDQQ  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            KFP+L +W+  F N P I ++WPPRDK++ KF+AI
Sbjct  180  KFPLLVQWIQEFANAPVIQENWPPRDKLVAKFEAI  214



>emb|CDP21862.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   275 bits (703),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 165/214 (77%), Gaps = 1/214 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL+RTWSS Y LR+VWAL +K I+YETI EDLTNKS  LL+YNP+H K+PVL+H+
Sbjct  1    MAEEVKLFRTWSSGYALRIVWALKLKGIEYETIFEDLTNKSPSLLQYNPIHGKVPVLVHD  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKP+CESLVILEY+++TW + PLLPQ P +++  RFWA F +DKL+ SI   +  + K+Q
Sbjct  61   GKPVCESLVILEYVDETWKHNPLLPQDPYEKSMARFWANFGDDKLMKSIWQLFIAREKDQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            +   V+AL+NLKL+EEQL  GK+FF G+ +G+LD+  GW A+  S+ EEI  LKL+D E+
Sbjct  121  DVAAVEALENLKLVEEQLK-GKKFFHGETVGYLDLAFGWFADFVSILEEIMSLKLVDGER  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            FP LS W+ +F + P I D WPPRDKMI KFQ +
Sbjct  180  FPHLSSWIQHFIDAPVIRDCWPPRDKMIIKFQVM  213



>emb|CDP19810.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   275 bits (702),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 164/214 (77%), Gaps = 1/214 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL+RTWSS Y LR+VWAL +K I+YETI EDLTNKS  LL+YNP H K+PVL+H+
Sbjct  1    MAEEVKLFRTWSSRYSLRIVWALKLKGIEYETIFEDLTNKSPSLLQYNPTHGKVPVLVHD  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKP+CESLVILEY+++TW + PLLPQ P +++  RFWA F +DKL+ SI   +    K+Q
Sbjct  61   GKPVCESLVILEYVDETWKHNPLLPQDPYEKSMARFWANFGDDKLMKSISQLFIAHEKDQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            +   V AL+NLK++EEQL  GK+FF G+ IG+LD+  GW+ANL S+ EEI  LKL+D E+
Sbjct  121  DVAAVAALENLKIVEEQLK-GKKFFHGETIGYLDLAFGWIANLVSILEEIMSLKLVDGER  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            FP LS W+ +F + P I D WPPRDKMI K+Q +
Sbjct  180  FPHLSSWIQHFIDAPVIRDCWPPRDKMIIKYQVM  213



>ref|XP_007218360.1| hypothetical protein PRUPE_ppa011115mg [Prunus persica]
 gb|EMJ19559.1| hypothetical protein PRUPE_ppa011115mg [Prunus persica]
Length=223

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+RTWSSP+ LR+VWAL +K + YETI EDL+NKS  LL+YNP+HKK+PVL+HNGKP
Sbjct  3    EVKLFRTWSSPFALRIVWALKLKGVPYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYI++TW   PLLP+ PL+RA  RFWAKF ++K +PSI  S+  +GKEQEE 
Sbjct  63   IAESLVILEYIDETWKENPLLPEDPLERAAARFWAKFGDEKAVPSIWESFTNEGKEQEEA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A +NLK +EE+L  GK+FFGG+ +G  DI LG LA+  SVFEE+ G+KL+  E+FP+
Sbjct  123  IVKAKENLKYLEEELK-GKKFFGGEKLGLADIALGLLAHYESVFEEVAGMKLLTEEEFPL  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            LS W   F + P I D+WP RDK++ KFQA
Sbjct  182  LSAWKLTFADAPIIKDNWPSRDKLVAKFQA  211



>ref|XP_010097693.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB70648.1| putative glutathione S-transferase [Morus notabilis]
Length=227

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 166/215 (77%), Gaps = 1/215 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL+RTWSSPY LR+VWAL +K ++YETI E++++KS  L+ YNP+HKK+PVL+HNGK
Sbjct  4    EEVKLFRTWSSPYALRIVWALKLKGVEYETIYEEVSHKSDLLIGYNPIHKKVPVLVHNGK  63

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ESLVILEYI++TW   PLL   P  RA  RFWAKF ++K+LP+I  ++  +GKEQEE
Sbjct  64   PIAESLVILEYIDETWKQHPLLSDQPHQRALARFWAKFGDEKVLPAIWEAFTKQGKEQEE  123

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             +  A++NLK +EE+L  GK+ FGG+ IG +DI LGWLANL SVFEEITGLKLI  EKFP
Sbjct  124  ALSTAVENLKYLEEELK-GKKLFGGEEIGLVDIALGWLANLVSVFEEITGLKLIPEEKFP  182

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            +L  WM  F + P I + WPPRDK++ KF +I  A
Sbjct  183  LLFNWMQVFADIPVIKESWPPRDKLVAKFHSIREA  217



>ref|XP_006484731.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=225

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 165/214 (77%), Gaps = 1/214 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL +TWSSP+GLR  W L +K +Q++ I EDL+NKS  LL+ NPV+KK+PVL+HN
Sbjct  1    MAEEVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEY+++TW   PLLP+ P +RA  RFWAKF EDK+L SI +++  +GKEQ
Sbjct  61   GKPISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGEDKVLVSIWNAFIKQGKEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            EE +  A++ LK +EE+L  GKRFFGG+ IG  D+ LGWLANL  VFEE+ G+KLI+ E+
Sbjct  121  EEAIGLAIETLKFLEEELK-GKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKLIEKER  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            FP+LS WM  F   P I + WPP +K++TKF+AI
Sbjct  180  FPLLSAWMQEFAEAPVIKESWPPHEKLVTKFRAI  213



>ref|XP_006437360.1| hypothetical protein CICLE_v10032686mg [Citrus clementina]
 gb|ESR50600.1| hypothetical protein CICLE_v10032686mg [Citrus clementina]
Length=225

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 165/214 (77%), Gaps = 1/214 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL +TWSSP+GLR  W L +K +Q++ + EDL+NKS  LL+ NPV+KK+PVL+HN
Sbjct  1    MAEEVKLLKTWSSPFGLRAFWILKLKGVQFDFVDEDLSNKSPLLLQSNPVYKKVPVLIHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEY+++TW   PLLP+ P +RA  RFWAKF EDK+L SI +++  +GKEQ
Sbjct  61   GKPISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGEDKVLVSIWNAFIKQGKEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            EE +  A++ LK +EE+L  GKRFFGG+ IG  D+ LGWLANL  VFEE+ G+KLI+ E+
Sbjct  121  EEAIGLAIETLKFLEEELK-GKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKLIEKER  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            FP+LS WM  F   P I + WPP +K++TKF+AI
Sbjct  180  FPLLSAWMQEFAEAPVIKESWPPHEKLVTKFRAI  213



>ref|XP_010067034.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
Length=235

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 168/215 (78%), Gaps = 1/215 (0%)
 Frame = -2

Query  847  VAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLL  668
            +A  EEVKL++TWSSP+ LRV WAL +K IQYE++LEDL+NKS+ LL+YNPV+KK+PVLL
Sbjct  10   LARPEEVKLFKTWSSPFPLRVAWALQLKGIQYESVLEDLSNKSNLLLQYNPVYKKVPVLL  69

Query  667  HNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGK  488
            HNG+PI ESL+ILEY+++TW   PLLPQ P  RA  RFWAKF +DK+LPSI + +  +GK
Sbjct  70   HNGRPISESLIILEYVDETWKQYPLLPQDPYARAMARFWAKFGDDKVLPSIYAVFKSEGK  129

Query  487  EQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA  308
            EQE  + +A ++L+ +EE+L  GK+FF GDNIG+LDI LGWLANL  VFEE++ L+++D 
Sbjct  130  EQEAVLAEASEHLQKLEEELR-GKKFFRGDNIGYLDIALGWLANLVRVFEEVSSLRVLDV  188

Query  307  EKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            E+FP+L  W+  F + P I D WPP D +I KF A
Sbjct  189  ERFPLLCAWLKEFSDAPVIKDCWPPHDMLIAKFIA  223



>gb|AFF18816.1| glutathione transferase, partial [Dimocarpus longan]
Length=224

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAE+VKL+ TWSS +GLR+VWAL +K ++Y++I EDL+NKS  LL+YNP++KK+PVLLHN
Sbjct  1    MAEKVKLFNTWSSRFGLRIVWALKLKGVEYDSINEDLSNKSPLLLQYNPIYKKVPVLLHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKP  ESLVILEYI++TW + PLLP+ P ++A  RFWAKF +DK++ SI S++  +GKEQ
Sbjct  61   GKPTSESLVILEYIDETWKHNPLLPEDPYEKATARFWAKFGDDKVMSSIWSAFTNEGKEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ + QA++NL  +EEQL  GK+FFGG+ IG  D+ LGWLANL  VFEEI G+K+ID E+
Sbjct  121  EDAIGQAIENLNFLEEQLK-GKKFFGGEKIGLTDLALGWLANLVRVFEEIIGVKIIDHER  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            FP L  W   F   P I + WPP DK+I KFQAI +A
Sbjct  180  FPSLLAWTQEFAEAPIIKESWPPHDKLIVKFQAIRDA  216



>gb|KDO46806.1| hypothetical protein CISIN_1g027333mg [Citrus sinensis]
Length=225

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 165/214 (77%), Gaps = 1/214 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL +TWSSP+GLR  W L +K +Q++ I EDL+NKS  LL+ NPV+KK+PVL+HN
Sbjct  1    MAEEVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEY+++TW   PLLP+ P +RA  RFWAKF +DK+L SI +++  +GKEQ
Sbjct  61   GKPISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGDDKVLASIWNAFIKQGKEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            EE +  A++ LK +EE+L  GKRFFGG+ IG  D+ LGWLANL  VFEE+ G+KLI+ E+
Sbjct  121  EEAIGLAIETLKFLEEELK-GKRFFGGEKIGLPDLALGWLANLIGVFEEVIGVKLIEKER  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            FP+LS WM  F   P I + WPP +K++TKF+AI
Sbjct  180  FPLLSAWMQEFAEAPVIKESWPPHEKLVTKFRAI  213



>ref|XP_008232144.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=223

 Score =   270 bits (690),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 164/210 (78%), Gaps = 1/210 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+RTWSSP+ LR+VWAL +K + YETI EDL+NKS  LL+YNP+HKK+PVL+HNGKP
Sbjct  3    EVKLFRTWSSPFALRIVWALKLKGVSYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYI++TW   PLLP+ PL+RA  RFWAKF ++K+LPSI  S+  +GK QEE 
Sbjct  63   IAESLVILEYIDETWKENPLLPEDPLERAAARFWAKFGDEKVLPSIWESFTNEGKGQEEA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A +NL  +EE+L  GK+FFGG+ +G  DI LGWLA+  SVFE++ G+KL+  E+FP+
Sbjct  123  IVKAKENLNYLEEELK-GKKFFGGEKLGLADIALGWLAHYESVFEDVAGMKLLTEEEFPL  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            LS W   F + P I D+ P RDK++ KFQA
Sbjct  182  LSAWKLTFADAPIIKDNLPSRDKLVAKFQA  211



>ref|XP_002523997.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF38365.1| glutathione s-transferase, putative [Ricinus communis]
Length=216

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 165/213 (77%), Gaps = 1/213 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EEVKL+ T  SP+GLRVVWAL +K I+YE+I EDL+NKS  LL+YNP++KK+PVL+H+
Sbjct  1    MGEEVKLFNTSPSPFGLRVVWALKLKGIRYESIEEDLSNKSPLLLQYNPIYKKVPVLVHD  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKP+ ESL+ILEYIE+TW  +PLLP HP  RA   FWAKF +DK+LPSI   +  KGKEQ
Sbjct  61   GKPVVESLIILEYIEETWQQSPLLPAHPYQRAMAHFWAKFGDDKVLPSIWYVFIKKGKEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ + +AL+NLK++EE+L  GK+FFGG+ IGF+D+  GWLAN  SV EE+ GLKLID  K
Sbjct  121  EDAIPEALENLKILEEELR-GKKFFGGEKIGFVDLAFGWLANTLSVLEEVVGLKLIDEMK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            FP+L+ WM  F + P I + WPPRD +I+ + A
Sbjct  180  FPLLAGWMIEFSDSPVIKESWPPRDVLISLYSA  212



>ref|XP_002523996.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF38364.1| glutathione s-transferase, putative [Ricinus communis]
Length=219

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EEVKL +TWSS +GLR+VWAL +K I Y++I EDLTNKS  LL+YNPVHKKIPVL+HN
Sbjct  1    MTEEVKLLKTWSSIFGLRIVWALKLKAINYDSIDEDLTNKSPLLLQYNPVHKKIPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEYI++TW   PLLPQ P DRA  RFWAKF +DK++PS+ +    +GKEQ
Sbjct  61   GKPIVESLVILEYIDETWQQNPLLPQDPHDRAEARFWAKFGDDKVIPSMWAILTKEGKEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            EE   Q  +NLK +EE+L  GK+FFGG+ IG+LDI LGWLAN   V EEI+ LK+ID E 
Sbjct  121  EEASAQTNENLKFLEEELK-GKKFFGGEQIGYLDIALGWLANSVPVLEEIS-LKVIDKEA  178

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            FP+LS WM  F + P + +  PP DK+ITKF+A   A
Sbjct  179  FPLLSAWMQEFSSVPKVKESLPPHDKLITKFRAFVAA  215



>ref|XP_006373657.1| hypothetical protein POPTR_0016s02350g [Populus trichocarpa]
 gb|ERP51454.1| hypothetical protein POPTR_0016s02350g [Populus trichocarpa]
Length=225

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 167/218 (77%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVK++RTWSSP+ LRV+WAL +K ++++TI EDL+NKS  LL+YNP+HKK+PVL+HN
Sbjct  1    MAEEVKVFRTWSSPFALRVIWALKLKGVEFDTIYEDLSNKSPLLLQYNPIHKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKE  485
            GK ICESLVILEYI++TW   PLLP+ P  +A+ RFWAKF +DK+L SI     MK GKE
Sbjct  61   GKVICESLVILEYIDETWKQNPLLPEDPHQQANARFWAKFGDDKVLQSIVWGVLMKEGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
             EEGV+ +L+NLK +EE++  GK+FFGG+ IG  DI LGWLA    +FEEI GLKLID E
Sbjct  121  LEEGVLASLENLKYLEEEIR-GKKFFGGETIGLADIALGWLAYYLDIFEEILGLKLIDQE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            KFP L+ W   F N P I ++WP RDK++ KF A+  A
Sbjct  180  KFPSLAAWKQEFANAPIIHENWPDRDKLVNKFVAMREA  217



>ref|XP_009343223.1| PREDICTED: probable glutathione S-transferase isoform X2 [Pyrus 
x bretschneideri]
Length=219

 Score =   269 bits (687),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 167/215 (78%), Gaps = 1/215 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL RTWSSP+ LR+VWAL +K + YETI EDL+NKS  LL+ NPVHKK+PVLLHNG  
Sbjct  3    EVKLLRTWSSPFPLRIVWALQLKGVPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNA  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            + ESL+ILEY+++TW   PLLP+ PLDRA  RFWA++ +DK+LPSI   +  +GKEQEE 
Sbjct  63   VVESLIILEYVDETWKENPLLPEDPLDRATARFWARYIDDKVLPSIWEFFTKEGKEQEEA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A +NLK +EE+L  GK+FFGG+ +GF+DI LGWLA   S+FEE+ G+K++  E+FP+
Sbjct  123  IVKAKENLKYLEEELK-GKKFFGGEKVGFVDIALGWLAYNESLFEEVAGMKVVTKEEFPL  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAI  188
            LS W   F + P I D+WP RDK+I K+QA+ ++I
Sbjct  182  LSAWAVTFADLPIIKDNWPSRDKLIAKYQAMRDSI  216



>ref|XP_007029835.1| Glutathione S-transferase TAU 8 [Theobroma cacao]
 gb|EOY10337.1| Glutathione S-transferase TAU 8 [Theobroma cacao]
Length=252

 Score =   270 bits (690),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 173/224 (77%), Gaps = 3/224 (1%)
 Frame = -2

Query  868  HPELAITVAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVH  689
            H  + I  +MAE VKL++TWS+ +G RVVWAL +K IQYE I EDL+NKS  LL+YNPV+
Sbjct  25   HKVVEIANSMAE-VKLFKTWSTQFGARVVWALKLKGIQYEAIDEDLSNKSALLLQYNPVY  83

Query  688  KKIPVLLHNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRS  509
            KK+PVL+HNGKPI ESLVILEYIE+TW   P+LP+ PL +A+ RFWAKF ++KLLPSI S
Sbjct  84   KKVPVLVHNGKPISESLVILEYIEETWKQNPILPEDPLGKANARFWAKFNDEKLLPSIWS  143

Query  508  SYFMKGKEQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEIT  329
            ++  +GKE+EE +   L++LK +EE+L  GK+FFGG+ IG  D+V GWLANL  VFEE+ 
Sbjct  144  AFTKEGKEREEAMGAVLESLKFVEEELK-GKKFFGGEKIGLADLVFGWLANLAPVFEEVA  202

Query  328  GLKLIDAEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIF  197
            GLK++D E++P+L  W   F  HP I D+WPP DK++ K+QA++
Sbjct  203  GLKILD-ERYPLLLAWQPEFSEHPIIKDYWPPHDKLVIKYQALY  245



>ref|XP_009335024.1| PREDICTED: probable glutathione S-transferase isoform X1 [Pyrus 
x bretschneideri]
Length=219

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 167/215 (78%), Gaps = 1/215 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL RTWSS +GLR+VWAL +K I YETI EDL+NKS  LL+ NPVHKK+PVLLHNG  
Sbjct  3    EVKLLRTWSSRFGLRIVWALQLKGIPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNA  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            + ESL+ILEY+++TW   PLLP+ PLDRA  RFWA++ +DK+ PSI  S+  +GKEQEEG
Sbjct  63   VVESLIILEYVDETWKENPLLPEDPLDRATARFWARYIDDKVSPSIWESFTKEGKEQEEG  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A +NLK +EE+L  GK+FFGG+ +GF+DI LGWLA   S+FE+I G+K++  E+FP+
Sbjct  123  IVKAKENLKYLEEELK-GKKFFGGEKVGFVDIALGWLAYYESLFEDIAGMKVVTKEEFPL  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAI  188
            LS W   F + P I D+ P RDK+I ++QA+ ++I
Sbjct  182  LSAWAATFADVPIIKDNLPSRDKLIARYQAMRDSI  216



>ref|XP_009343224.1| PREDICTED: probable glutathione S-transferase isoform X3 [Pyrus 
x bretschneideri]
Length=219

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 166/215 (77%), Gaps = 1/215 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL RTWSS +GLR+VWAL +K I YETI EDL+NKS  LL+ NP+HKKIPVLLHNG  
Sbjct  3    EVKLLRTWSSAFGLRIVWALQLKGIPYETIYEDLSNKSPLLLQSNPIHKKIPVLLHNGNA  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            + ESL+ILEY+++TW   PLLP+ PL+RA  RFWA++ ++K+ PSI  S+  +GKEQEEG
Sbjct  63   VVESLIILEYVDETWKENPLLPEDPLERATARFWARYGDEKVSPSIWESFTKEGKEQEEG  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A + LK +E +L  GK+FFGG+ +GF+DI LGWL    S+FE+ITG+K++  E+FP+
Sbjct  123  IVKAKEKLKYLEAELK-GKKFFGGEKVGFVDIALGWLTYYESLFEDITGMKVVTKEEFPL  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAI  188
            LS W   F + P I D+WPP+DK+I K QAI ++I
Sbjct  182  LSAWAGTFADAPIIKDNWPPKDKLIAKLQAIRDSI  216



>ref|XP_009606213.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana tomentosiformis]
Length=224

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 169/212 (80%), Gaps = 1/212 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEE+KL+RTWSSP+GLR VWAL+IK IQYETI EDL+ KS  LL++NPVHKKIPVL+H 
Sbjct  1    MAEELKLHRTWSSPFGLRAVWALHIKGIQYETIFEDLSQKSPELLQHNPVHKKIPVLVHK  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPICESLVILEYI++TW   PLLPQ P ++A  RFWAKF EDKLLPSI S +  +G E+
Sbjct  61   GKPICESLVILEYIDETWKEAPLLPQDPYEKAIARFWAKFGEDKLLPSIWSVFTGQGNEK  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
             E +  A+ NL+L+EEQL   K+FFGG+ IG+LD+ LG LA L  VFEE+  LKL DA K
Sbjct  121  NEALGPAVQNLELLEEQLK-EKKFFGGEKIGYLDLSLGLLAYLRDVFEEVIDLKLFDAGK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            FP+LS WM NFY+ P I +HWPPRDK+ITKFQ
Sbjct  180  FPLLSAWMDNFYDAPVIKEHWPPRDKLITKFQ  211



>ref|XP_004307164.1| PREDICTED: glutathione transferase GST 23-like [Fragaria vesca 
subsp. vesca]
Length=223

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 166/211 (79%), Gaps = 1/211 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+RTWSSP+ LR+VWAL +K +QY+TI EDL+NKS  LL+YNPVHKK+PVL+HNGK 
Sbjct  3    EVKLFRTWSSPFALRIVWALKLKDVQYDTIFEDLSNKSPLLLQYNPVHKKVPVLVHNGKS  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            + ES VILEYIE+TW + PLL + P +RA  RFWAKF ++K+L SI  ++  +G++QEEG
Sbjct  63   VAESFVILEYIEETWKHNPLLSEDPHERAAARFWAKFGDEKVLTSIWEAFISEGEKQEEG  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A +NLK +E +LN GK+FFGG+ IGF DI LGWL     VFEE+T +KLI   + P+
Sbjct  123  IVKAKENLKYLEGELN-GKKFFGGEQIGFADIALGWLTEYVDVFEEVTSMKLITEGELPL  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            LSEW  +F + P I +++PPRDK++TKFQA+
Sbjct  182  LSEWKKSFADAPIIKENFPPRDKLVTKFQAL  212



>ref|XP_009335025.1| PREDICTED: probable glutathione S-transferase isoform X2 [Pyrus 
x bretschneideri]
Length=219

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 167/215 (78%), Gaps = 1/215 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL RTWSSP+ LR+VWAL +K + YETI EDL+NKS  LL+ NPVHKK+PVLLHNG  
Sbjct  3    EVKLLRTWSSPFPLRIVWALQLKGVPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNA  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            + ESL+ILEY+++TW   PLLP+ PLDRA  RFWA++ +DK+ PSI  S+  +GKEQEEG
Sbjct  63   VVESLIILEYVDETWKENPLLPEDPLDRATARFWARYIDDKVSPSIWESFTKEGKEQEEG  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A +NLK +EE+L  GK+FFGG+ +GF+DI LGWLA   S+FE+I G+K++  E+FP+
Sbjct  123  IVKAKENLKYLEEELK-GKKFFGGEKVGFVDIALGWLAYYESLFEDIAGMKVVTKEEFPL  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAI  188
            LS W   F + P I D+ P RDK+I ++QA+ ++I
Sbjct  182  LSAWAATFADVPIIKDNLPSRDKLIARYQAMRDSI  216



>ref|XP_009343222.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Pyrus 
x bretschneideri]
Length=219

 Score =   266 bits (681),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 167/215 (78%), Gaps = 1/215 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL RTWSS +GLR+VWAL +K I YETI EDL+NKS  LL+ NP+HKKIPVLLHNG  
Sbjct  3    EVKLLRTWSSAFGLRIVWALQLKGIPYETIYEDLSNKSPLLLQSNPIHKKIPVLLHNGNA  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            + ESL+ILEY+++TW   PLLP+ PL+RA  RFWA++ ++K+LPSI   +  +GKEQEE 
Sbjct  63   VVESLIILEYVDETWKENPLLPEDPLERATARFWARYGDEKVLPSIWEFFTKEGKEQEEA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A +NLK +EE+L  GK+FFGG+ +GF+DI LGWLA   S+FEE+ G+K++  E+FP+
Sbjct  123  IVKAKENLKYLEEELK-GKKFFGGEKVGFVDIALGWLAYNESLFEEVAGMKVVTKEEFPL  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAI  188
            LS W   F + P I D+WP RDK+I K+QA+ ++I
Sbjct  182  LSAWAVTFADLPIIKDNWPSRDKLIAKYQAMRDSI  216



>ref|XP_002307924.1| hypothetical protein POPTR_0006s02510g [Populus trichocarpa]
 gb|EEE91447.1| hypothetical protein POPTR_0006s02510g [Populus trichocarpa]
 gb|ADB11389.1| tau class glutathione transferase GSTU18 [Populus trichocarpa]
Length=225

 Score =   264 bits (675),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 164/218 (75%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVK++R+WSSP+ LRV+WAL +K ++++ I EDL NKS  LL+YNPV KK+PVL+HN
Sbjct  1    MAEEVKVFRSWSSPFPLRVIWALRLKGVKFDVICEDLFNKSPLLLQYNPVGKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKE  485
            GK ICESLVILEYIE+TW  TPLLP+ P  +A+ RFWAKF +DK+L SI+    +K GKE
Sbjct  61   GKAICESLVILEYIEETWKQTPLLPEDPYQKANARFWAKFSDDKVLQSIKWDVLLKEGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QEEG++ +L NL+ +EE+L  GK+FFGG+ IG  D+ LGWLA   ++FEE+ GLKL+D E
Sbjct  121  QEEGILASLQNLRYLEEELR-GKKFFGGEAIGLADLALGWLAYYLNIFEEVAGLKLVDQE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
             FP L  WM +F N P +   WP +DK+  KF A+  A
Sbjct  180  SFPSLVAWMQDFANAPVVHGSWPDKDKLAEKFVAMREA  217



>ref|XP_008346936.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=275

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 166/218 (76%), Gaps = 1/218 (0%)
 Frame = -2

Query  844  AMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLH  665
            A   EVKL R+WSSP+GLR+VWAL +K I YE I EDL+NKS  LL+ NP+HKKIPVLLH
Sbjct  55   AKXAEVKLLRSWSSPFGLRIVWALQLKGIPYEXIYEDLSNKSPLLLQSNPIHKKIPVLLH  114

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            NG  + ESL+ILEY+++TW   PLLP+ PL+RA  RFWA++C++ + PSI  S+  +GKE
Sbjct  115  NGNAVVESLIILEYVDETWKENPLLPEDPLERATARFWARYCDETVSPSIWESFTKEGKE  174

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QEEG+V+A +NLK +EE+L  GK+FFGG+ IG +DI LGWL    S+FE+I G+K++  E
Sbjct  175  QEEGIVKAKENLKYLEEELK-GKKFFGGEKIGIVDIALGWLXYYESLFEDIVGMKVVTKE  233

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            +FP+LS W   F + P I D+WP +DK+I KFQAI ++
Sbjct  234  EFPLLSAWAATFADVPIIKDNWPSKDKLIPKFQAIRDS  271



>ref|XP_011010098.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 165/218 (76%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVK++RTWSS + LRV+WAL +K ++++TI EDL+NKS  LL+YNP++KK+PVL+HN
Sbjct  1    MAEEVKVFRTWSSSFALRVIWALKLKGVEFDTIYEDLSNKSPLLLQYNPIYKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKE  485
            GK ICESLVILEYI++TW   PLLP+ P  +A+ RFWAKF +DK+L SI     MK GKE
Sbjct  61   GKVICESLVILEYIDETWKQNPLLPEDPHQQANARFWAKFGDDKVLQSIVGDVLMKEGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
             EEGV+ +L+NLK +EE++  GK+FFGG+ IG  DI LGWLA    +FEEI GL LID E
Sbjct  121  LEEGVLASLENLKYLEEEIR-GKKFFGGETIGLADIALGWLAYYLGIFEEILGLILIDQE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            KFP L+ W   F N P I ++WP RDK++ KF A+  A
Sbjct  180  KFPSLAAWKQEFANAPIIHENWPDRDKLVNKFVAMREA  217



>ref|XP_002322571.1| hypothetical protein POPTR_0016s02370g [Populus trichocarpa]
 gb|EEF04332.1| hypothetical protein POPTR_0016s02370g [Populus trichocarpa]
 gb|ADB11390.1| tau class glutathione transferase GSTU24 [Populus trichocarpa]
Length=225

 Score =   264 bits (674),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 165/218 (76%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVK++RTWSS + LRV+WAL +K ++++TI EDL+NKS  LL+YNP+HKK+PVL+HN
Sbjct  1    MAEEVKVFRTWSSRFALRVIWALKLKGVEFDTIYEDLSNKSPLLLQYNPIHKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKE  485
            GK ICESLVILEYI++TW   PLLP+ P  +A+ RFWAKF +DK+L SI     MK GKE
Sbjct  61   GKVICESLVILEYIDETWKQNPLLPEDPHQQANARFWAKFGDDKVLQSIVWGVLMKEGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
             EEGV+ +L+NLK +EE++  GK+FFGG+ IG  DI LGWLA    + EEI GLKLID E
Sbjct  121  LEEGVLASLENLKYLEEEIR-GKKFFGGETIGLADIALGWLAYYLDIIEEILGLKLIDQE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            KFP L+ W   F N P I ++WP RDK++ KF A+  A
Sbjct  180  KFPSLAAWKQEFANAPIIHENWPDRDKLVNKFVAMREA  217



>ref|XP_006437359.1| hypothetical protein CICLE_v10032702mg [Citrus clementina]
 gb|ESR50599.1| hypothetical protein CICLE_v10032702mg [Citrus clementina]
Length=221

 Score =   263 bits (673),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 159/214 (74%), Gaps = 1/214 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL  TWSSP+ LRVVWAL +K +Q+++I EDL+NKS  LL+YNPVHKKIPVL+HN
Sbjct  1    MAEEVKLLTTWSSPFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQYNPVHKKIPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEY+++TW   PLLP  P DRA  RFWAKF +DK+ PSI   +  +GKE+
Sbjct  61   GKPISESLVILEYVDETWRQNPLLPDGPYDRARARFWAKFSDDKVSPSIWGVFIKQGKER  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            EE   Q  +NLK +EE+L  GK+FFGG+ IGF D+ LGW+A    V EEI G+K+++ EK
Sbjct  121  EEAFDQVFENLKFLEEELK-GKKFFGGEKIGFADLALGWIAERVCVLEEIIGVKIVEEEK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            FP++S WM  F   P I +  PP +K++TK + I
Sbjct  180  FPLVSAWMQEFVKVPIIKESCPPHEKLVTKIRGI  213



>ref|XP_011004953.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 162/215 (75%), Gaps = 3/215 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M + VKL++TWSSP+G+R+VWAL +K +Q+E I EDL NKS  LL YNPVHKKIPVL+H+
Sbjct  1    MEKGVKLFKTWSSPFGIRIVWALKVKGVQFEQIDEDLANKSPLLLLYNPVHKKIPVLVHD  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKP+ ESLVILEYIE+TW   PL P+ PL+RA  RFWAKF +DK++PSI  + F+KG+E+
Sbjct  61   GKPVVESLVILEYIEETWKQNPLFPEDPLERAAARFWAKFGDDKVMPSIWEA-FIKGREE  119

Query  481  EE-GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            EE     A +NLK +EE+L  GK+FFGG+ IG +DI  GWLANL  VFEEI  +K+ID E
Sbjct  120  EECAFAPAFENLKFLEEELK-GKQFFGGERIGIVDIAFGWLANLVPVFEEIHAIKVIDEE  178

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            +FP L  WM  F   P I D WPP +K++ KF+AI
Sbjct  179  RFPSLYAWMQEFSRAPLIADCWPPHEKLVNKFRAI  213



>ref|XP_006484732.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=221

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 159/214 (74%), Gaps = 1/214 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL  TWSSP+ LRVVWAL +K +Q+++I EDL+NKS  LL+YNPVHKKIPVL+HN
Sbjct  1    MAEEVKLLMTWSSPFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQYNPVHKKIPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEY+++TW   PLLP  P DRA  RFWAKF +DK+ PS+   +  +GKE+
Sbjct  61   GKPISESLVILEYVDETWRQYPLLPDGPYDRARARFWAKFSDDKVSPSMWGVFIKQGKER  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            EE   Q  +NLK +EE+L  GK+FFGG+ IGF D+ LGW+A    V EEI G+K+++ EK
Sbjct  121  EEAFDQVFENLKFLEEELK-GKKFFGGEKIGFADLALGWIAERVCVLEEIIGVKIVEEEK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            FP++S WM  F   P I +  PP +K++TK + I
Sbjct  180  FPLVSAWMQEFVKVPIIKESLPPHEKLVTKIRGI  213



>ref|XP_011004483.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   261 bits (668),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 163/218 (75%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVK++R+W+SP+ LRV+WAL +K ++++ I EDL NKS  LL+YNPV KK+PVL+HN
Sbjct  1    MAEEVKVFRSWASPFPLRVIWALRLKGVKFDVICEDLFNKSPLLLQYNPVEKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKE  485
            GK ICESLVILEYIE+TW  +PLLP+ P  +A+ RFWAKF +DK+  SI+    +K GKE
Sbjct  61   GKAICESLVILEYIEETWKQSPLLPEDPYQKANARFWAKFSDDKVFQSIKWDVLLKEGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QEEG++ +L NL+ +EE+L  GK+FFGG+ IG  D+ LGWLA   ++FEE+ GLKL+D E
Sbjct  121  QEEGILASLQNLRYLEEELR-GKKFFGGEAIGLADLALGWLAYYINIFEEVVGLKLVDQE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            +FP L  WM  F N P +   WP RDK+  KF A+  A
Sbjct  180  RFPSLVAWMQEFANAPFVHGSWPDRDKLAEKFVAMREA  217



>ref|XP_009335026.1| PREDICTED: probable glutathione S-transferase isoform X3 [Pyrus 
x bretschneideri]
Length=218

 Score =   261 bits (666),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL RTWSSP+ LR+VWAL +K + YETI EDL+NKS  LL+ NPVHKK+PVLLHNG  
Sbjct  3    EVKLLRTWSSPFPLRIVWALQLKGVPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNA  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESL+ILEY+++TW   PLLP+ PL+RA  RFWA++  D++ PSI  S+  +GKEQEEG
Sbjct  63   IVESLIILEYVDETWKENPLLPEDPLERATARFWARYI-DEVSPSIWESFTKEGKEQEEG  121

