BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22660_g1_i1 len=721 path=[923:0-118 1042:119-143 1067:144-720]

Length=721
                                                                      Score     E

gb|AFB73931.1|  LAT52-like protein                                      207   1e-63   
gb|AFB73932.1|  LAT52-like protein                                      206   3e-63   
ref|XP_009604804.1|  PREDICTED: anther-specific protein LAT52           204   2e-62   
ref|XP_004248244.1|  PREDICTED: anther-specific protein LAT52           201   2e-61   
ref|XP_006360048.1|  PREDICTED: anther-specific protein LAT52-like      199   2e-60   
ref|XP_009794171.1|  PREDICTED: anther-specific protein LAT52           198   5e-60   
ref|XP_009602640.1|  PREDICTED: anther-specific protein LAT52-like      175   5e-51   
ref|XP_009778120.1|  PREDICTED: anther-specific protein LAT52-like      172   4e-50   
ref|XP_009761932.1|  PREDICTED: anther-specific protein LAT52-like      172   1e-49   
ref|XP_011070069.1|  PREDICTED: anther-specific protein LAT52-like      169   1e-48   
ref|XP_009598969.1|  PREDICTED: anther-specific protein LAT52-like      167   8e-48   
ref|XP_004251892.1|  PREDICTED: anther-specific protein LAT52-like      165   3e-47   
ref|XP_006358942.1|  PREDICTED: anther-specific protein LAT52-like      162   4e-46   
ref|XP_011098227.1|  PREDICTED: anther-specific protein LAT52-like      158   1e-44   
gb|EYU26327.1|  hypothetical protein MIMGU_mgv1a015422mg                154   4e-43   
ref|XP_004244268.1|  PREDICTED: anther-specific protein LAT52-like      154   6e-43   
gb|EYU45018.1|  hypothetical protein MIMGU_mgv1a015317mg                154   6e-43   
ref|XP_006348395.1|  PREDICTED: anther-specific protein LAT52-like      153   2e-42   
ref|XP_011029563.1|  PREDICTED: olee1-like protein                      150   3e-41   
ref|XP_002316866.1|  pollen Ole e 1 allergen and extensin family ...    149   4e-41   Populus trichocarpa [western balsam poplar]
gb|EPS72638.1|  hypothetical protein M569_02120                         148   9e-41   
ref|XP_002523378.1|  Anther-specific protein LAT52 precursor, put...    145   3e-39   Ricinus communis
emb|CDP16230.1|  unnamed protein product                                143   1e-38   
emb|CDP06002.1|  unnamed protein product                                142   2e-38   
ref|XP_008371469.1|  PREDICTED: olee1-like protein                      142   2e-38   
ref|XP_007021723.1|  Pollen Ole e 1 allergen and extensin family ...    142   3e-38   
ref|XP_010277041.1|  PREDICTED: anther-specific protein LAT52           141   5e-38   
gb|KHG25858.1|  Olee1-like protein                                      140   2e-37   
ref|XP_009348994.1|  PREDICTED: olee1-like protein                      139   3e-37   
emb|CDP16229.1|  unnamed protein product                                139   3e-37   
gb|KDP32532.1|  hypothetical protein JCGZ_14735                         139   5e-37   
ref|XP_009617824.1|  PREDICTED: olee1-like protein                      138   1e-36   
ref|XP_009352776.1|  PREDICTED: olee1-like protein                      138   2e-36   
ref|XP_011006522.1|  PREDICTED: olee1-like protein                      137   3e-36   
sp|Q8LGR0.1|CHE1_CHEAL  RecName: Full=Pollen allergen Che a 1; Al...    136   7e-36   Chenopodium album [lamb's-quarters]
gb|KHG10520.1|  Olee1-like protein                                      135   2e-35   
ref|XP_006370166.1|  pollen Ole e 1 allergen and extensin family ...    134   3e-35   
gb|AAX93750.1|  pollen allergen Cro s 1                                 133   6e-35   Crocus sativus [saffron crocus]
ref|XP_010103032.1|  hypothetical protein L484_005787                   133   7e-35   
ref|XP_008383629.1|  PREDICTED: olee1-like protein                      133   1e-34   
ref|XP_007212169.1|  hypothetical protein PRUPE_ppa012463mg             132   3e-34   
ref|XP_011079002.1|  PREDICTED: olee1-like protein                      128   6e-33   
ref|XP_004143635.1|  PREDICTED: olee1-like protein-like                 128   7e-33   
ref|XP_007148052.1|  hypothetical protein PHAVU_006G176500g             127   1e-32   
ref|XP_009773994.1|  PREDICTED: olee1-like protein                      127   2e-32   
ref|XP_010261236.1|  PREDICTED: pollen-specific protein C13-like        126   3e-32   
ref|XP_008467237.1|  PREDICTED: olee1-like protein                      125   9e-32   
ref|XP_010686203.1|  PREDICTED: pollen allergen Che a 1                 125   1e-31   
gb|AFK47865.1|  unknown                                                 124   2e-31   
ref|XP_003541705.1|  PREDICTED: olee1-like protein-like                 124   2e-31   
ref|XP_003546028.1|  PREDICTED: olee1-like protein-like                 124   2e-31   
ref|XP_010057097.1|  PREDICTED: olee1-like protein                      124   2e-31   
ref|XP_007025385.1|  Olee1-like protein                                 124   2e-31   
ref|XP_004485892.1|  PREDICTED: olee1-like protein-like                 123   4e-31   
gb|ACU23617.1|  unknown                                                 123   4e-31   Glycine max [soybeans]
ref|XP_007213539.1|  hypothetical protein PRUPE_ppa019680mg             123   6e-31   
sp|O49813.1|OLEE1_BETPN  RecName: Full=Olee1-like protein; Flags:...    123   6e-31   Betula pendula [white birch]
gb|EYU43331.1|  hypothetical protein MIMGU_mgv1a014984mg                123   8e-31   
gb|ADI55168.1|  AS1                                                     123   8e-31   
gb|ACJ83911.1|  unknown                                                 122   1e-30   Medicago truncatula
ref|XP_008225283.1|  PREDICTED: olee1-like protein                      122   2e-30   
ref|XP_008226528.1|  PREDICTED: olee1-like protein                      120   4e-30   
ref|XP_011085997.1|  PREDICTED: olee1-like protein                      120   5e-30   
ref|XP_006857531.1|  hypothetical protein AMTR_s00061p00032820          120   6e-30   
ref|XP_004144129.1|  PREDICTED: olee1-like protein-like                 119   1e-29   
ref|XP_008450951.1|  PREDICTED: olee1-like protein                      119   1e-29   
ref|XP_002522577.1|  Pollen allergen Che a 1 precursor, putative        120   1e-29   Ricinus communis
ref|XP_009408781.1|  PREDICTED: pollen-specific protein C13-like        119   1e-29   
gb|KGN49303.1|  hypothetical protein Csa_6G519560                       119   1e-29   
ref|XP_008359333.1|  PREDICTED: olee1-like protein                      119   2e-29   
gb|EPS70684.1|  hypothetical protein M569_04073                         119   2e-29   
gb|KCW69946.1|  hypothetical protein EUGRSUZ_F03264                     119   2e-29   
ref|XP_011080816.1|  PREDICTED: major pollen allergen Ole e 1-like      119   3e-29   
ref|XP_009340070.1|  PREDICTED: olee1-like protein                      118   3e-29   
ref|XP_004134662.1|  PREDICTED: olee1-like protein-like                 118   3e-29   
ref|XP_010062811.1|  PREDICTED: olee1-like protein                      119   5e-29   
gb|KHG13789.1|  Anther-specific LAT52                                   118   6e-29   
gb|ADK22842.1|  Sal k 5                                                 117   7e-29   
ref|XP_004134927.1|  PREDICTED: olee1-like protein-like                 117   7e-29   
ref|XP_002513885.1|  Pollen-specific protein C13 precursor, putative    117   7e-29   Ricinus communis
ref|XP_009759546.1|  PREDICTED: olee1-like protein                      117   2e-28   
ref|XP_011075627.1|  PREDICTED: olee1-like protein                      116   2e-28   
ref|XP_009396935.1|  PREDICTED: pollen-specific protein C13-like        115   3e-28   
ref|XP_009334049.1|  PREDICTED: olee1-like protein                      115   5e-28   
ref|XP_011075462.1|  PREDICTED: olee1-like protein                      115   6e-28   
ref|XP_009608960.1|  PREDICTED: olee1-like protein                      115   6e-28   
ref|XP_011090511.1|  PREDICTED: major pollen allergen Lol p 11-like     114   9e-28   
gb|KDO80906.1|  hypothetical protein CISIN_1g031458mg                   114   1e-27   
ref|XP_011101449.1|  PREDICTED: olee1-like protein                      114   1e-27   
ref|XP_006472638.1|  PREDICTED: pollen-specific protein C13-like        114   2e-27   
gb|ACG33223.1|  pollen-specific protein C13 precursor                   114   2e-27   Zea mays [maize]
gb|ABC86745.1|  pollen-specific protein                                 113   2e-27   Vitis pseudoreticulata
ref|XP_008439742.1|  PREDICTED: olee1-like protein isoform X1           113   2e-27   
ref|XP_010269200.1|  PREDICTED: pollen-specific protein C13-like        113   3e-27   
gb|ACF82695.1|  unknown                                                 113   4e-27   Zea mays [maize]
ref|XP_010434511.1|  PREDICTED: pollen-specific protein-like At4g...    113   4e-27   
ref|XP_008439743.1|  PREDICTED: olee1-like protein isoform X2           113   5e-27   
ref|XP_010540511.1|  PREDICTED: pollen-specific protein-like At4g...    112   6e-27   
ref|XP_004975466.1|  PREDICTED: pollen-specific protein C13-like        112   6e-27   
emb|CDX99789.1|  BnaC05g22110D                                          112   7e-27   
ref|XP_008376286.1|  PREDICTED: pollen-specific protein C13-like        112   7e-27   
ref|NP_001148343.1|  LOC100281953 precursor                             112   9e-27   Zea mays [maize]
ref|XP_010439832.1|  PREDICTED: pollen-specific protein-like At4g...    112   9e-27   
ref|XP_006652233.1|  PREDICTED: pollen-specific protein C13-like        112   1e-26   
ref|XP_010529196.1|  PREDICTED: pollen-specific protein-like At4g...    112   1e-26   
ref|XP_007153183.1|  hypothetical protein PHAVU_003G013900g             111   1e-26   
ref|XP_008348540.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          111   2e-26   
ref|XP_010496255.1|  PREDICTED: pollen-specific protein-like At4g...    111   2e-26   
ref|XP_010538209.1|  PREDICTED: pollen-specific protein-like At4g...    111   2e-26   
ref|XP_006284941.1|  hypothetical protein CARUB_v10006240mg             111   2e-26   
ref|XP_010441660.1|  PREDICTED: pollen-specific protein-like At4g...    111   2e-26   
ref|XP_009115274.1|  PREDICTED: pollen-specific protein-like At4g...    111   2e-26   
gb|KFK28529.1|  hypothetical protein AALP_AA7G008600                    111   2e-26   
ref|XP_011016068.1|  PREDICTED: pollen-specific protein C13-like        110   3e-26   
ref|NP_567562.1|  pollen Ole e 1 allergen and extensin family pro...    111   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAN76546.1|AF393475_1  LLP-B3 protein                                110   3e-26   Lilium longiflorum [Easter lily]
ref|XP_010481521.1|  PREDICTED: pollen-specific protein-like At4g...    111   3e-26   
ref|XP_009342278.1|  PREDICTED: olee1-like protein                      110   3e-26   
ref|XP_009421183.1|  PREDICTED: pollen-specific protein C13-like        110   3e-26   
ref|XP_003634471.1|  PREDICTED: pollen-specific protein C13             110   4e-26   
ref|XP_006366520.1|  PREDICTED: olee1-like protein-like                 110   4e-26   
ref|XP_009760524.1|  PREDICTED: pollen-specific protein C13-like        110   4e-26   
ref|XP_006434027.1|  hypothetical protein CICLE_v10002743mg             110   4e-26   
ref|XP_008378536.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          111   5e-26   
gb|KDP32694.1|  hypothetical protein JCGZ_11986                         110   5e-26   
ref|XP_007153182.1|  hypothetical protein PHAVU_003G013800g             110   5e-26   
ref|XP_009403224.1|  PREDICTED: pollen-specific protein C13-like        110   5e-26   
gb|AFK46977.1|  unknown                                                 110   5e-26   
ref|XP_011101379.1|  PREDICTED: olee1-like protein                      110   6e-26   
ref|XP_010494740.1|  PREDICTED: pollen-specific protein-like At4g...    110   7e-26   
ref|XP_004233077.1|  PREDICTED: major pollen allergen Lig v 1-like      110   7e-26   
ref|XP_009622218.1|  PREDICTED: pollen-specific protein C13-like        109   9e-26   
gb|AEW90946.1|  pollen-specific protein F8-4                            109   1e-25   
gb|KHG12773.1|  Olee1-like protein                                      110   1e-25   
emb|CAH66537.1|  H0209H04.4                                             109   1e-25   Oryza sativa [red rice]
emb|CDX99452.1|  BnaC01g11000D                                          109   1e-25   
ref|NP_001052674.1|  Os04g0398700                                       109   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EAY93952.1|  hypothetical protein OsI_15725                          109   1e-25   Oryza sativa Indica Group [Indian rice]
ref|NP_001105351.1|  pollen-specific protein C13 precursor              109   1e-25   Zea mays [maize]
emb|CDY01556.1|  BnaC07g35460D                                          109   1e-25   
ref|XP_006664913.1|  PREDICTED: pollen allergen Phl p 11-like           109   1e-25   
ref|XP_008363638.1|  PREDICTED: olee1-like protein                      108   2e-25   
ref|XP_002273294.1|  PREDICTED: olee1-like protein                      108   2e-25   Vitis vinifera
ref|XP_007206364.1|  hypothetical protein PRUPE_ppa017800mg             108   2e-25   
ref|XP_009109686.1|  PREDICTED: pollen-specific protein-like At4g...    108   2e-25   
gb|KFK44745.1|  hypothetical protein AALP_AA1G297400                    108   2e-25   
ref|XP_007149397.1|  hypothetical protein PHAVU_005G066800g             108   2e-25   
gb|KFK31513.1|  hypothetical protein AALP_AA6G122400                    108   2e-25   
gb|AFK42345.1|  unknown                                                 108   2e-25   
dbj|BAJ86956.1|  predicted protein                                      108   2e-25   
emb|CDX77620.1|  BnaC07g18740D                                          108   2e-25   
ref|XP_010321468.1|  PREDICTED: LOW QUALITY PROTEIN: major pollen...    108   2e-25   
ref|XP_009136942.1|  PREDICTED: pollen-specific protein-like At4g...    108   3e-25   
ref|NP_174209.1|  pollen Ole e 1 allergen and extensin family pro...    108   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009764546.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          107   3e-25   
ref|XP_010499433.1|  PREDICTED: pollen-specific protein-like At4g...    108   3e-25   
emb|CDY43319.1|  BnaC03g58910D                                          108   4e-25   
ref|XP_006414083.1|  hypothetical protein EUTSA_v10026398mg             108   4e-25   
ref|XP_009402012.1|  PREDICTED: pollen-specific protein C13-like        107   4e-25   
ref|XP_008775180.1|  PREDICTED: pollen-specific protein C13-like        107   4e-25   
ref|XP_004489034.1|  PREDICTED: olee1-like protein-like                 107   4e-25   
ref|XP_002533139.1|  Pollen-specific protein C13 precursor, putative    107   5e-25   Ricinus communis
ref|XP_009132011.1|  PREDICTED: pollen-specific protein-like At4g...    107   5e-25   
ref|XP_009366359.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          107   5e-25   
ref|XP_009101556.1|  PREDICTED: pollen-specific protein-like At4g...    107   5e-25   
ref|XP_010460686.1|  PREDICTED: pollen-specific protein-like At4g...    107   5e-25   
ref|XP_008234009.1|  PREDICTED: pollen-specific protein C13             107   6e-25   
ref|XP_002870034.1|  pollen ole e 1 allergen and extensin family ...    107   6e-25   
ref|XP_002447728.1|  hypothetical protein SORBIDRAFT_06g014740          107   6e-25   Sorghum bicolor [broomcorn]
ref|XP_010478273.1|  PREDICTED: pollen-specific protein-like At4g...    107   6e-25   
ref|XP_002301038.1|  pollen Ole e 1 allergen and extensin family ...    107   7e-25   Populus trichocarpa [western balsam poplar]
gb|ABK94215.1|  unknown                                                 107   7e-25   Populus trichocarpa [western balsam poplar]
gb|ABK92993.1|  unknown                                                 107   7e-25   Populus trichocarpa [western balsam poplar]
ref|NP_001235303.1|  uncharacterized protein LOC100306199 precursor     107   9e-25   
ref|XP_008245042.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          106   9e-25   
ref|XP_004983223.1|  PREDICTED: pollen-specific protein C13-like        107   9e-25   
ref|XP_006304746.1|  hypothetical protein CARUB_v10012122mg             106   1e-24   
ref|XP_009797814.1|  PREDICTED: major pollen allergen Lol p 11-like     106   1e-24   
ref|XP_006398273.1|  hypothetical protein EUTSA_v10001051mg             106   1e-24   
ref|XP_002268073.1|  PREDICTED: pollen-specific protein C13             106   1e-24   Vitis vinifera
emb|CDY69202.1|  BnaCnng62360D                                          106   1e-24   
ref|XP_006281481.1|  hypothetical protein CARUB_v10027565mg             106   2e-24   
ref|XP_002863445.1|  hypothetical protein ARALYDRAFT_494394             106   2e-24   
gb|KHN36879.1|  Olee1-like protein                                      106   2e-24   
ref|XP_009102877.1|  PREDICTED: pollen-specific protein-like At4g...    106   2e-24   
ref|XP_009128814.1|  PREDICTED: pollen-specific protein-like At4g...    106   2e-24   
gb|AAF16869.1|AF109693_1  allergen-like protein BRSn20                  105   2e-24   Sambucus nigra
ref|XP_003566418.1|  PREDICTED: major pollen allergen Lol p 11-like     106   2e-24   
ref|XP_011097595.1|  PREDICTED: major pollen allergen Lol p 11-like     105   2e-24   
ref|XP_009108374.1|  PREDICTED: pollen-specific protein-like At4g...    106   2e-24   
ref|XP_002310579.1|  hypothetical protein POPTR_0007s05750g             105   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010538956.1|  PREDICTED: major pollen allergen Lol p 11          105   2e-24   
dbj|BAK06698.1|  predicted protein                                      105   3e-24   
gb|AEW90948.1|  pollen-specific protein F8-6                            105   3e-24   
ref|XP_004293940.1|  PREDICTED: olee1-like protein-like                 105   3e-24   
ref|XP_009386950.1|  PREDICTED: pollen-specific protein C13-like        105   3e-24   
ref|XP_009600627.1|  PREDICTED: major pollen allergen Lol p 11-like     105   3e-24   
ref|XP_008234688.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          105   3e-24   
ref|XP_006415610.1|  hypothetical protein EUTSA_v10008921mg             105   4e-24   
ref|XP_010941451.1|  PREDICTED: pollen-specific protein C13-like        105   4e-24   
emb|CAA16739.1|  pollen-specific protein - like                         111   4e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CAA78897.1|  pollen specific gene                                   105   4e-24   Oryza sativa [red rice]
ref|XP_002307393.1|  pollen Ole e 1 allergen and extensin family ...    104   4e-24   Populus trichocarpa [western balsam poplar]
ref|XP_011030966.1|  PREDICTED: protein DOWNSTREAM OF FLC               104   5e-24   
ref|NP_568650.1|  pollen_Ole_e_I-domain containing protein              105   5e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65838.1|  Ole e I (main olive allergen)-like protein              105   6e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87759.1|  BnaC02g31900D                                          105   6e-24   
ref|NP_001131377.1|  uncharacterized protein LOC100192702 precursor     104   7e-24   Zea mays [maize]
ref|XP_009114385.1|  PREDICTED: pollen-specific protein-like At4g...    104   7e-24   
ref|XP_007225977.1|  hypothetical protein PRUPE_ppa012675mg             103   1e-23   
ref|XP_006344595.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          103   1e-23   
ref|XP_009409254.1|  PREDICTED: major pollen allergen Lol p 11-like     103   1e-23   
gb|KDP46869.1|  hypothetical protein JCGZ_24078                         103   1e-23   
ref|XP_002307104.1|  hypothetical protein POPTR_0005s08000g             103   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006464247.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          103   2e-23   
ref|XP_006289520.1|  hypothetical protein CARUB_v10003061mg             103   2e-23   
ref|XP_006442530.1|  hypothetical protein CICLE_v10024378mg             103   2e-23   
ref|NP_001150330.1|  pollen allergen Phl p 11 precursor                 103   2e-23   Zea mays [maize]
gb|EMS52933.1|  hypothetical protein TRIUR3_31283                       103   3e-23   
ref|XP_011006159.1|  PREDICTED: pollen-specific protein C13-like        102   3e-23   
gb|EYU31033.1|  hypothetical protein MIMGU_mgv1a015328mg                102   3e-23   
gb|KDP21093.1|  hypothetical protein JCGZ_21564                         103   3e-23   
emb|CDY52214.1|  BnaAnng11370D                                          102   3e-23   
ref|XP_002392460.1|  hypothetical protein MPER_07958                    102   4e-23   Moniliophthora perniciosa FA553
pir||S43242  allergen-like protein Syr v I isoform 1 - Syringa vu...    102   4e-23
ref|XP_002489221.1|  hypothetical protein SORBIDRAFT_0012s014630        102   4e-23   Sorghum bicolor [broomcorn]
ref|XP_007149396.1|  hypothetical protein PHAVU_005G066700g             102   4e-23   
emb|CDY65576.1|  BnaC09g52000D                                          102   5e-23   
ref|NP_001146979.1|  LOC100280588 precursor                             102   5e-23   Zea mays [maize]
ref|XP_010549400.1|  PREDICTED: pollen-specific protein-like At4g...    102   6e-23   
ref|XP_010911793.1|  PREDICTED: pollen-specific protein C13-like        102   7e-23   
ref|XP_003573867.1|  PREDICTED: pollen-specific protein C13             101   8e-23   
ref|XP_010518802.1|  PREDICTED: pollen-specific protein-like At4g...    102   8e-23   
ref|NP_001238723.1|  uncharacterized protein LOC100499710 precursor     101   8e-23   
ref|XP_006428158.1|  hypothetical protein CICLE_v10027141mg             103   9e-23   
gb|AFW77548.1|  pollen allergen Phl p 11                                101   9e-23   
ref|XP_010060161.1|  PREDICTED: protein DOWNSTREAM OF FLC               101   1e-22   
gb|ABP58635.1|  major pollen allergen Ole e 1                           100   1e-22   Olea europaea
ref|XP_004237415.1|  PREDICTED: pollen-specific protein C13             100   1e-22   
gb|KHN19737.1|  Pollen-specific protein C13                             100   2e-22   
ref|XP_008782123.1|  PREDICTED: pollen-specific protein C13-like        100   2e-22   
gb|AAM08621.1|AC107314_12  Putative Pollen specific protein C13 p...    100   2e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CDY12288.1|  BnaA09g24880D                                          100   2e-22   
gb|ACG32277.1|  pollen-specific protein C13 precursor                   100   2e-22   Zea mays [maize]
ref|XP_004289324.1|  PREDICTED: pollen-specific protein C13-like        100   2e-22   
ref|XP_010942359.1|  PREDICTED: major pollen allergen Lol p 11-like     100   2e-22   
ref|XP_009134109.1|  PREDICTED: pollen-specific protein C13             100   2e-22   
ref|XP_004150698.1|  PREDICTED: pollen-specific protein C13-like        100   2e-22   
ref|NP_001064462.2|  Os10g0371000                                       100   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011078225.1|  PREDICTED: pollen allergen Che a 1-like            100   3e-22   
dbj|BAB09316.1|  Ole e I (main olive allergen)-like protein             100   3e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY05022.1|  BnaC03g28200D                                        99.8    4e-22   
emb|CDP01424.1|  unnamed protein product                              99.8    4e-22   
pir||S43244  allergen-like protein Syr v I isoform 3 - Syringa vu...  99.4    4e-22
ref|NP_567338.1|  protein SAH7                                        99.4    5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003581152.1|  PREDICTED: pollen-specific protein C13-like      99.4    6e-22   
ref|XP_002454899.1|  hypothetical protein SORBIDRAFT_03g001020        99.0    7e-22   Sorghum bicolor [broomcorn]
ref|XP_010436385.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        99.0    8e-22   
sp|Q7M1X5.1|LOLB_LOLPR  RecName: Full=Major pollen allergen Lol p...  97.8    9e-22   Lolium perenne [perennial ryegrass]
gb|ABP58633.1|  major pollen allergen Ole e 1                         98.2    1e-21   Olea europaea
emb|CAA73036.1|  Ole e 1 protein                                      97.8    1e-21   Olea europaea
gb|ABP58632.1|  major pollen allergen Ole e 1                         97.8    1e-21   Olea europaea
pir||B53806  major allergen OLE5c - common olive                      97.8    1e-21
ref|XP_008797140.1|  PREDICTED: major pollen allergen Lol p 11-like   98.6    2e-21   
ref|XP_008445353.1|  PREDICTED: protein DOWNSTREAM OF FLC             97.8    2e-21   
ref|NP_001237189.1|  uncharacterized protein LOC100305566 precursor   97.8    2e-21   
ref|XP_006355373.1|  PREDICTED: pollen-specific protein C13-like      97.4    2e-21   
ref|XP_006661725.1|  PREDICTED: pollen-specific protein C13-like      97.8    3e-21   
pir||S43243  allergen-like protein Syr v I isoform 2 - Syringa vu...  97.1    3e-21
ref|XP_010942360.1|  PREDICTED: pollen allergen Phl p 11-like         97.4    3e-21   
ref|XP_004960638.1|  PREDICTED: pollen allergen Phl p 11-like         97.4    4e-21   
pir||E53806  major allergen OLE17 - common olive (fragment)           96.3    4e-21
ref|XP_010455288.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        96.7    5e-21   
gb|AAQ83588.1|  allergen Fra e 1                                      96.3    5e-21   Fraxinus excelsior
gb|ABP58636.1|  major pollen allergen Ole e 1                         95.9    6e-21   Olea europaea
ref|XP_007018845.1|  Pollen-specific protein C13, putative            96.3    7e-21   
ref|NP_001057857.1|  Os06g0556600                                     96.7    7e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008803750.1|  PREDICTED: pollen-specific protein C13           96.3    8e-21   
ref|XP_002440811.1|  hypothetical protein SORBIDRAFT_09g007260        96.3    8e-21   Sorghum bicolor [broomcorn]
sp|O82015.2|LIGV1_LIGVU  RecName: Full=Major pollen allergen Lig ...  95.5    9e-21   
gb|EPS62385.1|  hypothetical protein M569_12405                       95.5    9e-21   
ref|XP_002890794.1|  hypothetical protein ARALYDRAFT_336019             101   1e-20   
ref|XP_010527375.1|  PREDICTED: major pollen allergen Lol p 11-like   95.9    1e-20   
pir||I53806  major allergen OLE16 - common olive (fragment)           95.1    1e-20
ref|XP_004959259.1|  PREDICTED: pollen-specific protein C13-like      95.9    1e-20   
pir||F53806  major allergen OLE19 - common olive (fragment)           95.1    1e-20
emb|CAA54819.1|  major allergen                                       95.1    1e-20   
emb|CAA73038.1|  Ole e 1.0102 protein                                 95.1    1e-20   
pir||C53806  major allergen OLE1c - common olive (fragment)           95.1    1e-20
ref|XP_010535648.1|  PREDICTED: major pollen allergen Lol p 11-like   95.5    1e-20   
ref|XP_007136225.1|  hypothetical protein PHAVU_009G028900g           95.5    1e-20   
sp|P19963.2|ALL1_OLEEU  RecName: Full=Major pollen allergen Ole e...  95.1    1e-20   
ref|NP_001148443.1|  pollen allergen Phl p 11 precursor               95.9    2e-20   
emb|CAA73037.1|  Ole e 1.0103 protein                                 94.7    2e-20   
gb|AAT08700.1|  pollen-specific protein                               95.5    2e-20   
gb|ABP58634.1|  major pollen allergen Ole e 1                         94.4    3e-20   
dbj|BAK07321.1|  predicted protein                                    94.7    3e-20   
ref|XP_004146873.1|  PREDICTED: pollen allergen Che a 1-like          94.7    3e-20   
gb|AAN18042.1|  major pollen allergen Ole e 1                         93.6    4e-20   
ref|XP_010676978.1|  PREDICTED: major pollen allergen Lol p 11-like   94.4    4e-20   
gb|EMT13715.1|  Pollen allergen Phl p 11                              94.4    4e-20   
gb|AEK85661.1|  major pollen allergen Ole e1                          93.6    4e-20   
gb|KEH38613.1|  pollen Ole e I family allergen                        94.0    5e-20   
sp|Q8H6L7.1|PHLB_PHLPR  RecName: Full=Pollen allergen Phl p 11; A...  93.2    6e-20   
ref|XP_006645671.1|  PREDICTED: pollen allergen Phl p 11-like         93.6    6e-20   
pir||H53806  major allergen OLE6 - common olive (fragment)            92.8    6e-20
gb|AFK37732.1|  unknown                                               93.6    6e-20   
ref|XP_008453801.1|  PREDICTED: major pollen allergen Lol p 11-like   93.6    7e-20   
gb|AEK85659.1|  major pollen allergen Ole e1                          92.8    8e-20   
ref|NP_196575.1|  pollen_Ole_e_I-domain containing protein            93.6    8e-20   
gb|EYU24008.1|  hypothetical protein MIMGU_mgv1a015363mg              93.2    9e-20   
gb|KFK32118.1|  hypothetical protein AALP_AA6G200700                  93.2    9e-20   
ref|XP_010916905.1|  PREDICTED: pollen-specific protein C13-like      93.6    9e-20   
ref|XP_009383585.1|  PREDICTED: pollen-specific protein C13-like      93.2    1e-19   
gb|KHG30321.1|  Anther-specific LAT52                                 93.2    1e-19   
gb|AEW90941.1|  group 11 grass pollen allergen F7-4                   93.2    1e-19   
gb|KHG18492.1|  Anther-specific LAT52                                 93.2    1e-19   
ref|XP_006397273.1|  hypothetical protein EUTSA_v10029031mg           92.8    1e-19   
gb|EPS69662.1|  hypothetical protein M569_05103                       92.4    1e-19   
pir||G53806  major allergen OLE26 - common olive (fragment)           92.0    1e-19
gb|KEH38612.1|  pollen Ole e I family allergen                        92.8    2e-19   
ref|XP_010424432.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        94.4    2e-19   
gb|AEK85660.1|  major pollen allergen Ole e1                          91.7    2e-19   
gb|AEW90942.1|  group 11 grass pollen allergen F7-6                   92.4    2e-19   
gb|ACJ86286.1|  unknown                                               92.4    2e-19   
gb|AAV74343.1|  Fra e 1.0102 major allergen                           91.7    3e-19   
pir||A38968  major allergen OLE20 - common olive (fragment)           91.3    3e-19
gb|AEW90943.1|  group 11 grass pollen allergen F8-6                   92.0    3e-19   
ref|XP_002872410.1|  hypothetical protein ARALYDRAFT_489767           91.7    3e-19   
gb|AFK47744.1|  unknown                                               91.7    3e-19   
gb|KFK42186.1|  hypothetical protein AALP_AA2G222600                  91.7    4e-19   
ref|XP_004500607.1|  PREDICTED: pollen-specific protein C13-like      91.7    4e-19   
ref|XP_008343344.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  90.1    6e-19   
ref|XP_010025486.1|  PREDICTED: protein DOWNSTREAM OF FLC             90.9    6e-19   
gb|AEW90940.1|  group 11 grass pollen allergen F7-1                   91.3    6e-19   
ref|XP_007048005.1|  Pollen-specific protein C13, putative            90.5    8e-19   
gb|AAQ10269.1|  major pollen allergen Ole e 1                         89.7    1e-18   
gb|AAQ07442.1|  major pollen allergen Ole e 1                         89.4    1e-18   
gb|AAQ08947.1|  allergen Fra e 1.0101                                 89.7    1e-18   
gb|AEK85663.1|  major pollen allergen Ole e1                          89.4    1e-18   
ref|XP_003565925.1|  PREDICTED: pollen allergen Phl p 11              90.1    1e-18   
gb|AAQ10267.1|  major pollen allergen Ole e 1                         88.6    2e-18   
ref|XP_006661014.1|  PREDICTED: pollen-specific protein C13-like      89.4    2e-18   
ref|XP_004971474.1|  PREDICTED: pollen allergen Phl p 11-like         89.4    2e-18   
gb|AEK85658.1|  major pollen allergen Ole e1                          88.6    2e-18   
ref|XP_011101376.1|  PREDICTED: pollen allergen Che a 1-like isof...  89.4    2e-18   
gb|EAZ45758.1|  hypothetical protein OsJ_30442                        89.0    3e-18   
gb|ADM76653.1|  extensin-like protein                                 89.0    3e-18   
gb|AAQ10277.1|  major pollen allergen Ole e 1                         88.2    3e-18   
ref|XP_010521200.1|  PREDICTED: major pollen allergen Lol p 11        89.0    4e-18   
dbj|BAD46623.1|  putative Pollen specific protein C13 precursor       88.6    5e-18   
gb|EEC85106.1|  hypothetical protein OsI_32490                        88.6    5e-18   
ref|NP_001064001.1|  Os09g0572800                                     88.6    5e-18   
gb|AEK85662.1|  major pollen allergen Ole e1                          87.4    6e-18   
gb|AAQ08188.1|  major pollen allergen Ole e 1                         87.0    7e-18   
gb|AEW90945.1|  group 11 grass pollen allergen R1-2                   87.8    8e-18   
ref|XP_002889170.1|  pollen ole e 1 allergen and extensin family ...  88.2    8e-18   
gb|AAQ10272.1|  major pollen allergen Ole e 1                         86.7    1e-17   
gb|ACJ86288.1|  unknown                                               87.8    1e-17   
ref|XP_007141147.1|  hypothetical protein PHAVU_008G171500g           87.0    1e-17   
ref|XP_011101377.1|  PREDICTED: olee1-like protein isoform X2         87.4    1e-17   
ref|XP_011102257.1|  PREDICTED: olee1-like protein                    87.4    1e-17   
gb|AAB32652.2|  main olive allergen                                   86.3    1e-17   
ref|XP_010105888.1|  hypothetical protein L484_021545                 87.4    1e-17   
ref|XP_002459879.1|  hypothetical protein SORBIDRAFT_02g012930        87.0    2e-17   
ref|XP_010416770.1|  PREDICTED: major pollen allergen Lol p 11-like   86.7    2e-17   
ref|XP_010472003.1|  PREDICTED: major pollen allergen Lol p 11-like   86.7    3e-17   
ref|XP_009106450.1|  PREDICTED: protein DOWNSTREAM OF FLC             86.3    3e-17   
gb|AAO22132.1|  major pollen allergen Ole e 1                         85.5    3e-17   
ref|XP_006302909.1|  hypothetical protein CARUB_v10021044mg           86.7    3e-17   
ref|XP_010422886.1|  PREDICTED: protein DOWNSTREAM OF FLC             86.3    3e-17   
gb|AAQ10274.1|  major pollen allergen Ole e 1                         85.5    3e-17   
ref|XP_010428908.1|  PREDICTED: major pollen allergen Lol p 11-like   86.3    4e-17   
ref|XP_006288804.1|  hypothetical protein CARUB_v10002136mg           85.9    4e-17   
gb|AAM78185.1|  putative SAH7 protein                                 84.7    4e-17   
ref|XP_010317514.1|  PREDICTED: olee1-like protein                    84.7    4e-17   
gb|EMS61378.1|  Pollen-specific protein C13                           85.1    5e-17   
emb|CDX88408.1|  BnaC06g38520D                                        85.5    6e-17   
emb|CDX87484.1|  BnaA07g33890D                                        85.1    8e-17   
ref|XP_010491667.1|  PREDICTED: protein DOWNSTREAM OF FLC             85.1    9e-17   
gb|AAM78187.1|  putative SAH7 protein                                 83.6    1e-16   
ref|XP_004502439.1|  PREDICTED: pollen-specific protein C13-like      84.7    1e-16   
gb|EAZ04544.1|  hypothetical protein OsI_26693                        84.3    1e-16   
gb|EAZ40496.1|  hypothetical protein OsJ_24951                        84.0    2e-16   
ref|XP_006601773.1|  PREDICTED: uncharacterized protein LOC100527...  84.0    2e-16   
ref|XP_010453035.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        84.3    2e-16   
ref|XP_003638771.1|  Pollen allergen Phl p                            84.0    2e-16   
gb|AAM78186.1|  putative SAH7 protein                                 82.8    2e-16   
ref|XP_010547621.1|  PREDICTED: protein DOWNSTREAM OF FLC             84.0    2e-16   
gb|ABP58637.1|  major pollen allergen Ole e 1                         83.2    2e-16   
ref|XP_006468202.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  82.4    3e-16   
ref|NP_001175282.1|  Os07g0590500                                     83.2    4e-16   
gb|AAQ10273.1|  major pollen allergen Ole e 1                         82.0    5e-16   
gb|AAM78189.1|  putative SAH7 protein                                 81.6    6e-16   
ref|XP_006390031.1|  hypothetical protein EUTSA_v10019236mg           82.4    7e-16   
ref|XP_002887714.1|  pollen ole e 1 allergen and extensin family ...  81.6    1e-15   
gb|ACK44512.1|  AT5G10130-like protein                                82.0    1e-15   
ref|XP_003543768.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        81.6    1e-15   
ref|NP_177927.1|  pollen Ole e 1 allergen and extensin family pro...  81.6    1e-15   
ref|XP_006399503.1|  hypothetical protein EUTSA_v10014875mg           81.3    2e-15   
gb|AFO38383.1|  putative pollen-specific protein C13                  82.0    2e-15   
ref|XP_009122085.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        81.3    2e-15   
gb|AAQ10280.1|  major pollen allergen Ole e 1                         80.5    2e-15   
gb|AAM78188.1|  putative SAH7 protein                                 80.1    2e-15   
ref|XP_009125327.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        80.9    3e-15   
emb|CDY40079.1|  BnaC02g00510D                                        80.9    3e-15   
gb|ADM76665.1|  extensin-like protein                                 80.5    3e-15   
gb|AAQ10281.1|  major pollen allergen Ole e 1                         79.7    3e-15   
emb|CDX85777.1|  BnaA02g00360D                                        80.5    3e-15   
gb|AAZ67595.1|  80A08_10                                              80.5    4e-15   
ref|XP_004299638.1|  PREDICTED: pollen allergen Phl p 11-like         79.0    4e-15   
ref|XP_010680579.1|  PREDICTED: major pollen allergen Lol p 11-like   80.1    5e-15   
ref|XP_002873440.1|  pollen ole e 1 allergen and extensin family ...  79.7    6e-15   
gb|ABK22573.1|  unknown                                               79.7    6e-15   
gb|ACQ44229.1|  putative pollen Ole e 1 allergen and extensin fam...  79.7    6e-15   
gb|ABK21930.1|  unknown                                               79.7    7e-15   
gb|AFK44177.1|  unknown                                               79.0    1e-14   
ref|XP_003596438.1|  Major pollen allergen Lol p                      79.3    1e-14   
gb|AAQ10279.1|  major pollen allergen Ole e 1                         77.8    1e-14   
gb|ADM76637.1|  extensin-like protein                                 78.6    2e-14   
ref|XP_010906302.1|  PREDICTED: pollen-specific protein C13-like      77.4    2e-14   
gb|AAN60344.1|  unknown                                               77.8    2e-14   
emb|CDY21640.1|  BnaC09g46520D                                        77.8    2e-14   
ref|XP_003596434.1|  Major pollen allergen Lol p                      77.8    3e-14   
emb|CDO96791.1|  unnamed protein product                              76.6    4e-14   
ref|XP_009794836.1|  PREDICTED: pollen-specific protein C13-like      75.9    5e-14   
ref|XP_008381078.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        76.6    7e-14   
gb|AAO22133.1|  major pollen allergen Ole e 1                         76.3    7e-14   
ref|XP_003596436.1|  Major pollen allergen Lol p                      76.6    7e-14   
ref|XP_009789881.1|  PREDICTED: olee1-like protein                    76.6    8e-14   
ref|XP_003601984.1|  Pollen-specific protein C13                      76.3    8e-14   
gb|KHN44330.1|  Pollen-specific protein C13                           75.5    1e-13   
emb|CDY21637.1|  BnaC09g46550D                                        75.9    2e-13   
ref|XP_006838264.1|  hypothetical protein AMTR_s00103p00069180        74.7    2e-13   
ref|XP_008343324.1|  PREDICTED: olee1-like protein                    73.6    3e-13   
gb|KDO56621.1|  hypothetical protein CISIN_1g041753mg                 73.6    4e-13   
emb|CAC41634.1|  plantain pollen major allergen, Pla l 1.0102         73.6    5e-13   
ref|XP_010090546.1|  hypothetical protein L484_016596                 74.7    5e-13   
emb|CAC41635.1|  plantain pollen major allergen, Pla l 1.0103         73.2    8e-13   
ref|XP_003596443.1|  Major pollen allergen Lol p                      74.3    9e-13   
gb|AAF17689.1|AC009243_16  F28K19.26                                  76.6    2e-12   
gb|EMT21854.1|  hypothetical protein F775_27590                       71.2    4e-12   
sp|P82242.2|PLAL1_PLALA  RecName: Full=Major pollen allergen Pla ...  70.5    5e-12   
gb|AAO41983.1|  unknown protein                                       70.1    6e-12   
ref|XP_009413179.1|  PREDICTED: pollen-specific protein C13-like      68.9    1e-11   
gb|KDO44647.1|  hypothetical protein CISIN_1g045131mg                 68.6    2e-11   
gb|AFW82075.1|  hypothetical protein ZEAMMB73_949741                  68.2    2e-11   
ref|XP_003596420.1|  Pollen allergen Che a                            68.2    7e-11   
ref|XP_008391140.1|  PREDICTED: olee1-like protein                    66.6    1e-10   
ref|XP_009147847.1|  PREDICTED: pollen-specific protein-like At4g...  65.9    2e-10   
ref|XP_008357485.1|  PREDICTED: uncharacterized protein LOC103421237  67.8    3e-10   
ref|XP_008238496.1|  PREDICTED: olee1-like protein                    65.1    8e-10   
ref|XP_007210061.1|  hypothetical protein PRUPE_ppa018487mg           65.1    1e-09   
emb|CDY14639.1|  BnaC02g24740D                                        63.9    1e-09   
ref|XP_007208811.1|  hypothetical protein PRUPE_ppa024778mg           62.8    6e-09   
ref|XP_007208803.1|  hypothetical protein PRUPE_ppa024703mg           62.4    8e-09   
ref|XP_008240860.1|  PREDICTED: olee1-like protein                    62.0    2e-08   
gb|KEH15235.1|  pollen protein Ole E I-like protein                   60.8    3e-08   
gb|EMS67079.1|  hypothetical protein TRIUR3_25214                     58.2    1e-07   
ref|XP_008225290.1|  PREDICTED: olee1-like protein                    57.0    7e-07   
gb|ABN50034.1|  putative Ole e 1-like protein                         55.1    7e-07   
ref|XP_003595687.1|  Olee1-like protein                               55.8    3e-06   
ref|XP_006449500.1|  hypothetical protein CICLE_v10017321mg           52.0    1e-05   
ref|NP_001237949.1|  uncharacterized protein LOC100527053             48.5    3e-04   