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A + LK +E +L  GK+FFGG+ +GF+DI LGWL    S+FE++ G+K++  E+FP+
Sbjct  122  IVKAKEKLKYLEAELK-GKKFFGGEKVGFVDIALGWLTYYESLFEDVAGMKVVTKEEFPL  180

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAI  188
            LS W   F + P I D+WP RDK+I KFQAI ++I
Sbjct  181  LSAWAATFADVPIIKDNWPSRDKLIAKFQAIRDSI  215



>ref|XP_002319750.2| hypothetical protein POPTR_0013s06950g [Populus trichocarpa]
 gb|EEE95673.2| hypothetical protein POPTR_0013s06950g [Populus trichocarpa]
Length=225

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 162/215 (75%), Gaps = 3/215 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M + VKL++TWSSP+G+R+VWAL +K +Q+E I EDL NKS  LL YNPVHKKIPVL+H+
Sbjct  1    MEKGVKLFKTWSSPFGIRIVWALKVKGVQFEQIDEDLVNKSPLLLLYNPVHKKIPVLVHD  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKP+ ESL+ILEYIE TW   PL P+ PL+RA  RFWAKF +DK++PSI  + F+KG+E+
Sbjct  61   GKPVVESLIILEYIEGTWKQNPLFPEDPLERAAARFWAKFGDDKVMPSIWEA-FIKGREE  119

Query  481  EE-GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            EE     A +NLK +EE+L  GK+FFGG+ IG +DI LGWLANL  VFEEI  +K+ID E
Sbjct  120  EECAFAPAFENLKFLEEELK-GKQFFGGERIGIVDIALGWLANLVPVFEEIHAIKMIDEE  178

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            +FP+L  WM  F   P I D  PP +K++ KF+AI
Sbjct  179  RFPLLYAWMQEFSKAPVIADCRPPHEKLVNKFRAI  213



>ref|XP_004307163.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=226

 Score =   259 bits (661),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 158/210 (75%), Gaps = 1/210 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+ TWSS + LR+VWAL +K + Y+TI EDL+NKS  LL+YNP+HKKIPVL+HNGK 
Sbjct  3    EVKLFSTWSSAFSLRIVWALKLKDVPYDTIFEDLSNKSPLLLQYNPIHKKIPVLVHNGKS  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYIE+TW   PLLP+ P DRA  RFWAKF +DK+ P I  +++ +GKEQEE 
Sbjct  63   IAESLVILEYIEETWKQNPLLPEDPHDRAAARFWAKFGDDKVFPPIVDAFYSEGKEQEEA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A +NLK +EE+L  GK FFGGD IGF DI LGWLA+   V EEI  + LI  ++FP+
Sbjct  123  IVKAKENLKYLEEELK-GKNFFGGDQIGFADIALGWLAHYLKVLEEIANMNLIAEDEFPL  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            LS+W   F +   I ++WPP DK+ITK+ A
Sbjct  182  LSQWQKTFADAHIIKENWPPLDKLITKYLA  211



>ref|XP_009343225.1| PREDICTED: probable glutathione S-transferase isoform X4 [Pyrus 
x bretschneideri]
Length=218

 Score =   258 bits (660),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL  TWSSP+ LR++WAL +K + YETI EDL+NKS  LL+ NPVHKK+PVLLHNG  
Sbjct  3    EVKLLSTWSSPFPLRIIWALQLKGVPYETIHEDLSNKSPLLLQSNPVHKKVPVLLHNGNA  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESL+ILEY+++TW   PLLP+ PL+RA  RFWA++  D++ PSI  S+  +GKEQEEG
Sbjct  63   IVESLIILEYVDETWKENPLLPEDPLERATARFWARYI-DEVSPSIWESFTKEGKEQEEG  121

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A + LK +E +L  GK+FFGG+ +GF+DI LGWL    S+FE+ITG+K++  E+FP+
Sbjct  122  IVKAKEKLKYLEAELK-GKKFFGGEKVGFVDIALGWLTYYESLFEDITGMKVVTKEEFPL  180

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAI  188
            LS W   F + P I D+WPP+DK+I K QAI ++I
Sbjct  181  LSAWAGTFADAPIIKDNWPPKDKLIAKLQAIRDSI  215



>gb|ADB11367.1| putative tau class glutathione transferase GSTU41 [Populus trichocarpa]
Length=225

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 161/215 (75%), Gaps = 3/215 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M + VKL++TWSSP+G+R+VWAL +K +Q+E I EDL NKS  LL YNPVHKKIPVL+H+
Sbjct  1    MEKGVKLFKTWSSPFGIRIVWALKVKGVQFEQIDEDLVNKSPLLLLYNPVHKKIPVLVHD  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKP+ ESL+ILEYIE TW   PL P+ PL+RA  RFWAKF +DK++PSI  + F+KG+E+
Sbjct  61   GKPVVESLIILEYIEGTWKQNPLFPEDPLERAAARFWAKFGDDKVMPSIWEA-FIKGREE  119

Query  481  EE-GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            EE     A +NLK +EE+L  GK+FFGG+ IG +DI  GWLANL  VFEEI  +K+ID E
Sbjct  120  EECAFAPAFENLKFLEEELK-GKQFFGGERIGIVDIAFGWLANLVPVFEEIHAIKMIDEE  178

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            +FP+L  WM  F   P I D  PP +K++ KF+AI
Sbjct  179  RFPLLHAWMQEFSKAPVIADCRPPHEKLVNKFRAI  213



>ref|XP_011040645.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 162/218 (74%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVK++R+W+SP+ LRV+WAL +K ++++ I EDL NKS  LL+YNPV KK+PVL+HN
Sbjct  1    MAEEVKVFRSWASPFPLRVIWALRLKGVKFDVICEDLFNKSPLLLQYNPVEKKVPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKE  485
            GK ICESLVILEYIE+TW  +PLLP+ P  +A+ RFWAKF +DK+  S++    +K GKE
Sbjct  61   GKAICESLVILEYIEETWKQSPLLPEDPYQKANARFWAKFSDDKVFQSMKWDVLLKEGKE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QEEG++ +L NL+ +EE+L  GK+FFGG+ IG  D+ LGWLA   ++FEE+ GLKL+D  
Sbjct  121  QEEGILASLQNLRYLEEELR-GKKFFGGEAIGLADLALGWLAYYINIFEEVVGLKLVDQG  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            +FP L  WM  F N P +   WP RDK+  KF A+  A
Sbjct  180  RFPSLVAWMQEFANAPFVHGSWPDRDKLAEKFVAMREA  217



>gb|KDP39591.1| hypothetical protein JCGZ_02611 [Jatropha curcas]
Length=217

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 157/211 (74%), Gaps = 1/211 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MA EVKL ++WSSP+ LR+VWAL +K IQY++I ED+TNKS  LL+YNPVHKKIPV +HN
Sbjct  1    MAGEVKLLKSWSSPFALRIVWALKLKGIQYDSIDEDMTNKSPLLLQYNPVHKKIPVFVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ES VILEYI++ W + PLLPQ P  RA  RF AKF ++K++ S+ +    KGKEQ
Sbjct  61   GKPIAESFVILEYIDEMWKHYPLLPQDPHKRATARFLAKFGDEKVMKSLWAISITKGKEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            EE   +A +NLK +EE L  GKRFFGG+ IGFLDI LGWLAN+  V EEI G K+ID + 
Sbjct  121  EEASAKATENLKYLEEALT-GKRFFGGEKIGFLDIALGWLANVVPVVEEIVGFKVIDKQG  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKF  209
            FP+LS WM  F + P I +  PP DK++T+F
Sbjct  180  FPLLSTWMQEFKSTPEIKESLPPHDKLVTRF  210



>gb|KCW65098.1| hypothetical protein EUGRSUZ_G02603 [Eucalyptus grandis]
Length=213

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 157/214 (73%), Gaps = 12/214 (6%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL+RTWSSPY LRVVWAL +K IQYE++LED++ KS  + RYNPV+KK+PVLLHN
Sbjct  1    MAEEVKLFRTWSSPYALRVVWALQLKGIQYESVLEDVSEKSDLVRRYNPVYKKVPVLLHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            G+PI ESL+ILEYI++TW   PLLP+ P  R   RFWA            S+   +GKEQ
Sbjct  61   GRPISESLIILEYIDETWKQHPLLPRDPYARTMARFWAN-----------SATTSEGKEQ  109

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E  + +A ++L+ +EE L  GK+FF GDNIG+LDI LGWLANL  VFEEI  LK++D E+
Sbjct  110  EAALAEASEHLQKLEEVLR-GKKFFSGDNIGYLDIALGWLANLIRVFEEICSLKVVDYER  168

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            FP+L  W+  F + PAI D WPPRDK+I KF A+
Sbjct  169  FPLLCAWLKEFSDTPAIKDCWPPRDKLIPKFIAL  202



>ref|XP_004297032.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=222

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+RTWSS + LR+VWAL +K + Y+TI EDL+NKS  LL++NP+HK +PVL+HNGK 
Sbjct  3    EVKLFRTWSSSFALRIVWALKLKDVPYDTIFEDLSNKSPLLLQHNPIHKLVPVLVHNGKS  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYIE+TW + PLLP  P +RA  RFWAKF +DK+ P I  +   +GKEQEE 
Sbjct  63   IAESLVILEYIEETWKHNPLLPADPHNRAAARFWAKFGDDKVFPPILDTLCSEGKEQEEA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A D+LK +EE+L  GK+FFGG+ IGF DI LGWLA+  +VF E+  +KLI  ++FP+
Sbjct  123  IVKAKDSLKYLEEELK-GKKFFGGEQIGFADIALGWLAHHENVFAEVANVKLIAEDEFPL  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            LS+W   F + P I ++ PPR K++TKFQAI
Sbjct  182  LSKWRETFADVPIIKENLPPRAKLVTKFQAI  212



>gb|KCW65100.1| hypothetical protein EUGRSUZ_G02605 [Eucalyptus grandis]
Length=257

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 167/246 (68%), Gaps = 34/246 (14%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL++TWSSP+ LRV WAL +K IQYE++LEDL+NKS+ LL+YNPV+KK+PVLLHN
Sbjct  1    MAEEVKLFKTWSSPFPLRVAWALQLKGIQYESVLEDLSNKSNLLLQYNPVYKKVPVLLHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLL-------PSIRSSY  503
            G+PI ESL+ILEY+++TW   PLLPQ P  RA  RFWAKF +DK++       P IR + 
Sbjct  61   GRPISESLIILEYVDETWKQYPLLPQDPYARAMARFWAKFGDDKVIYIRFSYAPCIRVNV  120

Query  502  FMK--------------------------GKEQEEGVVQALDNLKLIEEQLNGGKRFFGG  401
              K                          GKEQE  + +A ++L+ +EE+L  GK+FF G
Sbjct  121  DRKKESCLLTSLDYVGLVFREVRDNVTDEGKEQEAVLAEASEHLQKLEEELR-GKKFFRG  179

Query  400  DNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPVLSEWMHNFYNHPAILDHWPPRDKM  221
            DNIG+LDI LGWLANL  VFEE++ L+++D E+FP+L  W+  F + P I D WPP D +
Sbjct  180  DNIGYLDIALGWLANLVRVFEEVSSLRVLDVERFPLLCAWLKEFSDAPVIKDCWPPHDML  239

Query  220  ITKFQA  203
            I KF A
Sbjct  240  IAKFIA  245



>ref|XP_004299656.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=227

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 155/208 (75%), Gaps = 1/208 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL+RTW+S + LR+VWAL +K + Y+TI EDL+NKS  LL+YNP+HK IPVL+HNGK
Sbjct  2    EEVKLFRTWTSSFSLRIVWALKLKDVPYDTIFEDLSNKSPLLLQYNPIHKAIPVLVHNGK  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ESLVILEYIE+TW   PLLPQ P DRA  RF AKF +DK++PSI  + F +GKEQEE
Sbjct  62   PIAESLVILEYIEETWKQNPLLPQDPHDRATARFLAKFGDDKVMPSIVDAVFSEGKEQEE  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             + +A +NL  +E +L  GK++FGG+ IGF DI  GWLA+   V EE+T  KLI  ++FP
Sbjct  122  AIAKAKENLNYLEAELK-GKKYFGGERIGFADIAQGWLAHSLKVLEEVTNTKLIVEDEFP  180

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITK  212
            +LS+W   F +   I ++WPPR K++ +
Sbjct  181  LLSQWQKTFADAHIIRENWPPRGKLVAQ  208



>ref|XP_007219176.1| hypothetical protein PRUPE_ppa016653mg [Prunus persica]
 gb|EMJ20375.1| hypothetical protein PRUPE_ppa016653mg [Prunus persica]
Length=207

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 152/211 (72%), Gaps = 17/211 (8%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+RTWSSP+ LR++WAL +K                 LL+YNP+HKK+PVL+HNGKP
Sbjct  3    EVKLFRTWSSPFALRIIWALKLKG----------------LLQYNPIHKKVPVLVHNGKP  46

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ES V+LEYI++TW   PLLP+ PL RA  R WAKF +DK+LPSI  S+   GKEQEE 
Sbjct  47   IVESFVVLEYIDETWKENPLLPEDPLQRAAARLWAKFGDDKVLPSIWESFTNDGKEQEEA  106

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V+A +NLK +EE+L  GK+FF G+ +GF DI LGWLA+  SVFEE+ G+KL+  E+FP+
Sbjct  107  IVKAKENLKYLEEELK-GKKFFWGEKLGFADIALGWLAHYESVFEEVAGMKLLTEEEFPL  165

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            LS W   F + P I D+WP RDK++ KFQAI
Sbjct  166  LSAWKLTFADAPIIKDNWPSRDKLVAKFQAI  196



>ref|XP_010938159.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=225

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL  TWSSP+ LR+ WAL +K ++Y+ I EDL NKS  LL+YNPVHKK+PVL+H GKP
Sbjct  5    EVKLLGTWSSPFVLRIKWALKMKGVEYDFIEEDLQNKSPLLLKYNPVHKKVPVLVHEGKP  64

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEY+++TW   P+LP+ P  RA  RFW+KF E+K LPSI   +  +G+  EE 
Sbjct  65   IAESLVILEYMDETWKENPILPEDPYQRAMARFWSKFGEEKCLPSIWRVFISQGENTEEA  124

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +V A +NLK++E +L  GK+FF G+ +GF DI LGW+ N+  + EEI  LK+ID +++P 
Sbjct  125  LVSASENLKILEGELK-GKKFFNGETLGFADISLGWIVNMVILLEEIMELKMIDDQRYPS  183

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK*T  170
            LS WM NF N P I D +PP+++M+TK++ +  A+ A + T
Sbjct  184  LSAWMKNFSNFPGIRDSFPPQERMLTKYRILREALLATRGT  224



>emb|CBI38197.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 153/197 (78%), Gaps = 2/197 (1%)
 Frame = -2

Query  799  YGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKPICESLVILEYI  620
            + LR+VWA  IK I+YETI EDL+NKS  LL YNPVHKK+P+L+HNGK I ESLVILEYI
Sbjct  59   FALRIVWAPKIKGIEYETIFEDLSNKSPSLLHYNPVHKKVPILIHNGKLIVESLVILEYI  118

Query  619  EDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKEQEEGVVQALDNLKL  443
            ++TW  T LL +   +RA  RFWAKF +DK++ SI   +F+K GKE+++ +V+A+ +L+ 
Sbjct  119  DETWKETSLLSEDLYERAMARFWAKFGDDKVVTSIFQGFFLKEGKEKKKAMVEAMKHLQF  178

Query  442  IEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPVLSEWMHNFYN  263
            +E++L  GKR FGG+ IGF+D+ LGWLAN  S+FEE+ GLK++D +KFP+LSEWM  F +
Sbjct  179  LEDKLK-GKRLFGGERIGFVDLALGWLANFISIFEEVVGLKIVDEDKFPLLSEWMKEFSD  237

Query  262  HPAILDHWPPRDKMITK  212
             P I D+WPP+DKMI K
Sbjct  238  SPIIKDNWPPQDKMIAK  254



>ref|XP_008793319.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=226

 Score =   241 bits (614),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 161/218 (74%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAE-EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLH  665
            MAE EVKL  TWSSP+ LR+ WAL +K ++Y+ I EDL NKS  LL+YNPVHKK+PVL+H
Sbjct  1    MAEAEVKLLGTWSSPFVLRIKWALKLKGVEYDFIEEDLQNKSPLLLKYNPVHKKVPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            +GK I ES VILEYI++TW   P+LP+ P  RA  RFW+KF ++K LPS+   +  +G++
Sbjct  61   DGKSIAESYVILEYIDETWKENPILPEDPYQRAMARFWSKFGDEKFLPSMWKFFISQGEK  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            +EE +V A +NLK++E +L  GK+FF G+ +GF DI LGW+ ++ S+ EEI  LK+ID +
Sbjct  121  REEALVSASENLKILEGELK-GKKFFNGETLGFADISLGWIVDMVSLLEEIMELKMIDEQ  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            ++P LS WM NF + P I D +PP+++M+TK++ +  A
Sbjct  180  RYPSLSAWMKNFSDFPGIKDSFPPQERMLTKYRTLREA  217



>ref|XP_010922854.1| PREDICTED: probable glutathione S-transferase [Elaeis guineensis]
Length=224

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 152/211 (72%), Gaps = 1/211 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            +VKL+  WSSP+ L V WAL IK ++YE I EDL+NKS+ LL YNPVHKK+PV++HNGKP
Sbjct  5    DVKLFGIWSSPFVLIVKWALRIKGVEYEYIEEDLSNKSNLLLEYNPVHKKVPVMVHNGKP  64

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ES VILEYIE+TW N P+LP  P +RA  RFW KF  DKL P I   +  +GKEQEE 
Sbjct  65   IAESAVILEYIEETWKNNPILPDDPYERAMARFWCKFVVDKLSPPIWRLFISQGKEQEEA  124

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
               A++NLK++E++L  GK FF G+ IG  DI +G LA +  ++EEIT LK++DAE+FP+
Sbjct  125  YALAIENLKILEQELQ-GKMFFCGETIGLADISIGPLAYVMPIYEEITKLKMVDAERFPL  183

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            L  WM  F N P + D  PP +K++ K++A+
Sbjct  184  LCAWMEAFLNSPVVKDSLPPGEKLLLKYRAL  214



>emb|CAN60447.1| hypothetical protein VITISV_016434 [Vitis vinifera]
Length=202

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -2

Query  760  IQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKPICESLVILEYIEDTWHNTPLLPQH  581
            I+YETI EDL+NKS  LL YNPVHKK+P+ +HNGK I ESLVILEYI++TW  T LL + 
Sbjct  4    IEYETIFEDLSNKSPSLLHYNPVHKKVPIJIHNGKLIVESLVILEYIDETWKETSLLSED  63

Query  580  PLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKEQEEGVVQALDNLKLIEEQLNGGKRFFG  404
              +RA  RFWAKF +DK++ SI   +F+K GKE+++ +V+A+ +L+ +E++L  GKR FG
Sbjct  64   LYERAMARFWAKFGDDKVVTSIFQGFFLKEGKEKKKAMVEAMKHLQFLEDKLK-GKRLFG  122

Query  403  GDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPVLSEWMHNFYNHPAILDHWPPRDK  224
            G+ IGF+D+ LGWLAN  S+FEE+ GLK++D +KFP+LSEWM  F + P I D+WPP+DK
Sbjct  123  GERIGFVDLALGWLANFISIFEEVVGLKIVDEDKFPLLSEWMKEFSDSPIIKDNWPPQDK  182

Query  223  MITKFQAIFNA  191
            MI KF A+++A
Sbjct  183  MIAKFHALYDA  193



>ref|XP_006437357.1| hypothetical protein CICLE_v10032696mg [Citrus clementina]
 ref|XP_006484734.1| PREDICTED: glutathione transferase GST 23-like [Citrus sinensis]
 gb|ESR50597.1| hypothetical protein CICLE_v10032696mg [Citrus clementina]
Length=222

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 151/211 (72%), Gaps = 2/211 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL +TWSS + LRVVWAL +K +Q+++I EDL+NKS  LL++NPV+KKIPVL+HNG+ 
Sbjct  3    EVKLLKTWSSHFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQHNPVYKKIPVLVHNGRA  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYI++TW   PLLP  P + A  RFWAKF +DK+ PSI   +  +GKEQEE 
Sbjct  63   ISESLVILEYIDETWKQYPLLPDDPYESARARFWAKFSDDKVFPSIWGVFIKQGKEQEEA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
              Q  +N   +EE+L  GK+FFGG+ IG+ D+ LGW+A      EEI G+K+I+ EKFP+
Sbjct  123  FAQVFENFSFLEEELK-GKKFFGGEKIGYADLALGWIAERVFELEEI-GVKVIEKEKFPL  180

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            +S WM  F   P I +  PP +K++TK + I
Sbjct  181  VSAWMQEFLKVPVIKESLPPHEKLVTKMRGI  211



>ref|XP_002266744.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=223

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 148/212 (70%), Gaps = 1/212 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EEVKL   W SPY  RV+WAL++K I+YE + EDL+NKS  LL+YNPV+KKIPVL+H 
Sbjct  1    MEEEVKLLGAWPSPYSYRVLWALSLKDIKYEYVEEDLSNKSDLLLQYNPVYKKIPVLVHG  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEY+E+TW   PLLPQ P D+A  RFWAKF EDK  P   + +   G+EQ
Sbjct  61   GKPISESLVILEYMEETWPQNPLLPQDPYDKAMARFWAKFGEDK-GPIFMAIFVTVGEEQ  119

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+   +A + L ++EEQ  G K+FFGGD IG  DIVLGW+A    V EE++GLKL++AE 
Sbjct  120  EKAAKEAKEQLTILEEQALGEKKFFGGDKIGLTDIVLGWMAGWLDVIEEVSGLKLLEAEI  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            FP L  W+  F   P I +  P RD+M+  ++
Sbjct  180  FPRLHAWVQRFKEVPGIKEQLPDRDEMLVYYK  211



>ref|XP_010279540.1| PREDICTED: probable glutathione S-transferase isoform X1 [Nelumbo 
nucifera]
Length=227

 Score =   223 bits (568),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 150/213 (70%), Gaps = 0/213 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL   W SP+ LRV  AL +K +QYE I EDL+NKS  LL+YNP+HKK+PVLLHN
Sbjct  1    MAEEVKLIGAWISPFSLRVELALKLKGVQYEYIDEDLSNKSPLLLKYNPIHKKVPVLLHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ES VILEYI++TW    LLP+ P +RA  RFW KF ++K + +I  + +++ ++Q
Sbjct  61   GKPIAESTVILEYIDETWKGYHLLPEDPYERAMTRFWVKFIDEKCIEAIWKACWIEERKQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ + +A + LK++E +L  G++FF GDNIGF+DI   ++A    V +E+ G+ L+D EK
Sbjct  121  EKAIEEAKETLKILENELKKGRKFFAGDNIGFVDIAAIFIAFWVGVLQEVVGISLMDEEK  180

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            FPVL +W+  F N   + ++ PPRDK+   +Q 
Sbjct  181  FPVLHKWIEEFINCDVVGENLPPRDKLFAYYQG  213



>ref|XP_002280676.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   223 bits (567),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 155/220 (70%), Gaps = 1/220 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EEVK+  +  S + +RV WAL +K ++YE I EDL NKS  LL+YNPVHKK+PVL+H 
Sbjct  1    MGEEVKVIGSIKSGFCVRVEWALKLKGVEYEYIKEDLRNKSPMLLKYNPVHKKVPVLVHG  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
             KPI ESLVILEYI++TW + PLLP+ P +RA  RFWAK+ ++K +     ++  +G+E+
Sbjct  61   DKPIPESLVILEYIDETWKDNPLLPEDPYERAMARFWAKYADEKCMFGAWEAFKAEGEEK  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ +  AL++   +E+ +  GK+FFGG+ +GFLD+V+GW+ +  SV EE+ G+K++DAEK
Sbjct  121  EKAMESALESFAFLEKAIK-GKKFFGGEKMGFLDLVVGWIPHWLSVLEEVGGMKMLDAEK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEA  182
            FP L EW  NF   P I +  PPRD ++  F A F+++ +
Sbjct  180  FPSLHEWAENFIQIPLIKECIPPRDVLVNHFHATFSSLRS  219



>ref|XP_007223941.1| hypothetical protein PRUPE_ppa011108mg [Prunus persica]
 gb|EMJ25140.1| hypothetical protein PRUPE_ppa011108mg [Prunus persica]
Length=223

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 144/207 (70%), Gaps = 1/207 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
            A+ VKL   W+SP  LRV W L +K I+Y+ + EDL NKS  LL YNPVHKKIPVL+H+G
Sbjct  3    ADSVKLLGCWASPAALRVKWTLKLKEIEYQYVEEDLQNKSPLLLHYNPVHKKIPVLVHDG  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KP+ ESL+ILEYIE+TW   P+LP+ P +RA  RFWAKF E+K  PSI S++  KG+E+E
Sbjct  63   KPVAESLIILEYIEETWMQNPILPEDPYERAQARFWAKFVEEKCGPSIMSAFTKKGEEKE  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            +G  +A +NLK++E  L GGK+FFGG++IGF+DI  GW+     + EEI  + LID E  
Sbjct  123  KGAKEARENLKILESGL-GGKQFFGGESIGFVDIAAGWIGLWARIVEEIAEVNLIDTETM  181

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMI  218
            P+L+ W       P + +  PP+D ++
Sbjct  182  PLLNAWFGRVLEFPILKECLPPQDILL  208



>ref|XP_010278876.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=225

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 142/209 (68%), Gaps = 1/209 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            E+KL+  W SP+  RV  AL +K IQYE   EDL NKS  LL+Y+PVHKKIPVL+H+GKP
Sbjct  5    ELKLFGAWFSPFSFRVKLALKLKGIQYEYAEEDLQNKSPELLKYSPVHKKIPVLVHDGKP  64

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESL+ILEYI++TW   PLLP+ P +RA +RFW  F E+K + ++R + F +G +QE+ 
Sbjct  65   IVESLIILEYIDETWKQNPLLPEDPYERAMVRFWVTFAEEKFIEALRRALFSEGTKQEKE  124

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V Q  + L+++E +L  GK+FFGG+ IGFLDI L W+     V EE+   K+ D+ KFP 
Sbjct  125  VKQIAEALEILERELK-GKKFFGGETIGFLDIALSWVPAWLGVMEEVASFKVFDSNKFPC  183

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
              EWM NF       + +PPRD+++  FQ
Sbjct  184  FKEWMDNFQEFSITKETFPPRDELLVFFQ  212



>ref|XP_004978487.1| PREDICTED: glutathione transferase GST 23-like [Setaria italica]
Length=231

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 154/217 (71%), Gaps = 3/217 (1%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            ++VKL+  W SPY L+V+WAL IK ++Y+ I EDL+NKS  LL YNPVHKK+PVL++ GK
Sbjct  9    KQVKLFGFWPSPYVLKVIWALRIKGVEYDYIEEDLSNKSDQLLEYNPVHKKVPVLVYQGK  68

Query  655  PICESLVILEYIEDTWHN--TPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            PI ES VI+++I++ W +   P+LP+ P +RA  RFW +F +DKL P I   +  +G++Q
Sbjct  69   PIAESEVIIQFIDEAWKDRGDPILPEDPYERAMARFWVRFLQDKLSPPIWKWFTTQGQQQ  128

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+    A+D L ++E++L+ GKRFF G+ IGF+D+ LG L+ +  ++EEITG+K+I  EK
Sbjct  129  EDAHGAAIDQLLVLEKELD-GKRFFAGEKIGFVDLSLGPLSYVIPIYEEITGVKMITEEK  187

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
             P LS WM NF + P + DH PP DK+  + QAI  A
Sbjct  188  LPSLSAWMGNFLSSPVVKDHLPPLDKLRLRLQAIREA  224



>ref|XP_008346920.1| PREDICTED: glutathione transferase GST 23-like [Malus domestica]
Length=246

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 153/241 (63%), Gaps = 28/241 (12%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL RTWSSP+ LR+VWAL +K   YETI EDL+NKS  LL+ NP HKK PVLLHNG  
Sbjct  3    EVKLLRTWSSPFXLRIVWALQLKGXPYETIYEDLSNKSPLLLQSNPXHKKXPVLLHNGNA  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDK-------------------  530
            + ESL+ILEY+++TW   PLLP+ PL+RA  RF A++ ++K                   
Sbjct  63   VVESLIILEYVDETWKENPLLPEDPLERATARFXARYXDEKXENALSDQFANFXSKLQIF  122

Query  529  --------LLPSIRSSYFMKGKEQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIV  374
                    +  SI  S+  +GKEQEE +V+A +NLK +EE+L  GK+FFGG+  G  DI 
Sbjct  123  GCIFXFSGVXXSIWESFTKEGKEQEEXIVKAKENLKYLEEELK-GKKFFGGEKXGXXDIA  181

Query  373  LGWLANLPSVFEEITGLKLIDAEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFN  194
            LGWLA   S+ E+I G+K++  E+FP+LS W   F + P I D WP  DK+I K  AI +
Sbjct  182  LGWLAYYESLXEDIXGMKVVTXEEFPLLSAWAATFADVPIIKDXWPSXDKLIXKXXAIRD  241

Query  193  A  191
            +
Sbjct  242  S  242



>ref|XP_010279423.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=223

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 147/210 (70%), Gaps = 1/210 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVK+  +  S +  R+ WAL ++ I+YE + EDL NKS  LL+YNPVHKK+PV LHNG+P
Sbjct  3    EVKVVGSSPSLFCYRIEWALKLQGIEYEYLKEDLRNKSPLLLKYNPVHKKVPVFLHNGRP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYI++TW N PLLP+ P +RA  RFWAKF ++K L    ++   +G E+E+ 
Sbjct  63   IAESLVILEYIDETWKNNPLLPEDPHERALARFWAKFGDEKCLMGAWAALCAEGPEKEKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V  A++ L  +E+Q+  GK+FFGG  IGFLD+V+GW+ +   V +E+ G+KL DAE+FP 
Sbjct  123  VETAMETLNYLEKQIE-GKKFFGGKTIGFLDLVIGWIPHWLDVLDEVGGMKLFDAERFPC  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            L EW  NF   P I D  PPRD+M+  FQ+
Sbjct  182  LHEWAQNFIQIPIIKDCHPPRDEMVAYFQS  211



>ref|XP_004299558.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=224

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 151/208 (73%), Gaps = 1/208 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL  T  S    R+ WAL +K ++YE I EDL NKS  L +YNPVHKK+PVL+H+ KP
Sbjct  3    EVKLLGTTQSFPCARIQWALKLKGVEYEFIEEDLGNKSSLLRKYNPVHKKVPVLVHHDKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYI++TW + PLLPQ P D+A  RFWAKF ++K+L ++  ++  +G+E+E+ 
Sbjct  63   IAESLVILEYIDETWKDNPLLPQDPYDKAVARFWAKFADEKVLIAVWGAFTAEGEEKEKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +  AL+ L  +E+Q+  GK+FFGG+ IG+ D+V+GWL+   +V EE+ G+KL++AE+FP+
Sbjct  123  IKSALEPLAYLEQQIE-GKKFFGGEKIGYFDLVVGWLSQWLNVMEEVGGMKLLEAERFPL  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKF  209
            L EW  NF   PAI +  PPR+K++  F
Sbjct  182  LHEWGQNFIQAPAIRECIPPREKLVEYF  209



>ref|XP_010264127.1| PREDICTED: uncharacterized protein LOC104602212 [Nelumbo nucifera]
Length=453

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 151/218 (69%), Gaps = 2/218 (1%)
 Frame = -2

Query  859  LAITVAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKI  680
            L I ++M EEVKL+ T+ S +  RV+WAL +K + YE I EDL+NKS  LL+YNPVHKKI
Sbjct  224  LHIDISM-EEVKLFGTFPSAFSYRVIWALKLKGVPYEYIEEDLSNKSPLLLQYNPVHKKI  282

Query  679  PVLLHNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYF  500
            PVL+H GKPI ES+VI+EYIE+TW + PLLP+ P DRA  RFW KF EDK  P   + + 
Sbjct  283  PVLVHRGKPIAESMVIVEYIEETWPDHPLLPKDPYDRAMARFWTKFGEDK-GPIFHAFFR  341

Query  499  MKGKEQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLK  320
              G+EQE+ V +A++ L+ IEE   G K+FFGGD IG  DI  GW+A+   V EE  G+K
Sbjct  342  TVGEEQEKAVKEAVEVLRTIEEHGLGEKKFFGGDTIGLPDIGFGWIAHWLEVLEEAAGVK  401

Query  319  LIDAEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            L++A  FP L  WM NF   PAI D+ P RDKM+  F+
Sbjct  402  LVEAHAFPRLCSWMENFKQVPAIKDNLPDRDKMLAYFR  439


 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 143/210 (68%), Gaps = 1/210 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL   + SPY  RV+WAL +K +QYE + ED+ NKS  LL+YNPVHKKIPVL+H+GK
Sbjct  2    EEVKLLGAFPSPYSYRVIWALKLKGVQYEYVEEDVFNKSPSLLQYNPVHKKIPVLVHHGK  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            P+ ES+VI+EYIE TW   PLLP+ P +RA  RFW KF EDK  P  R+     G+E E+
Sbjct  62   PLAESMVIVEYIEQTWPGHPLLPEDPYERAMARFWTKFGEDK-GPIFRAFLQAVGEEHEK  120

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             V +AL  L+ IEE   G K+FFGGD+IG  DI  GW+A+   V EE  G+KL++A+ FP
Sbjct  121  AVEEALQVLRTIEEHGLGEKKFFGGDSIGLADIGFGWIAHWLEVMEEAIGVKLVEAQSFP  180

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
             L  W  NF   PAI ++ P RDKM+  F+
Sbjct  181  RLCSWKENFKQVPAIKENLPDRDKMLAFFR  210



>ref|XP_010923032.1| PREDICTED: probable glutathione S-transferase [Elaeis guineensis]
Length=222

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 145/204 (71%), Gaps = 1/204 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+  WSSP+  RV WAL IK I+YE I EDL NKS  LL Y+P++K++PVLLH+GKP
Sbjct  2    EVKLFGAWSSPFVRRVEWALKIKGIKYEYIEEDLYNKSPSLLTYSPINKQVPVLLHDGKP  61

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ES+VI+EYI+DTW   PLLP  P  R+  RFW+++ EDK   S++ ++F +G+EQ+  
Sbjct  62   IIESMVIIEYIDDTWKQKPLLPIDPYQRSMARFWSQYVEDKFYESVKRAFFTEGEEQKAA  121

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V  A++ LK +E++L  GK+FF G+ IGF+D+V GW+A+   V EE+  +K++D E FP 
Sbjct  122  VESAVEALKPLEQELK-GKKFFCGEEIGFVDLVAGWIAHWLEVVEEVLCIKVVDPENFPS  180

Query  292  LSEWMHNFYNHPAILDHWPPRDKM  221
            L  WM NF   P I ++ P RD+M
Sbjct  181  LCAWMKNFVEVPVIKENLPARDQM  204



>ref|XP_010279542.1| PREDICTED: probable glutathione S-transferase isoform X3 [Nelumbo 
nucifera]
Length=227

 Score =   220 bits (560),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 146/213 (69%), Gaps = 0/213 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EEVKL   W SP  LRV  AL +K ++YE I EDL+NKS  LL+YNP+HKK+PVLLHN
Sbjct  1    MTEEVKLIGAWVSPVSLRVELALKLKGVKYEYIDEDLSNKSPLLLKYNPIHKKVPVLLHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ES VILEYI++TW    LLP+ P +RA  RFW KF ++K   ++  + + +  EQ
Sbjct  61   GKPIAESAVILEYIDETWKGYQLLPEDPYERAVTRFWVKFIDEKCNATLWRACWSEASEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ + +A +NLK++E +L  GK+FFGGDNIG +DI   ++A    V +E+ G+ L+D EK
Sbjct  121  EKAIEEARENLKILENELKKGKKFFGGDNIGSVDIAAIYIAFWVGVLQEVVGISLMDEEK  180

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            FPVL +W+  F N   + ++ PPRDK+   +Q 
Sbjct  181  FPVLHKWIEEFINCDVVKENLPPRDKLFAYYQG  213



>gb|ADB11374.1| tau class glutathione transferase GSTU50 [Populus trichocarpa]
Length=219

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 143/211 (68%), Gaps = 1/211 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL  TW SP+  RV+WAL +K I YE I EDL+NKS  LL+ NPVHKKIPVL+H GK 
Sbjct  3    EVKLLGTWPSPFSYRVIWALKLKGIPYEYIEEDLSNKSPLLLQCNPVHKKIPVLIHGGKS  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            ICESLVILEY+E+TW   PL+P  P +RA  RFW KF EDK + ++   ++  G+EQE+ 
Sbjct  63   ICESLVILEYMEETWPQIPLMPDDPYERARARFWVKFVEDKGV-AVWIMFYSSGEEQEKA  121

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V  +L+ LK IEE   G KRFF GD I  +DI  GW+A    V EE+ G+KLI+ +KFP 
Sbjct  122  VKDSLEMLKTIEEHALGKKRFFCGDKISLVDIAYGWIAQWLEVLEEVAGIKLIEPQKFPR  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            L  W+ NF + P I ++ P  D+M+  F+ +
Sbjct  182  LHTWIKNFKDEPIIKENLPGHDEMLVYFKPL  212



>ref|XP_010279541.1| PREDICTED: probable glutathione S-transferase isoform X2 [Nelumbo 
nucifera]
Length=227

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 148/213 (69%), Gaps = 0/213 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EEVKL   W SP  LRV  AL +K ++YE I EDL+NKS  LL+YNP+HKK+PVLLHN
Sbjct  1    MTEEVKLIGAWVSPVSLRVELALKLKGVKYEYIDEDLSNKSPLLLKYNPIHKKVPVLLHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ES VILEYI++TW    LLP+ P +RA  RFW KF ++K + +I  + +++ ++Q
Sbjct  61   GKPIAESAVILEYIDETWKGYQLLPEDPYERAVTRFWVKFIDEKCIEAIWKACWIEERKQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ + +A + LK++E +L  G++FF GDNIGF+DI   ++A    V +E+ G+ L+D EK
Sbjct  121  EKAIEEAKETLKILENELKKGRKFFAGDNIGFVDIAAIFIAFWVGVLQEVVGISLMDEEK  180

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            FPVL +W+  F N   + ++ PPRDK+   +Q 
Sbjct  181  FPVLHKWIEEFINCDVVGENLPPRDKLFAYYQG  213



>ref|XP_007026865.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
 gb|EOY07367.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
Length=220

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 147/214 (69%), Gaps = 2/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDL-TNKSHHLLRYNPVHKKIPVLLH  665
            MAEEVK++  W SP+  RV  AL +K +QYE I ED+  NKS  LL+YNPVHKK+PVLLH
Sbjct  1    MAEEVKVFGAWGSPFSRRVELALQLKGVQYEYIEEDVHKNKSPLLLKYNPVHKKVPVLLH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            NGKPI ESLVILEYIE+TW   P+LP+ P DRA  RFWAKF ++K LP+I  + +    E
Sbjct  61   NGKPIAESLVILEYIEETWKGNPILPEDPYDRAMARFWAKFIDEKCLPAIWKAGWSPESE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            +E+ V +A + LK +E  L GGKRFFGGD +G +DI   ++     + +E+TG++L+ AE
Sbjct  121  REKPVEEACECLKTLESAL-GGKRFFGGDKVGMVDIAANFIGYWLRLIQEVTGMELLSAE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            KFP L +W   F +   +    PPRDK++  F+A
Sbjct  180  KFPELFKWTDEFVSCSVVKGSLPPRDKLLAFFKA  213



>ref|XP_002280532.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 156/225 (69%), Gaps = 4/225 (2%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EEVK+  +  S + +RV WAL +K ++YE I EDL NKS  LL+YNPVHKK+PVL+H 
Sbjct  1    MGEEVKVIGSILSGFCVRVEWALKLKGVEYEYIKEDLRNKSPMLLKYNPVHKKVPVLVHG  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
             KPI ESLVILEYI++TW + PLLP+ P +RA  RFWAK+ ++K L     ++  +G+E+
Sbjct  61   DKPIPESLVILEYIDETWKDNPLLPEDPYERAMARFWAKYADEKCLFGAWEAFKAEGEEK  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ +  AL++   +E+ +  GK+FFGG+ +GFLD+V+GW+ +  SV EE+ G+K++DAE+
Sbjct  121  EKAMESALESFAFLEKAIK-GKKFFGGEKMGFLDLVVGWIPHWLSVLEEVGGMKMLDAER  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFN---AIEANK  176
            FP L EW  NF   P I +  PPRD ++  F A  +   ++ ANK
Sbjct  180  FPSLHEWAENFIQIPLIKECIPPRDDLVNHFHASLSYVRSLSANK  224



>ref|XP_008219369.1| PREDICTED: glutathione transferase GST 23-like [Prunus mume]
Length=223

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 144/207 (70%), Gaps = 1/207 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
            A+ VKL   W+SP  LRV W L +K I+Y+ + EDL+NKS  LL+YNPVHKKIPVL+H G
Sbjct  3    ADSVKLLGNWASPSALRVKWTLKLKEIEYQYVEEDLSNKSPLLLQYNPVHKKIPVLVHGG  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KP+ ESLVILEYIE+TW   P+LP+ P +RA  RFWAKF ++K  PSI S++  KG+E+E
Sbjct  63   KPVAESLVILEYIEETWKPNPILPEDPYERAQARFWAKFVDEKCAPSIMSAFTKKGEEKE  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            +   +A +NL+++E  L GGK+FFGG++IGF+DI  GW+     + EEI  + LID E  
Sbjct  123  KVAKEARENLQILESGL-GGKQFFGGESIGFVDIAAGWIGLWARIVEEIAEVNLIDTETM  181

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMI  218
            P+L+ W       P + +  PP+D ++
Sbjct  182  PLLNAWFGRVLEFPILKECLPPQDILL  208



>ref|XP_007159485.1| hypothetical protein PHAVU_002G241400g [Phaseolus vulgaris]
 gb|ESW31479.1| hypothetical protein PHAVU_002G241400g [Phaseolus vulgaris]
Length=228

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 152/220 (69%), Gaps = 1/220 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
            +EEVK+   W SP+G+RV WAL +K I+YE I ED+ NKS+ LL+ NPVHKK+PVLLH  
Sbjct  3    SEEVKVVSFWVSPFGIRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLLHAH  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KPI ES +IL+YI++ W + PLLPQHP  RA + FWA F + KLL     +    G +QE
Sbjct  63   KPIAESFIILQYIDEIWKHYPLLPQHPYQRALVHFWANFGDQKLLDPSWIAMCSSGDDQE  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
              +  A ++++ IEE++  GK+FFGGDNIG+LDI LGW++    V+EE+  ++++D  KF
Sbjct  123  NALKVARESMEKIEEEIK-GKKFFGGDNIGYLDIALGWISYWLPVWEEVGSMQIMDPLKF  181

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            P  + W+ NF +HP I D+ PPRDKM+  F +   A+ ++
Sbjct  182  PATNAWITNFLSHPVIKDNLPPRDKMLVYFHSRRKALSSS  221



>gb|AFK47124.1| unknown [Lotus japonicus]
Length=221

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 156/221 (71%), Gaps = 4/221 (2%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EV+ +    SP+  RV  AL +K IQY  I EDL NKS  LL+YNPVHKK+PVL+HNGKP
Sbjct  3    EVQFFGVGGSPFARRVQIALKLKGIQYTYIEEDLRNKSEQLLKYNPVHKKVPVLVHNGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSI-RSSYFMKGKEQEE  476
            + ESLVILEYI++TW+N P+LPQ P +RA  RFW++F +DK+LP+I R+++    +E+E+
Sbjct  63   LAESLVILEYIDETWNNYPILPQQPYERALARFWSRFIDDKILPAISRAAWTANQEEREK  122

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
            G+ ++++ L+ +E++L    +FFGG+ IG +DI   +LA    V EE TG  L+ +EKFP
Sbjct  123  GIQESVEALQFLEKELK--HKFFGGETIGLVDIAGAFLAFWLPVIEESTGFSLLTSEKFP  180

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA-IEANK  176
             L +W  +F NHP + ++ PPRDK++  F+  + A I A+K
Sbjct  181  KLYKWSQDFINHPVVKENLPPRDKLLGFFKGRYAASINASK  221



>ref|XP_004299207.1| PREDICTED: glutathione transferase GST 23-like [Fragaria vesca 
subsp. vesca]
Length=222

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 144/218 (66%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MA++VKLY  WSSP+  RV+WAL +K I ++ I EDL  KS  LL+YNPVHKKIPVL+H 
Sbjct  1    MADQVKLYGDWSSPFSSRVIWALKLKGIPFDYIEEDLYKKSAELLKYNPVHKKIPVLVHG  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
             KPICES+VI+EYIE+TW   PLLP    +RA  RFWAKF +DK  P I  ++   G+E+
Sbjct  61   EKPICESMVIIEYIEETWPQNPLLPSDAHERAMARFWAKFADDK-GPEIWKAFVSSGEER  119

Query  481  EEGVVQALDNLKLIEEQLN-GGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            E+   +  + L+ IEE      K+FFGGDNIG  DI  GW A    V EE+ G+KL +A+
Sbjct  120  EKAKKETWEMLRTIEEHAGLENKKFFGGDNIGIADIAFGWFARWFGVIEEVAGVKLFEAD  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
             FP L  W++NF   P I ++ P RD ++ +F  + ++
Sbjct  180  AFPRLHAWINNFKEVPVIKENLPDRDNLVARFSKLSSS  217



>ref|XP_006433894.1| hypothetical protein CICLE_v10002406mg [Citrus clementina]
 gb|ESR47134.1| hypothetical protein CICLE_v10002406mg [Citrus clementina]
Length=222

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 143/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  841  MAEE-VKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLH  665
            MAEE VKL   W+SP+ LRV WAL +K + YE + E+L NKS  LLRYNPV+KKIPVL+H
Sbjct  1    MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            NGKP+ ESL+I+EYI++ W   PLLP+ P +RA+ RFWAKF ++K +P +  ++  KG+E
Sbjct  61   NGKPLAESLLIIEYIDEAWKQNPLLPEDPYERANARFWAKFFDEKCVPEVMGAFASKGEE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QE+   +A +NLK++E  L  GK FFGGD IGFLDI +GW+     + EEI G+ LIDAE
Sbjct  121  QEKA-AKARENLKMLERALE-GKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAE  178

Query  304  KFPVLSEWMHNFYNHPAI  251
              P+L+ W++NF   P I
Sbjct  179  TMPLLTAWLNNFLEVPVI  196



>gb|ADB11377.1| putative tau class glutathione transferase GSTU53 [Populus trichocarpa]
Length=219

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 143/211 (68%), Gaps = 1/211 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL  TW SP+  RV+WAL +K I YE I EDL+NKS  LL+ NPVHKKIPVL+H GK 
Sbjct  3    EVKLLGTWPSPFSYRVIWALKLKGIPYEYIEEDLSNKSPLLLQCNPVHKKIPVLIHGGKS  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            ICESLVILEY+E+TW   PL+P  P +RA  RFW KF EDK + ++   +   G+EQE+ 
Sbjct  63   ICESLVILEYMEETWPQIPLMPDDPYERARARFWVKFVEDKGV-AVWIMFHSSGEEQEKA  121

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V  +L+ LK IEE   G KRFF GD I  +DI  GW+A   +V EE+ G+KL++ +KFP 
Sbjct  122  VKDSLEMLKTIEEHALGKKRFFCGDKISLVDIAYGWIAQWLAVLEEVAGIKLMEPQKFPR  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            L  W+ NF + P I ++ P  D+M+  F+ +
Sbjct  182  LHTWIKNFKDEPIIKENLPGHDEMLVYFKPL  212



>ref|XP_010060069.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW66601.1| hypothetical protein EUGRSUZ_F00396 [Eucalyptus grandis]
Length=225

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 145/211 (69%), Gaps = 2/211 (1%)
 Frame = -2

Query  847  VAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNK-SHHLLRYNPVHKKIPVL  671
            +A   EVKL+  W SPY LRV+W L +K + Y+ + EDL NK S  LL+YNPVHKK+PVL
Sbjct  1    MADGGEVKLHGFWGSPYALRVIWTLKLKQVPYDYLEEDLPNKKSSLLLQYNPVHKKVPVL  60

Query  670  LHNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKG  491
            +H+GKPI ESLVILEYI++TW  +PLLPQ P +RA +RFWAKF ++K +P++++ +  +G
Sbjct  61   VHHGKPIPESLVILEYIDETWKQSPLLPQDPYERARVRFWAKFADEKCMPAMKAVFCTEG  120

Query  490  KEQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLID  311
            +EQ++ V++A + LK +E  L  GK FFGG+ I F D+  G++     + EEITG  LID
Sbjct  121  EEQQKAVLEARETLKTLESGLE-GKLFFGGETINFADVATGYIGCWARIVEEITGTTLID  179

Query  310  AEKFPVLSEWMHNFYNHPAILDHWPPRDKMI  218
            AE  P L  W   F   P I +  PP DK+I
Sbjct  180  AESMPSLDAWSKRFLELPVIKECVPPWDKLI  210



>gb|KDO81087.1| hypothetical protein CISIN_1g027498mg [Citrus sinensis]
Length=222

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 142/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  841  MAEE-VKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLH  665
            MAEE VKL   W+SP+ LRV WAL +K + YE + E+L NKS  LLRYNPV+KKIPVL+H
Sbjct  1    MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            NGKP+ ESL+I+EYI++ W   PLLP  P +RA+ RFWAKF ++K +P +  ++  KG+E
Sbjct  61   NGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QE+   +A +NLK++E  L  GK FFGGD IGFLDI +GW+     + EEI G+ LIDAE
Sbjct  121  QEKA-AKARENLKMLERALE-GKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAE  178

Query  304  KFPVLSEWMHNFYNHPAI  251
              P+L+ W++NF   P I
Sbjct  179  TMPLLTAWLNNFLEVPVI  196



>ref|XP_010243637.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=220

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 148/218 (68%), Gaps = 1/218 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+  WSSP+  RV+WAL +K ++YE I EDL+NKS  LL+YNPVHKK+PVL+HNGKP
Sbjct  3    EVKLFGNWSSPFVYRVIWALKLKGVEYEYIEEDLSNKSELLLKYNPVHKKVPVLVHNGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYI++TW   PLLP+    RA  RFWAKF EDK +  I   +   G+EQE+ 
Sbjct  63   IAESLVILEYIDETWPEHPLLPKDAQLRAEARFWAKFAEDKGI-CIWRFFSSVGEEQEKA  121

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
              ++L+ L+ IEE     K+FFGG  IGF D+  GW+++   V E+I G+KL++A+ FP 
Sbjct  122  KKESLEMLRTIEEHGLAEKKFFGGYTIGFADLAFGWISHWMGVMEDIVGVKLVEAQTFPH  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            L  W+HNF   P I ++ P  +KM  + + I   + A+
Sbjct  182  LHAWVHNFKQVPGIKENLPDPEKMFARLKCIREMLLAS  219



>ref|XP_007226235.1| hypothetical protein PRUPE_ppa017218mg [Prunus persica]
 gb|EMJ27434.1| hypothetical protein PRUPE_ppa017218mg [Prunus persica]
Length=224

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 146/217 (67%), Gaps = 4/217 (2%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLT-NKSHHLLRYNPVHKKIPVLLH  665
            MAE +KL+  W SP+  RV+WAL +K I YE I EDL   KS  LL+YNPVHKKIPVL+H
Sbjct  1    MAEVIKLHGAWPSPFSCRVIWALKLKGIPYENIEEDLPYRKSPELLKYNPVHKKIPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
              KPICES++I+EYIE+TW  TPLLP  P DRA  RFW KF +D + PSI   +   G+E
Sbjct  61   GVKPICESMIIIEYIEETWPETPLLPADPYDRAIARFWVKFADD-MGPSIWMVFRTTGEE  119

Query  484  QEEGVVQALDNLKLIEEQLN--GGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLID  311
            QE+   ++L+ LK IEE     G K+FFGGDNIG +DI  G +A+   V E++ G+KL +
Sbjct  120  QEKFKKESLEMLKTIEEHAGTLGKKKFFGGDNIGIVDIAFGGIAHWFGVIEDVVGVKLFE  179

Query  310  AEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            A+ FP L  W  NF   PAI D+ P RDK++  ++ +
Sbjct  180  AQVFPRLHAWTENFKQVPAIKDNLPDRDKLVVFYKQM  216



>ref|XP_007035122.1| Glutathione S-transferase tau 7 isoform 2, partial [Theobroma 
cacao]
 gb|EOY06048.1| Glutathione S-transferase tau 7 isoform 2, partial [Theobroma 
cacao]
Length=222

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 149/219 (68%), Gaps = 0/219 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL   W SP   RV WAL IK ++YE I ED+ NKS  L+  NPVHKK+PVL+H+GK
Sbjct  1    EEVKLLGFWVSPPVFRVKWALEIKGVKYEYIEEDIFNKSTLLMELNPVHKKVPVLVHDGK  60

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
             I ES VILEYI++TW   PLLPQ P  RA  RFWAKF E+K+L    ++   +G+E+++
Sbjct  61   AIAESFVILEYIDETWKQNPLLPQDPYQRALARFWAKFAEEKILRGAWNALCSQGEEKQK  120

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             + Q ++ ++ IE +L G ++FFGG+++G+LDI+LGW++    V+EE+  +++++  KFP
Sbjct  121  ALEQTIEAMEKIEGELEGKEQFFGGESVGYLDIILGWISYCLPVWEEVGSMQILNPLKFP  180

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
             ++ W++ F NHP + D  PP DKM+  F     A+ + 
Sbjct  181  AITAWINRFLNHPVVKDKLPPTDKMLVYFHQRSKALAST  219



>ref|XP_010938160.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=225

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 150/215 (70%), Gaps = 1/215 (0%)
 Frame = -2

Query  847  VAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLL  668
            +A   EVKL+  W+SP   RV WAL +K I+YE I ED++NKS  L++YNP++K++PVLL
Sbjct  1    MASGGEVKLFGMWASPAVRRVEWALKLKGIEYEYIEEDISNKSKDLVKYNPINKQVPVLL  60

Query  667  HNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGK  488
            HNGKPI ESLVI+EYI++ W + P+LP+ P +RA  RFWA + EDK   ++R  +F +G+
Sbjct  61   HNGKPIIESLVIIEYIDEVWKHNPILPKDPYERAMARFWATYSEDKCRGAVREVFFAEGE  120

Query  487  EQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA  308
            ++ + +    + L+ ++E+L  GK+FFGG+NIGF D+VLGW+A    V EE+   +++D 
Sbjct  121  KRVKAIKCLEETLRALDEELK-GKKFFGGENIGFSDLVLGWMAFWLGVSEEVASFEVLDP  179

Query  307  EKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            +KFP  + W+ NF   P I ++ PPRDK +  F +
Sbjct  180  KKFPWFTSWIDNFLKVPVIKENLPPRDKTVEFFHS  214



>ref|XP_009593034.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana tomentosiformis]
Length=225

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 147/221 (67%), Gaps = 2/221 (1%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
             E VKL   W+SPY LRV WAL +K ++Y+   EDL NKS  LL+YNPVHKKIPVL+HNG
Sbjct  3    GEGVKLLGYWASPYALRVHWALKLKGVEYDYQEEDLPNKSPLLLQYNPVHKKIPVLVHNG  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KPI ESLVILEYI++TW   PLLP+ P +RA  RFWAKF +DK +P I +++   G+EQ+
Sbjct  63   KPIAESLVILEYIDETWKQNPLLPEDPYERAKARFWAKFVDDKCVPGIFATFSKVGEEQQ  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            + V +A +NLKL+E +L+  KRFFG   IGF+D+   W+     + EEI  +KLIDAE+ 
Sbjct  123  KIVKEARENLKLLEGELD-KKRFFGDTRIGFIDVASAWIICWAQIVEEIIDIKLIDAEEM  181

Query  298  PVLSEWMHNFYNHPAILDHW-PPRDKMITKFQAIFNAIEAN  179
            P L  W  N      IL    PP+DK++   +  +  + A+
Sbjct  182  PSLVVWFQNILEAAPILKECTPPKDKLLEHNKGFYKMLVAS  222



>ref|XP_002532523.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29857.1| glutathione s-transferase, putative [Ricinus communis]
Length=227

 Score =   215 bits (548),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 148/208 (71%), Gaps = 1/208 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL  + +S +  R+ WAL +K + YE + EDL NKS  LL+YNPVHKK+PVL+H   P
Sbjct  5    EVKLIGSETSVFCTRIEWALKLKGVDYENLKEDLMNKSPILLKYNPVHKKVPVLVHGENP  64

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            + ESLVILEYI++TW + PLLPQ P +RA  RFWAKF ++K L  +  + + +G+++E  
Sbjct  65   VAESLVILEYIDETWKHNPLLPQDPYERAMARFWAKFADEKCLYGMFDACWQEGEQKENA  124

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +  A+++L  +EEQ+  GK+FF G+ IG+LDIV+GW+ +  +V EE+  +KL+D+EKFP 
Sbjct  125  IASAMESLAFLEEQIK-GKKFFNGEKIGYLDIVIGWIPHWLNVMEEVGAMKLVDSEKFPS  183

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKF  209
            LSEW+ +F   P I +  PPRD+++  F
Sbjct  184  LSEWVQSFNEVPLIQECLPPRDQIVDYF  211



>ref|XP_007035120.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOY06046.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=248

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 152/224 (68%), Gaps = 0/224 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
             +EVKL   W SP+  RV WAL IK ++YE I ED+ NKS  L+  NPV KK+PVL+H+G
Sbjct  25   TKEVKLLGFWVSPFVFRVEWALKIKGVKYEYIEEDIFNKSTLLMELNPVRKKVPVLVHDG  84

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            K I ES VILEYI++TW   PLLPQ P  RA  RFWAKF E+K+L    ++   +G+E++
Sbjct  85   KVIAESFVILEYIDETWKQNPLLPQDPYQRALARFWAKFAEEKILEGAWNALCSQGEEKQ  144

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            + + Q ++ ++ IE +L G ++FFGG+++G+LDI+LGW++    V+EE+  +++++  KF
Sbjct  145  KALRQTIEAMEKIEGELEGKQQFFGGESVGYLDIILGWISYWLPVWEEVGSMEILNPIKF  204

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK*TV  167
            P ++ W+++F NHP I D  PP DKM+  F     A+ +   +V
Sbjct  205  PAITAWINSFLNHPVIKDKLPPTDKMLVYFHQRSEALASTSQSV  248



>ref|XP_007035121.1| Glutathione S-transferase tau 7 isoform 1 [Theobroma cacao]
 gb|EOY06047.1| Glutathione S-transferase tau 7 isoform 1 [Theobroma cacao]
Length=241

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 149/220 (68%), Gaps = 0/220 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
             EEVKL   W SP   RV WAL IK ++YE I ED+ NKS  L+  NPVHKK+PVL+H+G
Sbjct  3    TEEVKLLGFWVSPPVFRVKWALEIKGVKYEYIEEDIFNKSTLLMELNPVHKKVPVLVHDG  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            K I ES VILEYI++TW   PLLPQ P  RA  RFWAKF E+K+L    ++   +G+E++
Sbjct  63   KAIAESFVILEYIDETWKQNPLLPQDPYQRALARFWAKFAEEKILRGAWNALCSQGEEKQ  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            + + Q ++ ++ IE +L G ++FFGG+++G+LDI+LGW++    V+EE+  +++++  KF
Sbjct  123  KALEQTIEAMEKIEGELEGKEQFFGGESVGYLDIILGWISYCLPVWEEVGSMQILNPLKF  182

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            P ++ W++ F NHP + D  PP DKM+  F     A+ + 
Sbjct  183  PAITAWINRFLNHPVVKDKLPPTDKMLVYFHQRSKALAST  222



>ref|XP_002532525.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29859.1| glutathione s-transferase, putative [Ricinus communis]
Length=224

 Score =   214 bits (546),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 146/210 (70%), Gaps = 1/210 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVK+  +++S +  RV WAL IK ++YE + EDL NKS  LL+ NPVHKK+PVL+H  KP
Sbjct  3    EVKVIGSYTSLFCTRVEWALKIKGVEYEYLKEDLRNKSPILLKVNPVHKKVPVLVHEEKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYI++TW+  PL PQ P +RA  RFWAKF +DK L     + + +G+E+E+ 
Sbjct  63   IAESLVILEYIDETWNKNPLFPQDPYERAMARFWAKFADDKCLYGAFHACWKEGEEKEKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +  A+++  ++EEQ+  GK+FF G+ IG+LD+ LGW+    +V EE+ G+KL+DAEKFP 
Sbjct  123  IESAMESFAMLEEQIK-GKKFFNGEQIGYLDLALGWIPYWLNVMEEVGGMKLVDAEKFPS  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            L EW  +F   P I +  PPRD+++  F  
Sbjct  182  LHEWTQSFIEIPLIKECLPPRDQLVNYFTG  211



>ref|XP_007026863.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
 gb|EOY07365.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
Length=228

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 145/218 (67%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILED-LTNKSHHLLRYNPVHKKIPVLLH  665
            MAEEVK++  W SP+  RV  AL +K +QYE I ED L NKS  LL+YNPVHKKIPVLLH
Sbjct  1    MAEEVKVFGAWGSPFSRRVELALQLKGVQYEYIEEDVLKNKSPLLLKYNPVHKKIPVLLH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            NGKPI ESLVILEYIE+TW   P+LP+ P D+A  RFWA F ++K LP +R + + +  E
Sbjct  61   NGKPIAESLVILEYIEETWKGNPILPEDPYDKAMARFWANFVDEKCLPVLRKAGWSQESE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            +E+ V +A + LK +E  L  GKRFFGGD +G +DI   ++     V +E TG++++ AE
Sbjct  121  REKVVEEACECLKTLESALR-GKRFFGGDTVGMVDIAANFIGYWLRVIQEATGMEVLSAE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            KFP L +W   F +   +    PPRDK++   +A   A
Sbjct  180  KFPELFKWTDEFVSCSIVKGSLPPRDKLLAFVKARIAA  217



>ref|XP_009372270.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=228

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 143/216 (66%), Gaps = 3/216 (1%)
 Frame = -2

Query  850  TVAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVL  671
            T    EEVKL+  W SPY  RV+WAL +K ++YE I EDL NKS  LL YNPVHKKIPVL
Sbjct  4    TQQETEEVKLFGAWPSPYSSRVIWALELKGVKYEYIEEDLANKSDLLLHYNPVHKKIPVL  63

Query  670  LHNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-  494
            +HNGKPI ES VILEYIE+TW   PLL   P +RA  RFW KF ++K +P  +  +FM  
Sbjct  64   VHNGKPIAESSVILEYIEETWPQNPLLSDDPHERALARFWTKFIDEKSVPFAK--FFMAD  121

Query  493  GKEQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLI  314
            G+E E+   +  D LK++EEQ  G K FFGG+ IG  D+ LG++A+   V E++ G+K++
Sbjct  122  GEEHEKAAKEVRDLLKILEEQALGEKEFFGGNEIGLADLALGFIASSFGVIEQVVGVKVL  181

Query  313  DAEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
             A +FP L  W++NF  +PAI     P D+M   ++
Sbjct  182  QASEFPCLCNWINNFRENPAIKKSLQPVDQMFVYYK  217



>gb|AFK41941.1| unknown [Lotus japonicus]
Length=228

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 143/212 (67%), Gaps = 1/212 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
            +++VKL  +W SP+  RV WAL +K ++YE + ED+ NKS  LL  NPVHKKIPVL+H  
Sbjct  3    SQDVKLLSSWPSPFSERVEWALKLKGVEYEYVEEDIFNKSSLLLELNPVHKKIPVLVHGH  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            K I ES +I+EYI++TW   PLLP  P +RA  RFWA F E KLL ++  +  + G EQE
Sbjct  63   KTIAESFIIIEYIDETWKQYPLLPHDPYERALARFWANFTEQKLLETVFVAMCITGDEQE  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            + + +A + ++ IEE +  GKRFFGG+NIG+LDI +GW++    ++EE+  + +ID  KF
Sbjct  123  KALNEAREAMEKIEEVIE-GKRFFGGENIGYLDIAVGWISYWIHIWEEVGSIHIIDPLKF  181

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            P  + WM NF +HP I D  PPRDKMI  F  
Sbjct  182  PATTAWMTNFLSHPVIKDTLPPRDKMIDYFHG  213



>ref|XP_008781207.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
 ref|XP_008781208.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=225

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 154/222 (69%), Gaps = 1/222 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVK++  W+SP+  RV  AL +K + YE I EDL+NKS  LL YNPVHKK+PVL+H 
Sbjct  1    MAEEVKVFGHWTSPFSCRVGIALRLKGVPYEYIEEDLSNKSSLLLEYNPVHKKVPVLVHG  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            G+PI ESLV+LEYIE+TW   P+LPQ P  RA  RFW KF ++K +P +  S + +G+ Q
Sbjct  61   GRPIAESLVVLEYIEETWRGNPMLPQDPHRRAMARFWTKFVDEKCMPIMWKSLWSEGEMQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            ++ + +  +NL ++E +L+ GK+FFGG++IG +DI   +L+    V +E+ G+ L + EK
Sbjct  121  QKLMEETNENLSILERELD-GKKFFGGNSIGLVDIAANFLSYWTEVLQEVAGISLFNEEK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
             P+L +W + F +  A+ +  PP+D++++ FQA+  A+ A K
Sbjct  180  HPILFKWANEFMSSDAVKECLPPKDELLSHFQAMKEAMSATK  221



>gb|ADB11358.1| tau class glutathione transferase GSTU26 [Populus trichocarpa]
Length=225

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 150/217 (69%), Gaps = 0/217 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVK+  +  S +  RV WAL +K ++YE + ED+ NKS  LL++NPVHKK+PVL+H+ KP
Sbjct  3    EVKVIGSSKSLFCARVEWALKLKGVEYEYLQEDIWNKSPLLLKHNPVHKKVPVLVHDDKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYI++TW + PLLP+ P +RA  RFWAKF E+K L    ++++ +G+E+E+ 
Sbjct  63   IAESLVILEYIDETWKDYPLLPEDPYERAMARFWAKFAEEKCLMGAFAAFWKEGEEKEKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +  AL++   +E+Q+ G K F G DNIG+LD+V+GW+    +V EE  G+KL+DA+KFP 
Sbjct  123  IESALESFTFLEKQIQGKKFFSGDDNIGYLDLVMGWIPLWLNVMEEAGGMKLMDAQKFPF  182

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEA  182
            L EW  NF   P I +  PPRD ++  F  + + I +
Sbjct  183  LHEWTQNFIEIPLIKECLPPRDALVNYFILVMSYIRS  219



>ref|XP_007034526.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOY05452.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=220

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 141/219 (64%), Gaps = 1/219 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL   W SP+  RVVWAL +K I YE I EDL NKS  LL+YNPVHKKIPVLLH GKP
Sbjct  3    EVKLLAAWPSPFYYRVVWALKLKGIAYEFIEEDLANKSPLLLQYNPVHKKIPVLLHGGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            ICES++ILEYIE+ W    LLP +P DRA  RFW KF ++K  P+I   +   G+E E+ 
Sbjct  63   ICESMIILEYIEEIWPQNSLLPSYPYDRAIARFWIKFADEK-SPAIWMVFRTNGEEHEKA  121