>gb|AFB73931.1| LAT52-like protein [Lycium barbarum]
Length=161

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+A+ L+SA CI+ALA  AHC PE F+V GKVYCDTCRVQFET++SQ+I+ A V+L+CR
Sbjct  1    MAKAIVLLSALCIVALANFAHCHPEVFDVEGKVYCDTCRVQFETKLSQNIEGATVKLQCR  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            N+  +T T+S+EG T  DG Y LTV+GDH+ D+C VTVVKSPREDCKE V G EKA + C
Sbjct  61   NITTETETFSVEGVTDKDGKYKLTVEGDHQDDICEVTVVKSPREDCKEAVSGYEKARIEC  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            + NVGM + +R+ANPLFFMK  A E C + L+E+   P
Sbjct  121  SDNVGMHNAVRYANPLFFMKAEAVEGCKEALDELGLFP  158



>gb|AFB73932.1| LAT52-like protein [Lycium barbarum]
Length=161

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+A+ L+SA CI ALA  AHC PE F+V GKVYCDTCRVQFET++SQ+I+ A V+L+CR
Sbjct  1    MAKAIVLLSALCIAALANFAHCHPEVFDVEGKVYCDTCRVQFETKLSQNIEGATVKLQCR  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            N+  +T T+S+EG T  DG Y LTV+GDH+ D+C VTVVKSPREDCKE V G EKA + C
Sbjct  61   NITTETETFSVEGVTDKDGKYKLTVEGDHQDDICEVTVVKSPREDCKEAVSGYEKARIEC  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            + NVGM + +R+ANPLFFMK  A E C + L+E+   P
Sbjct  121  SDNVGMHNAVRYANPLFFMKAEAVEGCKEALDELGLFP  158



>ref|XP_009604804.1| PREDICTED: anther-specific protein LAT52 [Nicotiana tomentosiformis]
Length=161

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+A+ L+SA CI+ALA  AHC P+ F+V GKVYCDTCRVQFET++S++++ A VRL+CR
Sbjct  1    MAKAIVLLSALCIVALANFAHCRPQVFDVEGKVYCDTCRVQFETKLSENVEGATVRLQCR  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            N+  +T T+S+EG T  DG Y LTV+GDH+ D+C VTVVKSPREDCKE+V G EKA + C
Sbjct  61   NISTETETFSVEGVTDKDGKYKLTVEGDHQDDICEVTVVKSPREDCKESVTGYEKARIEC  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            + NVG+ + +R+ANPLFFMK  A   C +VL+E+   P
Sbjct  121  SDNVGIHNAVRYANPLFFMKTEAVSGCKEVLDELGLFP  158



>ref|XP_004248244.1| PREDICTED: anther-specific protein LAT52 [Solanum lycopersicum]
 sp|P13447.1|LAT52_SOLLC RecName: Full=Anther-specific protein LAT52; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA33854.1| LAT52 [Solanum lycopersicum]
Length=161

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+A+ L+SA CILALA  AHC PE F+V GKVYCDTCRVQFET++S++++ A V+L+CR
Sbjct  1    MAKAIVLLSALCILALANFAHCRPEVFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCR  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            N+  +  T+S+EG T  DG Y LTV+GDHE D+C VTVVKSPREDCKE+V G EKA + C
Sbjct  61   NISTEAETFSVEGVTDKDGKYKLTVNGDHENDICEVTVVKSPREDCKESVSGYEKARIEC  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            + NVG+ + +R ANPLFFMK  + + C + L+E+   P
Sbjct  121  SDNVGIHNAVRFANPLFFMKAESVQGCKEALDELGLFP  158



>ref|XP_006360048.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=161

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+A+ L+SA CI+ALA  AHC  E F+V GKVYCDTCRVQFET++S+++  A V+L+CR
Sbjct  1    MAKAILLLSALCIVALANFAHCHSEVFDVEGKVYCDTCRVQFETKLSENLDGATVKLQCR  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            N+  +  T+S+EG T  DG Y LTVDGDHE D+C VTVVKSPREDCKE+V G EKA + C
Sbjct  61   NISTEAETFSVEGVTDKDGKYKLTVDGDHENDICEVTVVKSPREDCKESVSGYEKARIEC  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            + NVG+ + +R+ANPLFFMK  + + C + L+E+   P
Sbjct  121  SNNVGIHNAVRYANPLFFMKAESVQGCKEALDELGLFP  158



>ref|XP_009794171.1| PREDICTED: anther-specific protein LAT52 [Nicotiana sylvestris]
Length=161

 Score =   198 bits (503),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+A+ L+SA CI+ALA  AHC P+ F+V GKVYCDTCRVQFET++S++++ A VRL+CR
Sbjct  1    MAKAILLLSALCIVALANFAHCHPQVFDVEGKVYCDTCRVQFETKLSENVEGATVRLQCR  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            N+  +  T+S+EG T  DG Y LTV+GDH+ D+C VTVVKSPREDCKE V G EKA + C
Sbjct  61   NISTEIETFSVEGVTDKDGKYKLTVEGDHQDDICEVTVVKSPREDCKEAVTGYEKARIEC  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            + NVG+ + +R+AN LFFMK  A   C +VL+E+   P
Sbjct  121  SDNVGIHNAVRYANALFFMKSEAVSGCKEVLDELGLFP  158



>ref|XP_009602640.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana tomentosiformis]
Length=163

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 112/159 (70%), Gaps = 1/159 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCA-PEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+A+ L+SA CILA    A C   +  NV G VYCDTCRVQF+T++S+ I+ A VRL C
Sbjct  1    MAKAILLLSAVCILAFVNFAQCHDSQAINVEGSVYCDTCRVQFQTKLSEYIEGATVRLAC  60

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++++ +  TYS+EG T  +G Y + V+GDHE ++C V++VKSPREDCKE+  G E + VV
Sbjct  61   KDIETEKETYSVEGVTDKNGKYIIKVEGDHENELCEVSIVKSPREDCKESAIGFENSRVV  120

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            C+ANVG+ +  R+ANPLFFMK  A   C  VL+E+   P
Sbjct  121  CSANVGIHNPTRYANPLFFMKTEAVSGCKDVLDELGLFP  159



>ref|XP_009778120.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana sylvestris]
Length=163

 Score =   172 bits (437),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 110/159 (69%), Gaps = 1/159 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCA-PEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+A+ L+SA CILA    A C   +  NV G VYCDTCRVQF+T++S+ I+ A VRL C
Sbjct  1    MAKAILLLSAVCILAFVNFAQCHDSQAINVEGSVYCDTCRVQFQTKLSEYIEGATVRLAC  60

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++++ +  TYS+EG T  +G Y + V+GDHE ++C V++VKSPREDCKE   G E + VV
Sbjct  61   KDIETEKETYSVEGVTDKNGKYIIKVEGDHENELCEVSIVKSPREDCKEPAIGFENSRVV  120

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            C+ NVG+ +  R+ANPLFFMK  A   C  VL+E+   P
Sbjct  121  CSGNVGIHNPTRYANPLFFMKTEAVSGCKDVLDELGLFP  159



>ref|XP_009761932.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana sylvestris]
Length=164

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+A+ L+SA C+LA+A  A   PE F+V G+V+CDTCR+ F T +S++I+ A VRL CR
Sbjct  1    MAKAIVLLSALCVLAIANFAVAEPEVFDVEGRVFCDTCRLGFATSLSEAIQGATVRLTCR  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +++    TYS EG T   G Y LTV+GDHE D+C VTVV SPREDCKE V  L K  VVC
Sbjct  61   DIETHNETYSTEGKTDMIGKYTLTVEGDHENDICEVTVVNSPREDCKEIVSELVKGRVVC  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEID  175
            + NVGM + +R  NPLFF KD     C +++EE++
Sbjct  121  SKNVGMHNAVRFTNPLFFQKDKPVPGCKELVEEME  155



>ref|XP_011070069.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=161

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+AVAL+SA CILA A +     EKF+V G VYCD CRVQFET +S ++  A VRLECR
Sbjct  1    MAKAVALVSALCILA-AAVVDAHKEKFHVEGDVYCDPCRVQFETELSYNLAGATVRLECR  59

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +++ KT+TYSMEG TG+DG+Y+LTV GDHE+D+C V  VKSP+ +C E +   E+A + C
Sbjct  60   DIETKTVTYSMEGVTGSDGHYSLTVKGDHEKDICEVIPVKSPKAECSEPMGDYERAKIEC  119

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVL  187
            T N G+ + IR+ANP+ FM       C  +L
Sbjct  120  TENSGLHNPIRYANPIGFMTPEILPACGPIL  150



>ref|XP_009598969.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana tomentosiformis]
Length=164

 Score =   167 bits (422),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 105/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+A+ L+SA C LA+A  A   PE F+V G+V+CDTCR+ F T +S+ I+ A V L CR
Sbjct  1    MAKAIVLLSALCFLAIANFAVAEPEVFDVEGRVFCDTCRLGFATSLSEVIQGATVGLTCR  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +++    TYS EG T   G Y LTV+GDHE D+C VTVV SPREDCKE V  L K  VVC
Sbjct  61   DIETHNETYSTEGKTDMIGKYTLTVEGDHENDICEVTVVNSPREDCKEIVSELVKGRVVC  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEID  175
            + NVGM + +R  NPLFF KD     C +++EE++
Sbjct  121  SKNVGMHNAVRFTNPLFFQKDKPVPGCKELVEEME  155



>ref|XP_004251892.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=161

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 107/159 (67%), Gaps = 2/159 (1%)
 Frame = -2

Query  639  MARAVALISAFC-ILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+A+ ++SA C ILA A  A C  E F V G VYCDTCRVQF+TRIS+ I+ A V+L C
Sbjct  1    MAKAILVLSALCSILAFANFAQCQ-EAFKVEGTVYCDTCRVQFQTRISEYIEGAKVKLTC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+++ + +TY+ E  T  +G Y +   GDHE+++C V VV+SPREDCK+   G E + VV
Sbjct  60   RDMETEKVTYTAEALTDKNGKYTIEASGDHEKELCDVGVVQSPREDCKDPAIGFENSRVV  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            C+ NVGM +  R+ANPLFFMK      C  VL+E+   P
Sbjct  120  CSNNVGMHNPTRYANPLFFMKKETLPDCKDVLDELGLFP  158



>ref|XP_006358942.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=161

 Score =   162 bits (410),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 107/159 (67%), Gaps = 2/159 (1%)
 Frame = -2

Query  639  MARAVALISAFC-ILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+A+ ++SA C ILA A  A  + E F V G VYCDTCRVQF+T+IS++I+ A V+L C
Sbjct  1    MAKAILVLSALCSILAFANFAQ-SHEVFKVEGTVYCDTCRVQFQTKISENIEGAKVQLTC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+++ + +TY+ E  T  DG Y +   GDHE+++C V V+ SPREDCKE   G E   VV
Sbjct  60   RDMETEKVTYTTEALTDKDGKYTIEATGDHEKELCDVGVIHSPREDCKEPAIGFENTRVV  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            C+ NVGM +  R+ANPLFFMK  +   C  VL+E+   P
Sbjct  120  CSNNVGMHNPTRYANPLFFMKKESLPGCKDVLDELGLFP  158



>ref|XP_011098227.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=163

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 107/155 (69%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIA-HCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+AVAL+SA CILA++ +  H   EKF V G VYCD CRVQFET +S  I  A VR+EC
Sbjct  1    MAKAVALVSALCILAVSVVVVHAHKEKFYVEGDVYCDPCRVQFETELSYHIAGAMVRVEC  60

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+++ K +T+SMEG TG+DG+Y++ V GDHE+D+C V   +SP+ +C E +   E+A V 
Sbjct  61   RDIETKKITFSMEGVTGSDGHYSIMVTGDHEKDICEVIPTRSPKNECSEPMGDYERAKVE  120

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            CT N G+ + IR+ANP+ FM       C+ +L ++
Sbjct  121  CTENSGLHNTIRYANPVGFMTPKVLPECAPILADL  155



>gb|EYU26327.1| hypothetical protein MIMGU_mgv1a015422mg [Erythranthe guttata]
Length=158

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 102/157 (65%), Gaps = 1/157 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+ VALISA C LA     H   E FNV G VYCD CRVQFET ++Q +  A VRLECR
Sbjct  1    MAKTVALISALCFLAAVVHGH-QTEHFNVEGDVYCDPCRVQFETVLAQRLIGATVRLECR  59

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +L  K +TYS+EG TG +G+Y+L V GDH+ ++C V VVKSPR DC E +    K+ + C
Sbjct  60   DLVKKAVTYSVEGVTGFNGHYSLPVVGDHQNEICEVAVVKSPRPDCIEPMGDFAKSRISC  119

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFL  169
            T N G  + +R ANP+ FM   A  +C+ VL ++  L
Sbjct  120  TTNDGTHAAVRFANPIGFMTGAAVPQCTPVLFDLGVL  156



>ref|XP_004244268.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=169

 Score =   154 bits (390),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+A+ L+S  C+LA+A  A    E FNV GKV+CDTCR+ F T +S +++ A VR+ C+
Sbjct  1    MAKAIILLSTLCVLAVANFAVADVETFNVEGKVFCDTCRLGFVTSLSNTLEGATVRMTCK  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +++    T++ EG T   G Y L V+GDHE D+C VT+V SP++DCKE V  +    V+C
Sbjct  61   DMETHNETFTTEGKTDGIGKYTLKVEGDHENDICEVTLVNSPKDDCKEVVPDMVNNRVIC  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFL  169
            + NVGM + +R  NPLF+ KD   + C+K++EE++ +
Sbjct  121  SKNVGMHNAVRFVNPLFYQKDKPIDGCAKLVEEMELV  157



>gb|EYU45018.1| hypothetical protein MIMGU_mgv1a015317mg [Erythranthe guttata]
Length=161

 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 107/157 (68%), Gaps = 3/157 (2%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEK---FNVVGKVYCDTCRVQFETRISQSIKDAAVRL  469
            MA+AVAL+S  CI+ALA  +     +   FN+ G VYCD CRVQF T +S+ I  A VRL
Sbjct  1    MAKAVALVSVLCIVALAAASVAHAHQRNVFNIEGDVYCDPCRVQFHTELSKRIPGATVRL  60