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V  + + LK IEE   G K+FFGGD I  +DI  G LA    V E++TG+KL++A  FP 
Sbjct  122  VKDSFEMLKTIEEHALGEKKFFGGDKINMVDIAFGQLAYWLPVIEDVTGVKLLEAGNFPR  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
            L  W+ NF   P I ++ P RD+M   F+     I A+K
Sbjct  182  LQTWIKNFKQVPIIKENLPDRDEMFAFFKRRREMILASK  220



>ref|XP_009764523.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana sylvestris]
Length=226

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 140/212 (66%), Gaps = 1/212 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M E+VKL   + SPY  RV+WAL  K I YE I EDLTNKSH LL YNPV+K IPVL+H 
Sbjct  1    MEEQVKLLGAFPSPYSYRVIWALKHKGINYEYIEEDLTNKSHDLLTYNPVYKMIPVLVHA  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ES+VILEYIE+TW   PLLP+ P +RA  RFW KF EDK  P + + +   G+EQ
Sbjct  61   GKPIAESIVILEYIEETWPQNPLLPKDPHERAQARFWIKFGEDK-SPELFAIFHKIGEEQ  119

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
             +   +A + LK+IE+Q  G K+FFGGD IG  DIV GW+A    V +E   +K+ D+  
Sbjct  120  AKATEKAKEMLKIIEKQSLGEKKFFGGDTIGLTDIVFGWIALWLEVIQEAAEVKVFDSLS  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            FP L  W+HNF   P I ++ P RD M+  F+
Sbjct  180  FPRLHVWIHNFKQVPVIKENTPHRDAMLAYFK  211



>ref|XP_006472526.1| PREDICTED: glutathione transferase GST 23-like [Citrus sinensis]
Length=222

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 141/198 (71%), Gaps = 3/198 (2%)
 Frame = -2

Query  841  MAEE-VKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLH  665
            MAEE VKL   W+SP+ LRV WAL +K + YE + E+L NKS  LLRYNPV+KKIPVL+H
Sbjct  1    MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            NGKP+ ESL+I+EYI++ W   PLLP  P +RA+ R WAKF ++K +P +  ++  KG+E
Sbjct  61   NGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARLWAKFFDEKCVPEVMGAFASKGEE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            QE+   +A +NLK++E  L  GK FFGGD IGFLDI +GW+     + EEI G+ LIDAE
Sbjct  121  QEKA-AKARENLKMLERALE-GKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAE  178

Query  304  KFPVLSEWMHNFYNHPAI  251
              P+L+ W++NF   P I
Sbjct  179  TMPLLTAWLNNFLEVPVI  196



>ref|XP_002318530.2| hypothetical protein POPTR_0012s04770g [Populus trichocarpa]
 gb|EEE96750.2| hypothetical protein POPTR_0012s04770g [Populus trichocarpa]
Length=225

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 147/208 (71%), Gaps = 0/208 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVK+  +  S +  RV WAL +K ++YE + EDL NKS  LL++NPVHKK+PVL+H+ KP
Sbjct  3    EVKVIGSSKSLFCARVEWALKLKGVEYEYLQEDLWNKSTLLLKHNPVHKKVPVLVHDDKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYI++TW + PLLP+ P +RA  RFWAKF ++K L    ++++ +G+E+E+ 
Sbjct  63   IAESLVILEYIDETWKDYPLLPEDPYERAMARFWAKFADEKCLMGAFAAFWKEGEEKEKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +  AL++   +E+Q+ G K F G DNIG+LD+V+GW+    +V EE  G+KL+DA+KFP 
Sbjct  123  IESALESFTFLEKQIQGKKFFSGDDNIGYLDLVMGWIPLWLNVMEEAGGMKLMDAQKFPS  182

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKF  209
            L EW  NF   P I + +PPRD ++  F
Sbjct  183  LHEWTQNFIEIPLIKECFPPRDALVNYF  210



>ref|XP_011030495.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=229

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 148/214 (69%), Gaps = 1/214 (0%)
 Frame = -2

Query  847  VAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLL  668
            +A  E+VKL   W+SP+  RV WAL +K + YE I ED+ NKS  L+  NPVHKK+PVL+
Sbjct  1    MASTEQVKLLGFWASPFARRVEWALKLKGVDYEYIEEDIFNKSTLLMELNPVHKKVPVLV  60

Query  667  HNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGK  488
               K I ES VILE+I++TW   PL+PQ P +RA  RFWAKF E+K+L +   +    G+
Sbjct  61   RGRKVIAESFVILEFIDETWKQCPLMPQDPYERAMTRFWAKFAEEKILDAAWIAMCSLGE  120

Query  487  EQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA  308
            E+E+ +  A++ ++ IE +L  GK+FFGG+NIG+LDI +GW++    V+EE+  +K+++A
Sbjct  121  EKEKALKLAVEAMEKIEGELK-GKQFFGGENIGYLDIAMGWMSYWLPVWEEVGSMKIVNA  179

Query  307  EKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
             +FP  + WM+ F +HP I ++ PPRDKMI  FQ
Sbjct  180  LQFPATTSWMNKFLDHPVIKENLPPRDKMIIYFQ  213



>ref|XP_008793318.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=225

 Score =   213 bits (541),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 144/210 (69%), Gaps = 1/210 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+  W+SP   RV WAL +K I+YE + ED++NKS  L+RYNP++K++PVLLHNGKP
Sbjct  6    EVKLFGMWASPAVRRVEWALKLKGIKYEYVEEDISNKSGALVRYNPINKQVPVLLHNGKP  65

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYI++ W + P+LP+ P +RA  RFWA + EDK   ++R  +F +G E+ + 
Sbjct  66   IVESLVILEYIDEVWKHHPILPKDPYERAMARFWAAYSEDKCRDAVRRVFFAEGGERAKA  125

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +    + L+ ++ +L  GK FFGG+NIGF D+VLGW+A    V EE+   +++D +KFP 
Sbjct  126  IECLEETLRALDGELE-GKEFFGGENIGFSDLVLGWMAFWLGVSEEVASFEVLDPKKFPW  184

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
             + W+ NF   P I ++ PPRDK +  F  
Sbjct  185  FTSWIDNFLQVPVIKENLPPRDKTVAFFHG  214



>ref|NP_001234088.1| uncharacterized protein LOC543815 [Solanum lycopersicum]
 gb|AAG16758.1| putative glutathione S-transferase T3 [Solanum lycopersicum]
Length=225

 Score =   213 bits (541),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 143/208 (69%), Gaps = 2/208 (1%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
            +E+VKL   W+SP+ L+V WAL +K I+YE   EDL+NKS  LL+YNPVHKKIPVL+HNG
Sbjct  3    SEKVKLLGYWASPFALKVHWALKLKGIEYEYQEEDLSNKSPLLLQYNPVHKKIPVLVHNG  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KPI ESLVILEYIE+TW + PLLP+ P +RA  RFWAKF +DK +P I  ++   G EQ+
Sbjct  63   KPIAESLVILEYIEETWKHNPLLPEDPYERAKARFWAKFVDDKCVPGIFGTFAKVGVEQQ  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            +   +A +NLK++E++L G K FFG   IGF+D+   W+     + EE+  ++LIDAE+ 
Sbjct  123  KIAKEARENLKILEDEL-GKKHFFGDAKIGFMDVTSAWIICWAQIVEEVVDIRLIDAEEM  181

Query  298  PVLSEWMHNFYNHPAILDHW-PPRDKMI  218
            P L  W  N      IL    PP+DK++
Sbjct  182  PSLVSWFQNVLEAAPILKECTPPKDKLL  209



>ref|XP_008224069.1| PREDICTED: glutathione transferase GST 23-like [Prunus mume]
Length=240

 Score =   213 bits (542),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 150/225 (67%), Gaps = 4/225 (2%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MA+EVKL+  W+SP+  RV+WAL +K I Y+ I EDL NKS  LL+YNPVHKKIPVL+H 
Sbjct  17   MADEVKLHGVWNSPFSCRVIWALKLKGIPYDYIEEDLQNKSPELLKYNPVHKKIPVLVHG  76

Query  661  GKPICESLVILEYIEDTW-HNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
             +PICES++I+EYIE+TW    PLLP  P +RA  RFW K+ E+K + +I   +   G+E
Sbjct  77   ERPICESMIIVEYIEETWPQKYPLLPTDPYERAMARFWVKYFEEKSV-AIWMVFRTTGEE  135

Query  484  QEEGVVQALDNLKLIEEQLN--GGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLID  311
            QE+   ++L+ L+ IEE     G K+FFGGD IG +DI  GW+A    V E++ G+KL +
Sbjct  136  QEKFKKESLEMLRTIEEHAGNLGKKKFFGGDEIGIVDIAFGWIAQWFEVVEDVVGVKLFE  195

Query  310  AEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
            A  FP L  W  NF   P I ++ P RDKM+  F+++   + A++
Sbjct  196  AHAFPCLHAWTQNFKQVPVIKENLPDRDKMLVLFKSLREYLLASQ  240



>ref|XP_006378334.1| hypothetical protein POPTR_0010s08170g [Populus trichocarpa]
 gb|ADB11376.1| tau class glutathione transferase GSTU52 [Populus trichocarpa]
 gb|ERP56131.1| hypothetical protein POPTR_0010s08170g [Populus trichocarpa]
Length=229

 Score =   212 bits (540),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 146/214 (68%), Gaps = 1/214 (0%)
 Frame = -2

Query  847  VAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLL  668
            +A  E+VKL   W+SP+  RV WAL +K + YE I ED+ NKS  L+  NPVHKK+PVL+
Sbjct  1    MANTEQVKLLGFWASPFARRVEWALKLKGVDYEYIEEDIFNKSSLLMELNPVHKKVPVLV  60

Query  667  HNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGK  488
            H  K I ES VILE+I++TW   PL+PQ P +RA  RFWAKF E+K+L     +    G+
Sbjct  61   HGRKVIAESFVILEFIDETWKQCPLMPQDPYERAKTRFWAKFAEEKILDGAWIAMCSLGE  120

Query  487  EQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA  308
            E+E+ +  A++ ++ IE +L  GK FFGG+NIG+LDI +GW++    V+EE+  +K+++ 
Sbjct  121  EKEKAIKLAVEAIEKIEGELK-GKHFFGGENIGYLDIAMGWMSYWLPVWEEVGSMKIVNP  179

Query  307  EKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
             +FP  + WM+ F +HP I ++ PPRDKMI  FQ
Sbjct  180  LQFPATTSWMNKFLDHPVIKENLPPRDKMIIYFQ  213



>ref|XP_008346196.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
 ref|XP_008364332.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=221

 Score =   212 bits (539),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 142/220 (65%), Gaps = 1/220 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL+  W SPY  RVVWAL +K ++YE I EDL NKS  LL YNPVHK IPVL+HNGK
Sbjct  2    EEVKLFGAWHSPYSSRVVWALELKGVKYEYIEEDLANKSDLLLHYNPVHKXIPVLVHNGK  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ES VILEYIE+TW   PLL   P +RA  RFW KF ++K +P  +  +   G+E E+
Sbjct  62   PIAESSVILEYIEETWPQNPLLSNDPHERALARFWLKFIDEKSVPFAK-FFVADGEEHEK  120

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               +  D LK++EEQ  G K FFGG  IG  D+ LG++A+   V E++ G+K++ A +FP
Sbjct  121  AAKEVRDLLKILEEQALGEKEFFGGSEIGLADLALGFIASSVGVIEQVVGVKVLQASEFP  180

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
             L  W++NF  +PAI     P D+M   ++     I A++
Sbjct  181  CLCNWINNFRENPAIKKSLQPADQMFVNYKQKREMILASR  220



>ref|XP_008781341.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=231

 Score =   212 bits (540),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 145/209 (69%), Gaps = 1/209 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+  W+SP   RV WAL +K I+YE I EDL+NKS  LL YNP++K++PVLLHNGKP
Sbjct  7    EVKLFGMWASPAVRRVEWALKMKGIEYEYIEEDLSNKSASLLAYNPINKQVPVLLHNGKP  66

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVI+EYI++ W + P+LP+ P +R   RFW+ + E K   ++   YF +G+E+E  
Sbjct  67   IAESLVIIEYIDEVWKHNPILPEDPYERTKARFWSTYSEGKCRDAVGKGYFTEGEEKENA  126

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +    + +++++E+L  GK+FFGG+N+GF D+VLGW+A    V EE+   +++D++KFP 
Sbjct  127  IKYLEETVRVLDEELK-GKKFFGGENLGFSDLVLGWMAFWLPVAEEVAFFEVLDSKKFPW  185

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
             + W  NF   P I ++ PPRDK +  F+
Sbjct  186  FASWTDNFLEVPVIKENLPPRDKTVEFFE  214



>ref|XP_004292258.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 145/212 (68%), Gaps = 3/212 (1%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL+  W SPYG R +WAL +K ++YE I EDL+NKS  LL+YNP+HKKIPVL+HNGK
Sbjct  2    EEVKLFGAWPSPYGYRAIWALELKGVKYEYIEEDLSNKSDLLLQYNPIHKKIPVLVHNGK  61

Query  655  PICESLVILEYIEDTWHNTPLLP--QHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            PICES VILEYIE+TW   PLLP  + P  RA  RFW KF +DK LP        +G+E 
Sbjct  62   PICESTVILEYIEETWPENPLLPSLEDPHGRASARFWIKFIDDKALP-FAMLLMTEGEEL  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ V++  + L ++EEQ  G K+FFGG+ IG  D+ +G++A+   V EE+ G+++++ E+
Sbjct  121  EKEVIEVKEILNILEEQGLGEKKFFGGNEIGLADLAMGFIASSFRVIEELAGVRVLNIEE  180

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            FP L  W+  F  +PAI  + P  D+M   ++
Sbjct  181  FPGLCNWVKKFKENPAIKKNLPDPDQMFVYYK  212



>ref|XP_006354565.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Solanum 
tuberosum]
Length=225

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 140/208 (67%), Gaps = 2/208 (1%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
             E+VKL   W+SP  LRV WAL +K I+Y+   EDL NKS  LL+YNPVHKKIPVL+HNG
Sbjct  3    GEKVKLLGNWASPSALRVHWALKLKGIEYDYQEEDLRNKSPLLLQYNPVHKKIPVLVHNG  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KPI ESLVILEYIE+TW + PLLP+ P +RA  RFWAKF +DK +P I  ++   G+EQ+
Sbjct  63   KPIAESLVILEYIEETWKHNPLLPEDPYERAKARFWAKFVDDKCVPGIFGTFVKVGEEQQ  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            +   +A +NLK++E +L G K FFG   IGF+D+   W+     + EEI  +KLIDAE+ 
Sbjct  123  KIAKEARENLKILEGEL-GKKHFFGDTKIGFMDVASAWIICWAQIVEEIVDIKLIDAEEM  181

Query  298  PVLSEWMHNFYNHPAILDHW-PPRDKMI  218
            P L  W  N      IL    PP+DK++
Sbjct  182  PSLVSWFQNVLEAAPILKECTPPKDKLL  209



>ref|XP_006489728.1| PREDICTED: glutathione S-transferase U8-like [Citrus sinensis]
Length=227

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 151/222 (68%), Gaps = 2/222 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M  +VKL   W SP+  RVVWAL +K +++E I ED+ NKS  LL  NPVHKK+PVL+H+
Sbjct  1    MTTKVKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHD  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
             + I ES VILEYI++TW   PLLPQ P ++A  RFWAKF ++KLL S   + + KG+E+
Sbjct  61   KRVIVESFVILEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKLLESAYKAMWSKGEEK  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITG-LKLIDAE  305
            ++ + +A+++L+ IEE L GGK F GG++IG+LD+ +GW+     V+EE  G ++++D++
Sbjct  121  QKAMKEAVESLEKIEEVL-GGKNFMGGNSIGYLDLAIGWIGYWIPVWEEAGGSMRILDSQ  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            KFP ++EW   F  HP I ++ PPRD+ +         I AN
Sbjct  180  KFPAIAEWSAKFLKHPVIKENLPPRDRTLAYCHKRAEEIYAN  221



>emb|CDO99237.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 149/214 (70%), Gaps = 1/214 (0%)
 Frame = -2

Query  829  VKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKPI  650
            VKL   W SPY LRV WAL +K I+YE I ED+ NKS  LL+ NPV  ++PVL+H+GKPI
Sbjct  7    VKLLGFWVSPYVLRVKWALKLKGIEYEYIEEDVFNKSPLLLKLNPVKGQVPVLVHDGKPI  66

Query  649  CESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEGV  470
             ES+VILEYI++ W ++PLLPQ P +RA+ RFWAKF  +KL      +   +G++ E  +
Sbjct  67   PESIVILEYIDEVWKHSPLLPQDPYERANSRFWAKFAAEKLQAYAWEALCSRGEDHERAI  126

Query  469  VQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPVL  290
              +++ L+ +E++LN GK+FFGGD IGF+D+V G+++    V+EEI  +K++D+ KFP +
Sbjct  127  NASMEALEKMEKELN-GKKFFGGDKIGFVDLVAGFISYQLPVYEEIVSMKILDSSKFPAI  185

Query  289  SEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAI  188
            + W++NF NHP I +  PP+ KM+  F    N I
Sbjct  186  TNWINNFLNHPLIKEELPPKHKMLAYFSNRRNVI  219



>ref|XP_006376726.1| hypothetical protein POPTR_0012s04780g [Populus trichocarpa]
 gb|ERP54523.1| hypothetical protein POPTR_0012s04780g [Populus trichocarpa]
Length=225

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 145/208 (70%), Gaps = 0/208 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVK+  +  S +  RV WAL +K ++YE + EDL NKS  LL++NPVHKK+PVL+H+ KP
Sbjct  3    EVKVIGSSKSLFCARVEWALKLKGVEYEYLQEDLWNKSTLLLKHNPVHKKVPVLIHDDKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYI++TW + PLLP+ P +RA  RFWAKF ++K +     ++  +G+E+E+ 
Sbjct  63   IAESLVILEYIDETWKDYPLLPEDPYERAMARFWAKFADEKCVMGAFVAFLKEGEEKEKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +  AL++   +E+Q+ G K F G DNIG+LD+V+GW+ +  +  EE  G+KL+DA+KFP 
Sbjct  123  IESALESFTFLEKQIQGKKFFSGDDNIGYLDLVMGWIPHWLNAIEEAGGMKLMDAQKFPS  182

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKF  209
            L EW  NF   P I + +PPRD ++  F
Sbjct  183  LHEWTQNFIEIPLIKECFPPRDALVNYF  210



>ref|XP_007200430.1| hypothetical protein PRUPE_ppa011142mg [Prunus persica]
 gb|EMJ01629.1| hypothetical protein PRUPE_ppa011142mg [Prunus persica]
Length=222

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL+  W SPY  RV+WAL +K ++YE I EDL NKS  LL+YNPVHKKIPVL+HNGK
Sbjct  2    EEVKLFGAWPSPYSYRVIWALELKGVKYEYIEEDLANKSDLLLQYNPVHKKIPVLVHNGK  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKEQE  479
            PI ES VILEYI++TW   PLL   P +RA  RFW KF ++K LP   +++FM  G+E E
Sbjct  62   PIAESSVILEYIDETWPQNPLLSDDPHERALARFWTKFIDEKGLPF--ATFFMADGEEHE  119

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            +   +  D LK++EEQ  G K+FFGGD IG  D+ LG++A+   V E++ G+K++ A  F
Sbjct  120  KAAKEVKDLLKILEEQALGEKKFFGGDEIGLADLALGFIASSFGVIEQLVGVKVLHANDF  179

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            P L  W++NF  +PAI  +    D+M   ++
Sbjct  180  PRLCNWINNFKENPAIKQNLLNHDQMFVYYK  210



>gb|AGH14251.1| glutathione S-transferase [Musa acuminata AAA Group]
Length=224

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 151/225 (67%), Gaps = 1/225 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVK++R+W SP+  RV  AL +K + YE I EDL+NKS  LL YNPVHKK+PVLLH+
Sbjct  1    MAEEVKVFRSWGSPFSYRVELALRLKGVAYEYIEEDLSNKSTLLLEYNPVHKKVPVLLHH  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEYIE+TW   P+LP+ P +RA +RFW++F +DK   ++  S + +G+ Q
Sbjct  61   GKPIAESLVILEYIEETWQENPILPKDPRERAVVRFWSRFLDDKCSLALWMSCWTEGETQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            +  + QA      + E+   GK+FFGGD+IG +DI   ++A+   V EE+ G+ L+D EK
Sbjct  121  QNFMEQA-KECLHLLEEELKGKKFFGGDSIGMVDIAASFIAHWLGVLEEVAGISLLDEEK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK*TV  167
            +P L +W   F    A+++  P R  ++  FQA  +AI A K +V
Sbjct  180  YPNLCKWTEEFLKSDAVMECLPKRANLLAFFQARKHAISATKASV  224



>ref|XP_010243633.1| PREDICTED: glutathione transferase GST 23-like [Nelumbo nucifera]
Length=224

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 143/208 (69%), Gaps = 2/208 (1%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            E+VKL+  + SP+  RV+WAL +K +Q+E + EDL+NKS  LL YNPVHKK+PVL+H G 
Sbjct  2    EQVKLFGAFPSPFVYRVIWALKLKGVQFEYMEEDLSNKSALLLEYNPVHKKVPVLVHGGV  61

Query  655  PICESLVILEYIEDTWHNT-PLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            PI ES+VILEYIE+TW N  PLLPQ P  RA  RFW K+ EDK   +  + ++  G+EQE
Sbjct  62   PIAESIVILEYIEETWPNDHPLLPQDPYGRAQARFWIKYLEDK-QATFFAVFWSVGEEQE  120

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            + + +A + LK IEE+  G K+FFGG+ +G +DI  GWLA+     EE+TG+KL++A  F
Sbjct  121  KALKEAPEVLKTIEERALGEKKFFGGETVGMVDIAFGWLAHWIGPMEELTGVKLVEAHAF  180

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMIT  215
            P L  WM NF   P I D+ P R +M+ 
Sbjct  181  PRLHAWMENFKEVPEIRDNLPDRHRMLA  208



>ref|XP_009399930.1| PREDICTED: probable glutathione S-transferase [Musa acuminata 
subsp. malaccensis]
Length=224

 Score =   211 bits (536),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 150/225 (67%), Gaps = 1/225 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVK++R+W SP+  RV  AL +K + YE I EDL+NKS  LL YNPVHKK+PVLLH+
Sbjct  1    MAEEVKVFRSWGSPFSYRVELALRLKGVAYEYIEEDLSNKSTLLLEYNPVHKKVPVLLHH  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEYIE+TW   P+LP+ P +RA  RFW++F +DK   ++  S + +G+ Q
Sbjct  61   GKPIAESLVILEYIEETWQENPILPKDPRERAVARFWSRFLDDKCSLALWMSCWTEGETQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            +  + QA      + E+   GK+FFGGD+IG +DI   ++A+   V EE+ G+ L+D EK
Sbjct  121  QNFMEQA-KECLHLLEEELKGKKFFGGDSIGMVDIAASFIAHWLGVLEEVAGISLLDEEK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK*TV  167
            +P L +W   F    A+++  P R  ++  FQA  +AI A K +V
Sbjct  180  YPNLCKWTEEFLKSDAVMECLPKRANLLAFFQARKHAISATKASV  224



>ref|XP_007134772.1| hypothetical protein PHAVU_010G074600g [Phaseolus vulgaris]
 gb|ESW06766.1| hypothetical protein PHAVU_010G074600g [Phaseolus vulgaris]
Length=224

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 155/220 (70%), Gaps = 3/220 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            +V+L+    SPY +RV  AL +K IQY    EDL NKS  LL+YNP+HKK+PVL+HNG+P
Sbjct  7    DVELFGVRGSPYAVRVQIALELKGIQYTYFEEDLRNKSDLLLKYNPIHKKVPVLVHNGRP  66

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSI-RSSYFMKGKEQEE  476
            + ESLVILEYI++TW N P+ PQ P  RA  RFW++F +DK LP+I ++++    +E+++
Sbjct  67   LAESLVILEYIDETWGNHPIFPQQPYHRALARFWSRFIDDKCLPAILKAAFTANEEERQK  126

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
            G  ++LD L+++E++L   ++FFGG++IG +DI  G++A      EE  GLKL+ ++KFP
Sbjct  127  GTEESLDALQILEDELK--QKFFGGESIGLVDIAAGFIAFWLPAIEEAVGLKLLISQKFP  184

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
             LS+W   + NHP + +  P R++++  F+A + +I A+K
Sbjct  185  KLSKWSEEYTNHPVVKESLPQRERVVGFFKARYASIIASK  224



>ref|XP_010271919.1| PREDICTED: glutathione transferase GST 23-like [Nelumbo nucifera]
Length=223

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 140/212 (66%), Gaps = 1/212 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
             ++V L   W+SP  LR+ WAL IK I YE I EDL NKS  LL  NPVHKK+PVL+H G
Sbjct  3    TDQVTLLGMWASPLSLRIEWALKIKGIHYEYIDEDLDNKSQRLLTCNPVHKKVPVLVHAG  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KPI ESLVILEYI++TW ++ +LP+ P +RA  RFWAKF +DK   +I   +   G+EQE
Sbjct  63   KPIAESLVILEYIDETWSHSRILPEDPYERAMARFWAKFADDKCWTTIHGVFTKTGQEQE  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
                +A+++LK + E++    +FFGGD IGFLDIV GW+A    + EEITG+ L+  +  
Sbjct  123  NAKSEAIESLKTL-EKIPRESKFFGGDAIGFLDIVFGWMAYWVPLLEEITGIILVGEDSL  181

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            P L EW  NF + P + +  PPR+K++   Q 
Sbjct  182  PSLKEWFKNFLDVPLVKELLPPREKLLHHLQT  213



>ref|XP_008224066.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=224

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 144/217 (66%), Gaps = 4/217 (2%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLT-NKSHHLLRYNPVHKKIPVLLH  665
            MAE +KL+  W SP+  RV+WAL +K I YE I EDL   KS  LL+YNPVHKKIPVL+H
Sbjct  1    MAEVIKLHGAWPSPFSCRVIWALKLKGIPYENIEEDLPYRKSPELLKYNPVHKKIPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
              KPICES++I+EYIE+TW  TPLLP  P DRA  RFW KF +DK  PSI   +   G+E
Sbjct  61   GEKPICESMIIIEYIEETWPETPLLPADPYDRAIARFWVKFADDK-GPSIWMVFRTTGEE  119

Query  484  QEEGVVQALDNLKLIEEQLN--GGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLID  311
            Q +   ++L+ LK IEE     G K+FFGG+NIG +DI  G +A+   V E++ G+KL +
Sbjct  120  QVKFKKESLEMLKTIEEHAGTLGKKKFFGGNNIGIVDIAFGGIAHWFGVIEDVVGVKLFE  179

Query  310  AEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            A+ FP L  W  NF   PAI +  P RDK++  ++ +
Sbjct  180  AQVFPRLHAWTENFKQVPAIKESLPDRDKLVVFYKQM  216



>ref|XP_008382674.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=223

 Score =   210 bits (534),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 145/211 (69%), Gaps = 2/211 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILED-LTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EVKL   W SP+  RV+WAL +K +++E + ED L NKS  LL+YNPVHKKIPV +HNGK
Sbjct  3    EVKLLGAWPSPFVQRVIWALKLKGVEFENVEEDVLFNKSDELLKYNPVHKKIPVFVHNGK  62

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            P+ ES+VILEYI++ W + PLLP+ P  RA  RFWAKF EDK     R  +F+ G+EQ +
Sbjct  63   PVAESIVILEYIDEAWPHNPLLPKDPHLRAEARFWAKFGEDKDR-XFRGFFFVTGEEQVK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             V ++ +NLK++EE   G K+FFGG+ IG +D+  GW+A    V+EE+ G+K+ +A++FP
Sbjct  122  AVKESQENLKILEEHGLGNKKFFGGEEIGLVDLAFGWIACWLEVWEEVAGVKVFEADRFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
             L  W+  F   P I ++ P R  ++T F++
Sbjct  182  RLQAWIQRFREVPTIKENLPDRTALLTFFKS  212



>gb|AJE59670.1| tau class glutathione S-transferase [Glycine max]
Length=228

 Score =   210 bits (534),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 146/220 (66%), Gaps = 1/220 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
            +EEVKL   ++SP+G RV WAL +K ++YE I +D+  KS+ LL  NPVHKK+PVL+H  
Sbjct  3    SEEVKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFKKSNLLLELNPVHKKVPVLVHAQ  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KPI ES VI+EY+++TW   PLLPQ P  RA  RFWA   E KL+ +   +    G +Q+
Sbjct  63   KPIAESFVIVEYVDETWKQCPLLPQDPYQRALARFWAYSAEQKLIDAAWIAMCTSGDDQQ  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
              V    + ++ IEE++  GK+FFGGDNIG+LDI LGW++    V+EE+  + +I+  KF
Sbjct  123  NAVKVGRELMEKIEEEIK-GKKFFGGDNIGYLDIALGWISYWIPVWEEVGSMLIIEPLKF  181

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            P ++ WM NF +HP I D+ PPRDKM+  + +   A+ + 
Sbjct  182  PAITAWMTNFLSHPVIKDNLPPRDKMLVYYSSRRKALSST  221



>gb|AJE59654.1| tau class glutathione S-transferase [Glycine max]
Length=217

 Score =   209 bits (533),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 140/214 (65%), Gaps = 1/214 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            + VKL   W+SP+G RV WAL +K ++YE I ED+ N S  ++  NPVHKK+P+L+H  K
Sbjct  5    DRVKLVNFWASPFGKRVEWALKLKGVKYEYIEEDVYNMSSLVMELNPVHKKVPILVHAQK  64

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ES  ILEYI++TW   PLLPQ P  RA  RFWA F E KL+ + R +      E+ +
Sbjct  65   PIAESFTILEYIDETWKQYPLLPQDPYQRALARFWANFGEQKLMRAARKAMTTSRDERAK  124

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             + +  + ++ IEE++  GK++FGGDNIGFLDI LGW++    V EE+  + +ID  KFP
Sbjct  125  ALKETRELMERIEEEIK-GKKYFGGDNIGFLDIALGWISYWLPVVEEVGSMHIIDPLKFP  183

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFN  194
             ++ WM NF +H  I D+ PPRDKM+  ++   N
Sbjct  184  AITSWMTNFLSHRVIKDNLPPRDKMLVYYRNFVN  217



>gb|KDO57583.1| hypothetical protein CISIN_1g046710mg [Citrus sinensis]
Length=227

 Score =   210 bits (534),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 150/222 (68%), Gaps = 2/222 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M  +VKL   W SP+  RVVWAL +K +++E I ED+ NKS  LL  NPVHKK+PVL+H+
Sbjct  1    MTTKVKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHD  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
             + I ES V LEYI++TW   PLLPQ P ++A  RFWAKF ++KLL S   + + KG+E+
Sbjct  61   KRVIVESFVFLEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKLLESAYKAMWSKGEEK  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITG-LKLIDAE  305
            ++ + +A+++L+ IEE L GGK F GG++IG+LD+ +GW+     V+EE  G ++++D++
Sbjct  121  QKAMKEAVESLEKIEEVL-GGKNFMGGNSIGYLDLAIGWIGYWIPVWEEAGGSMRILDSQ  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            KFP ++EW   F  HP I ++ PPRD+ +         I AN
Sbjct  180  KFPAIAEWSTKFLKHPVIKENLPPRDRTLAYCHKRAEEIYAN  221



>gb|KHN06423.1| Putative glutathione S-transferase [Glycine soja]
Length=217

 Score =   209 bits (533),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 141/214 (66%), Gaps = 1/214 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            + VKL   W+SP+G RV WAL +K ++YE I ED+ N S  ++  NPVHKK+P+L+H  K
Sbjct  5    DRVKLVNFWASPFGKRVEWALKLKGVKYEYIEEDVYNMSSLVMELNPVHKKVPILVHAQK  64

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ES  ILEYI++TW   PLLPQ P  RA  RFWA F E KL+ + R +      E+ +
Sbjct  65   PIAESFTILEYIDETWKQYPLLPQDPNQRALARFWANFGEQKLMRAARKAMTTSRDERAK  124

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             + +  + ++ IEE++  GK++FGGDNIGFLDI LGW++    V EE+  + +ID  KFP
Sbjct  125  ALKETRELMERIEEEIK-GKKYFGGDNIGFLDIALGWISYWLPVVEEVGSMHIIDPLKFP  183

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFN  194
             ++ WM NF +H  I D+ PPRDKM+  ++ + N
Sbjct  184  AITSWMTNFLSHRVIKDNLPPRDKMLVYYRNLVN  217



>ref|XP_007034532.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOY05458.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=231

 Score =   210 bits (534),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 147/229 (64%), Gaps = 2/229 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+  W+SP+  RV+WAL IK ++YE I EDL+NKS  LL+YNPV+KKIPVL+H GKP
Sbjct  3    EVKLHGFWASPFSHRVIWALKIKGVEYEYIEEDLSNKSELLLKYNPVYKKIPVLVHGGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYF-MKGKEQEE  476
            I ESLVILEY+E+TW   PLLP  P +RA  RFW +F EDK  P  R+ +    G+EQE+
Sbjct  63   IAESLVILEYVEETWPENPLLPSDPYERAMARFWIQFVEDK-SPVFRAFFLSTGGEEQEK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               + L+ LK+I+E+  G K+FFGGD I  +DI  G LA    + +EI G+K+++    P
Sbjct  122  AAKELLEMLKIIQEKALGEKKFFGGDTINLVDISYGVLAYWLKIMQEIIGVKVLEPNTLP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK*TVLHEVAD  149
             L EW  NF     I +  P RDK++   + +   I A +   LH+ A 
Sbjct  182  RLHEWAQNFMEVAVIKETIPDRDKVLAHMRGVREKIVAEQFNKLHKKAS  230