Query  468  ECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAI  289
            EC+N + K +TYS+EG T ADG+Y+L VDGDHE+D+CVV  +KSP  +C E +  + ++ 
Sbjct  61   ECQNEETKAVTYSVEGLTNADGHYSLRVDGDHEKDVCVVKAIKSPIAECSEPMTDVRESR  120

Query  288  VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            +VCT N+GM S +R ANP+ FM  +   +C  VL++ 
Sbjct  121  IVCTNNIGMHSAVRFANPIGFMTKVGSPQCIPVLQDF  157



>ref|XP_006348395.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=169

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+A+ L+SA C+LA+A  A    E F+V GKV+CDTCR+ F T +S +++ A VRL C+
Sbjct  1    MAKAIILLSALCVLAVANFAVADFEIFDVEGKVFCDTCRLGFVTSLSNTLEGATVRLTCK  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +++    T++ EG T   G Y LTV+GDHE D+C VT+V SP++DCKE V  +    V+C
Sbjct  61   DMETHNETFTTEGKTDYIGKYTLTVEGDHENDICEVTLVNSPKDDCKEIVPDMVNNRVIC  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFL  169
            + NVGM + +R  NPLFF KD     C +++EE++ +
Sbjct  121  SKNVGMHNAVRFVNPLFFQKDKPINGCRELVEEMELV  157



>ref|XP_011029563.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=166

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 103/153 (67%), Gaps = 0/153 (0%)
 Frame = -2

Query  624  ALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNK  445
            A +S     +   I+  A +  +V GKVYCDTCRV+F+T+IS ++  A V+L C N +N 
Sbjct  9    AFVSTALCFSSVLISAYAADYLDVEGKVYCDTCRVEFQTKISDALPGAKVKLACNNRENG  68

Query  444  TLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVG  265
            TLTY++EG+T + G Y L V GDHE D+C V +V+SPR DC E  K ++ A ++ T NVG
Sbjct  69   TLTYTVEGSTDSRGTYRLPVAGDHEEDICEVRLVESPRADCNEPFKSVDSARILLTKNVG  128

Query  264  MKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            + + +R+AN L +MK +A   C+KVLEE+ FLP
Sbjct  129  VVNSLRYANALGYMKKVAQPECAKVLEEMGFLP  161



>ref|XP_002316866.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|EEE97478.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=164

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 105/155 (68%), Gaps = 1/155 (1%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            A  + +A C  ++  I+  A +  +V GKVYCDTCRV+F+T+IS +I  A V+L C N +
Sbjct  8    AAFVATALCFSSVL-ISAYAADYLDVEGKVYCDTCRVEFQTKISDAIPGAKVKLVCNNRE  66

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTAN  271
            N TLTY++EG T + G Y L V GDHE D+C V +V+SPR DC E  K ++ A ++ T N
Sbjct  67   NGTLTYTVEGTTDSSGTYRLPVVGDHEEDICEVRLVESPRADCNEPFKSVDSARILLTKN  126

Query  270  VGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            VG+  ++R+AN L +MK +A   C+KVLEE+ FLP
Sbjct  127  VGVVDNLRYANALGYMKKVAQPECAKVLEEMGFLP  161



>gb|EPS72638.1| hypothetical protein M569_02120, partial [Genlisea aurea]
Length=161

 Score =   148 bits (374),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 104/162 (64%), Gaps = 11/162 (7%)
 Frame = -2

Query  639  MARAVALISA--FCILALAGIAHCAPEK-------FNVVGKVYCDTCRVQFETRISQSIK  487
            MA+AVAL+ +  FC+LA+A  AH  P         F+VVG+VYCD CRVQF T +S+ + 
Sbjct  1    MAKAVALVGSLLFCVLAIAA-AHKKPPPAAAHNRFFDVVGEVYCDPCRVQFMTELSRRLV  59

Query  486  DAAVRLEC-RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETV  310
             A VRL+C R  D   +TYS+EG TG DG Y L V GDHE D+C V V+ SPR DC   +
Sbjct  60   GATVRLQCHRYNDTGCITYSVEGKTGFDGRYRLQVKGDHESDLCFVKVIGSPRADCAVPM  119

Query  309  KGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLE  184
              + ++ +VCT NVG+ S +R+ANPL FM   A  RC  VL+
Sbjct  120  TDVVESRIVCTKNVGISSPVRYANPLGFMTRAAAPRCLPVLK  161



>ref|XP_002523378.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
 gb|EEF38957.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
Length=166

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 100/154 (65%), Gaps = 2/154 (1%)
 Frame = -2

Query  624  ALI-SAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDN  448
            ALI SA C  +L   A  A     V GKVYCDTCRV+FET++S+ I    V+LEC+N +N
Sbjct  9    ALIASALCFSSLLSSA-LATAGLYVEGKVYCDTCRVEFETKLSEVIPGTRVKLECKNREN  67

Query  447  KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANV  268
             TLTY++EG T A G Y L V+G+HE D+C V ++KS + DC E  K ++ A V+ T NV
Sbjct  68   NTLTYAVEGVTDASGIYRLPVEGEHEEDLCEVKLIKSGKPDCAEAFKSVDHARVLLTHNV  127

Query  267  GMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            G+    R+ NPL FMK  A   C KVL+++ F+P
Sbjct  128  GVVQPTRYTNPLGFMKQKASPECGKVLQDMGFVP  161



>emb|CDP16230.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 104/158 (66%), Gaps = 2/158 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+AVA++SA C LALA +AH A E F V G+VYCD CRV+F+T +S+SI+ A V L+CR
Sbjct  1    MAKAVAVVSALCFLALASLAH-AQEAFTVKGRVYCDPCRVEFQTSLSKSIEGAEVELQCR  59

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
              +N+T+T S +  T A GNY L+V GDHE ++C V  V SP ++C     G  KA V+ 
Sbjct  60   VRENETVTVSQKAKTDAIGNYELSVQGDHEEEICEVVSVSSPSQECNVPF-GENKARVLL  118

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            T N G++   R+AN L +    A+  C  VL+E+ ++P
Sbjct  119  TQNNGVQGTDRYANALGYKTAEANPDCKAVLQEMGYIP  156



>emb|CDP06002.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+AVA++SA C LALA +AH A E F V G+VYCD CRV+F+T +S++I+ A V L+CR
Sbjct  1    MAKAVAVVSALCFLALASLAH-AQEAFTVKGRVYCDPCRVEFQTSLSKNIEGAEVELQCR  59

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
              +N T+T S +  T A+GNY L+V GDHE ++C V  V SP  +C     G  KA ++ 
Sbjct  60   VRENGTVTVSQKATTDANGNYELSVQGDHEEEICEVASVSSPSLECNVPF-GENKARILL  118

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            T N G++   R ANPL +    A+  C  +L+E+ ++P
Sbjct  119  TQNNGVQGTDRFANPLGYKTTEANPDCKPILQEMGYIP  156



>ref|XP_008371469.1| PREDICTED: olee1-like protein [Malus domestica]
Length=172

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 101/160 (63%), Gaps = 4/160 (3%)
 Frame = -2

Query  636  ARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            + ++ L+SA C L+LAG+A+C  E  NV G VYCD CR+QF TRIS+++K A VRLECR 
Sbjct  4    SNSIVLVSALCFLSLAGVAYCG-ETLNVHGIVYCDNCRIQFVTRISETLKGAKVRLECRE  62

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE---KAIV  286
             +   +T S E  T   G Y++ V+GDHE ++C V +VKSP+EDC E    L     A +
Sbjct  63   NEGGKITLSKEADTDDLGTYSIPVEGDHEEEVCEVILVKSPKEDCSEISNELHVKLSARI  122

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
              T + G+    R ANPL FMK   D +C++VL+E+   P
Sbjct  123  SLTNHNGITGPHRMANPLGFMKKEVDPKCAEVLKELGLTP  162



>ref|XP_007021723.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY13248.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=162

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = -2

Query  639  MARA--VALIS-AFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRL  469
            MA+A  +AL+S A C+ +L+     A + F V GKVYCDTCRV+FETR+SQ IK A V L
Sbjct  1    MAKASLIALVSLAICLSSLSFTY--AEDTFFVEGKVYCDTCRVEFETRLSQPIKGATVIL  58

Query  468  ECRNLD-NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKA  292
            ECR+     ++TYS E  T   G Y + V GDHE ++C V VVKSPREDC E ++  ++A
Sbjct  59   ECRDRTVGGSITYSQESVTDESGKYRIPVQGDHEEEICEVRVVKSPREDCNEFMEAWQRA  118

Query  291  IVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
             V+ T   G+   IR+AN L F+K  A   C++VLEE+ FLP
Sbjct  119  RVLLTKKNGVSDPIRYANNLGFLKKEAVPGCAEVLEELGFLP  160



>ref|XP_010277041.1| PREDICTED: anther-specific protein LAT52 [Nelumbo nucifera]
Length=165

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 93/145 (64%), Gaps = 1/145 (1%)
 Frame = -2

Query  588  GIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGA  409
            G  HC  E+F V GKVYCDTCR QFET++S+ I  A VRLECR+ +N  + YS+EG T  
Sbjct  22   GFVHCD-EQFFVQGKVYCDTCRTQFETKLSEPISGAKVRLECRSRENDDVAYSVEGETDT  80

Query  408  DGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLF  229
             G Y L V+G HE D+C V ++ SPR+DC E   GL+ A V+ ++N G+ S  R AN L 
Sbjct  81   TGIYKLPVEGSHEEDICEVKLLSSPRKDCSEPAPGLDHARVLLSSNNGISSASRFANSLG  140

Query  228  FMKDLADERCSKVLEEIDFLPGQTM  154
            FM     E CS VL+E+  LPG  +
Sbjct  141  FMVLKPIEGCSDVLKELGLLPGMKI  165



>gb|KHG25858.1| Olee1-like protein [Gossypium arboreum]
Length=166

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = -2

Query  639  MARAV--ALIS-AFCILA-LAGIAHCAP--EKFNVVGKVYCDTCRVQFETRISQSIKDAA  478
            MA+A   AL+S A C+L+ L G A+      KF V+GKVYCDTCRV+FET++S+ I  A 
Sbjct  1    MAKASQRALVSMAICLLSSLVGFAYAGSLSNKFVVLGKVYCDTCRVEFETKLSEPIPGAK  60

Query  477  VRLECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE  298
            V+LECR   ++T+TYS E  T A+G Y + V+GDHE  +C V+ V SPR DC E ++  E
Sbjct  61   VKLECRKEGDETVTYSHEAETDANGVYKIPVEGDHEEQICAVSTVSSPRADCNEKMEAFE  120

Query  297  KAIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
            KA V  T++ G+    R AN L F K +A   C++VL+E+ F
Sbjct  121  KAQVELTSDDGLAEPSRKANNLGFKKKVAVPGCAQVLKEMGF  162



>ref|XP_009348994.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=172

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (63%), Gaps = 4/160 (3%)
 Frame = -2

Query  636  ARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            + ++ L+SA C L+L G+A+C  E  NV G VYCD CR+QF TRIS+++K A VRLECR 
Sbjct  4    SNSIFLVSALCFLSLVGVAYCG-ETLNVHGIVYCDNCRIQFVTRISETLKGAKVRLECRE  62

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE---KAIV  286
             +   +T S E  T   G Y++ V+GDHE ++C V +VKSP+EDC E    L     A +
Sbjct  63   NEGGKITLSKEADTDDLGTYSIPVEGDHEEEVCEVILVKSPKEDCSEISNELHVKLSARI  122

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
              T + G+    R ANPL FMK   D +C++VL+E+   P
Sbjct  123  SLTNHNGITGPHRMANPLGFMKKEVDPKCAEVLKELGLTP  162



>emb|CDP16229.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 101/158 (64%), Gaps = 2/158 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+AVA++SA C LALA +AH A E F V G+VYCD CRV+F+T +S+SI+ A V L+CR
Sbjct  1    MAKAVAVVSALCFLALASLAH-AQEAFTVKGRVYCDPCRVEFQTSLSKSIEGAEVELQCR  59

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
              +N T+T S +  T A+GNY L+  GDHE ++C V  V SP ++C        KA V+ 
Sbjct  60   VRENGTVTVSQKATTDANGNYELSAQGDHEEEICEVVSVSSPSQECNVPF-AENKARVLL  118

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            T N G++   R+AN L +     +  C  +L+E+ ++P
Sbjct  119  TQNNGVQGTDRYANALGYKTTKTNPDCKAILQEMGYIP  156



>gb|KDP32532.1| hypothetical protein JCGZ_14735 [Jatropha curcas]
Length=165

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 100/162 (62%), Gaps = 1/162 (1%)
 Frame = -2

Query  651  LHTKMARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVR  472
            +    A A  + SA C  +L   A      F V GKVYCD CRV+FET++S+ IK A V+
Sbjct  1    MAKSFAFAGLIASALCFSSLFSYAFAGANMF-VEGKVYCDVCRVEFETKLSEPIKGAVVK  59

Query  471  LECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKA  292
            LEC+  +N TLTY++EG T   G Y L V+G+HE D+C V +VKS   DC E  K  ++A
Sbjct  60   LECKIRENNTLTYAVEGETDPQGIYRLPVEGEHEEDICEVRLVKSGMTDCIEPFKSTDRA  119

Query  291  IVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
             ++ + NVG+    R+ANPL +MK  A+  C +VL ++ FLP
Sbjct  120  RILLSQNVGVVQASRYANPLGYMKKEANPNCGQVLLDMGFLP  161



>ref|XP_009617824.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=171

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 102/164 (62%), Gaps = 4/164 (2%)
 Frame = -2

Query  645  TKMARAVALISAFCILALAGIAHC-APEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRL  469
            TK    + + SA C+ +L GI    A  +F+V GKVYCD CR  FE R+S+ +  A VRL
Sbjct  2    TKSGAIILIASAICLFSLIGITQAQAQAQFHVEGKVYCDFCRALFENRLSKPMPGAEVRL  61

Query  468  ECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVK---GLE  298
            +CRN  + ++T ++EG T  +G Y+L V+ DHE ++C + ++KS +EDC E        E
Sbjct  62   QCRNSTDDSVTLTVEGQTDKNGVYSLLVERDHEDEICEMILMKSSKEDCSEIPNEGHAKE  121

Query  297  KAIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
             A +  T+N GM   IRHANPLFF+K  A   C++V +E++ LP
Sbjct  122  SARITITSNNGMAETIRHANPLFFVKKEAAPECAEVFKELELLP  165



>ref|XP_009352776.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=180

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 98/160 (61%), Gaps = 4/160 (3%)
 Frame = -2

Query  636  ARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            + ++ L+SA C L+L G+A+CA E  NV G VYCD CR QF TRIS+ +  A VRLECR 
Sbjct  4    SNSIVLVSALCFLSLIGVAYCA-ETLNVHGIVYCDNCRTQFFTRISEPLTGAKVRLECRE  62

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE---KAIV  286
             +   +T + E  T   G Y++ V+GDHE ++C V +VKSP+EDC E    L     A +
Sbjct  63   SEGGKVTLTKEADTEELGTYSIPVEGDHEEEVCEVILVKSPKEDCSEISNELHAKLSARI  122

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
              T + G+    R ANPL FMK   D RC++VL+E+   P
Sbjct  123  SLTNHNGITGPHRMANPLGFMKKEVDPRCAEVLKELGLTP  162



>ref|XP_011006522.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=161

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA++  + +     +   I+  A +  NV GKVYCD CRV+F+T+IS+ I  A V+L C 
Sbjct  1    MAKSFTIAAFVLCFSSLLISAYAADYLNVEGKVYCDPCRVEFQTKISEGIPAAKVKLVCN  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            N DN T TY++EGAT + G Y L+V GDHE D+C + +V+S R DC E  + ++ A ++ 
Sbjct  61   NRDNGTETYTVEGATDSSGTYRLSVAGDHEDDICEIRLVESSRPDCNEPFRSIDSAKILL  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            T N G+    R+ N L +MK  A   C+ VL+E+ FLP
Sbjct  121  TKNAGVVDKTRYPNALGYMKKEAQPECANVLKEMGFLP  158



>sp|Q8LGR0.1|CHE1_CHEAL RecName: Full=Pollen allergen Che a 1; AltName: Allergen=Che 
a 1; Flags: Precursor [Chenopodium album]
 gb|AAL07319.1| Che a 1 allergen precursor [Chenopodium album]
Length=168

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 95/153 (62%), Gaps = 3/153 (2%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKT  442
            L+ A C+L+LAG+A+ A   F V G VYCDTCR+QF TRIS  ++ A V+LECRN+   T
Sbjct  10   LVGALCVLSLAGVANAAENHFKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGT  69

Query  441  LTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKET---VKGLEKAIVVCTAN  271
             T+  E  T   G Y++ V+GD E D+C + +VKSP  +C E    V   + A V  T+N
Sbjct  70   QTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSN  129

Query  270  VGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
             G  SDIR AN L FM+    + C +VL+E+D 
Sbjct  130  NGEASDIRSANALGFMRKEPLKECPEVLKELDL  162



>gb|KHG10520.1| Olee1-like protein [Gossypium arboreum]
Length=180

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 101/162 (62%), Gaps = 4/162 (2%)
 Frame = -2

Query  633  RAVALIS-AFCILALAGIAHCA--PEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            + + L+S A C+  L G+A  A   EKF V G+VYCDTCRV+FET+ISQ IK A+V+LEC
Sbjct  5    QQITLVSLAICLSTLLGLAAAANPEEKFIVEGRVYCDTCRVEFETKISQPIKGASVKLEC  64

Query  462  RNLDN-KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIV  286
            RN+ N K +++S +  T   G Y + V GDHE ++C V++VKSPR DC E  +   KA V
Sbjct  65   RNITNEKIVSHSQDVVTDEAGGYKIEVKGDHEDEICEVSLVKSPRADCNEPTEVWRKARV  124

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQ  160
            V T   G+    R AN L +MK  A   C KVL E+ +   Q
Sbjct  125  VLTKADGVSGTYRFANNLGYMKKEALPECKKVLTEMGYFELQ  166



>ref|XP_006370166.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ERP66735.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=161

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 97/158 (61%), Gaps = 0/158 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA++  + +     +   I+  A +  +V GKVYCD CRV+F+T+IS+ I  A V+L C 
Sbjct  1    MAKSFTIAAFVLCFSSLLISAYAADYLDVEGKVYCDPCRVEFQTKISEGIPAAKVKLVCN  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            N DN T TY++EGAT   G Y L V GDHE D+C V +V+S R DC E  + ++ A ++ 
Sbjct  61   NRDNGTETYTVEGATDNSGTYRLPVAGDHEDDICEVRLVESSRPDCNEPFRSIDSARILL  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            T NVG+    R+ N L +MK  A   C+ VL+E+ FLP
Sbjct  121  TKNVGVVDKTRYPNALGYMKKEAQPECADVLKEMGFLP  158



>gb|AAX93750.1| pollen allergen Cro s 1 [Crocus sativus]
Length=168

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 94/153 (61%), Gaps = 3/153 (2%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKT  442
            L+ A C+L+LAG+A+ A   F V G VYCDTCR+QF TR+S  ++ A V+LECRN+   T
Sbjct  10   LVGALCVLSLAGVANAAENHFKVQGMVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGT  69

Query  441  LTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKET---VKGLEKAIVVCTAN  271
             T+  E  T   G Y++ V GD + D+C + +VKSP  +C E    V   + A V  T+N
Sbjct  70   QTFKAEAVTDKVGQYSIPVHGDFQDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSN  129

Query  270  VGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
             G  SDIR AN L FM+    + C +VL+E+D 
Sbjct  130  NGEASDIRSANALGFMRKEPLKECPEVLKELDL  162



>ref|XP_010103032.1| hypothetical protein L484_005787 [Morus notabilis]
 gb|EXB94630.1| hypothetical protein L484_005787 [Morus notabilis]
Length=166

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 95/162 (59%), Gaps = 4/162 (2%)
 Frame = -2

Query  639  MARAVALI-SAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            M ++V +I SA C ++L G A+C      V G+VYCDTCR QF T++S  IK A VRLEC
Sbjct  1    MTKSVIIIASALCFMSLLGFAYCDTPHLIVEGRVYCDTCRAQFVTKVSNYIKGAKVRLEC  60

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAI--  289
            R  +  ++TYS +G T   G Y + VDGDHE ++C V +VKS   DC E        +  
Sbjct  61   RESEGGSVTYSNDGVTDESGTYRIAVDGDHEEEVCEVKLVKSSVPDCSEISNDPYNKLNA  120

Query  288  -VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
             V  T+N G+ S +R ANPL F+K  +   C +VL E+   P
Sbjct  121  RVSLTSNNGITSPVRQANPLGFLKKNSLPECPEVLRELGITP  162



>ref|XP_008383629.1| PREDICTED: olee1-like protein [Malus domestica]
Length=184

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 97/160 (61%), Gaps = 4/160 (3%)
 Frame = -2

Query  636  ARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            + ++ L+SA C L+L G+A+ + E  NV G VYCD CR QF TRIS+ +  A VRLECR 
Sbjct  4    SNSIVLVSALCFLSLIGVAY-STETLNVHGIVYCDNCRTQFFTRISEPLTGAKVRLECRE  62

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE---KAIV  286
             +   +T + E  T   G Y++ V+GDHE ++C V +VKSP+EDC E    L     A +
Sbjct  63   SEGGKVTLTKEXDTEELGTYSIPVEGDHEEEVCEVILVKSPKEDCSEISNELHAKLSARI  122

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
              T + G+    R ANPL FMK   D RC++VL+E+   P
Sbjct  123  SLTNHNGITGPHRMANPLGFMKKEVDPRCAEVLKELGLTP  162



>ref|XP_007212169.1| hypothetical protein PRUPE_ppa012463mg [Prunus persica]
 gb|EMJ13368.1| hypothetical protein PRUPE_ppa012463mg [Prunus persica]
Length=168

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 96/160 (60%), Gaps = 4/160 (3%)
 Frame = -2

Query  636  ARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            +  + L SA C L+L G A+CA +  +V G VYCD CR+QF TRIS+ ++ A V+LECR+
Sbjct  5    SSGIVLASALCFLSLLGFAYCA-DNLSVDGLVYCDNCRIQFMTRISEPLQGATVKLECRD  63

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE---KAIV  286
             +  T+T S E  T   G Y + V+GDHE ++C V +VKSPR+DC E          A +
Sbjct  64   REGGTVTLSSETDTDEQGRYQIPVEGDHEEEVCEVLLVKSPRDDCSEVSTDSHAKLSARI  123

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
              T N G+    R  NPL F+K   D +C++VL+E+   P
Sbjct  124  SLTNNNGIAGPHRIPNPLGFLKTEPDAKCAEVLKELGLTP  163



>ref|XP_011079002.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=165

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 92/159 (58%), Gaps = 4/159 (3%)
 Frame = -2

Query  639  MAR----AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVR  472
            MAR    A+ L +AFC L+L  +A     KF V GKVYC+ CR  F  R S+ +  A V+
Sbjct  1    MARLTQVAIILAAAFCFLSLVDVADSHAPKFIVDGKVYCEVCRANFTNRYSEPMAGAKVK  60

Query  471  LECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKA  292
            LEC+N   +++TY++EG T   G Y LT +GDH  D+C VT++KS   DC E       A
Sbjct  61   LECKNEVTESVTYTLEGETNEKGVYTLTAEGDHGEDLCAVTLLKSSMADCAEVPDEKPAA  120

Query  291  IVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEID  175
             V  T N G   + RHANPL F +  A   C+++ +E++
Sbjct  121  EVTLTLNNGFHDEFRHANPLTFTRKEALPECAELFKELE  159



>ref|XP_004143635.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004168700.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN50408.1| hypothetical protein Csa_5G172880 [Cucumis sativus]
Length=166

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 99/161 (61%), Gaps = 7/161 (4%)
 Frame = -2

Query  639  MARAVAL-ISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+++ L +SA  + +L  +A+   ++F V GKVYCD CRVQF T+ S+ ++ A V+L C
Sbjct  1    MAKSIILFVSALSLFSLLNVAYSQKDRFLVEGKVYCDACRVQFFTKASKFLEGATVKLVC  60

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEK----  295
            + ++  ++T S E  T   G+Y++  DGDHE D+C VT+VKS   DC E    LEK    
Sbjct  61   KEIEGGSVTLSKEAVTDKTGSYSIEADGDHEEDLCEVTLVKSNDPDCSEI--SLEKYEHM  118

Query  294  AIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
            A V  T N G+ + +RHANPL FMK      C +VL E+ F
Sbjct  119  ARVSITNNSGITNPVRHANPLAFMKKEKLPECKEVLRELGF  159



>ref|XP_007148052.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
 gb|ESW20046.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
Length=169

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 99/160 (62%), Gaps = 7/160 (4%)
 Frame = -2

Query  639  MARAVALI--SAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLE  466
            MA++  +I  SA C L+  G A  A ++F V G VYCDTCRVQF TR+S+ ++ AAVR+ 
Sbjct  1    MAKSAIIILASALCFLSFLGSAS-ARDRFFVEGTVYCDTCRVQFLTRMSEFLEGAAVRVM  59

Query  465  CRNLDN-KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKG---LE  298
            C  +DN K +T+  E  T A G+Y + VDGDHE D C VT+VKSPR DC E  K     +
Sbjct  60   CSQVDNAKNVTFDKETVTDALGSYKMEVDGDHEEDNCQVTLVKSPRPDCSEVDKESYLQQ  119

Query  297  KAIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
             A +  T N G+ S IR ANPL F+K      C  +L+E+
Sbjct  120  AARISITKNNGIVSPIRQANPLGFLKKDRLPGCQDLLKEL  159



>ref|XP_009773994.1| PREDICTED: olee1-like protein [Nicotiana sylvestris]
Length=173

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 98/166 (59%), Gaps = 6/166 (4%)
 Frame = -2

Query  645  TKMARAVALISAFCILALAGIAHCAPEK---FNVVGKVYCDTCRVQFETRISQSIKDAAV  475
            TK    + + S  C+ +L GI     +    F+V GKVYCD CR  FE R+S+ +  A V
Sbjct  2    TKSGAIILISSVVCLFSLIGITQAQAQAQAQFHVEGKVYCDFCRALFENRLSKPMAGAEV  61

Query  474  RLECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVK---G  304
            RL+CRN  + ++T ++EG T  +G Y+L V+ DHE ++C + ++KS  EDC E       
Sbjct  62   RLQCRNNTDDSVTLTVEGQTDKNGVYSLLVERDHEDEICEMILMKSSMEDCSEIPNEGHA  121

Query  303  LEKAIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
             E A +  T+N GM    RHANPLFF+K  A   C++V +E++ LP
Sbjct  122  KESARITITSNNGMAETTRHANPLFFVKKQAAPECAEVFKELELLP  167



>ref|XP_010261236.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=163

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MAR V    A C+L AL   A  A   FNVVG+VYCDTCR  FET  +  I  A VR+EC
Sbjct  3    MARLVVFF-ALCVLPALVTAARPAKNPFNVVGRVYCDTCRAGFETPATTYIPGARVRVEC  61

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+ DN  L +S+EG T A G YN+ V  DH   +C   +V+S +EDC +   G E+A VV
Sbjct  62   RDRDNLNLLFSVEGVTDATGTYNIQVAEDHGDQLCEAVLVRSSQEDCGKIESGRERANVV  121

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
             T N G+ SD R AN + F+KD     C+++L++
Sbjct  122  LTRNNGVLSDKRFANNMGFIKDQPLAGCAEILKQ  155



>ref|XP_008467237.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=166

 Score =   125 bits (314),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 99/161 (61%), Gaps = 7/161 (4%)
 Frame = -2

Query  639  MARA-VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA++ + L+SA  +++L  +A    ++F V GKVYCD CRVQF T+ S+ ++ A V+L C
Sbjct  1    MAKSMILLVSALSLMSLLNVAFSQKDRFLVEGKVYCDACRVQFFTKASKFLEGATVKLVC  60

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEK----  295
            + ++  ++T S E  T   G+Y++  DGDHE ++C VT+VKS   DC E    LEK    
Sbjct  61   KEIEGGSVTLSKEAVTDKTGSYSIEADGDHEEELCEVTLVKSNDPDCSEI--SLEKYEHM  118

Query  294  AIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
            A V  T N G+ + +RHANPL FMK      C ++L E+ F
Sbjct  119  ARVSITNNSGITNPVRHANPLAFMKKEKLPECKEILRELGF  159



>ref|XP_010686203.1| PREDICTED: pollen allergen Che a 1 [Beta vulgaris subsp. vulgaris]
Length=169

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 90/153 (59%), Gaps = 3/153 (2%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKT  442
            L     +L+LAG+A+ A   F V G VYCDTCR+QF TR+S  ++ A VRLECRN+   T
Sbjct  10   LAGVLSVLSLAGVAYAATNHFKVQGMVYCDTCRIQFITRVSTMMEGATVRLECRNITAGT  69

Query  441  LTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKET---VKGLEKAIVVCTAN  271
             T+  E  T   G Y++ VDGD+E D+C + + KS   +C +    V   + A V  T+N
Sbjct  70   ETFKSEAITDKLGMYSINVDGDYEDDICEIVLAKSSNNECTDISHDVYAKQAAKVSLTSN  129

Query  270  VGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
             G  SD+R AN L FM+      C +VL+E+D 
Sbjct  130  NGESSDVRSANALGFMRKTPLPECPEVLKELDL  162



>gb|AFK47865.1| unknown [Lotus japonicus]
Length=168

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 97/153 (63%), Gaps = 3/153 (2%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDN  448
            + L SA C L++ G  +   ++F V G VYCDTCR QF T++S+ ++ A VR+EC+   N
Sbjct  6    IFLASALCFLSVLGSVYSDDDRFFVEGVVYCDTCRTQFITKLSEFLEGATVRVECKEEGN  65

Query  447  KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKGLEKAI-VVCT  277
             ++T++ E  T A G+Y + VDGDHE ++C V +VKSPR DC E  +   LE+A  +  T
Sbjct  66   GSVTFTKEVVTDAKGSYKVEVDGDHEEELCQVVLVKSPRSDCSEIDSDSHLEQAAKISIT  125

Query  276  ANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
             N G+ S +R ANPL F+K      C+ VL+E+
Sbjct  126  KNNGIVSPVRAANPLGFLKKERLPGCADVLKEL  158



>ref|XP_003541705.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN08444.1| Olee1-like protein [Glycine soja]
Length=169

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDN  448
            + L S  C L+  G A+ A ++F V G VYCDTCRVQF T++S+ ++ A VR+ C  +DN
Sbjct  7    IILASTLCFLSFLGSAY-ARDRFMVEGTVYCDTCRVQFLTKLSEFLEGATVRVVCSQVDN  65

Query  447  -KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVK--GLEKAI-VVC  280
             K +T+S E  T A G+Y + VDGDHE D C VT++KSPR DC E  +   L++A  +  
Sbjct  66   AKNVTFSKEAVTDASGSYKVEVDGDHEEDTCEVTLLKSPRADCSEVDQESHLQQAARISI  125

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            T N G+ S IR ANPL F+K      C  +L+E+
Sbjct  126  TKNNGIVSPIRQANPLGFLKKDRLPGCLDLLKEL  159



>ref|XP_003546028.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN18912.1| Olee1-like protein [Glycine soja]
Length=169

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 99/157 (63%), Gaps = 5/157 (3%)
 Frame = -2

Query  636  ARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            A  + L S  C L+  G A+ A ++F V G VYCDTCRVQF T++S+ ++ A VR+ C  
Sbjct  4    AAIIILASTLCFLSFLGSAY-ARDRFMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQ  62

Query  456  LDN-KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVK--GLEKAI-  289
            +DN K +T+S E  T A G+Y + V+GDHE D C VT++KSPR DC E  +   L++A  
Sbjct  63   VDNAKNVTFSKEAVTDASGSYKVEVEGDHEEDTCEVTLLKSPRPDCSEIDRESHLQQAAR  122

Query  288  VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            +  T N G+ S +R ANPL F+K      C+ +L+E+
Sbjct  123  ISITKNNGIVSPLRQANPLGFLKKDRLPGCADLLKEL  159



>ref|XP_010057097.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
 gb|KCW74109.1| hypothetical protein EUGRSUZ_E02748 [Eucalyptus grandis]
Length=168

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 95/153 (62%), Gaps = 4/153 (3%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDN  448
            + L SA   L+L G  +    +F V GKVYCDTCR QF T++S+ + DA VRLEC++ + 
Sbjct  9    IFLASALSFLSLLGAVY-GDSRFFVEGKVYCDTCRTQFITKVSKDMPDAKVRLECKDREG  67

Query  447  KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKG--LEK-AIVVCT  277
             ++TYS+EG T   G Y L VDG+HE ++C + +VKS +  C+E      L K A +  T
Sbjct  68   GSVTYSIEGVTDNTGMYRLPVDGEHEEEICEIVLVKSSQPGCEEVSNDPFLRKTARISLT  127

Query  276  ANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
             N GM + +R ANPL +MK+ +   C+ VL E+
Sbjct  128  KNNGMATPVRQANPLGYMKNESLPECADVLREL  160



>ref|XP_007025385.1| Olee1-like protein [Theobroma cacao]
 gb|EOY28007.1| Olee1-like protein [Theobroma cacao]
Length=170

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 93/152 (61%), Gaps = 4/152 (3%)
 Frame = -2

Query  621  LISAFCILALAGIAHC-APEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNK  445
            L SA C L+L GI    APE+F V GKVYCD CR QF T+IS+ +  A VRLECR+ +  
Sbjct  11   LASALCFLSLLGIVDAQAPEQFFVEGKVYCDNCRAQFVTKISKYMAGAQVRLECRDREGG  70

Query  444  TLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKG---LEKAIVVCTA  274
             +TYS++G T   G Y++ V+GDHE ++C V++V+S   +C E  K     + A +  T 
Sbjct  71   DITYSVDGETDESGTYHIKVEGDHEEEICEVSLVQSSDPECSEIDKENFLRKSARISLTK  130

Query  273  NVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
              G+ SD R ANPL FM       C++VL E+
Sbjct  131  YSGITSDSRLANPLGFMVKKPLPECTEVLREL  162



>ref|XP_004485892.1| PREDICTED: olee1-like protein-like [Cicer arietinum]
Length=165

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 102/158 (65%), Gaps = 6/158 (4%)
 Frame = -2

Query  639  MARA-VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA++ + LIS  C L+  G  +C  ++F V G VYCDTCR QF T++++ ++ A VR+EC
Sbjct  1    MAKSTIILISTLCFLSFFGSVYCN-DRFFVEGVVYCDTCRTQFITKLTEFMEGATVRMEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKGLEKAI  289
            +  DN T+T+S E  T A G Y + VDGDHE ++C +T+ KSPR+DC E  +   LE+A 
Sbjct  60   KE-DNGTVTFSKEAVTDASGTYRVEVDGDHEDEVCEITLAKSPRKDCSEVDSDSHLEQAA  118

Query  288  -VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
             +  T N G+ S +R ANPL F+K      C+ VL+++
Sbjct  119  RISITNNNGIVSPLRTANPLGFLKKERLPGCADVLKDL  156



>gb|ACU23617.1| unknown [Glycine max]
Length=169

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 98/157 (62%), Gaps = 5/157 (3%)
 Frame = -2

Query  636  ARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            A  + L S  C L+  G A+ A ++F V G VYCDTCRVQF T++S+ ++ A VR+ C  
Sbjct  4    AAIIILASTLCFLSFLGSAY-ARDRFMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQ  62

Query  456  LDN-KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVK--GLEKAI-  289
            +DN K +T+S E  T A G+Y + V+GDHE D C VT++KSPR DC E  +   L++A  
Sbjct  63   VDNAKNVTFSKEAVTDASGSYKVEVEGDHEEDTCEVTLLKSPRPDCSEIDRESHLQQAAR  122

Query  288  VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            +  T N G+ S  R ANPL F+K      C+ +L+E+
Sbjct  123  ISITKNNGIVSPFRQANPLGFLKKDRLPGCADLLKEL  159



>ref|XP_007213539.1| hypothetical protein PRUPE_ppa019680mg [Prunus persica]
 gb|EMJ14738.1| hypothetical protein PRUPE_ppa019680mg [Prunus persica]
Length=163

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 93/157 (59%), Gaps = 7/157 (4%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDN  448
            V  +S FC LA A           V G+VYCD CRVQFETR+S  ++ A V LECR  +N
Sbjct  11   VVALSCFCSLAYATTKS----NLFVEGRVYCDPCRVQFETRLSVPLEGAVVALECRGREN  66

Query  447  KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANV  268
             TL Y+++G T  +G Y+L  D D E  +C V  V SPR +C E  +  E+A V+ T N 
Sbjct  67   GTLAYTLQGKTDKNGIYSLPTDEDMEEQICEVRTVSSPRANCNEHFE-FERARVLLTYNN  125

Query  267  GMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQT  157
            G+KS  R+ANPL FM+  +   C +VL+E+   P +T
Sbjct  126  GVKSMARYANPLGFMQKESVTECEQVLKEL--FPEET  160



>sp|O49813.1|OLEE1_BETPN RecName: Full=Olee1-like protein; Flags: Precursor [Betula pendula]
 emb|CAA74365.1| putative Ole e 1 protein [Betula pendula]
Length=166

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 95/162 (59%), Gaps = 5/162 (3%)
 Frame = -2

Query  639  MARAVALIS-AFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+++ + + A C L+L G A+ +  +F V GKVYCD CR QF T++S  +K A V LEC
Sbjct  1    MAKSIIIQAPALCFLSLLGFAY-SESRFFVEGKVYCDNCRTQFVTKLSTYMKGAKVSLEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKG--LEK-A  292
            RN +  TL YS +  T   G Y + VDGDHE ++C + + KS   DC E  K   L+K A
Sbjct  60   RNREGGTLIYSSDSETDKSGTYRIPVDGDHEEEICEIALKKSSDPDCSEVSKDPFLKKSA  119

Query  291  IVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
             +  T N G+ + +R ANPL FMK      C+K L E+   P
Sbjct  120  RISLTKNNGISTPVRLANPLGFMKKKPLPECAKALRELGMNP  161



>gb|EYU43331.1| hypothetical protein MIMGU_mgv1a014984mg [Erythranthe guttata]
Length=171

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 90/161 (56%), Gaps = 6/161 (4%)
 Frame = -2

Query  630  AVALISAFCILALAGIAH--CAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            A+    A C+L+L G A    A  KF+V G VYC+ CR  F  ++SQ +  A VRL+C+ 
Sbjct  8    AILFAGALCLLSLPGGAQSNAAATKFSVEGDVYCEVCRTNFINKLSQPMAGATVRLQCKG  67

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCK----ETVKGLEKAI  289
                 +TYS+EG T   G Y+LTV+GDH  D C +T+V+S R DC     E       + 
Sbjct  68   ETEGNITYSLEGITDDKGQYHLTVEGDHGEDECEITLVRSSRPDCNVVPDEGWATKPTSR  127

Query  288  VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            +  T N G   + R ANPL F K  AD +C+++ +E++  P
Sbjct  128  ITLTKNSGFHDNTRKANPLGFTKKKADPQCAQLFKELEINP  168



>gb|ADI55168.1| AS1 [Gossypium hirsutum]
Length=182

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 99/174 (57%), Gaps = 14/174 (8%)
 Frame = -2

Query  639  MARA--VALISAF-CILALAGIAHCAPE----------KFNVVGKVYCDTCRVQFETRIS  499
            MA+A  ++L+S F CI +    A+ +            +F V+G VYCDTCRV+FET IS
Sbjct  1    MAKASVISLLSLFICIFSSLSFAYASAPAPAPSSNQQMRFEVLGHVYCDTCRVEFETSIS  60

Query  498  QSIKDAAVRLECRNLDNKTLTY-SMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDC  322
            + I  A VRLECRN  ++ +TY S E   G  GNY + V GD+E   C V +VKSPR DC
Sbjct  61   EPIPGATVRLECRNRTDEKITYQSPEITAGDKGNYKIQVTGDYEESDCDVMLVKSPRADC  120

Query  321  KETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQ  160
             +  +   KA VV T   G+  +IR AN L F K  A   C+KVL E+ +   Q
Sbjct  121  NDPTEEWRKARVVLTTLDGVSGEIRFANNLGFKKKEALPECTKVLTEMGYFELQ  174



>gb|ACJ83911.1| unknown [Medicago truncatula]
 gb|ACJ86228.1| unknown [Medicago truncatula]
 gb|AFK43996.1| unknown [Medicago truncatula]
 gb|KEH36588.1| pollen Ole e I family allergen [Medicago truncatula]
Length=168

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 100/158 (63%), Gaps = 5/158 (3%)
 Frame = -2

Query  639  MARA-VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA++ + L+   C L+  G A+   ++F V G VYCDTCR QF TR+++ I+ A VR+EC
Sbjct  1    MAKSTIPLVFTLCFLSFLGSAYSKSDRFFVEGVVYCDTCRTQFITRLTEFIEGATVRVEC  60

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKGLEKAI  289
            +  DN TLT++ E  T   G Y++ +DGDHE + C V + KSPR+DC E  +   L++A 
Sbjct  61   KE-DNGTLTFNKEATTDKSGKYSVEIDGDHEDETCEVILCKSPRKDCSEVDSEAHLQQAA  119

Query  288  -VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
             +  T N G+ S +R A+PL F+K     +C +VL+E+
Sbjct  120  RISVTNNNGIVSPVRAASPLGFLKKERLPKCGEVLKEL  157



>ref|XP_008225283.1| PREDICTED: olee1-like protein [Prunus mume]
Length=168

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 98/160 (61%), Gaps = 4/160 (3%)
 Frame = -2

Query  636  ARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            +  + L SA C L+L G A+CA +  +V G VYCD+CR+QF TRIS++++ A V+LECR+
Sbjct  5    SSGIVLASALCFLSLLGFAYCA-DNLSVDGLVYCDSCRIQFMTRISEALQGAKVKLECRD  63

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE---KAIV  286
             +  T+T S E  T   G Y + V+GDHE ++C V +VKSPR+DC E          A +
Sbjct  64   REGGTITLSSETETDEQGRYQIPVEGDHEEEVCEVVLVKSPRDDCSEISTDSHAKLSARI  123

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
              T N G+    R  NPL F+K   D +C++VL+E+   P
Sbjct  124  SLTNNNGIAGPHRIPNPLGFLKKEPDAQCAEVLKELGLTP  163



>ref|XP_008226528.1| PREDICTED: olee1-like protein [Prunus mume]
Length=163

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 93/157 (59%), Gaps = 7/157 (4%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDN  448
            V  +S FC LA A           V G+VYCD CRVQFETR+S  ++ A V LECR  +N
Sbjct  11   VVALSCFCSLAYATTKT----NLFVEGRVYCDPCRVQFETRLSVPLEGAVVALECRGREN  66

Query  447  KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANV  268
             TL Y+++G T  +G Y+L  D D E  +C V  V SPR +C +     E+A V+ T N 
Sbjct  67   GTLAYTLQGKTDKNGIYSLPADEDMEEQICEVRTVSSPRANCNDHFD-FERARVLLTHNN  125

Query  267  GMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQT  157
            G+KS  R+ANPL FM++ +   C +VL+E+   P +T
Sbjct  126  GVKSMARYANPLGFMQNASVTECEEVLKEL--FPEET  160



>ref|XP_011085997.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=170

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 88/152 (58%), Gaps = 4/152 (3%)
 Frame = -2

Query  609  FCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYS  430
             C+L L G+A     +F VVG+VYC+ CR+ F  ++S+ +  A V+LEC+  +   +TY+
Sbjct  16   LCLLCLPGVARATAPEFFVVGEVYCEVCRLNFINKLSEPMPGAKVKLECKGEEAGNITYT  75

Query  429  MEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKET----VKGLEKAIVVCTANVGM  262
             EG T   G Y L V+GDHE + C +T+VKS R DC E           +++  T N G 
Sbjct  76   QEGETNEGGQYRLKVEGDHEEEECGITLVKSSRADCNEIPDEGWASKPSSLITLTKNNGF  135

Query  261  KSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
                R+ANPL F K  A+  C+++++E++  P
Sbjct  136  HGSSRYANPLGFTKKKANPECAELIKELEINP  167



>ref|XP_006857531.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
 gb|ERN18998.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
Length=159

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 2/153 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAP-EKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MAR+  L+S   +L L   A   P   F V G+VYCDTCR  FET  +  IK + VRLEC
Sbjct  1    MARS-QLLSVAAVLFLFSSALGTPTPNFEVEGRVYCDTCRAGFETSATTYIKGSTVRLEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++     LTYS+EG T A G Y L V  D + ++C V VV SP   C + + G E+A V+
Sbjct  60   KDRATHQLTYSIEGVTDATGTYRLPVSDDRQHEICEVVVVSSPEAGCGKAMLGRERARVL  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLE  184
             T N G+ S+ R+AN L F+KD    RC+++L+
Sbjct  120  LTHNNGIVSNTRYANALAFLKDEPLPRCAELLK  152



>ref|XP_004144129.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004171680.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN66323.1| hypothetical protein Csa_1G597700 [Cucumis sativus]
Length=165

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 99/159 (62%), Gaps = 4/159 (3%)
 Frame = -2

Query  639  MARA-VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA++ + L+SA C ++L  +A C  ++F V GKVYCDTCRVQF T++S+ ++ A V+LEC
Sbjct  1    MAKSTIILVSALCFISLFHLASCK-DQFFVEGKVYCDTCRVQFFTKVSKFLEGATVKLEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVK-GL-EKAI  289
            + ++  ++T   E  T   G Y++  DGDHE ++C V+++KS   DC E  K G    + 
Sbjct  60   KEIEGGSVTLDKEAVTDKSGKYSIEADGDHEEEVCEVSLMKSVDPDCDEISKEGYGHTSR  119

Query  288  VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
            V  T N G+ + +R ANPL F+K      C +VL E+ F
Sbjct  120  VTITNNSGITNPVRLANPLAFLKKEKLSECKEVLRELGF  158



>ref|XP_008450951.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=165

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 96/155 (62%), Gaps = 3/155 (2%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             + LISA C ++L  +A  + ++F V GKVYCDTCRVQF T++S+ +K A V+LEC+ ++
Sbjct  5    TIILISALCFVSLFYLAS-SKDQFFVEGKVYCDTCRVQFFTKVSKFLKGATVKLECKEIE  63

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVK-GL-EKAIVVCT  277
              ++T + E  T   G Y++  DGDHE ++C V++VKS   DC E  K G    + V  T
Sbjct  64   GGSVTLNKEAVTDKSGKYSIEADGDHEEEVCEVSLVKSVDPDCDEISKEGYGHTSRVTIT  123

Query  276  ANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
             N G+ + +R ANPL F+K      C +VL E+ F
Sbjct  124  NNSGITNPVRLANPLAFLKKEKLPECKEVLRELGF  158



>ref|XP_002522577.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
 gb|EEF39877.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
Length=171

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 90/156 (58%), Gaps = 5/156 (3%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD-NK  445
            L SA C L L  IAH     F V GKVYCDTCRVQF T+ +  IK A VRLEC++ +   
Sbjct  12   LASAICFLCLLSIAH-GESHFTVEGKVYCDTCRVQFITKATSYIKGARVRLECKDREGGG  70

Query  444  TLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVCTA  274
             +T+S E  T A G Y++ V+G+HE ++C +  +KSP  DC E  +     + A +  T 
Sbjct  71   AITFSAEAETDATGTYHIPVNGEHEEELCEIIPLKSPDPDCNEINQDPFVKKAAQITLTN  130

Query  273  NVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            + G+ S  R ANP+ F+K  A   CS +L E+   P
Sbjct  131  HNGIASPTRSANPIGFLKQQAVPECSGILREMGITP  166



>ref|XP_009408781.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 88/156 (56%), Gaps = 3/156 (2%)
 Frame = -2

Query  648  HTKMARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRL  469
            H ++  A+ L+S F  L + G A  AP    V G+VYCDTCR  FET+ ++ I+ A V+L
Sbjct  4    HLRVFTALCLLSTF--LCMVGFAIAAP-NLVVEGRVYCDTCRAGFETKATEYIEGAKVKL  60

Query  468  ECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAI  289
            EC+N      T +    T   G Y + V  DH+ + C V +V SPR DC E   G   A 
Sbjct  61   ECKNYTTGASTLTAVAVTNNKGTYQIPVSDDHQEESCAVMLVSSPRSDCSEISDGRNHAA  120

Query  288  VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
            VV T NVG+ S +R+AN L F+KD+    C ++L +
Sbjct  121  VVLTHNVGITSSVRYANSLGFLKDVPLASCGQMLMQ  156



>gb|KGN49303.1| hypothetical protein Csa_6G519560 [Cucumis sativus]
Length=168

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 96/156 (62%), Gaps = 3/156 (2%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            A+ L+SA C L+   IA  + ++F + GKVYCDTCR+QF TR+S+ +  A V+L CR   
Sbjct  6    AIILVSALCFLSFLDIALSSKDRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEA  65

Query  450  NK-TLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKGLEKAIVVC  280
            N    T++ EG T  +G Y + VDGDHE ++C V+V++S  E+C +  T      A V  
Sbjct  66   NAGNETFTGEGVTDKNGVYKIEVDGDHEEEICEVSVLESADEECSDIPTDGYGHFARVSI  125

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
            T N G+ + +R ANPL F+K  A  +C +VL E+ F
Sbjct  126  TGNNGIINPVRQANPLGFLKKDALPQCKEVLRELGF  161



>ref|XP_008359333.1| PREDICTED: olee1-like protein [Malus domestica]
Length=166

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 96/166 (58%), Gaps = 8/166 (5%)
 Frame = -2

Query  639  MARAVALISAF----CILALAGIAHCAP-EKFNVVGKVYCDTCRVQFETRISQSIKDAAV  475
            MA+A  + + F    C  +LA     A  E   V GKVYCD CRVQFETR+S  +  A V
Sbjct  1    MAKASGIAALFVTLSCFYSLAYATTGADIETLFVEGKVYCDPCRVQFETRLSTPLDGATV  60

Query  474  RLECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEK  295
             LECR+ +N T+ Y++EG T  +G Y+L  D + E  +C V  V SP  DC +    +EK
Sbjct  61   ALECRSRENGTMVYTLEGKTDKNGIYSLPADKNFEEQICEVRTVSSPTGDCADHFD-IEK  119

Query  294  AIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQT  157
            A ++ T N G+K+  R+ANPL FMK  +   C  VL+E+   P +T
Sbjct  120  ARILLTHNNGVKAMARYANPLGFMKKESTTECEAVLKEL--FPEET  163



>gb|EPS70684.1| hypothetical protein M569_04073 [Genlisea aurea]
Length=170

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 92/162 (57%), Gaps = 5/162 (3%)
 Frame = -2

Query  636  ARAVALIS-AFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            A+ VA+ + A  + AL   A     +F V G+V+C+ CR  F  R+S+ ++ A VRLECR
Sbjct  5    AQIVAIFAGALILFALGDTAVATDPEFFVQGQVFCEVCRTNFINRLSEPMEGATVRLECR  64

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKET-VKGL---EKA  292
              +   +T+ +EG T A GNY L   GDHE + C VT+VKS R DC+ET  +G      +
Sbjct  65   GDNVGNITFGIEGVTDAGGNYKLKATGDHEDEDCQVTLVKSSRLDCQETPSEGWAMQPSS  124

Query  291  IVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
             +  T N G   DIRHANPL F K   D  C ++ +E+   P
Sbjct  125  KITITKNNGFHDDIRHANPLGFTKKERDPACQELFKELQINP  166



>gb|KCW69946.1| hypothetical protein EUGRSUZ_F03264 [Eucalyptus grandis]
Length=167

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 95/163 (58%), Gaps = 6/163 (4%)
 Frame = -2

Query  639  MAR---AVALI-SAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVR  472
            MAR   A AL+ +A C+ +L G A+   EK +VVGKV+CDTCRV FET++S  + D+ VR
Sbjct  1    MARTLEAAALVATALCLSSLLGFAY-GHEKLDVVGKVFCDTCRVDFETKVSYGLADSKVR  59

Query  471  LECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKG-LEK  295
            LEC N  +  LT S E  T   G Y L V+GDHE ++C V +++S   +C   ++G +  
Sbjct  60   LECHNRTSGALTLSAEAVTDKTGEYRLEVEGDHEEEICEVQLIESSEPECSSLLEGAVHN  119

Query  294  AIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            A V  T   G+    R AN L F K      C++VL E+  LP
Sbjct  120  ARVALTNKNGVAQPARFANALAFAKKETLADCAQVLLEMGVLP  162



>ref|XP_011080816.1| PREDICTED: major pollen allergen Ole e 1-like [Sesamum indicum]
Length=166

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 87/154 (56%), Gaps = 4/154 (3%)
 Frame = -2

Query  615  SAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLT  436
             A C+L  + +      +F VVG+VYC+ CR+ F  ++S+ +  A V+LECR  +   +T
Sbjct  10   GALCLLCFSSVVRATTPEFFVVGEVYCEVCRINFINKLSEPMPGAKVKLECRGEETGNIT  69

Query  435  YSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDC----KETVKGLEKAIVVCTANV  268
            Y+ EG T   G Y L V+GDHE + C +T+VKS R DC     E       +++  T N 
Sbjct  70   YTQEGVTNEAGQYRLKVEGDHEEEECGITLVKSGRADCDEIPNEGWASKPSSLITLTKNN  129

Query  267  GMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            G     R+ANPL F K  A+  C+++++E++  P
Sbjct  130  GFHGSSRYANPLGFTKKKANHECAELIKELEIDP  163



>ref|XP_009340070.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 95/166 (57%), Gaps = 8/166 (5%)
 Frame = -2

Query  639  MARAVALISAF----CILALAGIAHCAP-EKFNVVGKVYCDTCRVQFETRISQSIKDAAV  475
            MA+A  + + F    C  +LA     A  E   V GKVYCD CRVQFETR+S  +  A V
Sbjct  1    MAKASGIAALFVTLSCFYSLAYATTGADIETLFVEGKVYCDPCRVQFETRLSTPLDGATV  60

Query  474  RLECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEK  295
             LECR+ +N T+ Y +EG T  +G Y+L  D + E  +C V  V SP  DC +    +EK
Sbjct  61   ALECRSRENGTMVYRLEGKTDKNGIYSLPADKNFEEQICEVRTVSSPTGDCADHFD-IEK  119

Query  294  AIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQT  157
            A ++ T N G+K+  R+ANPL FMK  +   C  VL+E+   P +T
Sbjct  120  ARILLTHNNGVKAMARYANPLGFMKKESTPECEAVLKEL--FPEET  163



>ref|XP_004134662.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004172168.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
Length=168

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 96/156 (62%), Gaps = 3/156 (2%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            A+ L+SA C L+   IA  + ++F + GKVYCDTCR+QF TR+S+ +  A V+L CR   
Sbjct  6    AIILVSALCFLSFLDIALSSKDRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEA  65

Query  450  NK-TLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKGLEKAIVVC  280
            N    T++ EG T  +G Y + VDGDHE ++C V++++S  E+C +  T      A V  
Sbjct  66   NAGNETFTGEGVTDKNGVYKIEVDGDHEEEICEVSLLESADEECSDIPTDGYGHFARVSI  125

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
            T N G+ + +R ANPL F+K  A  +C +VL E+ F
Sbjct  126  TGNNGIINPVRQANPLGFLKKDALPQCKEVLRELGF  161



>ref|XP_010062811.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
Length=196

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 95/163 (58%), Gaps = 6/163 (4%)
 Frame = -2

Query  639  MAR---AVALI-SAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVR  472
            MAR   A AL+ +A C+ +L G A+   EK +VVGKV+CDTCRV FET++S  + D+ VR
Sbjct  30   MARTLEAAALVATALCLSSLLGFAY-GHEKLDVVGKVFCDTCRVDFETKVSYGLADSKVR  88

Query  471  LECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKG-LEK  295
            LEC N  +  LT S E  T   G Y L V+GDHE ++C V +++S   +C   ++G +  
Sbjct  89   LECHNRTSGALTLSAEAVTDKTGEYRLEVEGDHEEEICEVQLIESSEPECSSLLEGAVHN  148

Query  294  AIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            A V  T   G+    R AN L F K      C++VL E+  LP
Sbjct  149  ARVALTNKNGVAQPARFANALAFAKKETLADCAQVLLEMGVLP  191



>gb|KHG13789.1| Anther-specific LAT52 [Gossypium arboreum]
Length=188

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTY-SMEGATGADGNYNLTV  385
            + VVG VYCDTCRV+FET++S+ I  A V+LECRN  N+ +T+ S E    + G+Y++ V
Sbjct  33   YMVVGHVYCDTCRVEFETKLSEPISGAVVKLECRNRTNEAITFQSSEIVADSHGDYHIIV  92

Query  384  DGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADE  205
            +GD+E   C V +V+SPR DC +  +   K+ VV T   G+ + +R AN L F KD+A  
Sbjct  93   EGDYEESDCDVALVRSPRADCSDPTEAWRKSRVVLTTFDGLSNKLRFANNLGFKKDIALP  152

Query  204  RCSKVLEEIDF  172
            +C+++L+E+ +
Sbjct  153  QCTRILKEMGY  163