>ref|XP_010243636.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=221

 Score =   209 bits (533),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 140/210 (67%), Gaps = 2/210 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+  W+S Y  RV+WAL +K I+YE I EDL+NKS  LL+YNPVHKK+PVL H+GKP
Sbjct  3    EVKLFGLWASSYVYRVIWALKLKGIEYEYIEEDLSNKSELLLKYNPVHKKVPVLAHDGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVILEYI++TW   PLLP+    RA  RFWAKF +DK      S +  +G+EQE+ 
Sbjct  63   IAESLVILEYIDETWPENPLLPKDAEQRAAARFWAKFADDK-ATCFMSFFCSRGEEQEKA  121

Query  472  VVQALDNLKLIEEQLN-GGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
              + L+ L+++EE    G K+FFGGD IG  D+  G +A    V E+I G+KL++A  FP
Sbjct  122  RKECLEMLRMVEEYGGLGEKKFFGGDTIGLADLAFGGVACFLGVMEDIVGVKLVEAHTFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
             L  W+HNF     I ++ P R++M   F+
Sbjct  182  RLYAWIHNFNQVGVIKENLPDREEMFVFFK  211



>ref|XP_004299557.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=224

 Score =   209 bits (533),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 147/209 (70%), Gaps = 1/209 (0%)
 Frame = -2

Query  829  VKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKPI  650
            VKL  T  S +  RV WAL +K ++YE I EDL NKS  LL+YNPVHKK+PVL+H+  PI
Sbjct  4    VKLVATTQSFFCTRVQWALKLKGVEYEFIEEDLRNKSPVLLKYNPVHKKVPVLVHHDTPI  63

Query  649  CESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEGV  470
             ESLVILEYI++TW   PLLPQ P DRA  RFWAKF ++K++  + ++   +G+ +E+ +
Sbjct  64   VESLVILEYIDETWKENPLLPQDPFDRAAARFWAKFADEKVVFGVWTACTAEGEGKEKAI  123

Query  469  VQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPVL  290
              AL++L  +E+Q+  GK+FFGG+ IG+LD+VLGW+ +  +  EE+ G+KL++AE+FP L
Sbjct  124  EAALESLAHLEKQIE-GKKFFGGEQIGYLDLVLGWIPHWLNTVEEVGGMKLLEAERFPCL  182

Query  289  SEWMHNFYNHPAILDHWPPRDKMITKFQA  203
             EW  NF + P I +  P R+K+I    A
Sbjct  183  LEWGQNFIHTPFIKECIPQREKLIEYLSA  211



>ref|XP_007201513.1| hypothetical protein PRUPE_ppa015182mg [Prunus persica]
 gb|EMJ02712.1| hypothetical protein PRUPE_ppa015182mg [Prunus persica]
Length=222

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 142/223 (64%), Gaps = 3/223 (1%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL  TW SP+  RV+WAL +K ++YE + E+L NKS  LL+YNPVHKKIPVL+H GK
Sbjct  2    EEVKLLGTWPSPFCYRVIWALKLKGVKYEYVEENLMNKSDRLLQYNPVHKKIPVLVHGGK  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKEQE  479
            PI ES+VILEYIE+ W + PLL   P +RA  RFW KF EDK   +I  +YF   G+EQE
Sbjct  62   PISESIVILEYIEEVWAHNPLLSDDPYERAMARFWIKFGEDK--TAIFRAYFQSVGEEQE  119

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            +   +  + LK IEE   G K+FFGGD IG  D+  GWLA      EE  G+KL++   F
Sbjct  120  KAKRETQEVLKTIEEHGLGEKKFFGGDTIGLADLTFGWLAGWLGEMEEAAGVKLLEPNLF  179

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK*T  170
            P L  W+ NF + P I D+ P  D ++  F+++     A+  T
Sbjct  180  PHLQTWIKNFRDVPVIKDNLPEHDALLAYFKSLREKFTASART  222



>gb|AFF18812.1| glutathione transferase, partial [Dimocarpus longan]
Length=219

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 142/212 (67%), Gaps = 1/212 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EEVKL   WSSP+  RV WAL +K I YE + EDL+NKS  LL+YNPVHKKIPVL+H 
Sbjct  1    MGEEVKLLGAWSSPFSSRVAWALKLKGIAYEFVEEDLSNKSAMLLKYNPVHKKIPVLVHA  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPICES++I+EYIE+TW +TPLLP  P +RA  RFW +F EDK   + R  +   G+E 
Sbjct  61   GKPICESMIIVEYIEETWPHTPLLPTDPYERAIARFWVQFAEDKGSVAWR-IFHSTGQEL  119

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ + ++L+ L+ +EE     K++F G+NIG +DI  G +     V EE+ G+KL++  K
Sbjct  120  EKAIKESLEMLQTVEEHGLVDKKYFNGENIGMVDIAFGSICYWLQVIEEVIGVKLLEPHK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
             P L +W  +F   P I ++ P RD+M+  F+
Sbjct  180  LPRLLKWFQSFLQAPVIKENLPDRDQMVVFFK  211



>ref|XP_008224070.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=223

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 144/219 (66%), Gaps = 9/219 (4%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAE +KL+  W SP+  RV+WAL +K I Y+ I EDL NKS  LL+YNPVHKKIPVL+H 
Sbjct  1    MAEVIKLHGAWPSPFSCRVIWALKLKGIPYDYIEEDLLNKSPELLKYNPVHKKIPVLVHG  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDK---LLPSIRSSYFMKG  491
             +PICES++I+EYIE+TW   PLLP  P DRA  RFW KF +DK   +   IR++    G
Sbjct  61   ERPICESMIIVEYIEETWPEKPLLPADPYDRAIARFWVKFADDKGSVIWMVIRTT----G  116

Query  490  KEQEEGVVQALDNLKLIEEQLN--GGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKL  317
            +EQE+   ++L+ LK IE+     G K+FFGGDNIG  DI  G +A    V E++ G+KL
Sbjct  117  EEQEKFKKESLEMLKTIEKHAGSLGKKKFFGGDNIGIADIAFGVIAYWFGVMEDVVGVKL  176

Query  316  IDAEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
             +A+ FP L  W  NF   PAI +  P RDK++  ++ +
Sbjct  177  FEAQVFPRLHAWTENFKQVPAIKESLPDRDKLVVVYKQM  215



>emb|CDP06552.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 139/209 (67%), Gaps = 1/209 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL+  W SP+   V  ALNIK IQYE I EDLTNKS  LL+YNPV+KKIPVLLHNGK
Sbjct  2    EEVKLFGYWVSPFCRSVEIALNIKGIQYEYIEEDLTNKSPQLLQYNPVYKKIPVLLHNGK  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ES+VILEYI++TW N P+LP+ P ++A  RFWA F + K  P++  + +   ++ E+
Sbjct  62   PIVESMVILEYIDETWKNNPILPEDPFEKARARFWANFVDQKCFPALWKTIWSTSEQYEQ  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               +AL+ LK++E +L GGKRFFGGD+IG +DIV  ++       +E   L +   + FP
Sbjct  122  NKAEALERLKVLENEL-GGKRFFGGDSIGMVDIVANFIGFSFRTIQEALKLDVFTEDNFP  180

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKF  209
             L EW  NF N   +    PP+DK+I  F
Sbjct  181  KLWEWAENFANCSPVKKCLPPQDKLIANF  209



>ref|XP_007226313.1| hypothetical protein PRUPE_ppa021702mg [Prunus persica]
 gb|EMJ27512.1| hypothetical protein PRUPE_ppa021702mg [Prunus persica]
Length=223

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 143/215 (67%), Gaps = 4/215 (2%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MA+EVKL+  W+SP+  RV+W L +K I Y+ I EDL NKS  LL+YNPVHKKIPVL+H 
Sbjct  1    MADEVKLHGVWNSPFSCRVIWVLKLKGIPYDYIEEDLQNKSPELLKYNPVHKKIPVLVHG  60

Query  661  GKPICESLVILEYIEDTW-HNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
             +PICES++I+EYIE+TW    PLLP  P +RA  RFW K+ E+K + +I   +   G+E
Sbjct  61   VRPICESMIIVEYIEETWPQKYPLLPTDPYERAMARFWVKYFEEKTI-AIWMVFRTTGEE  119

Query  484  QEEGVVQALDNLKLIEEQLN--GGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLID  311
            QE+   + L+ L+ IEE  +  G K+FFGGD IG +DI  GW++    V E++ G+KL +
Sbjct  120  QEKFKKETLEMLRTIEEHTSTLGKKKFFGGDKIGIVDIAFGWISQWFEVVEDVVGVKLFE  179

Query  310  AEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            A  FP L  W  NF   P I ++ P RDKM+  F+
Sbjct  180  AHAFPCLHAWTQNFKQVPLIKENLPDRDKMLVLFK  214



>gb|ADB11371.1| putative tau class glutathione transferase GSTU47 [Populus trichocarpa]
Length=218

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 141/211 (67%), Gaps = 2/211 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL  TW SP+  RV+WAL +K I YE I EDL+NKS  LL+ NPVHKKIP+ +H GK 
Sbjct  3    EVKLLGTWPSPFS-RVIWALKLKGIPYEYIEEDLSNKSPLLLQCNPVHKKIPIPVHGGKS  61

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            ICES+VILEY+E+TW   PL+P  P +RA  RFW KF EDK + ++   +   G+EQE+ 
Sbjct  62   ICESMVILEYLEETWPQIPLMPDDPYERARARFWVKFVEDKGV-AVWIMFHSSGEEQEKA  120

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V  +L+ LK IEE   G KRFF GD I  +DI  GW+A    V EE+ G+KL++ +KFP 
Sbjct  121  VKDSLEMLKTIEEHALGKKRFFCGDKISLVDIAYGWIAQWLEVLEEVAGIKLMEPQKFPR  180

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            L  W+ NF + P I ++ P  D+M+  F+ +
Sbjct  181  LHTWIKNFKDEPIIKENLPGHDEMLVYFKPL  211



>ref|XP_010921338.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=231

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 143/209 (68%), Gaps = 1/209 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+  W+SP   RV WAL IK I+YE I EDL+NKS  LL YNP++K++PVLLH GKP
Sbjct  6    EVKLFGMWASPAVRRVEWALKIKGIEYEYIEEDLSNKSTSLLEYNPINKQVPVLLHKGKP  65

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLV++EYI++ W + P+LP+ P +R   RFWA + E +   ++   YF +G+E+E  
Sbjct  66   IVESLVMIEYIDEVWKHNPILPEDPYERTKARFWATYGEGECRDAVGKVYFTEGEEKENA  125

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +    D +++++E+L  GK+FFGG+NIGF D+VLGW+A    V EE+   ++++++KFP 
Sbjct  126  IKHLEDTVRVLDEELK-GKKFFGGENIGFSDLVLGWMAFWLPVAEEVASFEVLNSKKFPW  184

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
             + W  NF   P I ++ P RDK +  FQ
Sbjct  185  FASWTDNFLQVPVIKENLPLRDKTVEFFQ  213



>gb|ACU20120.1| unknown [Glycine max]
Length=229

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 146/208 (70%), Gaps = 1/208 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            +VKL   W SP+G RV WAL +K I+YE I ED+ NKS+ LL+ NPVHKK+PVL+H  KP
Sbjct  6    DVKLLSFWVSPFGKRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLVHAHKP  65

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ES +ILEYI++TW   PLLP HP  RA  RFWA   E KL  +   +    G+EQE+ 
Sbjct  66   IAESFIILEYIDETWKQYPLLPCHPHQRALARFWATSVEQKLGKAGWVAMSTSGEEQEKA  125

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V +A++ ++ IEE++  GK+FFGGDNIG+LDI LGW+A L  V+EE+  +++ID  KFP 
Sbjct  126  VKEAIEMMEKIEEEIK-GKKFFGGDNIGYLDIALGWIAYLVPVWEEVGSMQIIDPLKFPA  184

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKF  209
             +EW+ NF +HP I D  PPRDKM+  +
Sbjct  185  TTEWITNFLSHPLIKDSLPPRDKMLVYY  212



>gb|KHN48021.1| Putative glutathione S-transferase [Glycine soja]
Length=285

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 146/220 (66%), Gaps = 1/220 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
            +EEVKL   ++SP+G RV WAL +K ++YE I +D+  KS+ LL  NPVHKK+PVL+H  
Sbjct  3    SEEVKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFKKSNLLLELNPVHKKVPVLVHAQ  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KPI ES VI+EY+++TW   PLLPQ P  RA  RFWA   E KL+ +   +    G +Q+
Sbjct  63   KPIAESFVIVEYVDETWKQCPLLPQDPYQRALARFWAYSAEQKLIDAAWIAMCTSGDDQQ  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
              V    + ++ IEE++  GK+FFGGDNIG+LDI LGW++    V+EE+  + +I+  KF
Sbjct  123  NAVKVGRELMEKIEEEIK-GKKFFGGDNIGYLDIALGWISYWIPVWEEVGSMLIIEPLKF  181

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            P ++ WM NF +HP I D+ PPRDKM+  + +   A+ + 
Sbjct  182  PAITAWMTNFLSHPVIKDNLPPRDKMLVYYSSRRKALSST  221



>ref|NP_001234957.1| glutathione S-transferase GST 17 [Glycine max]
 gb|AAG34807.1|AF243372_1 glutathione S-transferase GST 17 [Glycine max]
 gb|AJE59656.1| tau class glutathione S-transferase [Glycine max]
Length=229

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 146/208 (70%), Gaps = 1/208 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            +VKL   W SP+G RV WAL +K I+YE I ED+ NKS+ LL+ NPVHKK+PVL+H  KP
Sbjct  6    DVKLLSFWVSPFGKRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLVHAHKP  65

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ES +ILEYI++TW   PLLP HP  RA  RFWA   E KL  +   +    G+EQE+ 
Sbjct  66   IAESFIILEYIDETWKQYPLLPCHPHQRALARFWATSVEQKLGKAGWVAMSTSGEEQEKA  125

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V +A++ ++ IEE++  GK+FFGGDNIG+LDI LGW+A L  V+EE+  +++ID  KFP 
Sbjct  126  VKEAIEMMEKIEEEIK-GKKFFGGDNIGYLDIALGWIAYLVPVWEEVGSMQIIDPLKFPA  184

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKF  209
             +EW+ NF +HP I D  PPRDKM+  +
Sbjct  185  TTEWITNFLSHPLIKDSLPPRDKMLVYY  212



>gb|AFK45620.1| unknown [Lotus japonicus]
Length=219

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 142/210 (68%), Gaps = 1/210 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EV+L   W+SP+  RV  AL +K + Y    EDL NKS  LL+YNPV+KK+PVL+HNG P
Sbjct  7    EVRLLGKWASPFSNRVDLALKLKGVPYNYSEEDLANKSADLLKYNPVYKKVPVLVHNGNP  66

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            + ESLVILEYI++TW N P LPQ P +RA  RFW+K  +DK+LP I ++ +   K +E+ 
Sbjct  67   LAESLVILEYIDETWKNNPFLPQDPYERAVARFWSKTLDDKILPPIWNACWSDEKGREKA  126

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V +AL+ LKL+++QL    RFFGG+ IG +DI   ++    S+ +EI GL+L+  EKFP 
Sbjct  127  VEEALEALKLLQDQLKDN-RFFGGETIGLVDIAANFIGYWVSILQEIAGLELLTVEKFPK  185

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            L +W   F NHP I +  PPRD++   F+A
Sbjct  186  LFKWSQEFVNHPVIKEGLPPRDELFAFFKA  215



>ref|XP_004302690.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=218

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 144/218 (66%), Gaps = 3/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EEVKL+  W SP+  RV  AL +K ++Y+   EDL NKS  LL+YNPVHKKIPVL+H 
Sbjct  1    MGEEVKLFGVWGSPFSKRVEMALKLKGVEYDFFDEDLQNKSELLLKYNPVHKKIPVLVHK  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ES +ILEYI++TW    LLP+ P  RA  RFWA+F E+K +P++     +  +++
Sbjct  61   GKPIAESAIILEYIDETWEGFALLPKDPYQRATARFWARFVEEKCMPAMFKCS-VGTEDR  119

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANL-PSVFEEITGLKLIDAE  305
            E+ V +A + LKL+E +L  GK+FFGG+ IGF+DIV  ++       F+E+ G++L+  E
Sbjct  120  EKAVEEAYETLKLLENELK-GKKFFGGEEIGFVDIVADFIGGYWLRDFQEVVGMELLTKE  178

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            K P L EW   F NH  I +  PPRDK+I  F+  F +
Sbjct  179  KLPKLCEWSDEFVNHAVIKEVLPPRDKLIAFFRTRFGS  216



>ref|XP_010037769.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49508.1| hypothetical protein EUGRSUZ_K03029 [Eucalyptus grandis]
Length=226

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 147/222 (66%), Gaps = 2/222 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLT-NKSHHLLRYNPVHKKIPVLLH  665
            M EE+KL+  W SP+  R+  AL IK ++YE + ED+  NKS  LL+YNPVHKKIPVL+H
Sbjct  1    MGEELKLFGVWGSPFSRRIEIALKIKGVEYEYLEEDIFHNKSALLLKYNPVHKKIPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            NGKPI ES VILEYI++TW++ P+LP+ P  RA  RFWAKF ++K +P+I  S    G E
Sbjct  61   NGKPIAESQVILEYIDETWNDNPILPRDPYKRAMARFWAKFIDEKCVPAIWKSLTSVGPE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            +E+   +A + L  +E +L  GK+FFGG+ +GF+DIV  ++ +     +E  G   +  +
Sbjct  121  KEKANEEACELLSTLEGELK-GKKFFGGETVGFVDIVASFIGHWVGAVQEAAGFDFLTED  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            KFPVL +W   F N P I ++ PPRDK++  F+A    I ++
Sbjct  180  KFPVLYKWAEEFKNCPVIKENLPPRDKILADFKARLEMITSS  221



>gb|KHN06425.1| Putative glutathione S-transferase [Glycine soja]
Length=228

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 146/208 (70%), Gaps = 1/208 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            +VKL   W SP+G RV WAL +K I+YE I ED+ NKS+ LL+ NPVHKK+PVL+H  KP
Sbjct  5    DVKLLSFWVSPFGKRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLVHAHKP  64

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ES +ILEYI++TW   PLLP HP  RA  RFWA   E KL  +   +    G+EQE+ 
Sbjct  65   IAESFIILEYIDETWKQYPLLPCHPHQRALARFWATSVEQKLGKAGWVAMSTSGEEQEKA  124

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V +A++ ++ IEE++  GK+FFGGDNIG+LDI LGW+A L  V+EE+  +++ID  KFP 
Sbjct  125  VKEAIEMMEKIEEEIK-GKKFFGGDNIGYLDIALGWIAYLVPVWEEVGSMQIIDPLKFPA  183

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKF  209
             +EW+ NF +HP I D  PPRDKM+  +
Sbjct  184  TTEWITNFLSHPLIKDSLPPRDKMLVYY  211



>ref|XP_011039096.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 145/217 (67%), Gaps = 0/217 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVK+  +  S +  RV WAL +K ++YE + EDL NKS  LL++NPVHKK+PVL+H+ KP
Sbjct  3    EVKVIGSSKSLFCARVEWALKLKGVEYEYLEEDLLNKSPLLLKHNPVHKKVPVLVHDDKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESL ILEYI++ W N PLLP+ P +RA  RFWAKF ++K +    +++  +G+E+E+ 
Sbjct  63   IAESLFILEYIDERWKNYPLLPEDPYERAMARFWAKFADEKCVMGAFAAFRKEGEEREKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +  AL++   +E+Q+ G K F G DNIG+LD+V+GW+    +  EE  G+KL+DA+KFP 
Sbjct  123  IESALESFTFVEKQIQGKKFFSGDDNIGYLDLVMGWIPLWLNAMEEAGGMKLMDAQKFPS  182

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEA  182
            L EW  NF   P I +  PPRD ++  F    + I +
Sbjct  183  LHEWTQNFVEIPLIKECLPPRDALVNYFNLSLSYIRS  219



>gb|KDO66687.1| hypothetical protein CISIN_1g041211mg [Citrus sinensis]
Length=222

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 148/220 (67%), Gaps = 1/220 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKLY TW SP+  R+  AL +K + +E + EDL+NKS  LL+YNPVHKKIPVL+HN
Sbjct  1    MAEEVKLYGTWVSPFSRRIELALKLKGVPFEYMEEDLSNKSPELLKYNPVHKKIPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEYI++TW N P+LPQ P  RA +RFWAKF ++K+L +   + F +GKE+
Sbjct  61   GKPIAESLVILEYIDETWKNNPILPQDPYQRAMVRFWAKFIDEKILATGWKANFGEGKER  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E  + +  + +K +E +LN GK FF G+ IGFLDIV   +A    V ++  G++    EK
Sbjct  121  EVAIEEFAEQMKFLENELN-GKDFFEGETIGFLDIVANLIAFWFPVRQDALGIEAFTQEK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEA  182
            FPVL +W+ N      + +  PPR+K +   +A    +++
Sbjct  180  FPVLFKWIANITKIDLVNECRPPREKHLAFVKARIEGLQS  219



>ref|XP_010091847.1| Glutathione transferase GST 23 [Morus notabilis]
 gb|EXB46055.1| Glutathione transferase GST 23 [Morus notabilis]
Length=222

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 139/212 (66%), Gaps = 1/212 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            +EVKL   W S +  R++WAL +K I+YE + EDL NKS  LLR+NPVH+KIPVL+H GK
Sbjct  2    KEVKLLGAWPSTFCYRIIWALKLKGIEYEYVEEDLFNKSDLLLRHNPVHRKIPVLIHGGK  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ES VILEYIE+ W   PLLP  P +RA  RFW KF ED+  P+  + +   G+EQEE
Sbjct  62   PIAESTVILEYIEEVWPQNPLLPSDPYERATARFWTKFGEDE-NPTFFAFFQAVGEEQEE  120

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               +A + LK IEE+  G K+FFGGD +G  D+  GW+A      EE  G+KL++  +FP
Sbjct  121  ATKEAKEMLKTIEERGLGEKKFFGGDKVGMTDLTFGWIAGWLEYMEEAVGVKLLEPNRFP  180

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            +L  W+ NF + P I ++ P  DK++  F+ +
Sbjct  181  LLEAWIKNFRDVPVIKENLPDGDKLLVYFKGL  212



>ref|XP_010243655.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=230

 Score =   208 bits (529),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 143/210 (68%), Gaps = 1/210 (0%)
 Frame = -2

Query  829  VKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKPI  650
            VKL   WSSPY  RV+WAL +K ++YE I ED+ NKS  LL+YNPVHKK+PVL+HNGKPI
Sbjct  14   VKLIGFWSSPYVYRVIWALKLKGVEYEYIEEDIFNKSDILLKYNPVHKKVPVLVHNGKPI  73

Query  649  CESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEGV  470
             ES+V+LEYI++TW   P+LP+   +RA  RFWAKF EDK    I + +   G++ E+  
Sbjct  74   VESMVVLEYIDETWPEHPVLPEDAQERATARFWAKFAEDK-GSCIWAMFRSSGEKVEKAK  132

Query  469  VQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPVL  290
             ++L+ L+ IEE   G K+FFGGD IGF D+  G +A+   V E++ G+KL++A+ FP L
Sbjct  133  KESLEMLRTIEEHGLGEKKFFGGDTIGFADLAFGGIAHWLGVMEDVVGVKLLEAQSFPRL  192

Query  289  SEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
             EW  NF   P I D+ P  +KM+  F+ +
Sbjct  193  YEWTQNFKEVPVIKDNLPDPEKMLVFFKRL  222



>emb|CDP08010.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 143/219 (65%), Gaps = 1/219 (0%)
 Frame = -2

Query  829  VKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKPI  650
            VKL   W SP+  RV WAL +K +QYE I ED+ NKS  L + NPV+  +PVL+HNGKPI
Sbjct  7    VKLLGFWVSPFAQRVKWALKLKGVQYEYIEEDIYNKSPLLSKLNPVYGMVPVLVHNGKPI  66

Query  649  CESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEGV  470
             ES++ILEYI++ W   PLLPQ P +RA  RFWAKF E+K+  S+  +    G+E+++ V
Sbjct  67   SESIIILEYIDEVWKQAPLLPQDPYERAQARFWAKFAEEKVRQSVWEAMCSSGEEKQKAV  126

Query  469  VQALDNLKLIEEQLN-GGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
              A++  +  E++L   G +FFGG+ IGF+DIV G ++   +V EE+  +K++D+ +FP 
Sbjct  127  KSAVEAFEEFEKELKRRGTKFFGGETIGFVDIVAGCISYQLAVHEEVGSIKILDSSRFPA  186

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
            +SEW+ NF NHP I +  P +D+M   F      I + K
Sbjct  187  ISEWIKNFLNHPLINEGLPQKDQMFAYFSKRSKEIASRK  225



>ref|XP_010243635.1| PREDICTED: glutathione transferase GST 23-like [Nelumbo nucifera]
Length=221

 Score =   207 bits (527),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 141/208 (68%), Gaps = 2/208 (1%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            E+VKL+  + SPY  RV+WAL +K ++YE I EDL+NKS  +L YNPVHKK+PVL+H GK
Sbjct  2    EQVKLFGAFPSPYVYRVIWALKLKGVKYEYIEEDLSNKSALVLEYNPVHKKVPVLVHGGK  61

Query  655  PICESLVILEYIEDTWHNTP-LLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
             I ES+VILEYIE+TW + P LLPQ P +RA  RFW KF EDK    I + ++  G++QE
Sbjct  62   RIAESIVILEYIEETWPSNPLLLPQDPYERAQARFWIKFGEDKGATFI-AVFWSVGEQQE  120

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            +   +A + L+ IEE+  G K+FFGGD IG +DI  GW+A    V EE+ G+KL++   F
Sbjct  121  KAFREASEVLRTIEERALGEKKFFGGDRIGMVDIAFGWIALWMEVMEELKGVKLMEPHAF  180

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMIT  215
            P L  WM NF   P I D+ P R +M+ 
Sbjct  181  PRLHAWMENFKGIPEIRDNLPDRHRMLV  208



>ref|XP_002277724.2| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
 emb|CBI32812.3| unnamed protein product [Vitis vinifera]
Length=227

 Score =   207 bits (528),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 140/206 (68%), Gaps = 2/206 (1%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEV L   W+SP  LR+ WAL  K I Y+ I EDL NKS  LL +NP+HKKIPVLLH GK
Sbjct  4    EEVTLLGMWASPLALRIEWALKCKGIWYKCIDEDLLNKSQRLLTHNPIHKKIPVLLHGGK  63

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYF-MKGKEQE  479
             I ESLVILEYI++TW   PLLP+ P +RA  RFWAKF ++K   +I   +   +G EQE
Sbjct  64   SIPESLVILEYIDETWKQNPLLPEDPYERAMARFWAKFVDEKCWTTIPGVFGNERGDEQE  123

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            +   +A++ L+++E+QL  GK+FFGG+++GFLDIV GW+A      E+ITGLKL+D   F
Sbjct  124  KSKEKAIEELRILEKQLE-GKKFFGGESVGFLDIVCGWIAYWLPFIEDITGLKLVDETSF  182

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKM  221
            P LS W   + + P + +  PP DK+
Sbjct  183  PALSAWFKAYLSVPWVKELLPPPDKL  208



>ref|XP_006494129.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=219

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 145/212 (68%), Gaps = 2/212 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EV L+  WSSP+  RV+WAL +K I++E I EDL+NKS  LL+YNP++KKIPVL+H GKP
Sbjct  3    EVNLHGEWSSPFSYRVIWALKLKAIEFEYIEEDLSNKSPLLLQYNPIYKKIPVLVHGGKP  62

Query  652  ICESLVILEYIEDTWHNTP-LLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            I ES++ILEYIE+TW   P LLP    +RA  RFW KF E+K  P+I   +   G+EQE+
Sbjct  63   ISESMIILEYIEETWPKNPLLLPSDSFERAMARFWIKFSEEK-GPTIWKIFVTSGEEQEK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               ++L+ L+ IEE+  G K+FFGG+NI  LD+  GW+     V EEI GLKL++A+KFP
Sbjct  122  VKNESLEILRTIEEKGLGEKKFFGGENIDLLDLAFGWMPYWLGVIEEILGLKLLEADKFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
             L  W+ NF     I D+ P RD+M+  F ++
Sbjct  182  RLHAWIKNFKQVSIIKDNPPDRDRMLIHFSSL  213



>ref|NP_001238721.1| glutathione S-transferase GST 13 [Glycine max]
 gb|AAG34803.1|AF243368_1 glutathione S-transferase GST 13 [Glycine max]
 gb|KHN47445.1| Putative glutathione S-transferase [Glycine soja]
 gb|AJE59653.1| tau class glutathione S-transferase [Glycine max]
Length=220

 Score =   207 bits (527),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 146/211 (69%), Gaps = 1/211 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEV+L   W+SP+  RV  AL +K + Y+   EDL NKS  LL+YNPVHKK+PVL+HNG 
Sbjct  7    EEVRLLGKWASPFSNRVDLALKLKGVPYKYSEEDLANKSADLLKYNPVHKKVPVLVHNGN  66

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            P+ ESL+I+EYI++TW N PLLPQ P +RA  RFW+K  +DK+LP+I ++ +     +E+
Sbjct  67   PLPESLIIVEYIDETWKNNPLLPQDPYERALARFWSKTLDDKILPAIWNACWSDENGREK  126

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             V +AL+ LK+++E L   K+FFGG++IG +DI   ++    ++ +EI GL+L+  EKFP
Sbjct  127  AVEEALEALKILQETLK-DKKFFGGESIGLVDIAANFIGYWVAILQEIAGLELLTIEKFP  185

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
             L  W  +F NHP I +  PPRD++   F+A
Sbjct  186  KLYNWSQDFINHPVIKEGLPPRDELFAFFKA  216



>ref|XP_002524048.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF38416.1| glutathione s-transferase, putative [Ricinus communis]
Length=229

 Score =   207 bits (527),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 151/220 (69%), Gaps = 2/220 (1%)
 Frame = -2

Query  847  VAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLL  668
            +A  EEVK+   WSSP+  RV  AL +K IQYE ++E+L NKS  LL+YNP+++KIPVL+
Sbjct  1    MAGQEEVKVLGGWSSPFVFRVEVALKLKGIQYEAVVENLANKSPELLKYNPIYRKIPVLV  60

Query  667  HNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSY-FMKG  491
            HNGKPI ESL+I+EYI++TW + P+LPQ P +RA  RFW  F ++KL+ +++      + 
Sbjct  61   HNGKPISESLIIVEYIDETWKDNPILPQDPYERAMARFWGYFVDNKLMEALKGIIGSTEE  120

Query  490  KEQEEGVVQALDNLKLIEEQLNG-GKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLI  314
            +++++ V +A + L++IE +L   GK+FFGGD IGF+D+ LGW+ N     E    +K+ 
Sbjct  121  EQKQKEVEKAKEALQVIEGELKARGKKFFGGDTIGFIDVALGWIPNWVGAVEGTVDVKIH  180

Query  313  DAEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFN  194
            D EKFP+L EWMHNF   P I +  P +D +I  F+ + +
Sbjct  181  DPEKFPILDEWMHNFTQVPVIKETLPQQDDLIAHFKQLLS  220



>ref|XP_010069088.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW57313.1| hypothetical protein EUGRSUZ_H00110 [Eucalyptus grandis]
Length=224

 Score =   207 bits (527),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 139/213 (65%), Gaps = 1/213 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MA++VKL+  WSSP+  RV+WAL +K + YE I ED+  KS  L+RYNPVHKK+PVL H 
Sbjct  1    MADDVKLHGLWSSPFTQRVIWALQLKGLSYEYIAEDIICKSESLVRYNPVHKKVPVLFHG  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKP+ ES++I+EYI++TW   PLLPQ   +RA +RFWAKF E+K +P + + +   G++Q
Sbjct  61   GKPVTESMLIVEYIDETWAQNPLLPQDAHERAVVRFWAKFIEEKSIP-MMAFFRHVGEDQ  119

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ +   LD  K IEE   GG +F G + +   DI LGW+ +   V E+I G+KL+ AE 
Sbjct  120  EKAINFTLDTFKTIEENGLGGNKFLGSEEVSLADIALGWIVHTLPVMEDIIGVKLVKAET  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            FP+L EWM NF     I    P   + +  F+A
Sbjct  180  FPLLHEWMENFKQVSVIKSSLPDYARALDYFRA  212



>gb|KDO36340.1| hypothetical protein CISIN_1g027486mg [Citrus sinensis]
Length=223

 Score =   207 bits (526),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 148/220 (67%), Gaps = 0/220 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            E+VKL   W SPY  RV+WAL +K I+YE + E+L+NKS  LL+YNPVH+K+PVL+H+ K
Sbjct  2    EQVKLIGAWPSPYVYRVIWALQLKGIKYEYVEENLSNKSDMLLKYNPVHQKVPVLVHDEK  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ES VILEYIE+ W   PLLP+ P DRA  RFW KF ++ L P+  + Y   G+E E+
Sbjct  62   PIVESTVILEYIEEAWPRHPLLPKDPYDRAAARFWIKFSDENLAPTFVAFYIGVGEEHEK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             + +A + LK+IEEQ  G K+FFGG+ IG  D+V GW+A    V EE+ G+K++DA+ FP
Sbjct  122  AIKEAKEKLKIIEEQGLGDKKFFGGNEIGMADLVFGWIAKSFGVVEEVVGVKVLDADSFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
             L  W+ +F +HP I +H P  D+M   ++   +   A K
Sbjct  182  RLHAWIGSFRSHPVIKEHLPDCDEMFAYYKQKRDMFIAQK  221



>ref|XP_002285212.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=227

 Score =   207 bits (527),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 141/210 (67%), Gaps = 1/210 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            +EVKL   W+SP+  RV+WAL +K + YE I ED+ NKS  LL+ NP+HK +PVL+H  +
Sbjct  4    QEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDVFNKSPLLLQLNPLHKSVPVLIHGHR  63

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
             ICES VI++YI++TW   PLLPQHP +RA  RFWA+F E KL+ S       +G+E+E 
Sbjct  64   VICESFVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLMESAWMGQCSRGEERER  123

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
                A++ ++ IEE L  GK+ FGG++IG+LDI LGWL+    ++EE+  +++ID  KFP
Sbjct  124  AAKLAMETVEKIEE-LVKGKKLFGGESIGYLDICLGWLSYWLPIWEEVGCMQIIDPIKFP  182