>gb|ADK22842.1| Sal k 5, partial [Salsola kali]
Length=151

 Score =   117 bits (293),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 85/138 (62%), Gaps = 5/138 (4%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            ++V G VYCDTCR+QF TR+S  ++ A V L+CRNL   T T+  E  T   G Y + VD
Sbjct  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD  68

Query  381  GDHERDMCVVTVVKSPREDCKET---VKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLA  211
            GDHE D+C + +VKSP ++C E    V   + A V  T+N G  SD+R+AN L F+K   
Sbjct  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP  128

Query  210  DERCSKVLEEIDF--LPG  163
               C +VL+E+D   +PG
Sbjct  129  LPECPEVLKELDMYDVPG  146



>ref|XP_004134927.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004172170.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN49302.1| hypothetical protein Csa_6G519550 [Cucumis sativus]
Length=168

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 94/156 (60%), Gaps = 3/156 (2%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            A+ L+SA C L+   IA  + ++F + GKVYCDTCR+QF TR+S+ +  A V+L CR   
Sbjct  6    AIILVSALCFLSFLDIALSSKDRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEA  65

Query  450  NK-TLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKGLEKAIVVC  280
            N    T++ EG T  +G Y + VDGDHE ++C V++++S    C E  T      A V  
Sbjct  66   NAGNETFTGEGVTDKNGVYKIEVDGDHEEEICEVSLLESADTGCGEIPTDGYGHFARVSI  125

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
            T N G+ + +R ANPL FMK  A  +C +VL E+ F
Sbjct  126  TGNNGIINPVRQANPLGFMKKDALPQCKEVLRELGF  161



>ref|XP_002513885.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF48468.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=159

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 91/154 (59%), Gaps = 2/154 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MARA+ L+ A C+L AL   A  A   F V G+VYCDTCR  FET  +  +  A VR+EC
Sbjct  1    MARAILLL-ALCVLPALVAAARPARNPFEVEGRVYCDTCRAGFETSKTTYVAGAKVRVEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++     L YS EG T + G Y + VD DH+  +C   +V SP+ DC +   G ++A V+
Sbjct  60   KDRKTMELVYSKEGTTDSTGTYRIHVDEDHQDQLCDAMLVSSPQHDCMKPSSGRDRARVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
             T N G+ S+ R+AN + FMK+ A   C ++L +
Sbjct  120  LTNNNGIVSNKRYANSIGFMKEDAMSGCFELLRQ  153



>ref|XP_009759546.1| PREDICTED: olee1-like protein [Nicotiana sylvestris]
Length=172

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 96/164 (59%), Gaps = 6/164 (4%)
 Frame = -2

Query  639  MARA--VALISAFCILALAGIAHCAPE-KFNVVGKVYCDTCRVQFETRISQSIKDAAVRL  469
            MA++  +  +S  C+ ++ G+     + +F V G VYCD CR  F+T +SQ +  A VRL
Sbjct  1    MAKSAVIFFVSVICLFSILGLTQAYEKPQFIVEGIVYCDPCRSAFKTNLSQPLAGAGVRL  60

Query  468  ECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKET---VKGLE  298
            +CR+ + + +T ++   T + G Y+L V+GDHE ++C   + KSP+EDC E    V   E
Sbjct  61   QCRHPETEEVTITIASQTNSTGYYHLLVEGDHENEICETYLTKSPKEDCSEIPDEVHTKE  120

Query  297  KAIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
             + V  T N GM  ++R AN LFF+   +   C++  +++ ++P
Sbjct  121  SSRVTLTNNNGMAGNLREANALFFLAKKSSSECAQEFKDMQYIP  164



>ref|XP_011075627.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=163

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 88/153 (58%), Gaps = 4/153 (3%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            A+ L +A C L +A  A  AP KF V GKVYC+ CR  F  R S+ +  A V+LEC+N  
Sbjct  8    AIILAAALCFLDVA--ASLAP-KFVVDGKVYCEVCRANFTNRYSKPMAGAKVKLECKNEV  64

Query  450  NKTLTYSMEGATGADGNYNLTVDGDH-ERDMCVVTVVKSPREDCKETVKGLEKAIVVCTA  274
             + +TY++EG T   G Y LT +GDH   D+C VT+VKS   DC E       A V  T 
Sbjct  65   TEKVTYTLEGETNDKGVYTLTAEGDHGSEDLCAVTLVKSSMADCAEIPDEKPAAEVTLTL  124

Query  273  NVGMKSDIRHANPLFFMKDLADERCSKVLEEID  175
            N G   + RHANPL F +  A   C+++ +E++
Sbjct  125  NNGFHDEFRHANPLAFTRKEALPECAELFKELE  157



>ref|XP_009396935.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 87/154 (56%), Gaps = 3/154 (2%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVV--GKVYCDTCRVQFETRISQSIKDAAVRL  469
            MA      +A C L A      C     ++V  G+VYCDTCR  FET  ++ I  A V+L
Sbjct  1    MANGSHAFAATCFLFAFLNAVVCVVSTPDIVVEGRVYCDTCRAGFETTATEYIAGAKVKL  60

Query  468  ECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAI  289
            EC+N     + ++ +  T A G Y +TV  DH+ + C VT++ SPR DC E  +G   A+
Sbjct  61   ECKNYTTGEIIHTNQATTDATGKYQITVVDDHQEETCQVTLISSPRSDCSEISEGRNSAL  120

Query  288  VVCTANVGMKSDIRHANPLFFMKDLADERCSKVL  187
            VV T NVG+ S +R+AN L F+K+   E C ++L
Sbjct  121  VVVTHNVGITSGVRYANSLGFLKEKPLETCGQLL  154



>ref|XP_009334049.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 97/167 (58%), Gaps = 8/167 (5%)
 Frame = -2

Query  639  MARAVALISAFCILA-LAGIAHC----APEKFNVVGKVYCDTCRVQFETRISQSIKDAAV  475
            MA+A+ + + F IL+    +A+     A     V GKVYCD CRVQFETR+S  I  A V
Sbjct  1    MAKALGIAALFVILSCFYSLAYATRGAATRTLFVEGKVYCDPCRVQFETRLSTPIDGATV  60

Query  474  RLECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEK  295
             LECR+ +N T+ Y +EG T  +G Y+L    + E  +C V  V+SP ++C +    +E+
Sbjct  61   ALECRSRENGTIVYVVEGKTDKNGIYSLATHKEFEEQICEVRTVRSPTDECADHFD-IER  119

Query  294  AIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            A ++ T N G+ +  R+ANPL FMK  +   C  VL+E+   P +T 
Sbjct  120  ARILLTHNNGVNALARYANPLGFMKKESTSECEAVLKEL--FPEETQ  164



>ref|XP_011075462.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=163

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 90/160 (56%), Gaps = 8/160 (5%)
 Frame = -2

Query  639  MAR----AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVR  472
            MAR    A+ L  A C L +A  A  AP KF V GKVYC+ CR  F  R S+ +  A V+
Sbjct  1    MARFTQVAIILAVALCFLDVA--ASHAP-KFVVDGKVYCEVCRANFTNRYSEPMPGAKVK  57

Query  471  LECRNLDNKTLTYSMEGATGADGNYNLTVDGDH-ERDMCVVTVVKSPREDCKETVKGLEK  295
            LEC+N   + +TY++EG T   G Y LT +GDH   D+C VT+VKS   DC E       
Sbjct  58   LECKNEVTEKVTYTLEGETNDKGVYTLTAEGDHGSEDLCAVTLVKSSMADCAEIPDEKPA  117

Query  294  AIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEID  175
            A V  T N G   + RHANPL F +  A   C+++ +E++
Sbjct  118  AEVTLTLNNGFHDEFRHANPLAFTRKEALPECAELFKELE  157



>ref|XP_009608960.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=172

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 96/164 (59%), Gaps = 6/164 (4%)
 Frame = -2

Query  639  MARA--VALISAFCILALAGIAHCAPE-KFNVVGKVYCDTCRVQFETRISQSIKDAAVRL  469
            MA++  +  +SA C+ +L G+   + + +F V G VYCD CR  F+T +SQ +  A VRL
Sbjct  1    MAKSAVIFFVSAICLFSLLGLTQASEKPQFIVEGIVYCDPCRSAFKTNLSQPLAGAGVRL  60

Query  468  ECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKET---VKGLE  298
            +CR+ + + +T ++   T   G Y+L V+GDHE ++C   + KS +EDC E    V   E
Sbjct  61   QCRHPETEEVTITIASETNTTGYYHLLVEGDHENEICETYLTKSSKEDCSEIPDEVHTKE  120

Query  297  KAIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
             + V  T N G+  ++R AN LFF+   A   C++  +++ ++P
Sbjct  121  SSRVTLTNNNGIAGNLREANALFFLAKNASSECAQEFKDMQYIP  164



>ref|XP_011090511.1| PREDICTED: major pollen allergen Lol p 11-like [Sesamum indicum]
Length=159

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 88/153 (58%), Gaps = 0/153 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MAR + ++ A C+L     AH   + F+V G VYCDTCR  +ET  +  I  A VR+ECR
Sbjct  1    MARNLLVLFAVCVLPAIVSAHFVRDPFHVTGSVYCDTCRCGYETDATTYIAGATVRIECR  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            N DN  LTY+ E  T + G+Y++ V+ D   D C   +VKS   +C    +G ++A V+ 
Sbjct  61   NKDNGQLTYTKEAVTDSTGHYSVLVETDRGDDFCDAVLVKSADPECSTPNEGRDRARVIL  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
            T N GM S+ R AN + F+K+     C  +L++
Sbjct  121  TRNNGMISNKRFANAMGFLKNTPLANCPMILQK  153



>gb|KDO80906.1| hypothetical protein CISIN_1g031458mg [Citrus sinensis]
Length=159

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 89/152 (59%), Gaps = 2/152 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MAR + LI A C+L AL       P+ F+V G+VYCDTC+  FET  +  I  A V++EC
Sbjct  1    MARTLLLI-ALCVLPALVSAVRPNPKPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++  +  + YS EG T + G Y + V  DH+  +C   +V SP+ DCK    G E++ V+
Sbjct  60   KDRKSMQVVYSREGKTDSTGTYKILVSEDHQDQLCDAVLVSSPQNDCKTVAPGRERSRVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVL  187
             T+  G+ S+ R+AN + FMK      C++VL
Sbjct  120  LTSYNGISSETRYANSMGFMKAEPMSGCAEVL  151



>ref|XP_011101449.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=171

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 91/156 (58%), Gaps = 6/156 (4%)
 Frame = -2

Query  639  MAR-AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MAR A+ L  A C+L+LA +A+    +F V G+V+C+ CR  F  + S+ +  A V+LEC
Sbjct  1    MARLAIVLAGALCLLSLAQLANAQEPQFIVKGRVFCEVCRANFINKFSKPMVGAEVKLEC  60

Query  462  RNLDNKTLTYSMEGATGAD-GNYNLTVDGDHERDMCVVTVVKSPREDCKE-TVKGLEK--  295
            R+ ++  +TYS+ G    D G Y L  +GDHE + C VT+VKS   DC E  V GL +  
Sbjct  61   RDEESGMVTYSLTGGVTNDKGEYRLAAEGDHEAEYCEVTLVKSSEPDCAEIPVDGLGEIP  120

Query  294  -AIVVCTANVGMKSDIRHANPLFFMKDLADERCSKV  190
             A +  TAN G     RHAN LFF K  A  +C ++
Sbjct  121  AAEITLTANNGFHDTFRHANALFFTKKEAMPQCEEL  156



>ref|XP_006472638.1| PREDICTED: pollen-specific protein C13-like [Citrus sinensis]
Length=159

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 89/152 (59%), Gaps = 2/152 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MAR + LI A C+L AL       P+ F+V G+VYCDTC+  FET  +  I  A V++EC
Sbjct  1    MARILLLI-ALCVLPALVSAVRPNPKPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++  +  + YS EG T + G Y + V  DH+  +C   +V SP+ DCK    G E++ V+
Sbjct  60   KDRKSMQVVYSREGKTDSTGTYKILVSEDHQDQLCDAVLVSSPQNDCKTVAPGRERSRVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVL  187
             T+  G+ S+ R+AN + FMK      C++VL
Sbjct  120  LTSYNGISSETRYANSMGFMKAEPMSGCAEVL  151



>gb|ACG33223.1| pollen-specific protein C13 precursor [Zea mays]
Length=167

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 91/151 (60%), Gaps = 1/151 (1%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            AV L   FC  A   + +  P+ + + G+VYCDTCR  F T +++ I  A VRLEC++  
Sbjct  10   AVILSVLFCAAAGTAVDNDLPD-YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFG  68

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTAN  271
               L  S++G T A+G Y + +   HE D+C V +V+SPR+DC +     ++A V+ T N
Sbjct  69   TGKLERSIDGVTDANGTYTIELKDSHEEDICEVVLVESPRKDCDQVQADRDRAGVLLTRN  128

Query  270  VGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            VG+  ++R ANPL + KD+    C+ +L+++
Sbjct  129  VGISDNLRPANPLGYFKDVPLPICASLLKQL  159



>gb|ABC86745.1| pollen-specific protein [Vitis pseudoreticulata]
Length=159

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 89/154 (58%), Gaps = 2/154 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            M R + L+ A C+L AL        + F + G+VYCDTCR  FET  +  I  A VR+EC
Sbjct  1    MGRLMLLV-ALCVLPALVSAGRPVSQPFVLQGRVYCDTCRAGFETSATTYIAGAKVRVEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++ ++  L YS+EG T + G Y + V  DHE  +C   +V SP+ DC     G ++A V+
Sbjct  60   KDRNSMQLLYSIEGITDSTGTYKIMVTEDHEDQLCDAVLVSSPQSDCASVDPGRDRAAVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
             T   G+ SD R+AN + F+KD     C+++L++
Sbjct  120  LTRYNGIVSDNRYANSMGFLKDHPMSECTQLLQQ  153



>ref|XP_008439742.1| PREDICTED: olee1-like protein isoform X1 [Cucumis melo]
 ref|XP_008439744.1| PREDICTED: olee1-like protein isoform X3 [Cucumis melo]
Length=168

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 94/156 (60%), Gaps = 3/156 (2%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            A+ L+SA C L+   IA  + ++F + GKVYCDTCR+QF TR+S+ +  A V+L CR   
Sbjct  6    AIILVSALCFLSFLDIALSSKDRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEA  65

Query  450  NK-TLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCK--ETVKGLEKAIVVC  280
            N    T++ E  T  +G Y + VDGDHE ++C V++++S  ++C    T      A V  
Sbjct  66   NAGNETFTGEAVTDKNGVYKIEVDGDHEEEICEVSLLESADKECSGIPTDGYGHFARVSI  125

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
            T N G+ + +R ANPL F++  A  +C +VL E+ F
Sbjct  126  TGNNGITNPVRQANPLGFLRKDALPQCKEVLRELGF  161



>ref|XP_010269200.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=159

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 87/157 (55%), Gaps = 0/157 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MAR + L +   + A    A  A   F V GKVYCD CR  FET  +  I  A VR+ECR
Sbjct  1    MARLLLLFALCVLPAFVAAARPARNPFTVFGKVYCDNCRAGFETSATTYIPGAKVRVECR  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            + D   L +S++G T + G+Y + V  DHE  +C   +V SP+ DC     G E+A V+ 
Sbjct  61   DRDTLNLLFSVDGVTDSTGSYKIQVAEDHEDQLCESVLVSSPQNDCSAVEPGRERARVIL  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFL  169
            T   G+ SD R+AN L F+KD     C++++++   L
Sbjct  121  TRGNGIASDNRYANSLGFIKDQPLPGCAEIMKQYQEL  157



>gb|ACF82695.1| unknown [Zea mays]
 tpg|DAA38042.1| TPA: pollen-specific protein C13 [Zea mays]
Length=167

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 91/151 (60%), Gaps = 1/151 (1%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            AV L   FC  A   + +  P+ + + G+VYCDTCR  F T +++ I  A VRLEC++  
Sbjct  10   AVILSVLFCAAAGTAVDNDLPD-YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFG  68

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTAN  271
               L  S++G T  +G Y + +   HE D+C V +V+SPR+DC +     ++A V+ T N
Sbjct  69   TGKLERSIDGVTDGNGTYTIELKDSHEEDICEVVLVESPRKDCDQVQADRDRAGVLLTRN  128

Query  270  VGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            VG+  ++R ANPL ++KD+    C+ +L+++
Sbjct  129  VGISDNLRPANPLGYLKDVPLPICASLLKQL  159



>ref|XP_010434511.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 92/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             +SA C+ +LAG+A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  10   FVSAVCLSSLAGVAIADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRV  69

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP  +C +  K       A +  
Sbjct  70   NGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVESPNSECSDVSKEAYLRNAAKISL  129

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +EI  +P  T 
Sbjct  130  TANDGIVSHETRIVNPLGFMVKTPSAECPAAFKEIGIVPDVTF  172



>ref|XP_008439743.1| PREDICTED: olee1-like protein isoform X2 [Cucumis melo]
Length=168

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 92/156 (59%), Gaps = 3/156 (2%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            A+ L+SA C L+   IA  + ++F + GKVYCDTCR+QF TR+S+ +  A V+L CR   
Sbjct  6    AIILVSALCFLSFLDIALSSKDRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEA  65

Query  450  NK-TLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKGLEKAIVVC  280
            N    T++ E  T  +G Y + VDGDHE ++C V++++S  + C E  T      A V  
Sbjct  66   NAGNETFTGEAVTDKNGVYKIEVDGDHEEEICEVSLLESGDKGCGEIPTDGYGHFARVSI  125

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
            T N G+   +R ANPL F K  A  +C +VL E+ F
Sbjct  126  TGNNGIIDPVRQANPLGFKKKEALPQCKEVLRELGF  161



>ref|XP_010540511.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=170

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 96/166 (58%), Gaps = 8/166 (5%)
 Frame = -2

Query  639  MARAVALI-SAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVR  472
            MA+ + L+ SA C+  L   A    +   +F++ G VYCDTCRVQF TR+S+ ++ A V+
Sbjct  1    MAKLILLVASALCLATLVNFAAADADDFDRFHIKGSVYCDTCRVQFFTRLSKFLEGAKVK  60

Query  471  LECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVK---GL  301
            LEC+N+DN+T+T + E  T   GNY + V GDHE ++C + + +SP  +C +        
Sbjct  61   LECKNIDNQTVTLTKEAVTDKSGNYEMVVMGDHEDEVCEIVLAESPDTECSDINNEEFTR  120

Query  300  EKAIVVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
              A +  TAN G+ S + R  NPL FM+      C K  EE+  +P
Sbjct  121  NAARISLTANDGIVSNETRTVNPLGFMRRTPLSDCPKAFEELGIVP  166



>ref|XP_004975466.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=163

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 86/148 (58%), Gaps = 1/148 (1%)
 Frame = -2

Query  624  ALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNK  445
            A+  A     +  +A  AP+ F + G+VYCDTCR  F+T +++ IK A VRLEC++    
Sbjct  9    AVTVAVLFYGVVAVATNAPD-FVIQGRVYCDTCRAGFQTNVTEYIKGAKVRLECKHFGTG  67

Query  444  TLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVG  265
             +  +++G T   G Y + + G HE D+C V +++SPR+DC E     ++A V+   + G
Sbjct  68   AVERAIDGVTDESGFYTIKLKGGHEEDICEVILIESPRKDCAEVPAHSDRASVLLAKDAG  127

Query  264  MKSDIRHANPLFFMKDLADERCSKVLEE  181
            +  D+R  NPL + KD+    C  VL+E
Sbjct  128  ISDDMRFPNPLGYFKDVPLPVCGAVLKE  155



>emb|CDX99789.1| BnaC05g22110D [Brassica napus]
Length=171

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 94/162 (58%), Gaps = 9/162 (6%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            V L SA C   L  +     +   +FN+ G VYCDTCRVQF TR+S+ ++ A V+LEC++
Sbjct  7    VFLASALCFTTLLHLVAADADDFDRFNITGSVYCDTCRVQFVTRLSKFLEGAKVKLECKS  66

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE----KAI  289
              N+T+T + E  T  DG Y + V GDHE ++C + +V+SP  +C E V   E     A 
Sbjct  67   RVNQTVTLTKEAVTDKDGKYQMEVMGDHEEELCEIILVQSPDAECGE-VNNEEFLRNAAR  125

Query  288  VVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            +  TAN G+ S +IR  NPL FM+      C +V +E+  +P
Sbjct  126  ISLTANDGIVSNEIRTINPLGFMRKTPLADCPQVFKELGIVP  167



>ref|XP_008376286.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008343323.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008353938.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_009369651.1| PREDICTED: pollen-specific protein C13-like [Pyrus x bretschneideri]
Length=159

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 87/158 (55%), Gaps = 2/158 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+ V LI A C+L ALA         F V GKVYCDTCR  +ET+    I  A VRLEC
Sbjct  1    MAKLVLLI-ALCVLPALAAATRPMKTPFTVEGKVYCDTCRAGYETKAITYIAGAKVRLEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+  +  L Y+ EG T + G Y + V  DH    C   +V SP++DC     G E+A V+
Sbjct  60   RDKSSMALVYTKEGTTDSAGCYKIPVAEDHLDQFCDAVLVSSPQKDCATVSPGRERARVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFL  169
             T   G+ S  R AN + FM+  A   C+++L+E+  L
Sbjct  120  LTGYNGIASYTRFANAMGFMRTEALSGCTQILKELQEL  157



>ref|NP_001148343.1| LOC100281953 precursor [Zea mays]
 gb|ACG30892.1| pollen-specific protein C13 precursor [Zea mays]
Length=167

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 90/151 (60%), Gaps = 1/151 (1%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            AV L   FC  A   + +  P+ + + G+VYCDTCR  F T +++ I  A VRLEC++  
Sbjct  10   AVILSVLFCAAAGTAVDNDLPD-YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFG  68

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTAN  271
               L  S++G T  +G Y   +   HE D+C V +V+SPR+DC +     ++A V+ T N
Sbjct  69   TGKLERSIDGVTDGNGTYTXELKDSHEEDICEVVLVESPRKDCDQVQADRDRAGVLLTRN  128

Query  270  VGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            VG+  ++R ANPL ++KD+    C+ +L+++
Sbjct  129  VGISDNLRPANPLGYLKDVPLPICASLLKQL  159



>ref|XP_010439832.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 92/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             +SA C+ +LAG+A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  10   FVSAVCLSSLAGVAIADADDFDRFQIQGSVYCDTCRVQFITRLSKFLEGAKVKLECRSRV  69

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP  +C +  K       A +  
Sbjct  70   NGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVESPDSECSDVSKEAYLRNAAKISL  129

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +EI  +P  T 
Sbjct  130  TANDGIVSHETRIVNPLGFMVKTPSAECPAAFKEIGIVPDVTF  172



>ref|XP_006652233.1| PREDICTED: pollen-specific protein C13-like [Oryza brachyantha]
Length=166

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 91/157 (58%), Gaps = 4/157 (3%)
 Frame = -2

Query  633  RAVALISAFCILALAG---IAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            R + +I       LAG    A  AP+ + V G+VYCDTCR  FET +++ IK A VRLEC
Sbjct  5    RTIPVIFGILFYVLAGSTATATDAPD-YLVQGRVYCDTCRAGFETNVTEYIKGAKVRLEC  63

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++     +  +++G T   G Y + +   HE D+C V +VKSP  +C E     ++A V+
Sbjct  64   KHYGTGNIERAVDGVTDETGTYKIELKDSHEEDICEVVLVKSPLANCGEVQAERDRARVL  123

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
             T NVG+  ++R ANPL ++KD+    C ++L++ D 
Sbjct  124  LTRNVGICDNLRFANPLGYLKDIPLPVCGELLKQFDL  160



>ref|XP_010529196.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=173

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 95/166 (57%), Gaps = 10/166 (6%)
 Frame = -2

Query  633  RAVALI--SAFCILALAGIAHCAP----EKFNVVGKVYCDTCRVQFETRISQSIKDAAVR  472
            +A+AL+  SA C+  +AG A  A     ++F + G VYCDTCRVQF TR+S+ ++ A VR
Sbjct  4    KAIALLMASAVCLSYVAGFAAAADADDLDRFQIQGSVYCDTCRVQFITRLSKFLQGAKVR  63

Query  471  LECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---  301
            LEC+N  N TLT S E  T   G++ + V GDHE ++C + +V+SP +DC E  K     
Sbjct  64   LECKNRVNGTLTVSKEAVTDESGSFLMEVTGDHEEEVCEIVLVESPDKDCSEVSKEAFLR  123

Query  300  EKAIVVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
              A +  TAN G+ S + R  NPL FM       C    +E+   P
Sbjct  124  NAAKISLTANDGIVSNETRIVNPLGFMVKTPSTECPAAFKELGIKP  169



>ref|XP_007153183.1| hypothetical protein PHAVU_003G013900g [Phaseolus vulgaris]
 gb|ESW25177.1| hypothetical protein PHAVU_003G013900g [Phaseolus vulgaris]
Length=162

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 91/159 (57%), Gaps = 5/159 (3%)
 Frame = -2

Query  639  MARAVALISAF-CILALAG-IAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLE  466
            MAR+  +++ F  IL  +  +A   PEKF V GK+YCD C   FE+R+S  +    V L+
Sbjct  1    MARSFVVVALFVSILCFSSTLARKTPEKFFVEGKIYCDPCHFAFESRLSFPLSGVNVSLQ  60

Query  465  CRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPRE-DCKETVKGLEKAI  289
            C   +N T+TY     + A+G YN+ V GDHE D+CVV V  SP E  CKE +      I
Sbjct  61   CIQEENNTVTYLKNSTSDANGMYNIPVLGDHEDDICVV-VADSPNEGQCKEAMPNKSDRI  119

Query  288  VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
            ++ T N+G  S  R+ NPL FM    D +C+ V+ E++ 
Sbjct  120  IL-TDNMGAASLARYVNPLGFMTQTIDSQCNAVVHELEL  157



>ref|XP_008348540.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=162

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 85/153 (56%), Gaps = 1/153 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            M+R V L++    L L   A      F+V G+VYCDTCR  FET  +  I  A VR+EC+
Sbjct  3    MSRVVVLLALCMFLGLVS-ARTLGNPFHVQGRVYCDTCRCGFETTATNYIPGARVRIECK  61

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            + +   L YS+EG T + G YN+ V+ DHE  +C   +V SP  DCK    G  +A VV 
Sbjct  62   DRNTLQLAYSVEGETDSTGTYNILVEEDHEDQICESVLVSSPISDCKSADPGRSRANVVV  121

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
            T   G+  D R+AN + F K+     C K+LE+
Sbjct  122  TRYNGVVKDKRYANNMGFFKNEPLAGCEKILEQ  154



>ref|XP_010496255.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 92/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            L+SA C+ +LA +A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  10   LVSAVCLSSLASVAVADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRV  69

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP  +C +  K       A +  
Sbjct  70   NGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVESPDSECSDVSKEAYLRNAAKISL  129

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +EI  +P  T 
Sbjct  130  TANDGIVSHETRIVNPLGFMVKTPSAECPAAFKEIGIVPDVTF  172



>ref|XP_010538209.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=170

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 97/167 (58%), Gaps = 10/167 (6%)
 Frame = -2

Query  639  MARAVA-LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVR  472
            MA+ +  L SA C+  L   A    +    F++ G VYCDTCRVQF TR+S+ ++ A V+
Sbjct  1    MAKVIFFLASALCLATLVNFAAADADDFDTFHIKGSVYCDTCRVQFITRLSKFLEGAKVK  60

Query  471  LECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE--  298
            LEC+N  N+T+T   E  T   GNY + V GDHE ++C + +V+SP  +C+E +   E  
Sbjct  61   LECKNRVNQTVTLVEEAVTDKSGNYEMVVTGDHEEEVCEIVLVESPEAECRE-INNEEFL  119

Query  297  --KAIVVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
               A +  TAN G+ S + R  NPL FM++     C K  +E+D +P
Sbjct  120  RNAARISLTANDGIVSNETRTVNPLGFMRNTPLPDCPKAFKELDIVP  166



>ref|XP_006284941.1| hypothetical protein CARUB_v10006240mg [Capsella rubella]
 gb|EOA17839.1| hypothetical protein CARUB_v10006240mg [Capsella rubella]
Length=172

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 92/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             +SA C+ +LAG+A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  10   FVSAVCLSSLAGVAIADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRV  69

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +++SP  DC +  K       A +  
Sbjct  70   NGTVTLTEEAVTDKSGSYKMEVAGDHEEEVCELVLLESPDSDCSDVSKEAYLHNAAKISL  129

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  130  TANDGIVSHETRIVNPLGFMVKTPSAECPAAFKELGIVPDVTF  172



>ref|XP_010441660.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 92/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++SA C+ +LAG A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECRN  
Sbjct  12   IVSAVCLSSLAGFAAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRNRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  72   NGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C+   +EI  +P  T 
Sbjct  132  TANDGIVSHETRIVNPLGFMVKTPSADCAAAFKEIGIVPDVTF  174



>ref|XP_009115274.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=171

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 93/162 (57%), Gaps = 9/162 (6%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            V L SA C   L  +     +   +FN+ G VYCDTCRVQF TR+S+ ++ A V+LEC++
Sbjct  7    VFLASALCFTTLLHLVAADADDFDRFNITGSVYCDTCRVQFVTRLSKFLEGAKVKLECKS  66

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE----KAI  289
              N+T+T + E  T  DG Y + V GDHE ++C   +V+SP  +C E V   E     A 
Sbjct  67   RVNQTVTLTKEAVTDKDGKYQMEVMGDHEEELCEFILVQSPDAECGE-VNNEEFLRNAAR  125

Query  288  VVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            +  TAN G+ S +IR  NPL FM+      C +V +E+  +P
Sbjct  126  ISLTANDGIVSNEIRTINPLGFMRKTPLADCPQVFKELGIVP  167



>gb|KFK28529.1| hypothetical protein AALP_AA7G008600 [Arabis alpina]
Length=173

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 94/173 (54%), Gaps = 7/173 (4%)
 Frame = -2

Query  651  LHTKMARAVALISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDA  481
            + TK       +SA C+ +LAG+A    +   +F + G VYCDTCRVQF TR+S+ ++ A
Sbjct  1    METKAIFFFLFVSAVCLSSLAGVAVADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGA  60

Query  480  AVRLECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL  301
             V+LECR+  N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  K  
Sbjct  61   KVKLECRSRTNGTITLTKEAVTDKTGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSKEA  120

Query  300  ---EKAIVVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
                 A +  TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  121  YLRNAAKISLTANDGIVSHETRIVNPLGFMVQTPLADCPAAFKELGIVPDVTF  173



>ref|XP_011016068.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011027685.1| PREDICTED: pollen-specific protein C13 isoform X1 [Populus euphratica]
 ref|XP_011027686.1| PREDICTED: pollen-specific protein C13 isoform X2 [Populus euphratica]
Length=159

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 86/152 (57%), Gaps = 2/152 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MAR V L+ A C+L AL   A      F+V G+VYCDTC   FET  +  I  + V++EC
Sbjct  1    MAR-VFLLLALCVLPALVSAARPGRNPFSVQGRVYCDTCHAGFETPKTTYIAGSKVKVEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+   + L YS EG T + G Y +TVD DH+  +C   +V SPR+DC     G E+A V+
Sbjct  60   RDRKTQDLVYSKEGTTDSTGTYIITVDEDHKDQICDAMLVSSPRQDCSSPSAGRERARVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVL  187
             T   G+ S  R+AN + FM       C+++L
Sbjct  120  LTNYNGLVSTTRYANSMGFMAAQPMSGCTELL  151



>ref|NP_567562.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 sp|Q6NMJ2.1|OLE96_ARATH RecName: Full=Pollen-specific protein-like At4g18596; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAS47674.1| At4g18596 [Arabidopsis thaliana]
 dbj|BAD94719.1| pollen-specific protein - like [Arabidopsis thaliana]
 gb|AEE84066.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=172

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 91/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             +SA C+ +LAG+A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  10   FVSAVCLSSLAGVAIADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  69

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  70   NGTVTLTKEAVTDKTGSYRMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISL  129

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  130  TANDGIVSHETRIVNPLGFMVQTPSAECPAAFKELGIVPDVTF  172



>gb|AAN76546.1|AF393475_1 LLP-B3 protein [Lilium longiflorum]
Length=160

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 81/126 (64%), Gaps = 0/126 (0%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F V G+VYCD+CR  FET I+  I+ A V+LECR+ DN ++ +++EG T + G Y++ ++
Sbjct  28   FIVEGRVYCDSCRAGFETNITTYIEGAKVKLECRHFDNDSIAHTVEGVTNSTGTYSIQLE  87

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADER  202
             DHE ++C V +V SP  DC E     ++A V  T N G+ S IR+AN L F+++  D  
Sbjct  88   NDHESEICEVVLVSSPIFDCNEIDYDRDRARVTLTNNNGIDSPIRYANSLGFLQEQPDII  147

Query  201  CSKVLE  184
            C  +L+
Sbjct  148  CGDLLK  153



>ref|XP_010481521.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 91/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++SA C+ +LA  A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECRN  
Sbjct  12   IVSALCLSSLACFAAADADEFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRNRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  72   NGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C+   +EI  +P  T 
Sbjct  132  TANDGIVSHETRIVNPLGFMVKTPSADCAAAFKEIGIVPDVTF  174



>ref|XP_009342278.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 95/167 (57%), Gaps = 8/167 (5%)
 Frame = -2

Query  639  MARAVALISAF----CILALAGIAHCAPEK-FNVVGKVYCDTCRVQFETRISQSIKDAAV  475
            MA+A+ + + F    C  +LA     A  +   V GKVYCD CRVQFETR+S  I  A V
Sbjct  1    MAKALGIAALFVTLSCFYSLAYATRGAATRTLFVEGKVYCDPCRVQFETRLSTPIDGATV  60

Query  474  RLECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEK  295
             LECR+ +N T+ Y +EG T  +G Y+L    + E  +C V  V+S  ++C +    +E+
Sbjct  61   ALECRSRENGTIVYVVEGKTDKNGIYSLATHKEFEEQICEVRTVRSSTDECADHFD-IER  119

Query  294  AIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            A ++ T N G+ +  R+ANPL FMK  +   C  VL+E+   P +T 
Sbjct  120  ARILLTHNNGVNALARYANPLGFMKKESTSECEAVLKEL--FPEETQ  164



>ref|XP_009421183.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 86/149 (58%), Gaps = 2/149 (1%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDN  448
            + +++A C  ALAG+A   P  F + G+VYCD CR  FET  +  I+ A V+LECR  D 
Sbjct  7    LPVVAALC-FALAGVALALP-TFRIQGRVYCDKCRAGFETSATDYIEGAKVKLECRQYDT  64

Query  447  KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANV  268
              +  +    T A G Y L V+ +HE ++C V +V+SPR  C E + G ++A V+ +A  
Sbjct  65   GVVEQTATAVTDASGTYTLEVEDNHEEEICEVVLVESPRPGCSEIMTGRDRARVLISAES  124

Query  267  GMKSDIRHANPLFFMKDLADERCSKVLEE  181
            G+ + +R+AN L F+       C  +L++
Sbjct  125  GLTTSVRYANSLGFLNAAPLPECGLLLQK  153



>ref|XP_003634471.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CAN61642.1| hypothetical protein VITISV_029644 [Vitis vinifera]
 emb|CBI19132.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 88/154 (57%), Gaps = 2/154 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            M R + L+ A C+L AL        + F + G+VYCDTCR  FET  +  I  A VR+EC
Sbjct  1    MGRLMLLV-ALCVLPALVSAGRPVSQPFVLQGRVYCDTCRAGFETSATTYIAGAKVRVEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++ ++  L YS+EG T + G Y + V  D E  +C   +V SP+ DC     G ++A V+
Sbjct  60   KDRNSMQLLYSIEGITDSTGTYKIMVTEDREDQLCDAVLVSSPQSDCASVDPGRDRAAVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
             T   G+ SD R+AN + F+KD     C+++L++
Sbjct  120  LTRYNGIVSDNRYANSMGFLKDHPMSECTQLLQQ  153



>ref|XP_006366520.1| PREDICTED: olee1-like protein-like [Solanum tuberosum]
Length=162

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 91/158 (58%), Gaps = 4/158 (3%)
 Frame = -2

Query  621  LISAF--CILALAGIAHCAP--EKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNL  454
            +I++F  C++  A I   A   + F VVGKVYCDTCR  FET  S  +  + VR+EC+N 
Sbjct  4    MITSFVVCLVLFASINVSANFMDTFLVVGKVYCDTCRCGFETSASMYLPGSRVRIECKNR  63

Query  453  DNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTA  274
            D   L Y++EG T + G Y + V+ D   + C V +++S    C E   G ++A VV T+
Sbjct  64   DTNDLAYTVEGFTNSKGEYKILVNSDRRDEFCDVVLIRSSDPMCAEPNTGRDRARVVLTS  123

Query  273  NVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQ  160
            N GM S+ R AN + F+ +     C+K+L++ +F   Q
Sbjct  124  NNGMVSNTRFANSMGFLSNEPLASCTKILQQYEFSEDQ  161



>ref|XP_009760524.1| PREDICTED: pollen-specific protein C13-like [Nicotiana sylvestris]
Length=158

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 93/160 (58%), Gaps = 3/160 (2%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MAR VA + A C+L  +  A  +P  F V GK YCDTCR  FET  ++ +  + V++ECR
Sbjct  1    MARLVAFV-ALCLLFASLAAATSP--FLVKGKCYCDTCRCGFETEATKYLAGSKVKIECR  57

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            N     +TY++ G T + G YN+ VD D   D+C V +V+S  + C +   G ++A V+ 
Sbjct  58   NRVTNEITYTIGGVTNSQGEYNILVDRDCGDDVCDVVLVESSDKRCGKPNGGRDRARVIL  117

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQ  160
            T N GM SD+R+AN + F+ D     C+++L++      Q
Sbjct  118  TRNNGMISDVRYANNMGFLSDEPLSACTRILQQYQLTEDQ  157



>ref|XP_006434027.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
 gb|ESR47267.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
Length=159

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 88/152 (58%), Gaps = 2/152 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MAR + LI A C+L AL        + F+V G+VYCDTC+  FET  +  I  A V++EC
Sbjct  1    MARTLLLI-ALCVLPALVSAVRPNTKPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++  +  + YS EG T + G Y + V  DH+  +C   ++ SP+ DCK    G E++ V+
Sbjct  60   KDRKSMQVVYSREGKTDSTGTYKILVSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVL  187
             T+  G+ S+ R+AN + FMK      C++VL
Sbjct  120  LTSYNGISSETRYANSMGFMKAEPMSGCAEVL  151



>ref|XP_008378536.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=218

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 88/158 (56%), Gaps = 2/158 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+   LI A C+L ALA         F V GKVYCDTCR  +ET+    I  A VRLEC
Sbjct  60   MAKLFLLI-ALCMLPALAAATRPMRTPFTVEGKVYCDTCRAGYETKAITYIAGAKVRLEC  118

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+  +  L Y+ EG T + G Y + V  DH    C   +V SP++DC     G E+A V+
Sbjct  119  RDKTSMALLYTKEGTTDSAGCYKIPVAEDHLDQFCDAVLVSSPQKDCATVSPGRERARVI  178

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFL  169
             TAN G+ S  R AN + FM+  A   C+++L+E+  L
Sbjct  179  LTANNGIASYNRFANAMGFMRTEALSGCTQILKELQEL  216



>gb|KDP32694.1| hypothetical protein JCGZ_11986 [Jatropha curcas]
Length=159

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 88/153 (58%), Gaps = 0/153 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MAR V L++   + A+   A  A   F V G+VYCDTCR  FET  +  I  A VRLEC+
Sbjct  1    MARLVLLLALCVLPAIVSAARPARNPFEVEGRVYCDTCRAGFETPKTTYIAGAKVRLECK  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +  +  L YS EG T + G Y + VD DH   +C   +V SP++DC+    G ++A V+ 
Sbjct  61   DRKSMELVYSKEGTTDSTGTYKIYVDDDHADQLCDAVLVSSPKKDCRSPSSGRDRARVIL  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
            T+  G+ S+ R AN + F KD  +  C+++L +
Sbjct  121  TSYNGIASNKRFANAIGFEKDDIESGCTELLRQ  153



>ref|XP_007153182.1| hypothetical protein PHAVU_003G013800g [Phaseolus vulgaris]
 gb|ESW25176.1| hypothetical protein PHAVU_003G013800g [Phaseolus vulgaris]
Length=163

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 93/160 (58%), Gaps = 6/160 (4%)
 Frame = -2

Query  639  MARAVALISAF-CILALA-GIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLE  466
            MAR+  +++ F  +L  +  +A   PEKF+V GK+YCD C   FE+R+S  +   +V L+
Sbjct  1    MARSFVVVALFVSVLCFSSALARKTPEKFSVQGKIYCDPCHFAFESRLSFPLSGVSVSLQ  60

Query  465  CRNLDNKT-LTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPRE-DCKETVKGLEKA  292
            C   +N T +TY     + A+G YN+ V GDHE D+CVV V  SP E  CKE +      
Sbjct  61   CIKEENNTIITYLKNSTSDANGMYNIPVLGDHEDDICVV-VADSPNEGQCKEAMPNKSDR  119

Query  291  IVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
            I++ T N+G  S  R+ NPL FM    D +C+ V+ E++ 
Sbjct  120  III-TNNMGAASLTRYVNPLGFMTQTIDSQCNVVVHELEL  158



>ref|XP_009403224.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = -2

Query  564  KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTV  385
            KF + G+VYCDTCR  FET +SQ I  A V+L+CR+ +  ++ ++  G T   G YN+ V
Sbjct  26   KFVIQGRVYCDTCRAGFETVVSQYIPGAKVKLQCRHYETDSIEHTAVGVTDGTGTYNIEV  85

Query  384  DGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADE  205
            + +HE ++C V++V+SP   C E      +A V+ T   G+ SD+R+AN L F+KD   +
Sbjct  86   EDNHEEEICEVSLVQSPVPGCSEVSGTRNRARVLVTGRNGLASDVRYANSLGFLKDEPLK  145

Query  204  RCSKVLEE  181
             C  +L++
Sbjct  146  ECGLLLQQ  153



>gb|AFK46977.1| unknown [Lotus japonicus]
Length=168

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 90/150 (60%), Gaps = 5/150 (3%)
 Frame = -2

Query  615  SAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD-NKTL  439
            SA C L L G A+ + ++F + G VYCDTCR QF TR+S+ +  A V + CR  D    +
Sbjct  10   SALCFLTLVGSAY-SQDRFFIEGTVYCDTCRTQFLTRVSEFMSGATVGVVCRERDAGAKV  68

Query  438  TYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKGLEKAI-VVCTANV  268
            T+S E  T A+G Y++ VDGDHE ++C V ++KS R DC E  T   LE+A  +  T N 
Sbjct  69   TFSKEAVTDANGMYSVAVDGDHEDEVCEVKLLKSSRADCSEVDTESHLEQASRISITNNN  128

Query  267  GMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            G+ S +R ANPL F+K      C  +L ++
Sbjct  129  GIVSPVRTANPLGFLKTERLPECGHILLQL  158



>ref|XP_011101379.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=176

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 95/164 (58%), Gaps = 6/164 (4%)
 Frame = -2

Query  651  LHTKMAR-AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAV  475
            + TK+A+ A+ L  A C L+LA +A+    +F V GKV+C+ CR+ F  + S  +  A V
Sbjct  1    MATKLAQVAIILAGALCFLSLADVANSEVPQFIVKGKVFCEVCRLNFINKFSHPMPKAEV  60

Query  474  RLECRNLDNKTLTYSMEGA-TGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKG  304
            +LECR+     + Y + G  T  +G Y L  +GDH  ++C VT+VKS + DC E  T   
Sbjct  61   KLECRDEGTGKVMYRLTGGQTNDNGEYTLYAEGDHGEEICEVTLVKSSQHDCAEIPTDDS  120

Query  303  LEK--AIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
             EK  A +  T N G   +IR ANPL F +  A  +C+K+L+E+
Sbjct  121  GEKQAAEITLTVNNGFHDNIRLANPLSFTRKKALPKCAKLLKEL  164



>ref|XP_010494740.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 92/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++SA C+ +LAG A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  12   IVSAVCLSSLAGFAAADADDLDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  72   NGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C+   +EI  +P  T 
Sbjct  132  TANDGIVSHETRIVNPLGFMVKTPSADCAAAFKEIGIVPDVTF  174



>ref|XP_004233077.1| PREDICTED: major pollen allergen Lig v 1-like [Solanum lycopersicum]
Length=175

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 94/161 (58%), Gaps = 7/161 (4%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPE----KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            + + SA C+ +L GI     E    +F + G VYCD CR  F+T +S+ + DA V ++CR
Sbjct  7    IFIASAICLFSLLGITQANEESDKYQFILEGMVYCDPCRSIFKTNLSEPVVDARVGMQCR  66

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE-TVKGLEKAI--  289
            + + + +T ++  +T + G Y++ ++GDHE ++C   ++KSP+EDC E   +G  + +  
Sbjct  67   HPETERVTITVTASTNSTGYYHMLIEGDHENEICETYLIKSPKEDCSEIPTEGHTRELSR  126

Query  288  VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            V  T+  G+    R +NPLFF+       C +  +E+++LP
Sbjct  127  VTLTSKNGIAGKNRESNPLFFLTKKVAPECQQEFKEMEYLP  167



>ref|XP_009622218.1| PREDICTED: pollen-specific protein C13-like [Nicotiana tomentosiformis]
Length=158

 Score =   109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 95/160 (59%), Gaps = 3/160 (2%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MAR VA + A C+L  +  A  +P  F V GK YCDTCR  FET  ++ +  + V++ECR
Sbjct  1    MARLVAFV-ALCLLFASLAAATSP--FLVKGKCYCDTCRCGFETEATKYLAGSKVKIECR  57

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +     +TY+++G T + G YN+ V+ D   D+C V +V+S  + C +   G ++A V+ 
Sbjct  58   HRVTNEITYTIDGVTNSQGEYNILVNRDCGDDVCDVVLVESSDKRCGKPNGGRDRARVIL  117

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQ  160
            T N GM SD+R+AN + F+ D   + C+++L++      Q
Sbjct  118  TRNNGMSSDVRYANNMGFLSDEPLKSCTQILQQYQLTEDQ  157



>gb|AEW90946.1| pollen-specific protein F8-4 [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AEW90947.1| pollen-specific protein F8-5 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 91/152 (60%), Gaps = 3/152 (2%)
 Frame = -2

Query  633  RAVALISAFCILALAG--IAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            R +++I+   I ALAG  +A+  P+ + V G+VYCDTCR  FET +++ IK A VRLEC+
Sbjct  5    RILSVIAVVAIFALAGTAVANDLPD-YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECK  63

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
                + +  S++G T   G Y + +   H  D+C + +V+SP  +C E     ++A +V 
Sbjct  64   RFGTEKVERSIDGVTDETGTYKIELKDSHPEDICEMVLVQSPLANCNEIQDLRDRAEIVL  123

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLE  184
            + NVG+  +IR ANPL ++KD     C  +L+
Sbjct  124  SRNVGISDNIRMANPLGYLKDKPLPVCPDLLK  155



>gb|KHG12773.1| Olee1-like protein [Gossypium arboreum]
Length=187

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 93/158 (59%), Gaps = 6/158 (4%)
 Frame = -2

Query  627  VALISAFCIL-----ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            + +I+ FC       +L  +       + VVG VYCDTCRV+FET++S+ I  A V+LEC
Sbjct  4    IPIIAIFCFTIFVSSSLNFVYGAENMTYIVVGHVYCDTCRVEFETKLSEPIGGAVVKLEC  63

Query  462  RNLDNKTLTY-SMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIV  286
            RN  +  LT+ S E  T   G+Y++ V+GD+E   C V +V+SP  DC +  +    + V
Sbjct  64   RNRTDNQLTFQSQEIVTDEHGDYHIAVEGDYEESDCDVALVRSPNPDCNDPSEIWRISRV  123

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
            V T   G+  ++R AN L F K +A  +C++VL+EI +
Sbjct  124  VLTTLDGVSGELRFANNLGFKKKVALPQCTQVLQEIGY  161



>emb|CAH66537.1| H0209H04.4 [Oryza sativa Indica Group]
 gb|AFI71825.1| pollen specific protein [Oryza sativa]
Length=165

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 86/146 (59%), Gaps = 1/146 (1%)
 Frame = -2

Query  609  FCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYS  430
            F +LA    A  AP+ + V G+VYCDTCR  FET +++ IK A VRLEC++     +  +
Sbjct  15   FYVLASTATATDAPD-YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERA  73

Query  429  MEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDI  250
            ++G T   G Y + +   HE D+C V +V SP  +C E     ++A V+ T NVG+  ++
Sbjct  74   IDGVTDETGTYKIELKDSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNL  133

Query  249  RHANPLFFMKDLADERCSKVLEEIDF  172
            R ANPL ++KD+    C  +L++ D 
Sbjct  134  RLANPLGYLKDIPLPVCGALLKQFDL  159



>emb|CDX99452.1| BnaC01g11000D [Brassica napus]
Length=172

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 89/159 (56%), Gaps = 7/159 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             +SA C+ +LAG A    +   +F + G VYCDTCRVQF TR+SQ ++ A V+LECR+  
Sbjct  10   FVSAVCLSSLAGKAVADADDFDRFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRT  69

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +++SP   C +  K       A V  
Sbjct  70   NGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLLQSPDSGCSDVSKEAYLRNAAKVSL  129

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            TAN G+ S + R  NPL FM       C    +E+  +P
Sbjct  130  TANDGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVP  168



>ref|NP_001052674.1| Os04g0398700 [Oryza sativa Japonica Group]
 emb|CAE05158.2| OSJNBa0039C07.14 [Oryza sativa Japonica Group]
 dbj|BAF14588.1| Os04g0398700 [Oryza sativa Japonica Group]
 gb|EAZ30594.1| hypothetical protein OsJ_14643 [Oryza sativa Japonica Group]
Length=165

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 86/146 (59%), Gaps = 1/146 (1%)
 Frame = -2

Query  609  FCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYS  430
            F +LA    A  AP+ + V G+VYCDTCR  FET +++ IK A VRLEC++     +  +
Sbjct  15   FYVLASTATATDAPD-YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERA  73

Query  429  MEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDI  250
            ++G T   G Y + +   HE D+C V +V SP  +C E     ++A V+ T NVG+  ++
Sbjct  74   IDGVTDETGTYKIELKDSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNL  133

Query  249  RHANPLFFMKDLADERCSKVLEEIDF  172
            R ANPL ++KD+    C  +L++ D 
Sbjct  134  RLANPLGYLKDIPLPICGALLKQFDL  159



>gb|EAY93952.1| hypothetical protein OsI_15725 [Oryza sativa Indica Group]
Length=165

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 86/146 (59%), Gaps = 1/146 (1%)
 Frame = -2

Query  609  FCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYS  430
            F +LA    A  AP+ + V G+VYCDTCR  FET +++ IK A VRLEC++     +  +
Sbjct  15   FYVLASTATATDAPD-YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERA  73

Query  429  MEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDI  250
            ++G T   G Y + +   HE D+C V +V SP  +C E     ++A V+ T NVG+  ++
Sbjct  74   IDGVTDETGTYKIELKDSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNL  133

Query  249  RHANPLFFMKDLADERCSKVLEEIDF  172
            R ANPL ++KD+    C  +L++ D 
Sbjct  134  RLANPLGYLKDIPLPVCGALLKQFDL  159



>ref|NP_001105351.1| pollen-specific protein C13 precursor [Zea mays]
 sp|P33050.1|PSC13_MAIZE RecName: Full=Pollen-specific protein C13; Flags: Precursor [Zea 
mays]
 gb|AAB23277.1| pollen specific protein [Zea mays]
 gb|AFW58125.1| male-gametophyte specific1 [Zea mays]
 prf||2209273A Zm13
Length=170

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 88/157 (56%), Gaps = 6/157 (4%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAP------EKFNVVGKVYCDTCRVQFETRISQSIKDAAVRL  469
            A A  +A  IL L  +  CA         + + G+VYCDTCR  F T +++ I  A VRL
Sbjct  6    APATTTAAVILCLCVVLSCAAADDPNLPDYVIQGRVYCDTCRAGFVTNVTEYIAGAKVRL  65

Query  468  ECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAI  289
            EC++     L  +++G T A G Y + +   HE D+C V +V SPR+DC E     ++A 
Sbjct  66   ECKHFGTGKLERAIDGVTDATGTYTIELKDSHEEDICQVVLVASPRKDCDEVQALRDRAG  125

Query  288  VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            V+ T NVG+   +R ANPL + KD+    C+ +L+++
Sbjct  126  VLLTRNVGISDSLRPANPLGYFKDVPLPVCAALLKQL  162



>emb|CDY01556.1| BnaC07g35460D [Brassica napus]
Length=172

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 91/159 (57%), Gaps = 7/159 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             +SA C+ +LAG+A+   +    F + G VYCDTCRVQF TR+SQ ++ A V+LECR+  
Sbjct  10   FVSAVCLSSLAGVANADADDFDSFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRT  69

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKGLEKAI-VVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +++SP   C +  T   L  A  V  
Sbjct  70   NGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLLQSPDSGCSDVSTEAYLRNAAKVSL  129

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            TAN G+ S + R  NPL FM       C    +E+  +P
Sbjct  130  TANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP  168



>ref|XP_006664913.1| PREDICTED: pollen allergen Phl p 11-like [Oryza brachyantha]
Length=175

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 76/136 (56%), Gaps = 1/136 (1%)
 Frame = -2

Query  573  APEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYN  394
             P  F V G+VYCD CR  FET +S SIK A V++ECR+ + + + +  E A    G Y 
Sbjct  32   GPPGFTVTGRVYCDNCRAGFETNVSHSIKGATVQMECRHFETQEVKHRAEAAANEWGWYK  91

Query  393  LTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSD-IRHANPLFFMKD  217
            + V G+HE ++C V +V+SP  +C E  +  +++ V  T N G+K D  R+ANP+ F + 
Sbjct  92   MEVGGEHEAEICEVALVRSPEAECAEIERFRDRSRVPLTRNNGIKQDGFRYANPIAFFRK  151

Query  216  LADERCSKVLEEIDFL  169
                 C  +L   D  
Sbjct  152  DPPPACGDILRSYDLY  167



>ref|XP_008363638.1| PREDICTED: olee1-like protein [Malus domestica]
Length=163

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 91/165 (55%), Gaps = 9/165 (5%)
 Frame = -2

Query  639  MARAVALISAF----CILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVR  472
            MA+A+ + + F    C  +LA     A     V GKVYCD CRVQFETR+S  +  A V 
Sbjct  1    MAKALGIAALFITLSCFYSLASTV--ATRTLFVEGKVYCDPCRVQFETRLSTPVDGATVA  58

Query  471  LECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKA  292
            LECR+ +N T+ Y +EG T  +G Y+L      E  +C V  V+SP + C +     E+A
Sbjct  59   LECRSRENGTIVYVVEGKTDKNGIYSLASHKXFEEQICEVRTVRSPTDQCADHFD-FERA  117

Query  291  IVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQT  157
             ++ T N G+ +  R+ANPL FM   +   C  VL+E+   P +T
Sbjct  118  RILLTDNNGVNALARYANPLGFMTKESTYECEAVLKEL--FPEET  160



>ref|XP_002273294.1| PREDICTED: olee1-like protein [Vitis vinifera]
 emb|CBI30683.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 99/165 (60%), Gaps = 8/165 (5%)
 Frame = -2

Query  639  MARA----VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVR  472
            MAR+    + L +A C  +        P  F V G+VYCDTCR+QF TR+S+ +  A VR
Sbjct  1    MARSLQAVIFLAAALCFFSFQASVRAEPH-FFVKGQVYCDTCRIQFITRVSEYVPGAKVR  59

Query  471  LECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---  301
            LECR+ +  ++TYS++G T   G+Y L V+G+HE ++C V ++KS + +C E  +G+   
Sbjct  60   LECRDREGGSVTYSIDGETDETGSYRLPVEGEHEEEVCEVQLIKSSKPECSEISRGVFAR  119

Query  300  EKAIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLP  166
              A +   +N GM S  R ANPL F+K  +   C +VL+E+  LP
Sbjct  120  RSARISLASNNGMASSDRLANPLGFLKQESLSECPEVLKELGILP  164



>ref|XP_007206364.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
 gb|EMJ07563.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
Length=160

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 82/149 (55%), Gaps = 0/149 (0%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDN  448
            V L+ A C+L     A      F++ G+VYCDTCR  FET  +  I  A VR+EC+  + 
Sbjct  4    VLLLFALCVLPGLVSARTLGNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNT  63

Query  447  KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANV  268
              L YS+EG T A G YN+ V+ DHE  +C   +V SP  DCK    G ++A VV T   
Sbjct  64   LQLAYSVEGETDATGTYNILVEDDHEDQICESVLVSSPVNDCKSADPGRKRANVVVTRYN  123

Query  267  GMKSDIRHANPLFFMKDLADERCSKVLEE  181
            G+  D  +AN + F KD     C ++L++
Sbjct  124  GVVKDKHYANNMGFFKDQPLAGCEELLKQ  152



>ref|XP_009109686.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX90169.1| BnaA08g18150D [Brassica napus]
Length=171

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 95/162 (59%), Gaps = 9/162 (6%)
 Frame = -2