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
              S W+    +HP I D+ P R+ MI  FQ
Sbjct  183  ATSSWIDTVLHHPVIRDNLPAREAMIVYFQ  212



>ref|XP_008793317.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=226

 Score =   207 bits (526),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 149/223 (67%), Gaps = 2/223 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL  +W SP+  RV  AL +K I Y+ I EDL+NKS  LL+YNP+HKK+PV LH 
Sbjct  1    MAEEVKLLGSWGSPFSRRVELALRLKGISYDYIEEDLSNKSPLLLKYNPIHKKVPVFLHG  60

Query  661  GKPICESLVILEYIEDTWHNT-PLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            GKP+ ESLVILEYIE+TW     +LP+ P +RA  RFW+ F ++K +P+   S + +G  
Sbjct  61   GKPVVESLVILEYIEETWEGDHAILPKDPYERAMARFWSTFVDEKCIPAFWMSCWTEGDM  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            Q+  ++Q+ +NL ++E +L  GK+FFGGD IG +DI   ++A+   V +E+ G+ LI+ E
Sbjct  121  QQNFMIQSKENLSILEGELK-GKKFFGGDAIGMVDIAAFFIAHWAGVLQEVAGISLINEE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
            K P+L +W+  F +   +++  P R+ ++  FQA   AI A K
Sbjct  180  KHPILFKWIEEFMSSSIVMECLPAREGLLAYFQAKKEAIRATK  222



>ref|XP_010037776.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49511.1| hypothetical protein EUGRSUZ_K03034 [Eucalyptus grandis]
Length=226

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 144/214 (67%), Gaps = 2/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLT-NKSHHLLRYNPVHKKIPVLLH  665
            M EE+KL+  W SP+  R+  AL IK ++YE + ED+  NKS  LL+YNPVHKKIPVL+H
Sbjct  1    MGEELKLFGVWGSPFSRRIEIALKIKGVEYEYLEEDIFHNKSALLLKYNPVHKKIPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            NGKPI ES VILEYI++TW++ P+LP+ P  RA  RFWAKF ++K +P+I  S    G E
Sbjct  61   NGKPIAESQVILEYIDETWNDNPILPRDPYKRAMARFWAKFIDEKCVPAIWKSLTSVGPE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            +E+   +A + L  +E +L  GK+FFGG+ +GF+DIV  ++ +     +E  G   +  +
Sbjct  121  KEKANEEACELLSTLEGELK-GKKFFGGETVGFVDIVASFIGHWVGAVQEAAGFDFLTED  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            KFPVL +W   F N P I ++ PPRDK++  F+A
Sbjct  180  KFPVLYKWAEEFKNCPVIKENLPPRDKILAFFKA  213



>ref|XP_010269443.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=221

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 142/215 (66%), Gaps = 12/215 (6%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+  W S Y  RV+WAL +K I+YE I EDL+NKS  LL+YNPVHKK+PVL H+GKP
Sbjct  3    EVKLFGLWXSXYVYRVIWALKLKGIEYEYIEEDLSNKSELLLKYNPVHKKVPVLAHDGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDK---LLPSIRSSYFMKGKEQ  482
            I ESLVILEYI++TW   PLLP+    RA  RFWAKF EDK    +   RSS    G+EQ
Sbjct  63   IAESLVILEYIDETWPENPLLPKDAEQRAAARFWAKFAEDKGACFMTFFRSS----GEEQ  118

Query  481  EEGVVQALDNLKLIEEQLNGG---KRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLID  311
            E+   + L+ L+++EE   GG   K+FFGGD IG  D+  G +A    V E+I G+KL++
Sbjct  119  EKARKECLEMLRMVEEY--GGLEEKKFFGGDTIGLADLAFGGVACWLGVMEDIVGVKLVE  176

Query  310  AEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            A  FP L  W+HNF     I ++ P R+KM+  F+
Sbjct  177  AHTFPRLYAWIHNFNQVGVIKENLPDREKMLVFFK  211



>gb|AFS51729.1| tau class glutathione S-transferase [Glycine soja]
Length=219

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 145/211 (69%), Gaps = 1/211 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEV L   W+SP+  RV  AL +K + Y+   EDL NKS  LLRYNPVHKK+PVL+HNG 
Sbjct  6    EEVILLGKWASPFSNRVDLALKLKGVPYKYSEEDLANKSADLLRYNPVHKKVPVLVHNGN  65

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            P+ ESL+I+EYI++TW N PLLP+ P +RA  RFW+K  +DK+LP+I ++ +     +E+
Sbjct  66   PLPESLIIVEYIDETWKNNPLLPRDPYERALARFWSKTLDDKILPAIWNACWSDENGREK  125

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             V +AL+ LK+++E L   K+FFGG++IG +DI   ++    ++ +EI GL+L+  EKFP
Sbjct  126  AVEEALEALKILQEALK-DKKFFGGESIGLVDIAANFIGYWVAILQEIAGLELLTIEKFP  184

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
             L +W   F NHP I +  PPRD++   FQA
Sbjct  185  KLYKWSQEFINHPVIKEGLPPRDELFAFFQA  215



>gb|ADB11327.1| tau class glutathione transferase GSTU45 [Populus trichocarpa]
Length=220

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 142/206 (69%), Gaps = 1/206 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL   W SP+  RV  AL +K ++YE I EDL NKS  LL+YNP+HKK+PVLLHNGK 
Sbjct  3    EVKLLGAWGSPFSRRVEMALKLKGVEYEYIDEDLANKSPLLLKYNPIHKKVPVLLHNGKT  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            + ESLVILEYI++TW + P+LP+ P D+A  RFWAKF ++K +P+I      K  E+E+ 
Sbjct  63   MAESLVILEYIDETWKSNPILPEDPYDKAMARFWAKFIDEKCMPAIWQIMLSKENEREKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            + +A+ +LK +E +L   K+FFGG+ IG +DIV  ++       +E TG++L++ E+FPV
Sbjct  123  IEEAIQHLKTLENELK-DKKFFGGETIGLVDIVANFIGFWLGAAQEATGMELVNKERFPV  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMIT  215
            L +W+  + N   + ++ PPRDK+I 
Sbjct  182  LCKWIDEYANCSVVKENLPPRDKLIA  207



>ref|XP_002285214.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=227

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 142/210 (68%), Gaps = 1/210 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            +EVKL   W+SP+  RV+WAL +K + YE I ED+ NKS  LL+ NP+HK++PVL+H  +
Sbjct  4    QEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDVFNKSPLLLQLNPLHKRVPVLIHGHR  63

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
             ICES VI++YI++TW   PLLPQHP +RA  RFWA+F E KL  S   +   +G+E+E 
Sbjct  64   VICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLFESAWMALCSRGEERER  123

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
                A++ ++ IEE L  GK+ FGG++IG+LDI LGW++    ++EE+  +++ID  KFP
Sbjct  124  AAKLAMEAVEKIEE-LVKGKKLFGGESIGYLDICLGWISYWLPIWEEVGCMQIIDPIKFP  182

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
              S W+    +HP I D+ P R+ MI  FQ
Sbjct  183  ATSSWIDTVLHHPVIRDNLPAREAMIVYFQ  212



>gb|KHN48020.1| Glutathione transferase GST 23 [Glycine soja]
 gb|AJE59669.1| tau class glutathione S-transferase [Glycine max]
Length=228

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 142/210 (68%), Gaps = 1/210 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
            +E+VKL   W SP+G RV WAL +K ++YE I ED+ NKS+ LL  NPVHKK+PVL+H  
Sbjct  3    SEDVKLLNFWVSPFGKRVEWALKLKGVEYEYIEEDIFNKSNLLLELNPVHKKVPVLVHAQ  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KPI ES +ILEYI++TW   PLLP +P  RA  RFWA   E KL  +   +    G EQE
Sbjct  63   KPIAESFIILEYIDETWKKYPLLPHNPYQRALARFWATCVEQKLGKAGWVAMSTSGDEQE  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            E + +A + ++ IEE++  GK FFGGDNIG+LDI +GW+A L  V+EE+  +++ID  KF
Sbjct  123  EAMKEAKEMMEKIEEEIK-GKNFFGGDNIGYLDIAIGWIAYLVPVWEEVGSMQIIDPLKF  181

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKF  209
            P    WM NF +HP I D  PPRDKM+  +
Sbjct  182  PATFAWMTNFLSHPVIKDSLPPRDKMLVYY  211



>ref|NP_001235279.1| uncharacterized protein LOC100527381 [Glycine max]
 gb|ACU16470.1| unknown [Glycine max]
 gb|KHN06030.1| Putative glutathione S-transferase [Glycine soja]
 gb|AJE59646.1| tau class glutathione S-transferase [Glycine max]
Length=219

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 145/211 (69%), Gaps = 1/211 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEV L   W+SP+  RV  AL +K + Y+   EDL NKS  LLRYNPVHKK+PVL+HNG 
Sbjct  6    EEVILLGKWASPFSNRVDLALKLKGVPYKYSEEDLANKSADLLRYNPVHKKVPVLVHNGN  65

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            P+ ESL+I+EYI++TW N PLLP+ P +RA  RFW+K  +DK+LP+I ++ +     +E+
Sbjct  66   PLPESLIIVEYIDETWKNNPLLPRDPYERALARFWSKTLDDKILPAIWNACWSDENGREK  125

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             V +AL+ LK+++E L   K+FFGG++IG +DI   ++    ++ +EI GL+L+  EKFP
Sbjct  126  AVEEALEALKILQEALK-DKKFFGGESIGLVDIAANFIGYWVAILQEIAGLELLTIEKFP  184

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
             L +W   F NHP I +  PPRD++   FQA
Sbjct  185  KLYKWSQEFINHPVIKEGLPPRDELFAFFQA  215



>ref|XP_011000057.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
 ref|XP_011000058.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 146/214 (68%), Gaps = 1/214 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL   W SP+  RV  AL +K ++YE I +DL NKS  LL+YNP+HKK+PVLLHNGK 
Sbjct  3    EVKLLGAWGSPFSRRVEMALKLKGVEYEYIEQDLANKSPLLLKYNPIHKKVPVLLHNGKA  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            + ESLVILEYI++TW + P+LP+ P D+A  RFWAKF ++K +P+I    + K  E+E+ 
Sbjct  63   MAESLVILEYIDETWKSNPILPEDPYDKAMARFWAKFIDEKCMPAIWQIMWSKENEREKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            + +A+ +LK +E +L   K+FFGG+ IG +DIV  ++        E TG++L++ E+FP+
Sbjct  123  IEEAIQHLKTLENELK-DKKFFGGETIGLVDIVANFIGFWLGAAAEATGMELVNKERFPI  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            L +W+  + N   + ++ PPRDK+I   +  F+A
Sbjct  182  LCKWIDEYVNCSVVKENIPPRDKLIAFLRPRFSA  215



>ref|XP_008240197.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=225

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 150/224 (67%), Gaps = 5/224 (2%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            E VKL  T  S +  R+ WAL +K ++YE I EDL NKS  LL+YNPVHKK+PV +H+ +
Sbjct  2    EGVKLIATTQSLFCTRIEWALKLKGVEYEYIEEDLRNKSPILLKYNPVHKKVPVFVHDDR  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLL-PSIRSSYFMKGKEQE  479
             I ESLVILEYI++TW   PLLPQ   DRA  RFWAKF ++K++  + R+    +G+E+E
Sbjct  62   AIAESLVILEYIDETWKEHPLLPQDSYDRAIARFWAKFADEKVVFGAWRACTAAEGEEKE  121

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
              +  AL++L  +E+Q+  GK+FFGG+ IG+LD+ LGW+ +  +  EE  G+KL++AE+F
Sbjct  122  TAIESALESLAYLEKQIE-GKKFFGGEEIGYLDLALGWIPHWLNTMEEAGGMKLLEAERF  180

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQA---IFNAIEANK  176
            P L EW HNF   P I +  PPR+K++    A      ++ ANK
Sbjct  181  PSLHEWGHNFIQIPLIKECLPPREKLVNYLNASLTYLRSLSANK  224



>gb|AFY26875.1| glutathione-S-transferase [Ipomoea batatas]
Length=224

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 142/218 (65%), Gaps = 1/218 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL  +  S +  RV WAL +K ++YE I EDL NKS  LL+ NPV+KK+PVLL N  
Sbjct  2    EEVKLIGSSPSLFCTRVEWALRLKGVKYEYIKEDLRNKSDLLLKSNPVYKKVPVLLINHN  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
             I ESL+ILEYI+D+W + PLLPQ P +RA  RFWAKF +DK L    ++   +G+E+  
Sbjct  62   SIAESLIILEYIDDSWKHYPLLPQDPFERAQARFWAKFADDKCLMGTWTACMAEGEEKVR  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             +    ++   IE+Q+  GK+FFGG+ IGFLD+ +GW+    +V EE+ G+KL+D EKFP
Sbjct  122  AIESVQESFAFIEKQIE-GKKFFGGEEIGFLDLGIGWICLWLNVMEEVGGMKLLDPEKFP  180

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEA  182
             L  W  NF   P I    PPRD ++  F+A  N I++
Sbjct  181  CLHNWAQNFIKIPVIHQFLPPRDDLLNYFKASLNYIQS  218



>ref|XP_008235548.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=221

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 144/211 (68%), Gaps = 4/211 (2%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL+  W SPYG RV+WAL +K ++YE I EDL NKS  LL+YNPVHKKIPVL+HNGK
Sbjct  2    EEVKLFGAWPSPYGYRVIWALELKGVKYEYIEEDLANKSDLLLQYNPVHKKIPVLVHNGK  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKEQE  479
            PI ES VILEYI++TW   PLL   P +R   RFW KF ++K LP   +++FM  G+E E
Sbjct  62   PIAESSVILEYIDETWPQNPLLSDDPHERYLARFWTKFIDEKGLPF--ATFFMADGEEHE  119

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            +   +  D LK++EEQ   G++FFGGD IG  D+ LG++A+   V E++ G+K++ A  F
Sbjct  120  KAAKEVKDLLKILEEQAL-GEKFFGGDEIGLADLALGFIASSFGVIEQLVGVKVLHANDF  178

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            P L  W++NF  +PAI  +    D+M   ++
Sbjct  179  PRLCNWINNFKENPAIKQNLLNHDQMFVYYK  209



>ref|XP_003632026.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=224

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 136/205 (66%), Gaps = 1/205 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL   W+SP+  RV+WAL +K I YE + ED  NK+  LL++NPVHKK+PVL+H GKP
Sbjct  3    EVKLLGFWASPFSDRVIWALKLKGINYEYVEEDPYNKTQLLLQHNPVHKKVPVLIHAGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ES +ILEYIE+TW   PLLPQ   +RA  RFW KF E+K + +I +     G EQE  
Sbjct  63   IAESSMILEYIEETWPQNPLLPQGAYERAMARFWIKFGEEK-MATICAVLRTSGAEQERA  121

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
              +A++ LK++EEQ  G K+FFGGD IG  DI  GWLA L  V EE+ G+K++DA + P 
Sbjct  122  TKEAMELLKILEEQGLGDKKFFGGDAIGLADIAFGWLAYLFGVIEEVAGVKVLDANRLPR  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMI  218
            L  W+ N    P I ++ P R K++
Sbjct  182  LHAWIDNLKEVPVIKENLPDRQKLL  206



>ref|XP_007200426.1| hypothetical protein PRUPE_ppa011079mg [Prunus persica]
 gb|EMJ01625.1| hypothetical protein PRUPE_ppa011079mg [Prunus persica]
Length=224

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/222 (48%), Positives = 143/222 (64%), Gaps = 5/222 (2%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILED-LTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EVKL   W SPY  RV+WAL +K ++YE + ED L NKS  LL+YNPVHKK+PVL+H+GK
Sbjct  3    EVKLLGAWPSPYVYRVIWALKLKGVEYEYVEEDVLFNKSDQLLKYNPVHKKVPVLVHDGK  62

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ES+VILEYIE+ W   PLLP+    RA  RFWAKF E+K   +    +F+ G+EQ +
Sbjct  63   PIAESIVILEYIEEAWPQNPLLPKDHHQRAEARFWAKFGEEKNR-AFLGFFFVTGEEQVK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             + +A ++L ++EE   G K+FFGGD IG  D+  GW+A    V EE  G+K+++ + FP
Sbjct  122  AIKEAQESLGILEEHGLGNKKFFGGDEIGLADLAFGWIAWWLEVLEEAAGVKVLEDDSFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQ---AIFNAIEAN  179
             L  WM +F   P I +  P R  M+T F+   A F A  A+
Sbjct  182  QLKAWMQSFKEFPTIKESLPDRSAMLTYFKGRRATFVASAAD  223



>ref|XP_007034533.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOY05459.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=224

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 141/220 (64%), Gaps = 2/220 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+ +W+SP+  RV+WAL IK + YE I EDL+NKS  LL+YNPV+KKIPVL+H GKP
Sbjct  3    EVKLHGSWASPFSHRVIWALKIKGVDYEYIEEDLSNKSELLLKYNPVYKKIPVLVHGGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGK-EQEE  476
            I ESLVILEYIE+TW   PLLP  P +RA  RFW +F EDK  P  R+ +   G+ EQE+
Sbjct  63   IAESLVILEYIEETWPENPLLPSDPYERAMARFWIQFVEDK-GPIFRAFFLSTGREEQEK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               + L+ LK+IEE+  G K+FFGGD I  +DI  G LA      EE+ G+ +++    P
Sbjct  122  AAKELLEVLKIIEEKALGEKKFFGGDTINLVDISYGVLAYWFKNVEEVIGIMVLEPNTLP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
             L EW  NF     I +  P RDKM+   + +   I A +
Sbjct  182  RLHEWAQNFKEVAVIKETIPDRDKMLAYLRRVREKIVAEQ  221



>ref|XP_010037768.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49501.1| hypothetical protein EUGRSUZ_K03019 [Eucalyptus grandis]
Length=224

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 144/214 (67%), Gaps = 2/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDL-TNKSHHLLRYNPVHKKIPVLLH  665
            M EE+KL   W S +  RV  AL IK ++YE + ED+  NKS  LL+YNPVHKK+PVL+H
Sbjct  1    MGEELKLLGAWGSSFSRRVEIALKIKGVEYEYLEEDVFQNKSDLLLQYNPVHKKVPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            NGKPI ESLVIL+YI++TW + P+LP+ P +RA  RFWAKF ++K  P++  SY   G E
Sbjct  61   NGKPIAESLVILKYIDETWKDNPILPRDPYERAMARFWAKFLDEKCRPALWKSYTSVGPE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            +E+   +A + L  +E +L  GK+FFGG+ +GFLDIV  ++     V +E  G+ ++  E
Sbjct  121  REKAHEEAQELLSTLEGELK-GKKFFGGETVGFLDIVANFVGYWAGVLQEAVGVDVLTEE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            KFPVL +W   F N P I ++ PPRD+++  F+ 
Sbjct  180  KFPVLCKWAEGFQNCPVIWENLPPRDRLVGFFKT  213



>ref|XP_010037777.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49512.1| hypothetical protein EUGRSUZ_K03036 [Eucalyptus grandis]
Length=226

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 148/214 (69%), Gaps = 2/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLT-NKSHHLLRYNPVHKKIPVLLH  665
            M EE+KL+ +W SP+  R+  AL IK ++YE + ED+  NKS  LL+YNPVHKK+PVL+H
Sbjct  1    MGEELKLFGSWGSPFSRRIEIALKIKGVEYEYLEEDIIHNKSALLLKYNPVHKKVPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            N KPI ES VILEYI++TW++ P+LP+ P  RA  RFWAKF ++K +P+I  S+   G E
Sbjct  61   NSKPIAESQVILEYIDETWNDNPILPRDPYKRAMARFWAKFIDEKCVPTIWKSFMSGGPE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            +E+   +A + L  +E +L  GK+FFGG+ +GF+DIV  ++++     +E  G+ ++  +
Sbjct  121  REKAHEEACELLSTLEGELK-GKKFFGGETVGFVDIVASFISHWVGPVQEAAGVDVLTED  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            KFP+L +W   F N P I ++ PPRDK++  F+A
Sbjct  180  KFPMLYKWAEEFKNCPVIKENLPPRDKILAFFKA  213



>gb|EYU26623.1| hypothetical protein MIMGU_mgv1a013321mg [Erythranthe guttata]
Length=223

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 149/223 (67%), Gaps = 3/223 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL+  W SP   RV  AL +K ++YE I EDL NKS  LL YNPVHKK+PVLLHN
Sbjct  1    MAEEVKLFGAWGSPSTRRVEIALKLKGVKYEYIEEDLKNKSPLLLTYNPVHKKVPVLLHN  60

Query  661  GKPICESLVILEYIEDTWHNT--PLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGK  488
            G+PI ESL+ILEYI+DTW     P+LP+ P  R+  RFWAKF +DK  P I  + + +G+
Sbjct  61   GQPIAESLIILEYIDDTWQQQGPPILPKDPYQRSKARFWAKFLDDKFAPQIWKACWGEGE  120

Query  487  EQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA  308
            E+E+G+ +A ++LKL+E ++  GK+ FGGDN+G +DIV  ++A    + +++ GL     
Sbjct  121  EREKGIEEATESLKLLENEIK-GKKLFGGDNLGLVDIVAHFMAYWSEILQQLLGLDFFTR  179

Query  307  EKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            EK+P L  W   F N   + ++ PP+ +++  F+ + N+  ++
Sbjct  180  EKYPNLFNWGDEFCNCSFVKENLPPKHELVLIFKGLTNSYTSS  222



>ref|XP_008235550.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=222

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 143/222 (64%), Gaps = 3/222 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL  TW SP+  RV+WAL +K ++YE + E+LTNKS  LL+YNPVHKK+PVL+H GKP
Sbjct  3    EVKLLGTWPSPFCYRVIWALKLKGVKYEYVEENLTNKSDRLLQYNPVHKKVPVLVHGGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK-GKEQEE  476
            I ES VILEYIE+ W + PLL   P +RA  RFW KF EDK+  +I  +YF   G+E E+
Sbjct  63   ISESTVILEYIEEVWPHNPLLSDDPYERAMARFWIKFGEDKM--AIFIAYFHSVGEEHEK  120

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               +A + LK IEE+  G K+FFGGD IG  D+  GW+A      EE  G+KL++   FP
Sbjct  121  AKREAQEVLKTIEERGLGEKKFFGGDTIGLADLTFGWIAGCLGEMEEAAGVKLLEPNLFP  180

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK*T  170
             L  W+ NF + P I D+ P  D ++  F+++     A+  T
Sbjct  181  HLQIWIKNFRDVPVIKDNLPEHDGLLAYFKSLREKFTASART  222



>ref|XP_002518188.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF44321.1| glutathione s-transferase, putative [Ricinus communis]
Length=220

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 141/219 (64%), Gaps = 2/219 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+  WSSP+  R +WAL +K ++Y+ I EDL NKS  LLRYNPV+KKIPVL+H GKP
Sbjct  3    EVKLHGFWSSPFSCRAIWALKLKRVEYDYIEEDLQNKSEELLRYNPVYKKIPVLVHGGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGK-EQEE  476
            + ESLVILEYIE+TW   PLLP+   +RA  RFW ++C++K  P++ + +    K EQE+
Sbjct  63   VAESLVILEYIEETWPEKPLLPKDAYERAMARFWMQYCDNK-SPTLHAFFGATTKEEQEK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               +A + LK++EE+  G K+FFGGD +  +D+  G  A+     EE+ GLK+++  K P
Sbjct  122  AAKEAFEVLKVLEEKALGDKKFFGGDTVSLVDLTYGLFAHWFQAMEELVGLKVLEQSKLP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
             L  W  NF   P + D+ P  DKM+    ++   +  N
Sbjct  182  KLYAWAKNFKEVPEVKDNLPDYDKMLAHMASVRKKLAKN  220



>dbj|BAC21263.1| glutathione S-transferase [Cucurbita maxima]
Length=226

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 140/215 (65%), Gaps = 7/215 (3%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+ TW SP+  RV+WAL +K I YE + EDL+NKS  LL YNPVHKKIPVL+H GKP
Sbjct  3    EVKLHGTWPSPFSYRVIWALKLKGIPYEYVEEDLSNKSPLLLHYNPVHKKIPVLVHGGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKG-KEQEE  476
            ICES++ILEYI++TW   PLLP  P +RA  RFW KF EDK  P++   +  K  +EQE 
Sbjct  63   ICESMIILEYIDETWPEKPLLPSDPFERATARFWIKFIEDK-GPAVFMIFRAKSDEEQEN  121

Query  475  GVVQALDNLKLIEE-QLNGG----KRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLID  311
               Q+L+ L+ +EE    GG    ++FFGGD IG  D+  GW+A+   V EE+  +KL+D
Sbjct  122  AKKQSLEMLRTVEEWGFRGGDGRERKFFGGDEIGMTDLAFGWIAHWIGVIEEVVNVKLLD  181

Query  310  AEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            A +FP +  W   F +   I D+ P R+ M   F+
Sbjct  182  ANEFPKVYAWTERFKDAAVIRDNLPDRNLMAAAFR  216



>gb|EYU26622.1| hypothetical protein MIMGU_mgv1a013365mg [Erythranthe guttata]
Length=222

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 145/218 (67%), Gaps = 2/218 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEV++  +W+SP+  RV  AL  K ++YE I +DL NKS  LL YNPVHKK+PVLLHN
Sbjct  1    MAEEVQVLGSWASPFSKRVEMALKFKGVEYEYIEQDLKNKSPLLLNYNPVHKKVPVLLHN  60

Query  661  GKPICESLVILEYIEDTWHNT-PLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            GKPI ESL+ILEYI+DTW    P+LP+ P  RAH RFWAKF +DK +P +  + + +G+E
Sbjct  61   GKPIAESLIILEYIDDTWQQGPPILPKDPYQRAHARFWAKFVDDKCMPQVWKACWSEGEE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            +E+ + +A   L+ +E ++  GK+FFGGDN+G +D    +LA    +  E++GL+ +  E
Sbjct  121  REKAMEEASKALEFLENEIK-GKKFFGGDNVGLVDFSANFLAYWCGILAELSGLQFLTEE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            K+P L++W   F     + ++ P + KM+  F  +  A
Sbjct  180  KYPNLTKWADEFCGCSFVKENLPDKGKMVHVFNGLTKA  217



>ref|XP_010069125.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW57370.1| hypothetical protein EUGRSUZ_H00155 [Eucalyptus grandis]
Length=226

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/224 (46%), Positives = 145/224 (65%), Gaps = 1/224 (0%)
 Frame = -2

Query  847  VAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLL  668
            +A  +EV+L   W SP+  RV WAL +K I Y+ I ED+ NKS  LLR NPVH+K+PVL+
Sbjct  1    MANPKEVELLGLWVSPFVRRVEWALKLKGIAYDYIEEDILNKSALLLRLNPVHQKVPVLV  60

Query  667  HNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGK  488
            H G+ ICES +ILEYI++TW  +PLLPQ P DRA  RFWA   E +LL +   +   +G+
Sbjct  61   HGGRVICESFLILEYIDETWKQSPLLPQDPYDRATARFWASVAEGQLLRNAWIALCSEGE  120

Query  487  EQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA  308
            E+E  +  A + L  IE  +  GK FFGG+ IG+LD+ +GW+ +   V++E+  +K+ D 
Sbjct  121  EKERAIEFATEALGHIEGVIE-GKAFFGGEGIGYLDLAIGWVCHWLPVWDELGSMKICDP  179

Query  307  EKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
             KFP +  W   F  HP I ++ PPRDKM+  F+ + + I A+K
Sbjct  180  AKFPAMVAWTSRFVEHPVIKENLPPRDKMVVYFRNMRSQIMASK  223



>ref|XP_010025836.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
Length=292

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 144/223 (65%), Gaps = 1/223 (0%)
 Frame = -2

Query  844  AMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLH  665
            A  EEVKL   W SP+  RV WAL +K I Y+ I ED+ NKS  LLR NP H+K+PVL+H
Sbjct  68   ANPEEVKLLGLWVSPFVWRVEWALKLKGIAYDYIEEDILNKSALLLRLNPAHQKVPVLVH  127

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
             G+ ICES +ILEYI++TW  +PLLPQ P DRA  RFWA   E +LL +   +   +G+E
Sbjct  128  GGRVICESFLILEYIDETWKQSPLLPQDPYDRAMARFWASVAEGQLLKNAWIALISEGEE  187

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            +E  +  A + L   E  +  GK FFGG+ IG+LD+ +GW+++   V++E+  +K++D  
Sbjct  188  KERAIEFATEVLGHFEGVIE-GKAFFGGEGIGYLDLAIGWISHSLPVYDEVGSMKILDPA  246

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
            KFP +  W   F  HPAI ++ PPRDK++  F+   + I A+K
Sbjct  247  KFPAMVAWTGRFVEHPAIKENLPPRDKLVVYFRNKRSQIMASK  289



>gb|ADD71974.1| glutathione S-transferase [Glycine soja]
Length=219

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 145/211 (69%), Gaps = 1/211 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EE+ L   W+SP+  RV  AL +K + Y+   EDL NKS  LLRYNPVHKK+PVL+HNG 
Sbjct  6    EELILLGKWASPFSNRVDLALKLKGVPYKYSEEDLANKSADLLRYNPVHKKVPVLVHNGN  65

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            P+ ESL+I+EYI++TW N PLLP+ P +RA  RFW+K  +DK+LP+I ++ +     +E+
Sbjct  66   PLPESLIIVEYIDETWKNNPLLPRDPYERALARFWSKTLDDKILPAIWNACWSDENGREK  125

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             V +AL+ LK+++E L   K+FFGG++IG +DI   ++    ++ +EI GL+L+  EKFP
Sbjct  126  AVEEALEALKILQEALK-DKKFFGGESIGLVDIAANFIGYWVAILQEIAGLELLTIEKFP  184

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
             L +W   F NHP I +  PPRD++   FQA
Sbjct  185  KLYKWSQEFINHPVIKEGLPPRDELFAFFQA  215



>gb|KDO57582.1| hypothetical protein CISIN_1g043218mg [Citrus sinensis]
Length=226

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 150/222 (68%), Gaps = 3/222 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MA +VKL   WSSP   RVVWAL +K +++E I ED+ NKS  LL  NPVHKK+PVL+H+
Sbjct  1    MATKVKLLGFWSSPPVFRVVWALKLKGVEFENIEEDIFNKSTRLLELNPVHKKVPVLVHD  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
             K I +S VILEYI+ TW + PLLPQ P + A  RFWAKF  +KLL S   + + KG+E+
Sbjct  61   DKVIVDSFVILEYIDVTWQHDPLLPQDPYETAMARFWAKFAYEKLLESAYKAMWSKGEEK  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITG-LKLIDAE  305
            ++ + +A+++L+ IEE    GK F GG++IG+LD+ +GW++    V+EE  G ++++D++
Sbjct  121  QKTMKEAIESLEKIEEL--RGKNFIGGNSIGYLDLAIGWISYWLPVWEEADGSMRILDSQ  178

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            KFP ++EW   F  HP I ++ PPRDK +  F      I A+
Sbjct  179  KFPAIAEWSTKFLKHPVIKENLPPRDKTLAYFHKRAEEIYAD  220



>ref|XP_002525352.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF36990.1| glutathione s-transferase, putative [Ricinus communis]
Length=223

 Score =   205 bits (521),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 136/211 (64%), Gaps = 2/211 (1%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            E+VKL   W SP+  RV+WAL +K + YE + E+L NKS  LL+ NPVH+KIPVLLH GK
Sbjct  2    EQVKLLGAWPSPFSYRVIWALKLKGVSYEYVEENLFNKSEQLLQNNPVHRKIPVLLHGGK  61

Query  655  PICESLVILEYIEDTW-HNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            P+ ES VILEYIE+TW  N PLLPQ P DRA  RFW KF E+K  P+  + +   G++QE
Sbjct  62   PVAESTVILEYIEETWPQNYPLLPQDPHDRAVARFWTKFEEEK-SPTFFAFFQTVGQQQE  120

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            + + +A + L +IEE   G K FFGGD IG  DI  GW+A    V +E  G+KL++A+ F
Sbjct  121  KAITEAKELLGIIEEYGLGEKEFFGGDKIGLADIAFGWIAGWLEVMQEAVGVKLMEADSF  180

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            P L  W+ NF     I +  P  D M+  F+
Sbjct  181  PRLQAWIKNFKEVSVIKEDLPDHDGMLAYFK  211



>ref|XP_010042776.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=224

 Score =   205 bits (521),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 142/214 (66%), Gaps = 2/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDL-TNKSHHLLRYNPVHKKIPVLLH  665
            M EE+KL   W S +  RV   L IK ++YE + ED+  NKS  LL+YNPVHKK+PVL+H
Sbjct  1    MGEELKLLGAWGSSFSRRVEIVLKIKGVEYEYLEEDVFQNKSDLLLQYNPVHKKVPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            NGKPI ESLVILEYI++TW + P+LP+ P +RA  RFWAKF ++K  P++  SY   G E
Sbjct  61   NGKPIAESLVILEYIDETWKDNPILPRDPYERAMARFWAKFLDEKCRPALWKSYTSVGPE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            +E+   +A + L  +E +L  GK+FFGG+ +GFLDIV  ++     V +E  G+ ++  E
Sbjct  121  REKAHEEAQELLSTLEGELE-GKKFFGGETVGFLDIVANFVGYWAGVLQEAVGVDVLTEE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            KFP L +W   F N P I ++ PPRD+++  F+ 
Sbjct  180  KFPALCKWAEGFQNCPVIRENLPPRDRLVAFFKT  213



>ref|XP_007050084.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOX94241.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=222