Query  627  VALISAFC---ILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            V L SA C   +L  A       ++F++ G VYCDTCRVQF TR+S+ ++ A V+LEC+ 
Sbjct  7    VFLASALCFTTLLHFAAADADDLDRFHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKA  66

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE----KAI  289
             +N+T+T + E  T  DG Y + V GDHE ++C + +V+SP  +C E V   E     A 
Sbjct  67   RENQTVTLTKEAVTDKDGKYEMVVMGDHEEEVCEIILVESPDAECGE-VNNQEFLRNAAR  125

Query  288  VVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            +  TAN G+ S ++R  NPL FM+      C +V +E+  +P
Sbjct  126  ISLTANDGIVSNEVRTINPLGFMRKTPLADCPQVFKELGIVP  167



>gb|KFK44745.1| hypothetical protein AALP_AA1G297400 [Arabis alpina]
Length=171

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 97/163 (60%), Gaps = 11/163 (7%)
 Frame = -2

Query  627  VALISAFC---ILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            V L SA C   +L  A       ++F++ G VYCDTCRVQF TR+S+ ++ A V+LEC+ 
Sbjct  7    VFLASALCFTTLLHFAAADADDFDRFHIKGSVYCDTCRVQFVTRVSKFLEGAKVKLECKG  66

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDC-----KETVKGLEKA  292
             +N+T+T + E  T   GNY + V GDHE ++C + +V+SP  +C     +E ++    A
Sbjct  67   RENQTVTLTKEAVTDNAGNYQMEVMGDHEEEVCEIVLVQSPDPECGDINNQEFLRN--AA  124

Query  291  IVVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
             +  TAN G+ S + R  NPL FM+    E CS+V +E+  +P
Sbjct  125  RISLTANDGIVSNETRTINPLGFMRKNPLEDCSQVFKELGIVP  167



>ref|XP_007149397.1| hypothetical protein PHAVU_005G066800g [Phaseolus vulgaris]
 gb|ESW21391.1| hypothetical protein PHAVU_005G066800g [Phaseolus vulgaris]
Length=162

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 91/157 (58%), Gaps = 5/157 (3%)
 Frame = -2

Query  639  MARAVALISAF--CILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLE  466
            MAR+ A+++ F   +   + +A  +PEKF V GK+YCD C+  FE+R+S ++    V L+
Sbjct  1    MARSFAVVALFVSAVCFSSALARKSPEKFFVEGKIYCDPCQFAFESRLSFALSGVNVTLK  60

Query  465  CRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPRE-DCKETVKGLEKAI  289
            C   +N  ++Y     T A+G Y++ V GDHE ++CVV V   P E  CKE +      I
Sbjct  61   CIKEENDIVSYQKNSTTDANGMYSIPVHGDHEEEICVV-VADPPNEGQCKEAMPNKSDRI  119

Query  288  VVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            ++ T N+G  S  R+ NPL FM    D +C  V++E+
Sbjct  120  IL-TKNMGAASMTRYVNPLGFMTQTTDSQCFAVVQEL  155



>gb|KFK31513.1| hypothetical protein AALP_AA6G122400 [Arabis alpina]
Length=173

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 95/173 (55%), Gaps = 7/173 (4%)
 Frame = -2

Query  651  LHTKMARAVALISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDA  481
            + +K   +  ++SA C+ +LAG A    +   +F + G VYCDTCRVQF TR+S+ ++ A
Sbjct  1    MASKAIFSFFVVSAVCLSSLAGFASADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGA  60

Query  480  AVRLECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL  301
             V+LECR+  N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  +  
Sbjct  61   KVKLECRSRTNGTITLTKEAVTDKTGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSQEA  120

Query  300  ---EKAIVVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
                 A +  TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  121  YLRNAAKISLTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVPDVTF  173



>gb|AFK42345.1| unknown [Lotus japonicus]
Length=164

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 90/159 (57%), Gaps = 7/159 (4%)
 Frame = -2

Query  639  MARAVA----LISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVR  472
            MAR+ A    L+SAFC  ++        +KF VVGK+YCD C  +FE+R+S  ++   + 
Sbjct  1    MARSFAVVALLVSAFCFSSVLARVGPVDDKFVVVGKIYCDPCHFEFESRLSHPLEGVKIT  60

Query  471  LECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKA  292
            LEC+  D   +T++ E  T  +G Y LT DGDHE ++C V    + + +C  T+  + K 
Sbjct  61   LECKKADTNNVTFTTEAVTDKNGVYTLTCDGDHEEEVCEVNTDANTKGEC--TIPMVNKF  118

Query  291  -IVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
              +V T N+G+ S  R+ NPL FM      +C  V++E+
Sbjct  119  DRIVLTRNMGVSSLTRYVNPLGFMTKAIHSQCGNVVQEL  157



>dbj|BAJ86956.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=169

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 78/138 (57%), Gaps = 3/138 (2%)
 Frame = -2

Query  579  HCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGN  400
            H  P +F V G+V+CDTCR  FET  S  I  A VR+EC++      T S EG T   G 
Sbjct  29   HLHPTQFVVRGRVWCDTCRAGFETPASTFIAGAKVRVECKSRSTGAQTCSFEGHTDHTGT  88

Query  399  YNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMK  220
            YN+ VD +HE ++C   +V SP   C + V G E+A V    N G+ S++R AN L F K
Sbjct  89   YNIPVDDEHEHELCESVLVSSPDTACAKAVAGRERAPVFLNNNNGVASNVRLANALGFEK  148

Query  219  DLADERCSKVL---EEID  175
            D     C+++L   EE+D
Sbjct  149  DTPLAACAQILKMYEEVD  166



>emb|CDX77620.1| BnaC07g18740D [Brassica napus]
Length=174

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 88/159 (55%), Gaps = 7/159 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPEKFNVV---GKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++S  C+ +LAG      + F++    G VYCDTCRVQF TR+SQ ++ A V+LECR+  
Sbjct  12   IVSTVCLSSLAGFTAADADDFDIFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N TLT + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  72   NGTLTLTKEAVTDKSGSYKIEVTGDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            TAN G+ S + R  NPL FM       C    +E+  +P
Sbjct  132  TANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP  170



>ref|XP_010321468.1| PREDICTED: LOW QUALITY PROTEIN: major pollen allergen Lol p 11-like 
[Solanum lycopersicum]
Length=162

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 91/162 (56%), Gaps = 3/162 (2%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAP--EKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLE  466
            MA+ + L    C++  A I   A   + F V+GKVYCDTCR  +ET  S+ +  + VR+E
Sbjct  1    MAKMIFLF-VVCLVLFASINVSANFMDTFLVIGKVYCDTCRCGYETSASKYLPGSRVRIE  59

Query  465  CRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIV  286
            C+N D   L Y++EG T + G Y + V+ D   + C V +++S    C E   G ++  V
Sbjct  60   CKNRDTNDLAYTVEGVTNSKGEYKILVNSDRRDEFCDVVLIRSSDPMCAEPNTGRDRTRV  119

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQ  160
            V T+N GM S+ R AN L F+ +     C+K+L++ +F   Q
Sbjct  120  VLTSNNGMVSNTRFANSLGFLYNEPLASCTKILKQYEFSEDQ  161



>ref|XP_009136942.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY53995.1| BnaA03g58200D [Brassica napus]
Length=171

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 90/159 (57%), Gaps = 7/159 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             +SA C+ +LAG+A+   +    F + G VYCDTCRVQF TR+SQ ++ A V+LECR+  
Sbjct  9    FVSAVCLSSLAGVANADADDFDSFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRT  68

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKGLEKAI-VVC  280
            N T+T + E  T   G+Y + V GDHE ++C + ++ SP   C +  T   L  A  V  
Sbjct  69   NGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLLHSPDSGCSDVSTEAYLRNAAKVSL  128

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            TAN G+ S + R  NPL FM       C    +E+  +P
Sbjct  129  TANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP  167



>ref|NP_174209.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAF88123.1|AC021043_16 Similar to major allergen OLE5c [Arabidopsis thaliana]
 gb|AEE31049.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=171

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 93/166 (56%), Gaps = 9/166 (5%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            V L SA C   L        +   KF++ G VYCDTCRVQF TRIS+ ++ A V+LEC+ 
Sbjct  7    VFLASALCFTTLVHFTAADADDFDKFHIKGSVYCDTCRVQFITRISKFLEGAKVKLECKG  66

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE----KAI  289
             +N+T+T + E  T   GNY + V GDHE ++C + +++SP  +C + V   E     A 
Sbjct  67   RENQTVTLTKEAVTDNAGNYQMEVMGDHEEEVCEIVLLQSPDPECGD-VNNQEFLRNAAR  125

Query  288  VVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            +  TAN G+ S + R  NPL FM+      C +V +E+  +P  T 
Sbjct  126  ISLTANDGIVSNETRTINPLGFMRKTPLAECPQVFKELGIVPDVTF  171



>ref|XP_009764546.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Nicotiana sylvestris]
Length=161

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 87/160 (54%), Gaps = 0/160 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MAR +A  +   + A    A      F V GK YCDTCR  FET  ++ +  A VR+ECR
Sbjct  1    MARLIAFFTLCLLSASVASATFTGNPFLVKGKAYCDTCRCGFETPATKYLAGAKVRIECR  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +   +  TY++EG T + G YN+ V+ D   D C V +VKSP   C +   G +++ V+ 
Sbjct  61   HRVIEASTYTVEGVTNSKGEYNILVNSDRGDDACDVILVKSPDRTCTKPNAGRDRSRVIL  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQ  160
            T N GM S+ R AN + F++D     C+++L++      Q
Sbjct  121  TRNNGMISNTRFANAMGFLRDEPLSSCTQILQQYQLTDDQ  160



>ref|XP_010499433.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 94/166 (57%), Gaps = 9/166 (5%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            V L SA C   L   A    +   +F++ G VYCDTCRVQF TR+S+ ++ A V+LEC+ 
Sbjct  7    VFLASAICFTTLVNFAAADADDFDRFHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKG  66

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE----KAI  289
             +N+T+T + E  T + GNY + V GDHE ++C + +V+SP  +C E V   E     A 
Sbjct  67   RENQTVTLTKEAVTDSAGNYQMEVMGDHEEELCEIVLVQSPDPECGE-VNNQEFLRNAAR  125

Query  288  VVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            +  TAN G+ S + R  NPL FM+      C +  +E+  +P  T 
Sbjct  126  ISLTANDGIVSNETRTINPLGFMRKTPLADCPQAFKELGIVPDVTF  171



>emb|CDY43319.1| BnaC03g58910D [Brassica napus]
Length=171

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 95/162 (59%), Gaps = 9/162 (6%)
 Frame = -2

Query  627  VALISAFC---ILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            V L SA C   +L  A       ++F++ G VYCDTCRVQF TR+S+ ++ A V+LEC+ 
Sbjct  7    VFLASALCFTTLLHFAAADADDLDRFHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKG  66

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE----KAI  289
             +N+T+T + E  T  +G Y + V GDHE ++C + +V+SP  +C E V   E     A 
Sbjct  67   RENQTVTLTKEAVTDKEGKYEMVVMGDHEEEVCEIILVESPDAECGE-VNNQEFLRNAAR  125

Query  288  VVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            +  TAN G+ S ++R  NPL FM+      C +V +E+  +P
Sbjct  126  ISLTANDGIVSNEVRTINPLGFMRKTPLADCPQVFKELGIVP  167



>ref|XP_006414083.1| hypothetical protein EUTSA_v10026398mg [Eutrema salsugineum]
 gb|ESQ55536.1| hypothetical protein EUTSA_v10026398mg [Eutrema salsugineum]
Length=172

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 91/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             +SA C+ +LAG A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  10   FVSAVCLSSLAGKALADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRA  69

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  70   NGTVTLTKEAVTDKSGSYRMEVTGDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISL  129

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C+   +E+  +P  T 
Sbjct  130  TANDGIVSHETRIVNPLGFMVKTPLADCAAAFKELGIVPDVTF  172



>ref|XP_009402012.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = -2

Query  564  KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTV  385
            KF + G+VYCDTCR  F+T +SQ I  A V+L+CRN +   + + +E  T + G Y++ V
Sbjct  26   KFVIEGRVYCDTCRAGFQTAVSQYIAGAKVKLQCRNYETDAVEHLVEAVTDSTGTYHIEV  85

Query  384  DGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKD  217
            +  HE ++C V++++SP+  C E  +   +A ++ T   G+ SDIR+AN L F+KD
Sbjct  86   EDSHEEEICEVSLLQSPQPGCTEVAQSRNRARILVTGRSGLASDIRYANSLGFLKD  141



>ref|XP_008775180.1| PREDICTED: pollen-specific protein C13-like [Phoenix dactylifera]
Length=168

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 96/156 (62%), Gaps = 6/156 (4%)
 Frame = -2

Query  636  ARAVALISAFCIL-ALAGIAHCAP-EKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            A+   +++A C++ AL GIA   P   F+V G+VYCDTCR  F    ++ ++ A VRLEC
Sbjct  3    AKFRPVLAALCLISALLGIADTTPTPTFHVRGRVYCDTCRAGFVHEYTEYLEGAKVRLEC  62

Query  462  RNLDNKTLTY-SMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETV--KGLEKA  292
            ++  +  + + S E  T  +GNY + +  DH+ + C V +V+SPR+DCKE     G+ +A
Sbjct  63   KHYGSGEIAHRSEEAVTDGNGNYVIDITDDHQEETCEVVLVESPRDDCKEIPADHGI-RA  121

Query  291  IVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLE  184
             V+ T+N G+ S+ R ANP+ F++D    +C  +L+
Sbjct  122  RVMLTSNNGISSEWREANPIGFLRDAPLPKCGAMLQ  157



>ref|XP_004489034.1| PREDICTED: olee1-like protein-like [Cicer arietinum]
Length=166

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 89/161 (55%), Gaps = 9/161 (6%)
 Frame = -2

Query  639  MARAVA----LISAFCILALAGIAHCAP---EKFNVVGKVYCDTCRVQFETRISQSIKDA  481
            MAR+      ++S FC  ++   A  AP   E F+VVGK+YCD C  +FE+R+SQ ++  
Sbjct  1    MARSFVVVAIIVSTFCFSSVLA-ARKAPTGVEIFSVVGKIYCDPCHFEFESRLSQPLEGV  59

Query  480  AVRLECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL  301
             V L+CR  D+  +TY  E  T  +G Y + VDGDHE ++C V    + +  C + +   
Sbjct  60   KVTLKCRKGDSNNVTYVKESRTDINGVYKINVDGDHEEEVCEVNADATGKGACSQVMANK  119

Query  300  EKAIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
               IV+ T N+G+ S +R  NPL FM    D +C  V  E+
Sbjct  120  SDRIVL-TKNMGVSSLVRFVNPLGFMTQAIDSQCGNVFSEL  159



>ref|XP_002533139.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF29251.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=161

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 85/156 (54%), Gaps = 2/156 (1%)
 Frame = -2

Query  639  MARAVALISAF--CILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLE  466
            MAR + L  A   C+L     A      F++ G+VYCDTCR  FET+ +  I  A VR+E
Sbjct  1    MARQLVLFFALSLCVLPSLVSARLVGRPFHIKGRVYCDTCRCGFETKKTTYIPGARVRIE  60

Query  465  CRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIV  286
            C +     L YS+EG T   G YN+ V+ DH+  +C   +V SP   C     G  +A V
Sbjct  61   CEDRTTLRLKYSVEGETDETGTYNILVEDDHQDQICYAALVSSPWPSCNTADPGRSRAHV  120

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            V T N G  SD+  AN + F+++ A   C+++++++
Sbjct  121  VVTRNNGAISDLHFANSMGFLRNQAMSGCTELVKQL  156



>ref|XP_009132011.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX78874.1| BnaA01g09410D [Brassica napus]
Length=172

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 89/159 (56%), Gaps = 7/159 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             +SA C+ +LAG A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  10   FVSAVCLSSLAGKAVADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  69

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +++SP   C +  K       A V  
Sbjct  70   NGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLLQSPDSGCSDVSKEAYLRNAAKVSL  129

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            TAN G+ S + R  NPL FM       C    +E+  +P
Sbjct  130  TANDGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVP  168



>ref|XP_009366359.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Pyrus x bretschneideri]
Length=162

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F+V G+VYCDTCR  FET  +  I  A VR+EC++ +   L YS+EG T + G YN+ ++
Sbjct  28   FHVQGRVYCDTCRCGFETTATNYISGARVRIECKDRNTLQLAYSVEGETDSTGTYNILIE  87

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADER  202
             DHE  +C   +V SP  DCK    G  +A VV T   G+  D R+AN + F KD     
Sbjct  88   EDHEDQICKSVLVSSPISDCKSADPGRSRANVVVTRYNGVVKDKRYANNMGFFKDEPLAD  147

Query  201  CSKVLEE  181
            C K+LE+
Sbjct  148  CEKILEQ  154



>ref|XP_009101556.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=174

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 88/159 (55%), Gaps = 7/159 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPEKFNVV---GKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++S  C+ +LAG      + F++    G VYCDTCRVQF TR+SQ ++ A V+LECR+  
Sbjct  12   IVSTVCLSSLAGFTAADADDFDIFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N TLT + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  72   NGTLTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVQSPDIGCSDVSKEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            TAN G+ S + R  NPL FM       C    +E+  +P
Sbjct  132  TANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP  170



>ref|XP_010460686.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 93/166 (56%), Gaps = 9/166 (5%)
 Frame = -2

Query  627  VALISAFCILALA---GIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            V L SA C   L           ++F++ G VYCDTCRVQF TR+S+ ++ A V+LEC+ 
Sbjct  7    VFLASAICFTTLVHFAAADADDFDRFHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKG  66

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE----KAI  289
             +N+T+T + E  T + GNY + V GDHE ++C + +V+SP  +C E V   E     A 
Sbjct  67   RENQTVTLTKEAVTDSAGNYQMEVMGDHEEELCEIVLVQSPDPECGE-VNNQEFLRNAAR  125

Query  288  VVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            +  TAN G+ S + R  NPL FM+      C +  +E+  +P  T 
Sbjct  126  ISLTANDGIVSNETRTINPLGFMRKTPLADCPQAFKELGIVPDVTF  171



>ref|XP_008234009.1| PREDICTED: pollen-specific protein C13 [Prunus mume]
Length=159

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 85/155 (55%), Gaps = 2/155 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+ + L  A C+L ALA         F V GKVYCDTCR  FET  +  I  A VRLEC
Sbjct  1    MAKLIVLF-ALCVLPALAVATRPMRTPFTVEGKVYCDTCRAGFETSATTYIPGATVRLEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+     + Y+ EG T + G Y + V  DHE   C   +V S ++DC     G ++A V+
Sbjct  60   RDRKTMDIRYTKEGRTDSTGTYKIPVTEDHEDQFCDAVLVSSSQKDCAAAAPGRDRARVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
             T   G+ S  R AN + FMK+ A   C+++L+++
Sbjct  120  LTGYNGIASYNRFANAMGFMKNEAVPGCAQILKQL  154



>ref|XP_002870034.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH46293.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=173

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 90/163 (55%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             +SA C+ +LA +A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  11   FVSAVCLSSLARVAIADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  70

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  71   NGTVTLTKEAVTDKTGSYRMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISL  130

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  131  TANDGIVSHETRIVNPLGFMVKTPSPECPAAFKELGIVPDVTF  173



>ref|XP_002447728.1| hypothetical protein SORBIDRAFT_06g014740 [Sorghum bicolor]
 gb|EES12056.1| hypothetical protein SORBIDRAFT_06g014740 [Sorghum bicolor]
Length=173

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 81/129 (63%), Gaps = 0/129 (0%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            + + G+VYCDTCR  F T +++ +  A VRLEC++     +  +++G T A G Y + + 
Sbjct  38   YVIQGRVYCDTCRAGFVTNVTEYMAGAKVRLECKHFGTGEVERAIDGVTDATGTYTIELK  97

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADER  202
              HE D+C V +V+SPR+DC +T    ++A V+ T NVG+   +R ANPL + KD+    
Sbjct  98   DSHEEDICQVVLVQSPRKDCDQTQPLRDRAGVLLTRNVGIADSLRPANPLGYFKDVPLPV  157

Query  201  CSKVLEEID  175
            C+ +L+++D
Sbjct  158  CAALLKQLD  166



>ref|XP_010478273.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 93/166 (56%), Gaps = 9/166 (5%)
 Frame = -2

Query  627  VALISAFCILALA---GIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            V L SA C   L           ++F++ G VYCDTCRVQF TR+S+ ++ A V+LEC+ 
Sbjct  7    VFLASAICFTTLVHFAAADADDFDRFHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKG  66

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE----KAI  289
             +N+T+T + E  T + GNY + V GDHE ++C + +V+SP  +C E V   E     A 
Sbjct  67   RENQTVTLTKEAVTDSAGNYEMEVMGDHEEELCEIVLVQSPDPECGE-VNNQEFLRNAAR  125

Query  288  VVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            +  TAN G+ S + R  NPL FM+      C +  +E+  +P  T 
Sbjct  126  ISLTANDGIVSNETRTINPLGFMRKTPLADCPQAFKELGIVPDVTF  171



>ref|XP_002301038.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK93129.1| unknown [Populus trichocarpa]
 gb|ABK94485.1| unknown [Populus trichocarpa]
 gb|ABK95752.1| unknown [Populus trichocarpa]
 gb|EEE80311.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 88/159 (55%), Gaps = 5/159 (3%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MAR   L+ A C+L AL   A      F+V G VYCDTC   FET  +  I  + V++EC
Sbjct  1    MARVFMLL-ALCVLPALVSAARPGRNPFSVQGLVYCDTCLAGFETPKTTYIAGSKVKVEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+   + L YS EG T + G Y +TVD DH+  +C   +V SPR+DC     G ++A V+
Sbjct  60   RDRKTQDLVYSKEGTTDSTGKYIITVDEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVL---EEID  175
             T+  G+ S  R+AN + FM       C+++L   +E D
Sbjct  120  LTSYNGLVSTTRYANSMGFMAAQPMSGCTELLRSYQEFD  158



>gb|ABK94215.1| unknown [Populus trichocarpa]
Length=159

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 88/159 (55%), Gaps = 5/159 (3%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MAR   L+ A C+L AL   A      F+V G VYCDTC   FET  +  I  + V++EC
Sbjct  1    MARVFMLL-ALCVLPALVSAARPGRNPFSVQGIVYCDTCLAGFETPKTTYIAGSKVKVEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+   + L YS EG T + G Y +TVD DH+  +C   +V SPR+DC     G ++A V+
Sbjct  60   RDRKTQDLVYSKEGTTDSTGKYIITVDEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVL---EEID  175
             T+  G+ S  R+AN + FM       C+++L   +E D
Sbjct  120  LTSYNGLVSTTRYANSMGFMAAQPMSGCTELLRSYQEFD  158



>gb|ABK92993.1| unknown [Populus trichocarpa]
Length=159

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 88/159 (55%), Gaps = 5/159 (3%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MAR   L+ A C+L AL   A      F+V G VYCDTC   FET  +  I  + V++EC
Sbjct  1    MARVFMLL-ALCVLPALVSAARPGRNTFSVQGLVYCDTCLAGFETPKTTYIAGSKVKVEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+   + L YS EG T + G Y +TVD DH+  +C   +V SPR+DC     G ++A V+
Sbjct  60   RDRKTQDLVYSKEGTTDSTGKYIITVDEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVL---EEID  175
             T+  G+ S  R+AN + FM       C+++L   +E D
Sbjct  120  LTSYNGLVSTTRYANSMGFMAAQPMSGCTELLRSYQEFD  158



>ref|NP_001235303.1| uncharacterized protein LOC100306199 precursor [Glycine max]
 gb|ACU14266.1| unknown [Glycine max]
Length=165

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 89/156 (57%), Gaps = 4/156 (3%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
             A     +SA C  ++      A +KF V GK+YCD C   FE+R+S  ++   V L+C 
Sbjct  5    FAVVALFVSALCFSSILARKTPALDKFFVEGKIYCDPCHFAFESRLSFPLEGVKVSLQCL  64

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPRE-DCKETVKGLEKAIVV  283
              +N T+TY  EG T A+G Y++ V GDHE ++C+V V  SP E  CKE +      IV+
Sbjct  65   RSENDTVTYVKEGKTDANGQYSIPVHGDHEEEICIV-VADSPTEGQCKEAMPNKSDRIVL  123

Query  282  CTANVGMKSDIRHANPLFFMKDLAD-ERCSKVLEEI  178
             T N+G+ S  R+ NPL FM    D  +C+ V++E+
Sbjct  124  -TKNMGVSSMARYVNPLGFMTQGIDATQCNLVVQEL  158



>ref|XP_008245042.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 80/149 (54%), Gaps = 0/149 (0%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDN  448
            V L+ A C+L     A      F++ G+VYCDTCR  FET  +  I  A VR+EC+  + 
Sbjct  6    VLLLFALCVLPGLVSARTLGNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNT  65

Query  447  KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANV  268
              L YS+EG T   G YN+ V+ DHE  +C   +V SP  DCK    G  +A VV T   
Sbjct  66   LQLAYSVEGETDTTGTYNILVEDDHEDQICESVLVSSPVNDCKSADPGRNRANVVVTRYN  125

Query  267  GMKSDIRHANPLFFMKDLADERCSKVLEE  181
            G+  D  +AN + F KD     C ++L++
Sbjct  126  GVVKDKHYANNMGFFKDQPLAGCEELLKQ  154



>ref|XP_004983223.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=170

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F V G+V+CDTCR  FET +S  I  A VR+ECR+      + + EG T   G YN+ V 
Sbjct  36   FVVRGRVWCDTCRAGFETPVSTYIAGAKVRVECRSKTTGLKSCTYEGHTDRTGTYNILVT  95

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADER  202
             +HE ++C   ++ SP   C  TV G E+A V  T+N G+ S++R AN L F KD+A  R
Sbjct  96   DEHEDELCESVLISSPDMRCATTVPGRERAPVFLTSNNGVASNVRMANALGFQKDVALPR  155

Query  201  CSKVLE  184
            C++VL+
Sbjct  156  CAQVLK  161



>ref|XP_006304746.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
 gb|EOA37644.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
Length=171

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 92/166 (55%), Gaps = 9/166 (5%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            V L SA C   L        +   +F++ G VYCDTCRVQF TR+S+ ++ A V+LEC+ 
Sbjct  7    VFLASALCFTTLVHFTAADADDFDRFHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKG  66

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE----KAI  289
             +N+T+T + E  T   GNY + V GDHE ++C + +++SP  +C E V   E     A 
Sbjct  67   RENQTVTLTKEAVTDKAGNYQMEVMGDHEEEVCEIVLLQSPDAECGE-VNNQEFLRNAAR  125

Query  288  VVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            +  TAN G+ S + R  NPL FM+      C +  +E+  +P  T 
Sbjct  126  ISLTANDGIVSNETRTINPLGFMRKTPLAECPQAFKELGIVPDVTF  171



>ref|XP_009797814.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana sylvestris]
Length=161

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 88/161 (55%), Gaps = 2/161 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCA-PEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+ VAL    C L  A IA     + F VVGKVYCDTCR  FET  S+ +  + VR+EC
Sbjct  1    MAKLVALF-VVCFLVFASIASAHFMDTFLVVGKVYCDTCRCGFETSASKYLAGSRVRIEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            +  D   ++Y++EG T + G Y + V  D   ++C V +++S    C     G ++A VV
Sbjct  60   KKRDTNDVSYTIEGVTNSKGEYKILVYSDRGDEVCDVVLIRSSDPMCATPAAGRDRARVV  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQ  160
             T N GM S+ R AN + F+ D     C+++L++      Q
Sbjct  120  LTRNNGMISNTRFANSIGFLSDEPLASCNQILQQYQLTEDQ  160



>ref|XP_006398273.1| hypothetical protein EUTSA_v10001051mg [Eutrema salsugineum]
 gb|ESQ39726.1| hypothetical protein EUTSA_v10001051mg [Eutrema salsugineum]
Length=174

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 91/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            +++A C+ +LAG A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  12   VVAAVCLSSLAGFAAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N TLT + E  T   G+Y + V GDHE ++C + +V+SP   C    K       A +  
Sbjct  72   NGTLTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVQSPDSGCSNVSKEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C+   +E+  +P  T 
Sbjct  132  TANDGIVSHETRIVNPLGFMVKTPLADCAAAFKELGIVPDVTF  174



>ref|XP_002268073.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CBI33037.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 87/153 (57%), Gaps = 0/153 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+ +  I+   +L     A    + F + G+VYCDTCR  FET  +  I  A VR+EC+
Sbjct  1    MAKLLMSIALCLLLVYVSEARPMRKPFVLHGRVYCDTCRAGFETSATTYIAGARVRIECK  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            + ++  L YS+EG T + G Y  ++  DH   MC   +VKSP+ DC +   G +++ +  
Sbjct  61   DRNSLQLVYSVEGVTDSTGTYKFSIADDHGDQMCDAVLVKSPQPDCAKVDAGRDRSRLSL  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
            T + G+ SD R AN + FMKD     C+++L++
Sbjct  121  TRSNGLVSDTRFANAMGFMKDEPASGCTQLLKQ  153