 Score =   205 bits (521),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 133/209 (64%), Gaps = 1/209 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL  TW SP+  RV+WAL  K ++YE + E++ NKS  LLR NPVHKKIPVL H GK
Sbjct  2    EEVKLLGTWGSPFSYRVLWALKHKGVKYEYVEENVFNKSELLLRSNPVHKKIPVLFHGGK  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ES+VILEYIE+ W   PLLPQ P +R   RFW KF ED   P+    +   G+EQ +
Sbjct  62   PIAESIVILEYIEEIWPENPLLPQDPYERTLSRFWIKFGEDT-APAFYKFFHTVGEEQVK  120

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               +A   LK+IEE   G K+FFGGD IG  DI  GW+A    V  E  G++L++++ FP
Sbjct  121  ATKEARQLLKIIEEHGLGEKKFFGGDKIGLTDIAYGWVACWLDVLAEAAGVQLLESDSFP  180

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKF  209
             L  W  NF   P I ++ P RDKM+T F
Sbjct  181  RLQAWAENFKEVPLIKENLPNRDKMLTFF  209



>ref|XP_010263987.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=220

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 140/204 (69%), Gaps = 1/204 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+  W SP+  RV+WAL +K I+YE I EDLTNKS  LL+YNPVHKKIPVL+H+GKP
Sbjct  3    EVKLFGAWPSPFLYRVIWALKLKGIEYEYIEEDLTNKSDLLLKYNPVHKKIPVLVHDGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ES+VILEYI++TW   PLLP+    RA  RFWAKF EDK  P I S +   G+EQ++ 
Sbjct  63   IAESVVILEYIDETWPENPLLPKDAHQRAVARFWAKFAEDK-GPCIWSLFSTCGEEQDKA  121

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
              ++L+ L+ IEE   G K+FFGGD IG +D+  G +A+   V E++  +KL++A  FP 
Sbjct  122  KKESLEMLRTIEEHCLGEKKFFGGDTIGLVDLAYGGIAHWLVVMEDVLDVKLVEAHTFPR  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKM  221
            L  W+HN      I ++ P R+K+
Sbjct  182  LHSWIHNLKEVAVIKENLPDREKL  205



>ref|XP_002518184.1| glutathione s-transferase, putative [Ricinus communis]
 pdb|4J2F|A Chain A, Crystal Structure Of A Glutathione Transferase Family 
Member From Ricinus Communis, Target Efi-501866
 gb|EEF44317.1| glutathione s-transferase, putative [Ricinus communis]
Length=223

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 141/214 (66%), Gaps = 3/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAE +KL+  W SP+  RV+WAL +K I YE + EDL NKS  LL+YNPVHKKIPVL+H 
Sbjct  1    MAEVLKLHGAWPSPFSCRVIWALKLKGIPYEYVEEDLFNKSPLLLQYNPVHKKIPVLVHG  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPICES +ILEY+++TW   PLLP  P +RA  RFW KF EDK   +I + +  KG+E 
Sbjct  61   GKPICESTIILEYLDETWPENPLLPSDPHERAVARFWVKFIEDKGT-AIWNIFRTKGEEL  119

Query  481  EEGVVQALDNLKLIEEQLNG--GKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA  308
            E+ V   L+ LK IEE   G    ++FGGD IG +DI    +A+   V EE+ G+K++++
Sbjct  120  EKAVKNCLEVLKTIEEHAMGVSDDKYFGGDKIGIVDIAFCGIAHWLGVIEEVAGVKVLES  179

Query  307  EKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            +KFP L  W  NF   P I ++ P RD+M   F+
Sbjct  180  QKFPRLHAWTENFKEAPIIKENLPDRDQMTAFFK  213



>ref|XP_009778650.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana sylvestris]
Length=225

 Score =   205 bits (521),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 139/208 (67%), Gaps = 2/208 (1%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
             E VKL   W+SP+ LRV WAL +K ++Y+   EDL NKS  LL+YNPVHKKIPVL+HNG
Sbjct  3    GEGVKLLGHWASPFALRVHWALKLKGVEYDYQEEDLPNKSPLLLQYNPVHKKIPVLVHNG  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KPI ES VILEYI++TW   PLLP+ P +RA  RFWAKF +DK +P I  ++   G+EQ+
Sbjct  63   KPIAESSVILEYIDETWKKNPLLPEDPYERAKARFWAKFIDDKCVPGIFRTFSKVGEEQQ  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            +   +A +NLKL+E +L+  KR FG   IGF+D+   W+     + EEI  +KLIDAE+ 
Sbjct  123  KIAKEARENLKLLEGELD-KKRVFGDSRIGFIDVASAWIICWAQIVEEIVDIKLIDAEEM  181

Query  298  PVLSEWMHNFYN-HPAILDHWPPRDKMI  218
            P L  W  N     P + +  PP+DK++
Sbjct  182  PSLVAWFENVLEAAPVLKECTPPKDKLL  209



>emb|CDP08048.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 146/234 (62%), Gaps = 6/234 (3%)
 Frame = -2

Query  829  VKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKPI  650
            VKL+  W SP+  RV WAL +K IQYE I ED  NKS  LL+ NPV+ K+PVL+HNGKPI
Sbjct  7    VKLFGFWVSPFAQRVKWALKLKGIQYEYIEEDKYNKSPLLLKLNPVYGKVPVLVHNGKPI  66

Query  649  CESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEGV  470
             ES++ILEYI++ W   PLLPQ P +RA   FWAKF E+K+  S+  +    G E+++ V
Sbjct  67   SESIIILEYIDEVWKQAPLLPQDPYERAQAHFWAKFAEEKVRQSVVEAMCSSGDEKQKAV  126

Query  469  VQALDNLKLIEEQLN-GGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
              A++  +  E++L   G +FFGG+ IGF+DIV G ++    V EE+  LK++D+ KFP 
Sbjct  127  KLAVEAFEEFEKELKRRGTKFFGGETIGFVDIVAGCISYQLPVHEEVGSLKILDSSKFPA  186

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK*T-----VLHEVADI  146
            +SEW  NF NHP I +  P +D+M   +      I   K +     V+ E  D+
Sbjct  187  ISEWTRNFLNHPLINEGLPQKDQMFAYYSKRSKEIAYQKMSHKTSIVIREFTDV  240



>gb|KDP40336.1| hypothetical protein JCGZ_02334 [Jatropha curcas]
Length=230

 Score =   204 bits (520),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 143/216 (66%), Gaps = 2/216 (1%)
 Frame = -2

Query  847  VAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLL  668
            +A  EEVKL   W SP+  RV WAL +K + YE I ED+ NKS  LL+ NPV+KK+PVL+
Sbjct  1    MAKKEEVKLLGLWVSPFVRRVEWALKLKGVDYEYIEEDIFNKSPLLLQLNPVNKKVPVLV  60

Query  667  HNGKPICESLVILEYIEDTW-HNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKG  491
            H  K I ES VILEYI++TW HN PLLPQ P  RA  RFWAKF E+K+  +  ++    G
Sbjct  61   HGNKVIAESFVILEYIDETWKHNYPLLPQDPYQRAKARFWAKFAEEKIFEAAWNALCSLG  120

Query  490  KEQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLID  311
             E+E  +   ++ L+ +E +L  GK+FFGG+NIG++DI+ GW++    V+EE+  +K ID
Sbjct  121  DEKERAIKMTIEALEKLEGELE-GKQFFGGENIGYVDILAGWISYWLPVWEEVGSMKFID  179

Query  310  AEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            A +FP +  WM  F NH  I ++ PPR+KM   F +
Sbjct  180  ALQFPSICSWMDRFLNHDVIKNNLPPREKMAVYFNS  215



>ref|XP_002285220.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=227

 Score =   204 bits (520),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 141/210 (67%), Gaps = 1/210 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            +EVKL   W+SP+  RV+WAL +K + YE I ED+ NKS  LL+ NP+HK +PVL+H  +
Sbjct  4    QEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDVFNKSPLLLQLNPLHKSVPVLIHGHR  63

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
             ICES VI++YI++TW   PLLPQ+P +RA  RFWA+F E KL+ S       +G+E+E 
Sbjct  64   VICESFVIVQYIDETWPQYPLLPQNPYERAMARFWAEFAESKLMESAWMGQCSRGEERER  123

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
                A++ ++ IEE L  GK+ FGG++IG+LDI LGWL+    ++EE+  +++ID  KFP
Sbjct  124  AANLAMETVEKIEE-LVKGKKLFGGESIGYLDICLGWLSYWLPIWEEVGCMQIIDPIKFP  182

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
              S W+    +HP I D+ P R+ MI  FQ
Sbjct  183  ATSSWIDTVLHHPVIRDNLPAREAMIVYFQ  212



>ref|XP_002524046.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF38414.1| glutathione s-transferase, putative [Ricinus communis]
Length=229

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 145/220 (66%), Gaps = 2/220 (1%)
 Frame = -2

Query  847  VAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLL  668
            +A  EEVK+   W SP+  R   AL +K I YE + E+L NKS  LL+YNP++KKIPVL+
Sbjct  1    MAGQEEVKVLGGWFSPFAFRAEVALKLKGISYEAVAENLANKSPELLKYNPIYKKIPVLV  60

Query  667  HNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGK  488
            HNGKPI ESL+I+EYI++ W + P+LP+ P +RA  RFWA F ++KL+ ++R       +
Sbjct  61   HNGKPITESLIIIEYIDEVWKHNPVLPEDPYERAMARFWAYFVDNKLMEAVRRVINTTEE  120

Query  487  E-QEEGVVQALDNLKLIEEQLNG-GKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLI  314
            E +++ V +A + L++IE++L   G +FFGGD +G++D+ +GW+ N     E    +K+ 
Sbjct  121  EAKQKEVEKAKEALQVIEKELKAKGNKFFGGDTVGYVDVAMGWIPNWVGAIEAAFSVKIH  180

Query  313  DAEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFN  194
            D E FP+L EWMHNF   P I +  P +DK+I  F+ +  
Sbjct  181  DPENFPLLDEWMHNFTQVPIIQEALPQQDKLIAYFKQLLT  220



>ref|XP_004290016.1| PREDICTED: glutathione transferase GST 23-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=223

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 136/211 (64%), Gaps = 2/211 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILED-LTNKSHHLLRYNPVHKKIPVLLHNGK  656
            +V +   W SPY  RV+WAL +K + YE + ED L NKS  LL+YNPVHKK+PVL+H GK
Sbjct  3    QVTVLGAWPSPYVYRVIWALKLKGVDYEYVEEDVLHNKSDRLLKYNPVHKKVPVLVHAGK  62

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ES VILEYIE+TW   PLLP+ P  RA  RFW KF EDK   ++   +  +G++QE+
Sbjct  63   PIAESAVILEYIEETWPQNPLLPKDPHQRALARFWIKFGEDK-SAALFGFFMTEGEQQEK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               +  + L+++EEQ  G K+FFGGD IG  D+  GWLA    V  EI G+K+IDAE FP
Sbjct  122  ATKEGQEQLRILEEQGLGEKKFFGGDEIGMADLEFGWLAWWLDVMSEIAGVKVIDAESFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
             L  W+  F +  AI +  P R  M+T F+ 
Sbjct  182  RLHAWIQRFKDISAIKEPLPDRSAMLTYFKG  212



>ref|XP_002266900.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=236

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 145/228 (64%), Gaps = 5/228 (2%)
 Frame = -2

Query  859  LAITVAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKI  680
            +A      E+VKL   W SP+  RV WAL  K I+YE + EDLTNKS  LL  NPVH+K+
Sbjct  1    MASGAMQEEQVKLLGIWVSPFVKRVEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKV  60

Query  679  PVLLHNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYF  500
            PVLLHNG PI ESLVI+EYI++ W   P+LPQ P +RA  RFWA F E K+  + R++  
Sbjct  61   PVLLHNGNPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALV  120

Query  499  MKGKEQEEGVVQALDNLKLIE----EQLNGGKRFFGGDN-IGFLDIVLGWLANLPSVFEE  335
             +G++QE+ V +  + ++++E     +LN    FFGG N +G++DIVLGW+ N   V EE
Sbjct  121  TEGEQQEKVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEE  180

Query  334  ITGLKLIDAEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
            + G K++D +K P + +WM NF   P I     P++KM+  FQ +  A
Sbjct  181  VGGFKVLDPQKQPHIHKWMANFVEVPLIKPTLLPKEKMVVYFQMVRQA  228



>ref|XP_010037778.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=224

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 144/214 (67%), Gaps = 2/214 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLT-NKSHHLLRYNPVHKKIPVLLH  665
            M EE+KL   W S Y  RV  AL IK ++YE + +++  NKS  LL+YNPVHKK+PVL+H
Sbjct  1    MEEELKLLGMWGSLYSRRVEMALKIKRVKYEYLEQEIFHNKSALLLKYNPVHKKVPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            NGKPI ES +ILEYI++TW + P+LPQ P +RA  RFWAKF ++K +P++  S    G E
Sbjct  61   NGKPIAESQMILEYIDETWKDNPILPQDPYERAMARFWAKFVDEKCVPALWKSCMSVGPE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            +E+   +A + L  +E +L  GK+FFGG+NIGF+DIV   LA    V +E  G+ ++  +
Sbjct  121  REKAQEEACELLSTLEGELK-GKKFFGGENIGFVDIVGDVLAYWVGVLQEAVGVDVLTED  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            KFPVL  W  +F N P + ++ PPRDK++  F+ 
Sbjct  180  KFPVLCRWAEDFRNCPVVKENLPPRDKLLAFFKT  213



>emb|CAN60691.1| hypothetical protein VITISV_044168 [Vitis vinifera]
Length=224

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 136/205 (66%), Gaps = 1/205 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL   W+SP+  RV+WAL +K I YE + ED  NK+  LL++NPVHKK+PVL+H GKP
Sbjct  3    EVKLLGFWASPFSDRVIWALKLKGINYEYVEEDPYNKTQLLLQHNPVHKKVPVLIHAGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ES +ILEYIE+TW   PLLPQ   +RA  RFW KF E+K + +I +     G EQE  
Sbjct  63   IAESSIILEYIEETWPQNPLLPQGAYERAMARFWIKFGEEK-MATICAVLRTSGAEQERA  121

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            + +A++ LK++EEQ  G K+FFGGD IG  DI  GWLA L  V EE+ G+K++DA + P 
Sbjct  122  IKEAMELLKILEEQGLGDKKFFGGDAIGLADIAFGWLAYLYGVIEEVAGVKVLDANRLPR  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMI  218
            L  W+ N    P I ++ P   K++
Sbjct  182  LHAWIDNLKEVPLIKENLPDHQKLL  206



>ref|XP_007221843.1| hypothetical protein PRUPE_ppa024247mg [Prunus persica]
 gb|EMJ23042.1| hypothetical protein PRUPE_ppa024247mg [Prunus persica]
Length=218

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 142/214 (66%), Gaps = 5/214 (2%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+  WSSP+  RV+WAL +K I Y+ I EDL  KS  LL+YNPVHKKIPVL+H G+P
Sbjct  3    EVKLHGFWSSPFSCRVIWALKLKGIPYDYIEEDLHKKSPELLKYNPVHKKIPVLVHGGRP  62

Query  652  ICESLVILEYIEDTW-HNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            ICES++I+EYIE+TW H  P LP  P +RA  RFW K+ E+K  P+I       G EQ +
Sbjct  63   ICESMIIVEYIEETWPHKHPFLPTDPYERAVARFWVKYVEEK-GPAIWMVSQTTGDEQVK  121

Query  475  GVVQALDNLKLIEEQLNG--GK-RFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
               ++L+ L+ I+    G  GK +FFGGDNIG LDI LG++A+   V E++ G+KL +A 
Sbjct  122  FKKESLEVLRTIDNHAAGTLGKNKFFGGDNIGILDIALGYIAHWTEVIEDVAGVKLFEAH  181

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
             FP L  W  NF   PAI ++ P RDKM+  F+ 
Sbjct  182  AFPYLHAWTQNFKEVPAIKENLPDRDKMLVHFKG  215



>gb|ADB11369.1| tau class glutathione transferase GSTU43 [Populus trichocarpa]
Length=227

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 144/209 (69%), Gaps = 1/209 (0%)
 Frame = -2

Query  829  VKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKPI  650
            VKL+    SP+  RV+WAL +K I+YE + +DL+NKS+ LL+YNP++KKIPVL+H+GKPI
Sbjct  4    VKLFGLSPSPFSQRVIWALKLKGIRYEYVEDDLSNKSNLLLQYNPIYKKIPVLVHDGKPI  63

Query  649  CESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEGV  470
             ES+VILEYI++TW   PLLP+ P +R+ +RFWAKF +++L P + S +   G++QE+ +
Sbjct  64   AESMVILEYIDNTWPENPLLPKDPHERSLVRFWAKFIDERLKP-MMSFFTYVGEQQEKAI  122

Query  469  VQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPVL  290
               L  L++IEE   G ++F  GD IG  DI LGW+ +  +  EEI G+K + A+ FP+L
Sbjct  123  NDNLQTLRIIEEHGLGEQKFLSGDRIGLADIALGWIIHTLAAMEEIVGVKFVQADTFPLL  182

Query  289  SEWMHNFYNHPAILDHWPPRDKMITKFQA  203
              WM NF   P I D+ P  D+++  F+ 
Sbjct  183  HAWMKNFREIPVIKDNLPSHDQILDYFKG  211



>emb|CDP15482.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 144/220 (65%), Gaps = 1/220 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
             E++KL  T SS +  R VWAL IK ++Y  I E+L NKS  LL  NPV+KK+PVL+H G
Sbjct  3    GEDLKLLGTRSSSFVWRTVWALKIKGLEYTYIEENLYNKSSLLLELNPVYKKVPVLVHRG  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KPICESLVI+EYI++TW   P+LP+ PL+RA+ RFWAKF ++KL  S        G+EQ 
Sbjct  63   KPICESLVIIEYIDETWKENPILPEDPLERAYARFWAKFSDEKLAESAGQVLRTTGEEQA  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            + + +  + ++++E +++ GK+FFGGD IG+LDIV+GW A      EE+   K +D+ K+
Sbjct  123  KALERMTEAMEILEREIS-GKKFFGGDKIGYLDIVIGWSAYWLQFLEEVGCFKAMDSTKY  181

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            P L  WM NF   P I  + P  D++++ F+   N I A 
Sbjct  182  PCLHLWMKNFIEFPLIKKNLPTPDELLSTFRPYRNMILAR  221



>ref|XP_004309296.1| PREDICTED: glutathione transferase GST 23-like [Fragaria vesca 
subsp. vesca]
Length=223

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 145/223 (65%), Gaps = 3/223 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLT-NKSHHLLRYNPVHKKIPVLLH  665
            MA++VKL+ TW SP+  RV+WAL +K I Y+   E L   KS  LL+YNPVHKKIPVL+H
Sbjct  1    MADQVKLFGTWCSPFSTRVIWALKLKGIPYDYTEEHLPYKKSDQLLKYNPVHKKIPVLVH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
              KPICES+VI+EY+E+TW   PLLP  P +RA  RFW KF ED   P++   +   G+E
Sbjct  61   GDKPICESMVIIEYLEETWSQNPLLPSDPYERAMARFWVKFAEDT-APAVWMVFRTTGEE  119

Query  484  QEEGVVQALDNLKLIEEQLN-GGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA  308
            QE+   + L+ L+ IEE      KRFFGGD+IG +DI  G++A    V EE+ G++L++ 
Sbjct  120  QEKAKKETLELLRTIEEHAGLDKKRFFGGDSIGIVDIAFGYIARWYGVIEELVGVQLLEP  179

Query  307  EKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
              FP +  W ++F + P I ++ P  D+M+  F+ I  ++ A+
Sbjct  180  HAFPHVHAWTNSFKDVPVIKENLPDHDRMVAFFKTIRESLLAS  222



>ref|XP_002315607.2| hypothetical protein POPTR_0010s07100g [Populus trichocarpa]
 gb|EEF01778.2| hypothetical protein POPTR_0010s07100g [Populus trichocarpa]
Length=230

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 135/199 (68%), Gaps = 1/199 (1%)
 Frame = -2

Query  796  GLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKPICESLVILEYIE  617
             +RV+WAL +K I YE I EDL+NKS  LL+ NPVHKKIPVL+H GK ICESLVILEY+E
Sbjct  26   SVRVIWALKLKGIPYEYIEEDLSNKSPLLLQCNPVHKKIPVLIHGGKSICESLVILEYME  85

Query  616  DTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEGVVQALDNLKLIE  437
            +TW   PL+P  P +RA  RFW KF EDK + ++   ++  G+EQE+ V  +L+ LK IE
Sbjct  86   ETWPQIPLMPDDPYERARARFWVKFVEDKGV-AVWIMFYSSGEEQEKAVKDSLEMLKTIE  144

Query  436  EQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPVLSEWMHNFYNHP  257
            E   G KRFF GD I  +DI  GW+A    V EE+ G+KLI+ +KFP L  W+ NF + P
Sbjct  145  EHALGKKRFFCGDKISLVDIAYGWIAQWLEVLEEVAGIKLIEPQKFPRLHTWIKNFKDEP  204

Query  256  AILDHWPPRDKMITKFQAI  200
             I ++ P  D+M+  F+ +
Sbjct  205  IIKENLPGHDEMLVYFKPL  223



>emb|CBI26437.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 143/220 (65%), Gaps = 5/220 (2%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            E+VKL   W SP+  RV WAL  K I+YE + EDLTNKS  LL  NPVH+K+PVLLHNG 
Sbjct  4    EQVKLLGIWVSPFVKRVEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNGN  63

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ESLVI+EYI++ W   P+LPQ P +RA  RFWA F E K+  + R++   +G++QE+
Sbjct  64   PIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQEK  123

Query  475  GVVQALDNLKLIE----EQLNGGKRFFGGDN-IGFLDIVLGWLANLPSVFEEITGLKLID  311
             V +  + ++++E     +LN    FFGG N +G++DIVLGW+ N   V EE+ G K++D
Sbjct  124  VVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGFKVLD  183

Query  310  AEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
             +K P + +WM NF   P I     P++KM+  FQ +  A
Sbjct  184  PQKQPHIHKWMANFVEVPLIKPTLLPKEKMVVYFQMVRQA  223



>ref|XP_007034540.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOY05466.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=224

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 138/212 (65%), Gaps = 2/212 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+  W+SP+  RV+WAL IK + YE I EDL+NKS  LL+YNPV+KKIPVL+H GKP
Sbjct  3    EVKLHGFWASPFSQRVIWALKIKGVDYEYIEEDLSNKSELLLKYNPVYKKIPVLVHGGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYF-MKGKEQEE  476
            I ESLVILEYIE+TW   PLLP  P +RA  RFW +F  DK  P  R+ +    G+EQE+
Sbjct  63   IAESLVILEYIEETWPENPLLPSDPYERAMARFWIQFVADK-SPVFRAFFLSTGGEEQEK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               + L+ LK+IEE+  G K+FFGGD I  +DI  G LA    + ++I G+K+++    P
Sbjct  122  AARELLEVLKIIEEKALGEKQFFGGDTINLVDISYGVLAYWLKIMQDIIGVKVLEPNTLP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
             L EW  NF     I +  P RDK++   + +
Sbjct  182  RLHEWAQNFMEVAVIKETIPDRDKLLAHIRGV  213



>ref|XP_004507184.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=218

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 144/210 (69%), Gaps = 1/210 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EV+L   WSSP+  RV  AL +K + Y+   E+L NKS  LL++NPV+KK+PVL+HNG P
Sbjct  8    EVRLLGKWSSPFSNRVDLALKLKGVSYKYSDENLANKSDDLLKFNPVYKKVPVLVHNGNP  67

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESLVI+EYI++TW N  LL Q P +RA  RFW+K  +DK+LP+I ++ ++  K +E+ 
Sbjct  68   ISESLVIVEYIDETWTNNSLLSQDPYERALARFWSKTLDDKILPAIWNACWIDEKGREKA  127

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V +AL+ LK++E  LN  K+FFGG+ IG +DI   ++    SV +EI GL+L+  EKFP 
Sbjct  128  VEEALEALKILEGALN-DKKFFGGETIGLVDIAANFIGYWVSVLQEIKGLELLTIEKFPK  186

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            L +W   F NHP I +  PPRD++   F+A
Sbjct  187  LFKWSQEFINHPVIKEGLPPRDELFAFFKA  216



>ref|XP_009370935.1| PREDICTED: glutathione transferase GST 23-like [Pyrus x bretschneideri]
 ref|XP_009370948.1| PREDICTED: glutathione transferase GST 23-like [Pyrus x bretschneideri]
Length=223

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 139/210 (66%), Gaps = 2/210 (1%)
 Frame = -2

Query  829  VKLYRTWSSPYGLRVVWALNIKHIQYETILED-LTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            VKL   W+SPY  RV+WAL +K ++YE + ED L NKS  LL+YNPVHKK+PVL+H+GKP
Sbjct  4    VKLLGAWASPYVYRVIWALKLKGVEYEYVEEDVLFNKSDELLKYNPVHKKVPVLVHDGKP  63

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ES++ILEYIE+ W + PLLP+ P  RA  RFWAKF EDK   +    +F  G+EQ + 
Sbjct  64   IAESIIILEYIEEVWPHNPLLPKDPHQRAEARFWAKFGEDK-NGAFLGLFFATGEEQVKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            + +A +NLK++EE   G K+FF G+ IG  D+  GW+A    V EE  G+K+ + + FP 
Sbjct  123  IKEAQENLKILEEHGLGNKKFFSGNEIGLADLAFGWIALWLEVLEEAAGVKVFERDSFPR  182

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            L  W+ +F   P I ++ P R+ ++  F+ 
Sbjct  183  LHAWIQSFKESPTIKENLPERNALLNYFKG  212



>ref|XP_003632015.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=227

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 140/210 (67%), Gaps = 1/210 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            +EVKL   W+SP+  RV+WAL +K + YE I ED+ NKS  LL+ NP+HK++PVL+H  +
Sbjct  4    QEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDIFNKSPLLLQLNPLHKRVPVLIHGHR  63

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
             ICES VI++YI++TW   PLLPQHP +RA  RFWA+F E KLL +       +G+E+E 
Sbjct  64   VICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLLETAWMGICSRGEERER  123

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
                A++ +  IEE L  GK+ FGG++IG+LDI LGW++    ++EE+  +++ID  KFP
Sbjct  124  AAKLAIEAVAKIEE-LVKGKKLFGGESIGYLDICLGWISYWLPIWEEVGCMQIIDPIKFP  182

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
              S W+    +HP I D+ P R+ MI   Q
Sbjct  183  ATSSWIDTVLHHPVIRDNLPAREAMIVYVQ  212



>ref|XP_006420235.1| hypothetical protein CICLE_v10006671mg [Citrus clementina]
 gb|ESR33475.1| hypothetical protein CICLE_v10006671mg [Citrus clementina]
Length=231

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 150/226 (66%), Gaps = 6/226 (3%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M  +VKL   W SP+  RVVWAL +K +++E I ED+ NKS  LL  NPVHKK+PVL+H+
Sbjct  1    MTTKVKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHD  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCED----KLLPSIRSSYFMK  494
             + I ES VILEYI++TW   PLLPQ P ++A  RFWAKF ++    KLL S   + + K
Sbjct  61   KRVIVESFVILEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKVTVKLLESAYKAMWSK  120

Query  493  GKEQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITG-LKL  317
            G+E+++ + +A+++L+ IEE L  GK F GG++IG+LD+ +GW+     V+EE  G +++
Sbjct  121  GEEKQKAMKEAVESLEKIEEVLR-GKNFMGGNSIGYLDLAIGWIGYWIPVWEEAGGSMRI  179

Query  316  IDAEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            +D++KFP ++EW   F  HP I ++ PPRD+ +         I AN
Sbjct  180  LDSQKFPAIAEWSTKFQKHPVIKENLPPRDRTLAYCHKRAEEIYAN  225



>emb|CAN63628.1| hypothetical protein VITISV_018696 [Vitis vinifera]
Length=227

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 141/210 (67%), Gaps = 1/210 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            +EVKL   W+SP+  RV+WAL +K + YE I ED+ NKS  LL+ NP+HK++PVL+H  +
Sbjct  4    QEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDIFNKSPLLLQLNPLHKRVPVLIHGHR  63

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
             ICES VI++YI++TW   PLLPQHP +RA  RFWA+F E KLL +       +G+E+E 
Sbjct  64   VICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLLETAWMGICSRGEERER  123

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
                A++ ++ IEE L  GK+ FGG++IG+LDI LGW++    ++EE+  +++ID  KFP
Sbjct  124  AAKLAIEAVEKIEE-LVKGKKLFGGESIGYLDICLGWISYWLPIWEEVGCMQIIDPIKFP  182

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
              S W+    +HP I D+ P R+ MI   Q
Sbjct  183  ATSSWIDTVLHHPVIRDNLPAREAMIVYVQ  212



>ref|XP_002275657.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=218

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 144/213 (68%), Gaps = 1/213 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL   W S + LRV  AL +K +QYE I  DLTNKS  LL+ NPVHKK+PVLLHN
Sbjct  1    MAEEVKLIGMWVSSFSLRVEIALKLKGVQYEYIEVDLTNKSPLLLKSNPVHKKVPVLLHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ESLVILEYI++TW + P+LPQHP DRA  RFWAK+ ++K +P++  + + + KE+
Sbjct  61   GKPIAESLVILEYIDETWKDNPILPQHPYDRAMARFWAKYIDEKCVPALWKACWCEEKER  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ V +A   LK +E +L   K+FFGG+++GF+DIV  ++        E  G++L+  +K
Sbjct  121  EKAVEEACVCLKTLENELK-DKKFFGGESVGFVDIVANFIGFWVGAIGEAVGVELLTRDK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            FP+L +W         I ++ P +DK++  ++ 
Sbjct  180  FPILCKWSDEHVGCRVIKENLPSKDKVVAFYRT  212



>emb|CAN73675.1| hypothetical protein VITISV_001110 [Vitis vinifera]
Length=221

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 147/222 (66%), Gaps = 1/222 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKL+ TW+SP+  R+  AL +K +Q+E I E+L NKS  LL+YNPVHKKIPVL+HN
Sbjct  1    MAEEVKLFGTWASPFSRRIEVALKLKGVQFEYIEENLXNKSPALLKYNPVHKKIPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKP+ ESLVILEYI++TW + P+LP  P ++A  RFWAK+ +DKL P+       KG+EQ
Sbjct  61   GKPVAESLVILEYIDETWKHNPILPTDPYEKAMARFWAKYMDDKLWPAATKVVVSKGEEQ  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            +  + +  + LK +E +L   K+FFGG+++GF+DI    +  L    E +  ++++  EK
Sbjct  121  KAVIEEIQEQLKTLESELK-EKKFFGGESLGFVDIAANIIVFLLVAQEALGLMEILTEEK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
            FPVL EW     +     +  PPR++ +  F+A F +  A+K
Sbjct  180  FPVLHEWYZRLVDDAVFKECVPPRERHLGFFKARFGSSTASK  221



>gb|KHG09979.1| Glutathione S-transferase U8 -like protein [Gossypium arboreum]
Length=225

 Score =   203 bits (516),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 139/209 (67%), Gaps = 2/209 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDL-TNKSHHLLRYNPVHKKIPVLLH  665
            M EEVK++  W+SPY  R   AL +K + YE I ED+  NKS  LL+YNPVHKK+PVLLH
Sbjct  1    MGEEVKVFGYWASPYSYRAELALKLKGVSYEYINEDIFGNKSDLLLKYNPVHKKVPVLLH  60

Query  664  NGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            NGKPI ES+VILEYIE+TW + P LPQ P D+A  RFW KF ++K  P++  + +    E
Sbjct  61   NGKPIVESVVILEYIEETWKHNPYLPQDPYDKATARFWIKFIDEKCFPTLWLAAWSSENE  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            +E+   +A + +K +E  LN GK+FFGG+ IG +DIV   +     V +EI GL L+ A+
Sbjct  121  REKVTNEACEYMKTLESALN-GKKFFGGETIGMVDIVASSVGYFIRVTQEIMGLNLLSAD  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMI  218
            KFP L +W  +F N   + +  PPRDK++
Sbjct  180  KFPQLFQWSEDFANCSIVKESLPPRDKLL  208



>gb|KDP33368.1| hypothetical protein JCGZ_12917 [Jatropha curcas]
Length=220

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 134/209 (64%), Gaps = 1/209 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL   + SPY  R V AL +K I YE + EDL NKS  LL+YNPV+KKIPVL+H+GKP
Sbjct  3    EVKLLGAYFSPYSFRAVCALKLKGIPYEFVEEDLMNKSSSLLQYNPVYKKIPVLVHDGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            ICES+VILEY+++ W   PLLP  P +RA  RFW K+ EDK  P++   +   G+EQE+ 
Sbjct  63   ICESIVILEYLDEIWPECPLLPTEPYERAVARFWIKYVEDK-SPAMWVVFRTSGQEQEKA  121

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V + ++ LK IEE   G K++FGGD I  +DI    +A      EE+ G+K+++ +KFP 
Sbjct  122  VKETVEMLKTIEENAMGEKKYFGGDKINMVDIAYSGIAYWLGGIEEVVGIKMLEPQKFPR  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            L  W  NF   P I D+ P RD M   F+
Sbjct  182  LHAWTRNFNETPVIKDNLPDRDSMFALFK  210



>ref|XP_008372419.1| PREDICTED: glutathione transferase GST 23-like [Malus domestica]
Length=223

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 137/210 (65%), Gaps = 2/210 (1%)
 Frame = -2

Query  829  VKLYRTWSSPYGLRVVWALNIKHIQYETILED-LTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            VKL   WSSPY  RV+WAL +K ++YE + ED L NKS  LL+YNPVHKK+PVL+H+GKP
Sbjct  4    VKLLGAWSSPYVYRVIWALKLKGVEYEYVEEDVLFNKSDELLKYNPVHKKVPVLVHDGKP  63

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
              ES++ILEYIE+ W + PLLP+ P  RA  RFW KF EDK    I   +F  G+EQ + 
Sbjct  64   TAESIIILEYIEEAWPHNPLLPKDPHQRAEARFWXKFGEDKNRAFI-GLFFATGEEQVKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            + +A +NLK++EE   G K+FFGG++IG  D+  GW+A    V EE   +K+ + + FP 
Sbjct  123  IKEAQENLKILEEHGLGNKKFFGGNDIGLADLAFGWMALWLEVLEEAASVKVFEGDSFPR  182

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            L  W+ +F   P I ++ P R  ++  F+ 
Sbjct  183  LHAWIQSFKESPTIKENLPERSALLNYFKG  212



>ref|XP_007036677.1| Tau class glutathione transferase GSTU26 [Theobroma cacao]
 gb|EOY21178.1| Tau class glutathione transferase GSTU26 [Theobroma cacao]
Length=224

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 144/217 (66%), Gaps = 1/217 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            E+KL  +  S +  R+ WAL +K + YE + EDL NKS  LL +NPVHKK+PVLL NGKP
Sbjct  3    ELKLIASSLSVFCARIEWALKLKGVGYEYLEEDLRNKSPLLLTHNPVHKKVPVLLQNGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESL+ILEYIE+TW ++PLLP+ P ++A  RFWAKF ++K L     +    G E+E+ 
Sbjct  63   IAESLIILEYIEETWKDSPLLPEDPYEKAMARFWAKFADEKCLHGAFDACRAVGDEKEKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            +  A  +   +E+QL  GK++FGG+ IG+LD+ LGW+ +  +V EE+  +KL+D ++ P+
Sbjct  123  IESAAKSFAFLEKQLE-GKKYFGGEQIGYLDLALGWIPHWLNVMEEVGCMKLVDTQRTPL  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEA  182
            L +W   F   P I +  PPRDK++ +F A  N + +
Sbjct  182  LHQWGQEFMEIPLIKECLPPRDKLLGRFTASINYLRS  218



>ref|XP_008382671.1| PREDICTED: glutathione transferase GST 23-like [Malus domestica]
Length=225

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 143/224 (64%), Gaps = 7/224 (3%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILED-LTNKSHHLLRYNPVHKKIPVLLHNGK  656
            +VKL   W SPY  RV+WAL +K ++YE + ED L NKS  LL+YNPVHKK+PVL+H+GK
Sbjct  3    QVKLLGLWXSPYVYRVIWALKLKGVEYEYVEEDVLFNKSDELLKYNPVHKKVPVLVHDGK  62

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
               ES+VILEYIE+ W + PLLP+ P  RA  RFW KF EDK   +    +F  G+EQ +
Sbjct  63   ATAESIVILEYIEEAWPHNPLLPKDPHQRAEARFWTKFGEDKNR-AFLGFFFATGEEQVK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             V +A +NLK++EE   G K+FFGGD IG +D+  GW+A    V EE  G+K+ +A+ FP
Sbjct  122  AVKEAQENLKILEEHGLGNKKFFGGDKIGLVDLAFGWIALWLEVLEESAGVKVFEADSFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK*TVL  164
             L  W+ +F   P I ++ P RD+      A  N  +  + T++
Sbjct  182  RLHAWIQSFKESPTIKENLPDRDR-----SAFLNYFKGRRATIV  220



>ref|XP_009622502.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana tomentosiformis]
Length=224

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 138/213 (65%), Gaps = 2/213 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M ++VKL   + SP+  RV+WAL  K I Y+ I EDL+NKSH LL+YNP++K IPVL+H 
Sbjct  1    MEDQVKLLGAFPSPFSYRVIWALKHKGINYKYIEEDLSNKSHDLLKYNPIYKMIPVLVHA  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GKPI ES VILEYIE+TW   PLLP+ P +RA  RFW KF EDK  P + + +   G+EQ
Sbjct  61   GKPIAESTVILEYIEETWPQNPLLPKDPHERAQARFWIKFGEDK-SPEVFAIFHKIGEEQ  119

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDA-E  305
             +   +A + LK+IEEQ  G K+FF GD IG  DIV GW+A    V +E   +K+ D+  
Sbjct  120  VKATEKAKEVLKIIEEQGLGEKKFFSGDTIGLSDIVFGWIALWLEVIQEAAEVKVFDSVS  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
             FP L  W+HNF   P I  + P RD M+  F+
Sbjct  180  TFPRLHAWIHNFKQLPVIKQNTPHRDAMLAYFK  212



>ref|XP_011041491.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=223

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 142/221 (64%), Gaps = 2/221 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAE VKL     SP+  RV+WAL +K I YE I ED+TNKS  LL+YNPVHK+IPVLLH 
Sbjct  1    MAEGVKLLGALPSPFVYRVIWALKLKAIPYEFIEEDVTNKSPLLLKYNPVHKQIPVLLHG  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
             KP+CES++I+EYI++TW   PLLP  P +RA  RFW KF EDK   S+R  +   G+E 
Sbjct  61   DKPVCESMIIVEYIDETWPQNPLLPNDPYERALARFWVKFAEDKGT-SVRRMFLATGEEL  119

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLI-DAE  305
            E+   + L+ L+ +EE   G K+FFGGD++G  DI  G +     V EE+ G  +I +A+
Sbjct  120  EKTRKEILEMLQNVEEHGLGKKKFFGGDSVGIADIAFGSVVYWLEVIEEVVGEGVIFEAQ  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEA  182
            KFP L  W+ NF   P I ++ P RD M+T F+    AI A
Sbjct  180  KFPRLHAWIKNFKQAPIIKENLPERDWMMTFFKGRREAILA  220



>ref|XP_006494139.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=220

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 140/209 (67%), Gaps = 1/209 (0%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+    SP+  RV+WAL +K + YE + EDL+NKS  LL+YNPVHKKIPVL+H GKP
Sbjct  3    EVKLHGALPSPFVYRVIWALKLKGVPYEFVSEDLSNKSALLLKYNPVHKKIPVLVHGGKP  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            +CES+VILEYIE+TW   PL+P +P DRA  RFW KF EDK + ++   +   G+E +  
Sbjct  63   VCESMVILEYIEETWPQNPLMPNNPYDRALARFWIKFAEDKGV-AVWKMFRSTGQELQNT  121

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            + +AL+ L+ +EE   G K+FF GDNIG +D+  G +     V E+  G+KL ++ KFP 
Sbjct  122  MKEALEMLQTVEEHGLGEKKFFNGDNIGLVDLAFGSIVYWLQVIEDAVGVKLFESHKFPR  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
            L  W+ NF   P I ++ P +D+M+  F+
Sbjct  182  LHAWLENFKQVPIIEENLPNQDEMLVVFK  210



>ref|XP_008374802.1| PREDICTED: glutathione S-transferase U8-like [Malus domestica]
Length=221

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 144/213 (68%), Gaps = 1/213 (0%)
 Frame = -2

Query  829  VKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKPI  650
            VKL+ T  S +  R+ WAL +K ++YE ILEDL NKS  LL+YNP++KK+PVL+H    +
Sbjct  4    VKLFATKESLFSSRIQWALKLKGVEYEFILEDLANKSPLLLKYNPIYKKVPVLVHGDNVV  63

Query  649  CESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEGV  470
             ESLVILEYIE+TW   PLLP+   DRA  RFWAKF ++KL+P + ++   +G+ QE+  
Sbjct  64   VESLVILEYIEETWKEHPLLPRDSYDRATARFWAKFNDEKLVPPVWTACTGEGEAQEKAK  123

Query  469  VQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPVL  290
              AL++L L+E+Q+  GK+FFGG+ IG+LD+VLGW++   S  EE  G K+++AE FP L
Sbjct  124  ESALESLALLEKQIE-GKKFFGGEQIGYLDLVLGWISYWISGVEEAGGNKVLEAEMFPSL  182

Query  289  SEWMHNFYNHPAILDHWPPRDKMITKFQAIFNA  191
             +W  NF ++P I +  P R+  +   Q   N 
Sbjct  183  HQWGQNFIHNPLIEECIPAREAFVAYVQYAINC  215



>ref|XP_010938161.1| PREDICTED: glutathione S-transferase U8-like [Elaeis guineensis]
Length=226

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 151/223 (68%), Gaps = 2/223 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M EE+KL+  W SP+  RV  AL +K I Y+ + EDL+NKS  LL+YNP+HKKIPVLLH 
Sbjct  1    MGEELKLFGVWGSPFSRRVELALRLKGIPYDYMEEDLSNKSPSLLKYNPIHKKIPVLLHG  60

Query  661  GKPICESLVILEYIEDTWH-NTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKE  485
            GKP+ ESLVILEYIE+TW  N  +LP+ P +RA  RFWA+F +DK +P++  S + +G  
Sbjct  61   GKPVVESLVILEYIEETWEGNHAILPKDPYERAMARFWARFLDDKCMPAMWMSCWTEGDA  120

Query  484  QEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
            Q+  + ++ +NL ++E +L  GK+FFGG+ IG +DI   ++A+   V +E+ G+ L++ E
Sbjct  121  QQNFMKESKENLSILEGELK-GKKFFGGNAIGLVDIAALFIAHWAGVLQEVAGISLVNEE  179

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
            K P+L +W+  F +   +++  P R++++  FQA    + A K
Sbjct  180  KHPILFKWIEEFISSDIVVECLPARERLLAFFQAKKETMLATK  222



>ref|XP_006480160.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=223

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 146/220 (66%), Gaps = 0/220 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            E+VKL   W SPY  RV+W L +K I+YE   E+L+NKS  LL+YNPVH+K+PVL+H+ K
Sbjct  2    EQVKLIGAWPSPYVYRVIWTLQLKGIKYEYEEENLSNKSDMLLKYNPVHQKVPVLVHDEK  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ES VILEYIE+ W   PLLP+ P DRA  RFW KF ++ L P+  + Y   G+E E+
Sbjct  62   PIVESTVILEYIEEAWPRHPLLPKDPYDRAVARFWIKFSDENLAPTFVAFYIGVGEEHEK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             + +A + LK+IEEQ  G K+FFGG+ IG  D+V GW+A    V EE+ G+K++DA+ FP
Sbjct  122  AIKEAKEKLKIIEEQGLGDKKFFGGNEIGMADLVFGWIAKSFGVVEEVVGVKVLDADSFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
             L  W+ +F +HP I +H P  D+M   ++   +   A K
Sbjct  182  RLHAWIGSFRSHPVIKEHLPDCDEMFAYYKQKRDMFIAQK  221



>ref|XP_008382670.1| PREDICTED: glutathione transferase GST 23-like [Malus domestica]
Length=225

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 143/224 (64%), Gaps = 7/224 (3%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILED-LTNKSHHLLRYNPVHKKIPVLLHNGK  656
            +VKL   W SPY  RV+WAL +K ++YE + ED L NKS  LL+YNPVHKK+PVL+H+GK
Sbjct  3    QVKLLGLWPSPYVYRVIWALKLKGVEYEYVEEDVLFNKSDELLKYNPVHKKVPVLVHDGK  62

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
               ES+VILEYIE+ W + PLLP+ P  RA  RFW KF EDK   +    +F  G+EQ +
Sbjct  63   ATAESIVILEYIEEAWPHNPLLPKDPHQRAEARFWTKFGEDKNR-AFLGFFFATGEEQVK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             V +A +NLK++EE   G K+FFGGD IG +D+  GW+A    V EE  G+K+ +A+ FP
Sbjct  122  AVKEAQENLKILEEHGLGNKKFFGGDKIGLVDLAFGWIALWLEVLEESAGVKVFEADSFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK*TVL  164
             L  W+ +F   P I ++ P RD+      A  N  +  + T++
Sbjct  182  RLHAWIQSFKESPTIKENLPDRDR-----SAFLNYFKGRRATIV  220



>ref|XP_008344765.1| PREDICTED: glutathione S-transferase U8-like [Malus domestica]
 ref|XP_008352075.1| PREDICTED: glutathione S-transferase U8-like [Malus domestica]
Length=224

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/221 (48%), Positives = 147/221 (67%), Gaps = 4/221 (2%)
 Frame = -2

Query  829  VKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKPI  650
            VKL+ T  S +  R+ WAL +K ++YE ILEDL NKS  LL+YNP++KK+PVL+H    I
Sbjct  4    VKLFATEGSVFCARIQWALKLKGVEYEFILEDLANKSPLLLKYNPIYKKVPVLVHGENVI  63

Query  649  CESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEGV  470
             ESLVILEYIEDTW   PLLP+ P DRA  RFWAKF ++KL  S+  +   +G+ QE+  
Sbjct  64   VESLVILEYIEDTWKEHPLLPRDPYDRATARFWAKFNDEKLXLSVWXACTGEGEAQEKAK  123

Query  469  VQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPVL  290
              AL++L L+E+Q+  GK+FFGG+ IG+LD+VLGW+ +  S  EE  G K+ +AE FP L
Sbjct  124  ESALESLALVEKQIE-GKKFFGGEQIGYLDLVLGWIPHWISAMEEAGGNKVPEAEMFPSL  182

Query  289  SEWMHNFYNHPAILDHWPPRDKMITKFQ---AIFNAIEANK  176
             +W  NF + P I +  P ++ ++T  +       ++ ANK
Sbjct  183  HQWGQNFIHTPLIEECIPAKEALVTYLRFMIGYMRSLSANK  223



>ref|XP_006424949.1| hypothetical protein CICLE_v10029241mg [Citrus clementina]
 gb|ESR38189.1| hypothetical protein CICLE_v10029241mg [Citrus clementina]
Length=222

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/221 (48%), Positives = 144/221 (65%), Gaps = 1/221 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKLY TW SP+  R+  AL +K + +E I  DL+NKS  LL+YNP+HKKIPVL+HN
Sbjct  1    MAEEVKLYGTWVSPFSRRIELALKLKGVPFEYIGVDLSNKSPELLKYNPIHKKIPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
            GK I ESL+ILEYI+DTW N P+LP+ P  RA  RFWAKF ++KLL +   +   +GKE+
Sbjct  61   GKSIVESLIILEYIDDTWKNNPILPRDPHQRAVARFWAKFIDEKLLATGMKASLAEGKEK  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E    + L+ +KL+E +LN GK FFGG+ IG +DIV   +A    V  E+ G+++I  EK
Sbjct  121  ELLNEEILEQMKLLENELN-GKDFFGGEAIGLVDIVATVVAFWFPVSHEVLGVEVITQEK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            FPVL +W+        +    PPR+K +   +A    + + 
Sbjct  180  FPVLLKWIGKLQEIDVVSQSRPPREKHVAHVRARMEGLNSG  220



>gb|KDO66688.1| hypothetical protein CISIN_1g038634mg [Citrus sinensis]
Length=222

 Score =   202 bits (513),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 143/220 (65%), Gaps = 1/220 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVKLY TWSSP+  R+  AL +K + +E I EDL+NKS  LL+YNPVHKKIPVL+HN
Sbjct  1    MAEEVKLYGTWSSPFSRRIELALKLKGVPFEYIEEDLSNKSPELLKYNPVHKKIPVLVHN  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
             KPI ES VILEYI++ W+N P+LPQ P  RA  RFW KF ++K L +   + F +GKE+
Sbjct  61   SKPIAESQVILEYIDEIWNNNPILPQDPYQRAMARFWGKFIDEKALATRMKANFAEGKER  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E    +    +K +E +LN GK FFGG+ IGF+DIV   +A    + +E+ G++    EK
Sbjct  121  ELVTEEFFQQMKFLENELN-GKDFFGGETIGFVDIVAIVVAIWFPLTQEVLGVETFTEEK  179

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEA  182
            FPVL +W+        + +  PPR+K +   +A    +++
Sbjct  180  FPVLFKWIRKITEIDVVNECRPPREKHLAYVKARIEGLKS  219



>ref|XP_009343408.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=224

 Score =   202 bits (513),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 143/215 (67%), Gaps = 5/215 (2%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDL-TNKSHHLLRYNPVHKKIPVLLHNGK  656
            EVKL+  W SP+  RV+WAL +K I Y+ I EDL  NKS  LL+YNPVHK+IPVL+H  K
Sbjct  3    EVKLHGAWPSPFSCRVIWALKLKGIPYDNIEEDLPNNKSPQLLKYNPVHKRIPVLIHGEK  62

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PICES+VI+EYIE+TW + PLLP  P +RA  RFW KF EDK  P+I   +   G+EQE+
Sbjct  63   PICESMVIVEYIEETWPHKPLLPADPYERATARFWVKFAEDK-GPAIWMVFRTTGEEQEK  121

Query  475  GVVQALDNLKLIEEQLN---GGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAE  305
                +L+ L+ IE+      G K+FFGGDNIG +DI  G +A+   V E++  ++L  A+
Sbjct  122  AKKDSLEMLRTIEDHAACTLGKKKFFGGDNIGIVDIAFGGIAHWFGVIEDVVEVRLFQAK  181

Query  304  KFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
            +FP L  W ++F   PAI ++ P R K++  F+ I
Sbjct  182  EFPRLYAWTNDFKQVPAIKENLPDRHKLVLLFKQI  216



>ref|XP_010023536.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW59828.1| hypothetical protein EUGRSUZ_H02573 [Eucalyptus grandis]
Length=224

 Score =   202 bits (513),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 145/208 (70%), Gaps = 2/208 (1%)
 Frame = -2

Query  829  VKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKPI  650
            VKL+  W+SPY  RV+WAL +K I ++ I EDL+NKS  LL+YNPVHKKIPVL+H  +P+
Sbjct  4    VKLHGFWASPYSSRVIWALKLKGIPFDYIEEDLSNKSALLLQYNPVHKKIPVLVHGSRPV  63

Query  649  CESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEGV  470
            CES+VI+EY+E+TW   PL+P  P +RA +RFW KF ++K L ++ + Y   G+EQE+ V
Sbjct  64   CESMVIVEYLEETWPQYPLVPSDPHERAVVRFWVKFIDEKSL-NVWTVYRSVGEEQEKAV  122

Query  469  VQALDNLKLIEEQL-NGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
              +++ L ++E+   N GK+FFGGD+I  +DI  G +A+     EE++G KL DA KFP 
Sbjct  123  RDSVEMLSILEQHGPNRGKKFFGGDDINIVDIAFGAVAHWVGTIEEVSGRKLFDAGKFPR  182

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKF  209
            L+ WM NF + P I ++ P ++K+   F
Sbjct  183  LNAWMANFESSPMIAENLPDQEKLREIF  210



>ref|XP_004290013.1| PREDICTED: glutathione transferase GST 23-like [Fragaria vesca 
subsp. vesca]
Length=223

 Score =   202 bits (513),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 135/211 (64%), Gaps = 2/211 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILED-LTNKSHHLLRYNPVHKKIPVLLHNGK  656
            +V +   WSSPY  RV+WAL +K + YE + ED L NKS  LL+YNPVHKK+PVL+H GK
Sbjct  3    QVTVLGAWSSPYVYRVIWALKLKGVDYEYVEEDVLHNKSDRLLKYNPVHKKVPVLVHAGK  62

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ES VILEYIE+TW   PLLP+ P  RA  RFW KF EDK   ++   +  +G++Q +
Sbjct  63   PIAESAVILEYIEETWPQNPLLPKDPHQRALARFWIKFGEDK-FGALFGFFMTEGEQQVK  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               +  + L ++EEQ  G K+FFGGD +G  D+  GWLA    V  E+ G+K I+AE FP
Sbjct  122  ATKERQEQLTILEEQGLGDKKFFGGDELGMADLEFGWLAWWMDVMSELAGVKGIEAETFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
             L  W+  F + P I +H P R  M+T F+ 
Sbjct  182  RLHAWIQRFKDIPTIKEHLPDRSAMLTYFKG  212



>ref|XP_006420441.1| hypothetical protein CICLE_v10005837mg [Citrus clementina]
 gb|ESR33681.1| hypothetical protein CICLE_v10005837mg [Citrus clementina]
Length=221

 Score =   202 bits (513),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 142/210 (68%), Gaps = 2/210 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVKL+ T  SP+  RV+WAL +K + YE + EDL+NKS  LL+YNPVHKKIPVL+H GKP
Sbjct  3    EVKLHGTLLSPFVYRVIWALKLKGVPYEFVSEDLSNKSALLLKYNPVHKKIPVLVHGGKP  62

Query  652  ICESLVILEYIEDTWHNTP-LLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            +CES+VIL+YIE+TW   P L+P +P DRAH RFW KF EDK + ++   +   G+E + 
Sbjct  63   VCESMVILQYIEETWPQNPSLMPNNPYDRAHARFWIKFAEDKGV-AVWKMFRSTGQELQN  121

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
             + +AL+ L+ +EE   G K+FF GDNIG +D+  G +     V E+  G+KL ++ KFP
Sbjct  122  TMKEALEMLQTVEEHGLGEKKFFNGDNIGLVDLAFGSIVYWLQVIEDAVGVKLFESHKFP  181

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQ  206
             L  W+ NF   P I ++ P +D+M+  F+
Sbjct  182  RLHAWLENFKQVPIIEENLPNQDEMLVVFK  211



>gb|AFK40836.1| unknown [Lotus japonicus]
Length=225

 Score =   202 bits (513),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 145/221 (66%), Gaps = 2/221 (1%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL     SP+  RV  AL +K ++Y+ I E+L NKS  LL+YNPVHKK+PV +HN K
Sbjct  6    EEVKLLGATGSPFVCRVQIALKLKGVEYKFIEENLRNKSELLLKYNPVHKKVPVFVHNEK  65

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKG-KEQE  479
            PI ESLVILEYIE+TW   P+LP +P  RA  RFW+KF +DK++ +   S F    KE+E
Sbjct  66   PIAESLVILEYIEETWKGNPILPTNPYQRALARFWSKFIDDKVVTAAWKSVFTADEKERE  125

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            + + ++ + L+ +E +L   K+FFGG+  GF+DI   ++A    + +EI GL+L  AEKF
Sbjct  126  KNIQESFEALQFLENELK-DKKFFGGEEFGFVDITAVFIAFWIPMIQEIAGLQLFTAEKF  184

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
            P L +W   F NHP + +  PPRD +   F+ ++ ++ A+K
Sbjct  185  PKLYKWSQEFLNHPVVKECLPPRDPVFAFFKGLYQSLTASK  225



>gb|KEH20685.1| glutathione S-transferase [Medicago truncatula]
Length=224

 Score =   202 bits (513),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 145/212 (68%), Gaps = 1/212 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
            +++VKL   W SP+  RV WAL +K + YE + ED+ NK+  LL  NPVHKK+PVL+H  
Sbjct  3    SQDVKLVGFWVSPFVKRVEWALKLKGVNYEYVEEDIFNKTPLLLELNPVHKKVPVLVHAQ  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KPI ES +ILEYI++TW  +PLLPQHP +RA  RFWA F E KLL +   +    G+EQE
Sbjct  63   KPIAESFIILEYIDETWKQSPLLPQHPYERALARFWADFAEQKLLNAAWIAMCNSGEEQE  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
            + +  A + ++ IEE++  GK+FFGGDNIG+LD+ LGW++    VFEE+  +++ID  K 
Sbjct  123  KALKVAREAIEKIEEEIK-GKKFFGGDNIGYLDLALGWISYWLPVFEEVGSMQIIDPLKC  181

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
              ++ WM NF N P I D  PPRDKM+  FQ+
Sbjct  182  SAITAWMTNFLNQPVINDSLPPRDKMLVYFQS  213



>ref|XP_011000484.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=223

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 144/222 (65%), Gaps = 0/222 (0%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            M   VKL  +++S +  RV WAL +K +QYE + +D+ NKS  LL +NPVHKK+PVL+H+
Sbjct  1    MTGAVKLIGSYTSLFCTRVEWALKLKGVQYEYVEDDVFNKSPLLLEHNPVHKKVPVLVHD  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
             KPI ESL+IL+YI++TW++  LLPQ   +R    FWAKF ++K L    ++ + +G+E+
Sbjct  61   DKPIPESLIILQYIDETWNDNNLLPQDSYERTMAHFWAKFTDEKCLMETFTAAYKEGEEK  120

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ +  A ++L  +E+ + G K F G D IG+LD+ +GW+     + EE+ G+KL+DAEK
Sbjct  121  EKAIESAQESLAFLEKLIQGKKFFSGDDKIGYLDLAMGWIPLCLDIIEEVGGMKLVDAEK  180

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEANK  176
            FP L EW  NF   P I +  PPRD ++  F  I     +NK
Sbjct  181  FPSLLEWAQNFTEIPLIKERLPPRDALLNYFHKIVGLKRSNK  222



>ref|XP_011041493.1| PREDICTED: probable glutathione S-transferase isoform X2 [Populus 
euphratica]
Length=222

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 142/212 (67%), Gaps = 1/212 (0%)
 Frame = -2

Query  835  EEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGK  656
            EEVKL+  W SPY  RV+WAL +K I+YE + EDL+ KS  LL+YNP+HKK+PVL+H GK
Sbjct  2    EEVKLHSFWPSPYCYRVIWALKLKGIRYEYVEEDLSIKSQALLQYNPIHKKVPVLVHGGK  61

Query  655  PICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEE  476
            PI ES+VILEYIE+TW + PLLP+   +RA  RFW +F  DK + +  + +    +E+E+
Sbjct  62   PIVESMVILEYIEETWPDHPLLPKDAYERAIARFWIQFGIDKGM-TFFAFFRATEEEKEK  120

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
               Q L+ LK++EEQ  G K+FFGG+NIG +DI  GWLA+     EE+ G+KL++    P
Sbjct  121  AATQVLEVLKILEEQCLGDKKFFGGENIGMVDIAYGWLAHWFEASEEMVGVKLVEPSTLP  180

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAI  200
             L  W+      P I ++ P R++++  F+ +
Sbjct  181  RLHAWIQRLKEIPVIKENLPDRERLLVHFRRL  212



>gb|KEH28979.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=220

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 147/217 (68%), Gaps = 1/217 (0%)
 Frame = -2

Query  853  ITVAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPV  674
            +  A  EEV+L   W+SP+  R+  AL +K + Y+   E+L NKS  LL+YNPV+KK+P+
Sbjct  1    MATANQEEVRLLGKWASPFSNRIDLALKLKGVPYKYSEENLANKSDDLLKYNPVYKKVPI  60

Query  673  LLHNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMK  494
            L+HNG PI ESL+ILEYI++TW N PLL + P +RA  RFW+K  +DK+LP+I ++ +  
Sbjct  61   LVHNGNPIAESLIILEYIDETWKNNPLLSEDPYERALARFWSKTLDDKILPAIWNACWSD  120

Query  493  GKEQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLI  314
             K +E+ V +AL+ LK++E+++   K+FFGG+ +G +DI   ++     + +EI GL+L+
Sbjct  121  EKGREKAVEEALEALKILEDEIK-DKKFFGGETLGLVDIAANFIGYWVYILQEIAGLELL  179

Query  313  DAEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
              EKFP + +W   F NHP I +  PPRD++   F+A
Sbjct  180  TLEKFPKVYKWSQEFINHPVIKEGLPPRDELFAFFKA  216



>gb|AEC32486.1| tau class glutathione S-transferase [Glycine soja]
 gb|KHN06426.1| Putative glutathione S-transferase [Glycine soja]
Length=224

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 150/220 (68%), Gaps = 1/220 (0%)
 Frame = -2

Query  838  AEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNG  659
            +EEVKL   ++SP+G RV WAL +K ++YE I +D+ NK+  LL+ NPVHKK+PVL+H  
Sbjct  3    SEEVKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLVHAH  62

Query  658  KPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQE  479
            KPI ES VI+EY+++TW   PLLPQ P  RA  RFWA F E KLL +     +  G EQ+
Sbjct  63   KPIAESFVIVEYVDETWKQYPLLPQDPYQRALARFWANFAEQKLLDAAWIGMYSSGDEQQ  122

Query  478  EGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKF  299
              V  A + ++ IEE++  GK++FGG+NIG+LDI LGW++    ++EE+  +++ID  KF
Sbjct  123  NAVKVAREAIEKIEEEIK-GKKYFGGENIGYLDIALGWISYWLPIWEEVGSIQIIDPLKF  181

Query  298  PVLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEAN  179
            P ++ W+ NF +HP I D+ PPRDKM+  F +   A+ + 
Sbjct  182  PAITAWITNFLSHPVIKDNLPPRDKMLVYFHSRRTALSST  221



>ref|XP_006424951.1| hypothetical protein CICLE_v10030408mg, partial [Citrus clementina]
 gb|ESR38191.1| hypothetical protein CICLE_v10030408mg, partial [Citrus clementina]
Length=228

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 141/216 (65%), Gaps = 1/216 (0%)
 Frame = -2

Query  850  TVAMAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVL  671
            T+ MAEEVKLY TWSSP+  R+  AL +K + +E I EDL+NKS  LL+YNP HKKIPVL
Sbjct  4    TLTMAEEVKLYGTWSSPFSRRIELALKLKGVPFEYIEEDLSNKSPELLKYNPAHKKIPVL  63

Query  670  LHNGKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKG  491
            +HN KPI ES VILEYI++ W+N P+LPQ P  RA  RFW KF ++K+L +   + F +G
Sbjct  64   VHNSKPIAESQVILEYIDEIWNNNPILPQDPYQRAMARFWGKFIDEKVLATRMKANFAEG  123

Query  490  KEQEEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLID  311
            KE+E    +    ++ +E +LN GK FFGG+ IGF+DIV   +A    + +E+ G+    
Sbjct  124  KERELVTEEFFQQMEFLENELN-GKDFFGGETIGFVDIVAIVVAIWFPLTQEVLGVDTFT  182

Query  310  AEKFPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
             EKFPVL +W+        + +  PPR+K +   +A
Sbjct  183  EEKFPVLFKWIRKITEIDVVNECRPPREKHLAYVKA  218



>gb|ACJ86006.1| unknown [Medicago truncatula]
 gb|AFK37765.1| unknown [Medicago truncatula]
 gb|AFK44018.1| unknown [Medicago truncatula]
 gb|KEH28980.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=225

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 149/218 (68%), Gaps = 3/218 (1%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EV+L     SP+  RV  AL +K I+Y  I E+L NKS  LL+YNP+HKK+PV +HNGKP
Sbjct  7    EVQLLGVGGSPFVRRVQIALKLKGIEYTYIEENLRNKSDLLLKYNPIHKKVPVFVHNGKP  66

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSI-RSSYFMKGKEQEE  476
            + ESLVILEYI++TW N P+ PQ P ++A  RFW++F +DK+LP+I ++++ +  +E+E+
Sbjct  67   LAESLVILEYIDETWENYPIFPQQPYEKALARFWSRFIDDKILPAISKAAWTVNKEEREK  126

Query  475  GVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFP  296
            G+ ++L  L+ +E +L    +FFGG+NI  +DI   +LA      EE  GLK++ ++KFP
Sbjct  127  GIEESLQALQFLENELK--HKFFGGENISIVDIAASYLAFWLPAIEEAVGLKVLSSDKFP  184

Query  295  VLSEWMHNFYNHPAILDHWPPRDKMITKFQAIFNAIEA  182
             L +W   F NHP + ++ PP+D ++  F++ + AI A
Sbjct  185  KLYKWSQEFNNHPIVKENLPPKDGLLGFFKSRYAAISA  222



>ref|XP_010101874.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB90011.1| putative glutathione S-transferase [Morus notabilis]
Length=217

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 143/213 (67%), Gaps = 3/213 (1%)
 Frame = -2

Query  841  MAEEVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHN  662
            MAEEVK++  W S + LRV  AL +K I YE   EDL+NKS  L++YNP+HKK+PVL+H+
Sbjct  1    MAEEVKVFGCWGSAFSLRVDIALKLKGIDYEYHEEDLSNKSSLLIKYNPIHKKVPVLVHH  60

Query  661  GKPICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQ  482
             KP+ ES VILEYI++TW N P+LP+ P +RA  RFWA+F +DK  P I  +Y+ K  E+
Sbjct  61   NKPLAESQVILEYIDETWENYPILPKDPYERAKARFWARFIDDKCFPEIWKAYWSKD-ER  119

Query  481  EEGVVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEK  302
            E+ V + ++ LK +E +LN    FFGG+ +G +DIV   +A    V +E+ G++++  EK
Sbjct  120  EKAVEELIELLKFLENELNDN--FFGGETVGLVDIVGSLIAYWLPVVQEVAGVEILTEEK  177

Query  301  FPVLSEWMHNFYNHPAILDHWPPRDKMITKFQA  203
            FP L  W H F NH  + +  P R+K+I  F+A
Sbjct  178  FPKLCRWSHEFVNHSVVKEVLPCREKLIAYFRA  210



>ref|XP_008453455.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=224

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 151/222 (68%), Gaps = 4/222 (2%)
 Frame = -2

Query  832  EVKLYRTWSSPYGLRVVWALNIKHIQYETILEDLTNKSHHLLRYNPVHKKIPVLLHNGKP  653
            EVK+  + +S + +RV WAL +K I+YE I+EDL NKS  LL+ NPV+KKIPVLLHN K 
Sbjct  3    EVKIIGSAASLFSVRVEWALKLKGIEYEYIVEDLRNKSELLLKSNPVYKKIPVLLHNDKA  62

Query  652  ICESLVILEYIEDTWHNTPLLPQHPLDRAHLRFWAKFCEDKLLPSIRSSYFMKGKEQEEG  473
            I ESL+I+EYI++TW   P+LP+ P DRA+ RFWAKF ++K L     +   +G+E+E+ 
Sbjct  63   ISESLLIIEYIDETWKENPILPEDPYDRANARFWAKFLDEKGLLGAWEACQAEGEEKEKA  122

Query  472  VVQALDNLKLIEEQLNGGKRFFGGDNIGFLDIVLGWLANLPSVFEEITGLKLIDAEKFPV  293
            V  A+ +L L+++++  GK+FFGG+ IG+LD+  GW+ +  SV +E+  + + D E+FP 
Sbjct  123  VEAAVQHLALLDKEIQ-GKKFFGGEKIGYLDLAAGWICHWLSVLDEVGEMNVFDRERFPS  181

Query  292  LSEWMHNFYNHPAILDHWPPRDKMITKFQAIFN---AIEANK  176
            L EW  NF + P I +  PPR+ ++  F+   +   ++ ANK
Sbjct  182  LHEWAQNFIHVPVIKESLPPREILVNYFKGSLSYVRSLAANK  223



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1932141131370