>emb|CDY69202.1| BnaCnng62360D [Brassica napus]
Length=171

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 98/172 (57%), Gaps = 11/172 (6%)
 Frame = -2

Query  639  MARAVA--LISAFC---ILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAV  475
            MA+ V   L SA C   +L  A       ++F++ G VYCDTCRVQF TR+S+ ++ A V
Sbjct  1    MAKLVIFFLASALCFTTLLHFAAADADDFDRFHIKGSVYCDTCRVQFMTRLSKVLEGAKV  60

Query  474  RLECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE-  298
            +LEC+  +N+T+T + E  T  DGNY + V GDHE ++C + +V+SP  +C + V   E 
Sbjct  61   KLECKGRENQTVTLTKEAMTDKDGNYEMEVMGDHEEEVCEIILVQSPDAECGD-VNNQEF  119

Query  297  ---KAIVVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
                A +  TAN G+ S + R  NPL FM+      C +  +E+  +P  T 
Sbjct  120  LRNAARISLTANDGIVSNETRTINPLGFMRKTPLADCPQAFKELGIVPDVTF  171



>ref|XP_006281481.1| hypothetical protein CARUB_v10027565mg [Capsella rubella]
 gb|EOA14379.1| hypothetical protein CARUB_v10027565mg [Capsella rubella]
Length=174

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 91/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++SA C+ +LAG A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  12   IVSAICLSSLAGFAAADADDSDRFQIQGSVYCDTCRVQFITRLSKFLEGAKVKLECRSRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  72   NGTVTLTKEAVTDKTGSYMMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  132  TANDGIVSHETRIVNPLGFMVMTPSADCPAAFKELGIVPDVTF  174



>ref|XP_002863445.1| hypothetical protein ARALYDRAFT_494394 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39704.1| hypothetical protein ARALYDRAFT_494394 [Arabidopsis lyrata subsp. 
lyrata]
Length=174

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 91/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++SA C+ +LAG A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  12   VVSAVCLSSLAGFAAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  72   NGTVTLTKEAVTDKTGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  132  TANDGIVSHETRIVNPLGFMVQTPLADCPAAFKELGIVPDVTF  174



>gb|KHN36879.1| Olee1-like protein [Glycine soja]
Length=165

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 89/156 (57%), Gaps = 4/156 (3%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
             A     +SA C  ++      A +KF V GK+YCD C   FE+R+S  ++   V L+C 
Sbjct  5    FAVVALFVSALCFSSILARKTPALDKFFVEGKIYCDPCHFAFESRLSFPLEGVKVSLQCL  64

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPRE-DCKETVKGLEKAIVV  283
              +N T+TY  EG T A+G Y++ V GDHE ++C+V V  SP E  CKE +      IV+
Sbjct  65   RSENDTVTYVKEGKTDANGQYSIPVHGDHEDEICIV-VADSPTEGQCKEAMPNKSDRIVL  123

Query  282  CTANVGMKSDIRHANPLFFMKDLAD-ERCSKVLEEI  178
             T N+G+ S  R+ NPL FM    D  +C+ V++E+
Sbjct  124  -TKNMGVSSMARYVNPLGFMTQGIDATQCNLVVQEL  158



>ref|XP_009102877.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY15649.1| BnaA07g08200D [Brassica napus]
Length=171

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 86/142 (61%), Gaps = 6/142 (4%)
 Frame = -2

Query  564  KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTV  385
            +F++ G VYCDTCRVQF TR+S+ ++ A V+LEC+  +N+T+T + E  T  DGNY + V
Sbjct  31   RFHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAMTDKDGNYEMEV  90

Query  384  DGDHERDMCVVTVVKSPREDCKETVKGLE----KAIVVCTANVGMKS-DIRHANPLFFMK  220
             GDHE ++C + +V+SP  +C + V   E     A +  TAN G+ S + R  NPL FM+
Sbjct  91   MGDHEEEVCEIILVQSPDAECGD-VNNQEFLRNAARISLTANDGIVSNETRTINPLGFMR  149

Query  219  DLADERCSKVLEEIDFLPGQTM  154
                  C +  +E+  +P  T 
Sbjct  150  KTPLADCPQAFKELGIVPDVTF  171



>ref|XP_009128814.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY06029.1| BnaA09g37510D [Brassica napus]
Length=174

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 89/163 (55%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPEK---FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++S  C+ +LAG A    +    F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  12   VVSTVCLFSLAGFAAADADDFDLFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N TLT + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  72   NGTLTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  132  TANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVPDVTF  174



>gb|AAF16869.1|AF109693_1 allergen-like protein BRSn20 [Sambucus nigra]
Length=159

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 85/153 (56%), Gaps = 1/153 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MAR + L+ A   L L   A      F + G VYCDTCR  FET  ++ +  A VR+EC+
Sbjct  1    MARLILLV-ALSFLPLLTSARLIGNPFLLKGSVYCDTCRAGFETDATKYLHGARVRIECK  59

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            + D   LTYS E  T + G Y++ V  DH   MC   +V SP  +C    KG ++A V+ 
Sbjct  60   DRDTLRLTYSDEAVTDSKGKYSVLVSDDHGDQMCDAILVSSPDPECAVPDKGRDRACVIL  119

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
            T + GM SD R AN + F+K+     C+++L++
Sbjct  120  TRSNGMTSDERFANAMGFLKNEPMAGCTQILQK  152



>ref|XP_003566418.1| PREDICTED: major pollen allergen Lol p 11-like [Brachypodium 
distachyon]
Length=169

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 75/132 (57%), Gaps = 1/132 (1%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F V G+VYCDTCR  FET  S SI  A V++ECR+ +   L +  E  T A G Y + V 
Sbjct  31   FLVTGRVYCDTCRAGFETNASHSIPGAVVQMECRHFETNELHHKAEATTDAQGWYKMEVG  90

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMK-SDIRHANPLFFMKDLADE  205
             DH+ ++C V +++SP +DC E  K  ++  V  T N G+K S +R+ANP+ F +     
Sbjct  91   EDHQEEICEVALLRSPEKDCAEIEKSRDRCRVPLTRNNGIKQSGVRYANPIAFFRKEPLA  150

Query  204  RCSKVLEEIDFL  169
             C  VL + D  
Sbjct  151  NCGDVLRKYDLY  162



>ref|XP_011097595.1| PREDICTED: major pollen allergen Lol p 11-like [Sesamum indicum]
Length=159

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 86/153 (56%), Gaps = 0/153 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+ + ++ A C++     A  A +   + G VYCDTCR  +ET  ++ +  A VR+ECR
Sbjct  1    MAKFLLVLFALCVVPSIVTARFANDPLLLTGCVYCDTCRCGYETSATKYLAGAVVRVECR  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
              D+  LTY+ E  T + G+Y + V+ D   D C   +VKSP  +C     G ++A V+ 
Sbjct  61   KRDSSELTYTKEAVTDSTGHYKILVETDRGDDYCDSVLVKSPDPECSIPNAGRDRARVIL  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
            T N GM S+ R AN L F+K+     C +VL++
Sbjct  121  TRNNGMNSNARFANALGFLKNTPLASCPQVLQQ  153



>ref|XP_009108374.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY34057.1| BnaC03g62750D [Brassica napus]
 emb|CDX76511.1| BnaA08g08890D [Brassica napus]
Length=171

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 89/163 (55%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPEKFN---VVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             +SA C+ +LAG A    + F+   + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  9    FVSALCLSSLAGKAMADADDFDSFKIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  68

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+  + E  T   G+Y + V GDHE ++C + +++SP   C +  +       A V  
Sbjct  69   NGTVALTKEAVTDKSGSYTMEVTGDHEEEVCELVLLQSPDSACSDVSQDAYLRNAAKVSL  128

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  129  TANDGIVSHETRIVNPLGFMVKTPSAECPAAFKELGIVPDVTF  171



>ref|XP_002310579.1| hypothetical protein POPTR_0007s05750g [Populus trichocarpa]
 gb|EEE91029.1| hypothetical protein POPTR_0007s05750g [Populus trichocarpa]
Length=158

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 90/155 (58%), Gaps = 3/155 (2%)
 Frame = -2

Query  639  MARAVALISAFCILALAGI-AHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MAR   L+ A C+L+   + A      F V G+VYCDTC+  FET+ +  + DA VR+EC
Sbjct  1    MARL--LLFALCVLSSVLVSAWSMGNPFYVRGRVYCDTCQCGFETKKTTYVPDARVRIEC  58

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+  +  L YS+EG T + G Y + V+GD    +C V +V SP  DCK        A V+
Sbjct  59   RDRTDLQLRYSVEGVTDSTGTYKIKVEGDQADRLCHVVLVDSPLADCKTVDTARNGAEVI  118

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
             T + G  SD+ +AN L F+KD A   C+++++++
Sbjct  119  LTRSNGAISDLHYANSLGFVKDKALPGCAELVKQL  153



>ref|XP_010538956.1| PREDICTED: major pollen allergen Lol p 11 [Tarenaya hassleriana]
Length=159

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 84/153 (55%), Gaps = 0/153 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA ++ L++   +  L   A      F V G+VYCDTCR  FET  S  I  A V+LEC+
Sbjct  1    MANSIVLMAILLLPTLVMAARPNRNPFVVRGRVYCDTCRAGFETPASTYIPGAVVKLECK  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +  +  L YS E  T + G Y + V+ DHE  +C + +VKSP+  C +   G E+A V  
Sbjct  61   DRRSMELVYSHEARTDSTGAYKIWVNEDHEDQLCDIMLVKSPQLGCSKVSHGRERARVTL  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
            T   G+ SD R+ N + F +D A   CS+++ +
Sbjct  121  TRYNGIASDDRYVNNMGFERDEALSGCSEIMRQ  153



>dbj|BAK06698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 86/154 (56%), Gaps = 5/154 (3%)
 Frame = -2

Query  633  RAVALISAFCILALAGIA----HCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLE  466
            R +++I+   I ALA  A       P+ + V G+VYCDTCR  FET +++ IK A VRLE
Sbjct  5    RILSVIAVVAIFALADTAVANDRDLPD-YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLE  63

Query  465  CRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIV  286
            CR      L  S++G T   G Y + +   H  D+C + +V+SP  +C E      +A +
Sbjct  64   CRRFGTDKLERSIDGVTDESGTYKIELKDSHPEDICEMVLVQSPLPNCNEIQALRNRAEI  123

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLE  184
            V + NVG+  +IR ANPL ++KD     C  +L+
Sbjct  124  VLSRNVGISDNIRLANPLGYLKDKPLPVCPDLLK  157



>gb|AEW90948.1| pollen-specific protein F8-6 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = -2

Query  633  RAVALISAFCILALAG--IAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            R +++I+   I ALAG  +A+  P+ + V G+VYCDTCR  FET +++ IK A VRLEC+
Sbjct  5    RILSVIAVVAIFALAGTAVANDLPD-YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECK  63

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
                + +  S++G T   G Y + +   H  D+C + +V+SP  +C E     ++A +V 
Sbjct  64   RFGTEKVECSIDGVTDETGTYKIELKDSHPEDICEMVLVQSPLANCNEIQDLRDRAEIVL  123

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLE  184
            +  VG+  +IR ANPL ++KD     C  +L+
Sbjct  124  SRYVGISDNIRMANPLGYLKDKPLPVCPDLLK  155



>ref|XP_004293940.1| PREDICTED: olee1-like protein-like [Fragaria vesca subsp. vesca]
Length=169

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = -2

Query  564  KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTV  385
            K  V G V+CD+CR+QF TRI + I+ A V+LEC++LD+ ++TYS E  T   G Y++ V
Sbjct  29   KLQVEGVVFCDSCRIQFITRIDKLIQGAKVKLECKDLDSGSITYSKEAETNEQGRYSIEV  88

Query  384  DGDHERDMCVVTVVKSPREDCKETVKGLEKAI---VVCTANVGMKSDIRHANPLFFMKDL  214
            D DHE + C V +V SP EDC +    L + I   +  T + G+   +R  NPL FMK  
Sbjct  89   DSDHEEEECEVVLVSSPDEDCNQISHELHQQISARISLTQHNGIAGPVRIPNPLGFMKKE  148

Query  213  ADERCSKVLEEIDFLP  166
                C +VL+E+   P
Sbjct  149  PAPECPQVLKELGLTP  164



>ref|XP_009386950.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=166

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F V G+V+CDTCR  FET +S  I+ A VR+ECR+      T S EG T   G YN+ V+
Sbjct  33   FVVQGRVFCDTCRAGFETPVSTYIQGATVRVECRSEFTGAKTCSFEGTTDHTGTYNILVE  92

Query  381  GDH-ERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADE  205
            G+H + ++C   +V SP   CK  ++G E+A V  + N G+ SD R AN L F+KD +  
Sbjct  93   GEHDDHEICESLLVSSPESGCKTALQGRERAPVFLSHNNGIASDTRFANSLGFLKDTSLP  152

Query  204  RCSKVLEEID  175
             C+++L+  +
Sbjct  153  VCTELLKSYE  162



>ref|XP_009600627.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana tomentosiformis]
Length=162

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 88/154 (57%), Gaps = 2/154 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCA-PEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+ VAL    C L  A IA     + F VVGKVYCDTCR  FET  S+ +  + VR+EC
Sbjct  1    MAKLVALF-VVCFLVFASIASAHFMDTFLVVGKVYCDTCRCGFETSASKYLAGSRVRIEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            +N D   ++Y++EG T + G Y + V  D   ++C V +++S    C     G ++A VV
Sbjct  60   KNRDTNDISYTIEGVTNSKGEYKILVYSDRGDEVCDVVLIRSSDPMCAVPNAGRDRARVV  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
             T N GM S+ R AN + F+ +     C+++L++
Sbjct  120  LTRNNGMVSNTRFANSIGFLSNEPLASCNQILQQ  153



>ref|XP_008234688.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 80/149 (54%), Gaps = 0/149 (0%)
 Frame = -2

Query  627  VALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDN  448
            V L+ A C+L     A      F++ G+VYCDTCR  FET  +  I  A VR+EC+  + 
Sbjct  6    VLLLFALCVLPGLVSARTLGNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNT  65

Query  447  KTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANV  268
              L YS+EG T A G YN+ V+ DHE  +C   +V SP  DCK       +A VV T   
Sbjct  66   LQLAYSVEGETDATGTYNILVEDDHEDQICESVLVSSPVNDCKSADPRRNRANVVVTRYN  125

Query  267  GMKSDIRHANPLFFMKDLADERCSKVLEE  181
            G+  D  +AN + F KD     C ++L++
Sbjct  126  GIVKDKHYANNMGFFKDQPLAGCEELLKQ  154



>ref|XP_006415610.1| hypothetical protein EUTSA_v10008921mg [Eutrema salsugineum]
 gb|ESQ33963.1| hypothetical protein EUTSA_v10008921mg [Eutrema salsugineum]
Length=171

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 93/166 (56%), Gaps = 9/166 (5%)
 Frame = -2

Query  627  VALISAFC---ILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            V L SA C   +L  A       ++F++ G VYCDTCRVQF TR+S+ ++ A V+LEC+ 
Sbjct  7    VFLASALCFTTLLHFAAADADDFDRFHIKGSVYCDTCRVQFVTRLSKFLEGAKVKLECKG  66

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLE----KAI  289
             +N+T+T + E  T   GNY + V GDHE ++C + +V SP  +C + V   E     A 
Sbjct  67   RENQTVTLTKEAVTDKAGNYQMEVMGDHEEEVCEIVLVHSPDAECSD-VNNQEFLRNAAR  125

Query  288  VVCTANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            V  TAN G+ S + R  NPL FM+      C +  +E+  +P  T 
Sbjct  126  VSLTANDGIVSNETRTINPLGFMRKTPLADCPQAFQELGIVPDVTF  171



>ref|XP_010941451.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=165

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = -2

Query  630  AVALISAFCIL-ALAGIAHCAP-EKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            A+ ++++ C + AL G+A   P   F+V G+VYCDTCR  F    ++ +  A VRLECR+
Sbjct  2    ALLVLASLCFISALIGVADAVPTPSFSVTGRVYCDTCRAGFVHEFTEYLGGAKVRLECRD  61

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE-TVKGLEKAIVVC  280
              +  +++S E  T   G Y +T+  DH+ ++C V ++ SPR DCKE      ++A V  
Sbjct  62   YVSGQVSHSGEALTDKYGYYTITMSDDHQEEICEVVLLDSPRYDCKEIPADHRDRARVAL  121

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLE  184
            T N GM S+ R+ N + ++KD+   +C  +L+
Sbjct  122  TRNNGMSSEQRNVNAIGYLKDVPLPKCGPMLQ  153



>emb|CAA16739.1| pollen-specific protein - like [Arabidopsis thaliana]
 emb|CAB78861.1| pollen-specific protein-like [Arabidopsis thaliana]
Length=842

 Score =   111 bits (278),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 61/159 (38%), Positives = 90/159 (57%), Gaps = 7/159 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
             +SA C+ +LAG+A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  283  FVSAVCLSSLAGVAIADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  342

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  343  NGTVTLTKEAVTDKTGSYRMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISL  402

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            TAN G+ S + R  NPL FM       C    +E+  +P
Sbjct  403  TANDGIVSHETRIVNPLGFMVQTPSAECPAAFKELGIVP  441



>emb|CAA78897.1| pollen specific gene [Oryza sativa Indica Group]
Length=164

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = -2

Query  609  FCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYS  430
            F +LA    A  AP+ + V G+VYCDTCR +FET +++ IK A VRLEC++     +  +
Sbjct  15   FYVLASTATATDAPD-YVVQGRVYCDTCRAEFETNVTEYIKGAKVRLECKHFGTDKVERA  73

Query  429  MEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDI  250
            ++G T   G Y + +   HE D+C V +V SP  +C E     ++A V+ T NVG+  ++
Sbjct  74   IDGVTDETGTYKIELKDSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNL  133

Query  249  RHANPLFFMKD  217
            R ANPL ++KD
Sbjct  134  RLANPLGYLKD  144



>ref|XP_002307393.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK95954.1| unknown [Populus trichocarpa]
 gb|EEE94389.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 76/132 (58%), Gaps = 0/132 (0%)
 Frame = -2

Query  582  AHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADG  403
            A  A   F V G VYCDTC   FET  + +I  A VRLEC++   + L YS EG T + G
Sbjct  20   ARPARNPFVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTG  79

Query  402  NYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFM  223
             Y +TVD DHE  +C   +V SPR+DC+    G ++A V+ T + G+ S  R+AN + FM
Sbjct  80   KYTITVDEDHEDQICDCMLVSSPRKDCRSPSAGRDRARVILTNDNGLVSTTRYANAMGFM  139

Query  222  KDLADERCSKVL  187
                   C+++L
Sbjct  140  AAQPMSGCTELL  151



>ref|XP_011030966.1| PREDICTED: protein DOWNSTREAM OF FLC [Populus euphratica]
Length=157

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 89/154 (58%), Gaps = 2/154 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MAR   L+ A C+L     A      F+V G+VYCDTC+  FET+ +  I  A VR+EC+
Sbjct  1    MARL--LLFALCVLPSLVSAWRMGNPFHVRGRVYCDTCQCGFETKKTTYIPGATVRIECK  58

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +  +  L YS+EG T + G Y + V GD    +C V +V SP  DCK     L +A V+ 
Sbjct  59   DRTDLQLRYSLEGVTDSTGAYKIKVVGDQADRICHVVLVDSPLADCKTVHPVLNRAEVIL  118

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            T + G  SD+ +AN L F+KD A   C+++++++
Sbjct  119  TRSNGAISDLHYANSLGFVKDEALPGCAELVKKL  152



>ref|NP_568650.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
 dbj|BAD43611.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
 gb|ABR46194.1| At5g45880 [Arabidopsis thaliana]
 gb|AED95311.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
Length=174

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 92/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++SA C+ +LAG A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  12   VVSAVCLSSLAGFAAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKGLEKAI-VVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  T   L  A  +  
Sbjct  72   NGTITLTKEAVTDKTGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSTEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  132  TANDGIVSHETRIVNPLGFMVQTPLADCPAAFKELGIVPDVTF  174



>gb|AAM65838.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
Length=174

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 92/163 (56%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++SA C+ +LAG A    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  12   VVSAVCLSSLAGFAAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKE--TVKGLEKAI-VVC  280
            N T+T + E  T   G+Y + V GDHE ++C + +V+SP   C +  T   L  A  +  
Sbjct  72   NGTITLTKEAVTDKTGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSTEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  132  TANDGIVSHETRIVNPLGFMVQTXLADCPAAFKELGIVPDVTF  174



>emb|CDX87759.1| BnaC02g31900D [Brassica napus]
Length=174

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 89/163 (55%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPEK---FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++S  C+ +LAG A    +    F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  12   VVSTVCLSSLAGFAAADADDFDLFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
            N TLT + E  T   G+Y + V GDHE ++C + +V+SP   C +  K       A +  
Sbjct  72   NGTLTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  132  TANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVPDVTF  174



>ref|NP_001131377.1| uncharacterized protein LOC100192702 precursor [Zea mays]
 gb|ACF79764.1| unknown [Zea mays]
 gb|AFW82076.1| hypothetical protein ZEAMMB73_949741 [Zea mays]
Length=164

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 80/145 (55%), Gaps = 1/145 (1%)
 Frame = -2

Query  603  ILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSME  424
            +L    IA      F V G++YCD CR  FET +S +I+ A V +ECR+ +++ +    E
Sbjct  12   VLVATAIAAAPGVGFVVTGRIYCDNCRAGFETNVSHAIQGATVEMECRHFESQQVHDKAE  71

Query  423  GATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMK-SDIR  247
              TG  G Y + + GDH+ ++C V ++KSP  DC E     ++  V  T N G+K S +R
Sbjct  72   ATTGPGGWYRMEISGDHQDEICDVRLLKSPEADCAEIDHSRDRCRVPLTRNDGIKQSGVR  131

Query  246  HANPLFFMKDLADERCSKVLEEIDF  172
            +ANP+ F++      C ++L   D 
Sbjct  132  YANPIAFLRKEPLPNCGELLRAYDL  156



>ref|XP_009114385.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=174

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 88/163 (54%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++S  C+ +LAG +    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  12   VVSVVCLSSLAGFSAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDC---KETVKGLEKAIVVC  280
            N TL  + E  T   G+Y + V GDHE ++C + +V+SP   C    E       A +  
Sbjct  72   NGTLALTKEAVTDKTGSYMMEVTGDHEEEVCELVLVQSPDSGCSDVSEEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  132  TANDGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVPDVTF  174



>ref|XP_007225977.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
 gb|EMJ27176.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
Length=159

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 84/155 (54%), Gaps = 2/155 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA+ + L  A C+L ALA         F V GKV+CD CR  FET  +  I  A VRLEC
Sbjct  1    MAKLIVLF-ALCVLPALAVATRPMRTPFTVEGKVFCDPCRAGFETSATTYIPGATVRLEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            R+     + Y+ EG T + G Y + V  DHE   C   +V S ++DC     G ++A V+
Sbjct  60   RDRKTMDIRYTKEGRTDSTGTYKIPVTEDHEDQFCDAVLVSSSQKDCAAAAPGRDRARVI  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
             T   G+ S  R AN + FMK+ A   C+++L+++
Sbjct  120  LTGYNGIASYNRFANAMGFMKNEAVSGCAQILKQL  154



>ref|XP_006344595.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Solanum tuberosum]
Length=158

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 87/153 (57%), Gaps = 3/153 (2%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MAR VA   A C+L+ +  +   P    V GKVYCDTCR  FET  +  + DA V++EC+
Sbjct  1    MARLVAFF-AICLLSTSIASASNP--LLVEGKVYCDTCRCGFETPATTYLPDAKVKIECK  57

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +   +  TY++EG T + G Y++ V  D   D+C V ++KSP   C +   G +++ V  
Sbjct  58   SRITEEPTYTVEGVTNSQGEYSILVKSDRGDDVCDVVLIKSPDPTCAKPSAGRDRSRVTL  117

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
            T N GM SD+  AN + F++D     C ++L +
Sbjct  118  TRNNGMISDVYFANAMGFIRDEPLASCDEILRQ  150



>ref|XP_009409254.1| PREDICTED: major pollen allergen Lol p 11-like [Musa acuminata 
subsp. malaccensis]
Length=168

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 84/154 (55%), Gaps = 4/154 (3%)
 Frame = -2

Query  624  ALISAFCILALAGIAH----CAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRN  457
            A+++  C+L    +A        + F V G+V+CDTCR  FET +S   K A VR+ECR+
Sbjct  11   AVLAVACVLPSLSVAARNVAGGKQGFVVQGRVFCDTCRAGFETPVSTYTKGAKVRIECRS  70

Query  456  LDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCT  277
                  T + EG T   G YN+ V  +HE ++C   +V SP   CK  ++G E+A V  +
Sbjct  71   KATGAKTCNFEGTTDHTGTYNILVADEHEHEICESMLVSSPESRCKTPLQGRERARVFLS  130

Query  276  ANVGMKSDIRHANPLFFMKDLADERCSKVLEEID  175
             N G+ SD R+AN L F  D     C+++L+  +
Sbjct  131  HNNGIASDTRYANSLGFQTDTPLSVCAELLKTYE  164



>gb|KDP46869.1| hypothetical protein JCGZ_24078 [Jatropha curcas]
Length=159

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 82/154 (53%), Gaps = 0/154 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA+ V L  A  + A+  +       F V G+VYCDTCR  FET  +  I  A VR+EC 
Sbjct  1    MAKWVFLFFALSLCAVPSLVSAHRRPFFVHGRVYCDTCRCGFETNKTTYIPGAKVRIECL  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +  N  L YS+EG T + G Y + V  DH+   C   +V SP+ +CK    G  +A V+ 
Sbjct  61   DRVNSQLKYSIEGKTDSTGTYRIKVKDDHQDQFCYAVLVSSPQANCKTADPGRSRAEVIL  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            T + G  SD+  AN + + +      C+++++E+
Sbjct  121  TRSNGAVSDLHFANSMGYFRYQPMSGCAELVKEL  154



>ref|XP_002307104.1| hypothetical protein POPTR_0005s08000g [Populus trichocarpa]
 gb|EEE94100.1| hypothetical protein POPTR_0005s08000g [Populus trichocarpa]
Length=157

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 88/154 (57%), Gaps = 2/154 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MAR   L+ A C+L     A      F+V G+VYCDTC+  FET+ +  I  A VR+EC+
Sbjct  1    MARL--LLFALCVLPSLVSAWRMGNPFHVRGRVYCDTCQCGFETKKTTYISGATVRIECK  58

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            +  +  L YSMEG T + G Y + V GD    +C V +V SP  DCK       +A V+ 
Sbjct  59   DRTDLQLRYSMEGVTDSTGAYKIKVVGDQADRICHVVLVDSPLADCKTVHPVRNRAEVIL  118

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
            T + G  SD+ +AN L F+KD A   C+++++++
Sbjct  119  TRSNGAISDLHYANSLGFVKDEALPGCAELVKKL  152



>ref|XP_006464247.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Citrus sinensis]
Length=161

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 82/136 (60%), Gaps = 2/136 (1%)
 Frame = -2

Query  573  APEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYN  394
            A + F++ G+VYCDTCR  FET  +  I+ A VR+EC++ ++  L YS++G T + G YN
Sbjct  21   AGDPFHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYN  80

Query  393  LTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDL  214
            + VDGDH+  +C   ++ SP  DCK    G   + V+ T + G  S++  AN L F+K  
Sbjct  81   IHVDGDHQDQICYSKLISSPLADCKTADPGRACSQVILTRSNGAVSNLHFANALGFLKAR  140

Query  213  ADERCSKVLEEIDFLP  166
                C ++L++  +LP
Sbjct  141  PLAFCPELLKK--YLP  154



>ref|XP_006289520.1| hypothetical protein CARUB_v10003061mg [Capsella rubella]
 gb|EOA22418.1| hypothetical protein CARUB_v10003061mg [Capsella rubella]
Length=160

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 85/154 (55%), Gaps = 3/154 (2%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEK--FNVVGKVYCDTCRVQFETRISQSIKDAAVRLE  466
            M++AV L+ A C L +  I    P K  F V G+VYCDTC   FET  S  I  A VRLE
Sbjct  1    MSKAV-LLFALCFLQVLAIIAARPNKNPFVVRGRVYCDTCLAGFETSASTYIPGAVVRLE  59

Query  465  CRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIV  286
            C++     LTYS E  T + G+Y + V  DH+   C  T+V+S +  C     G ++A V
Sbjct  60   CKDRRTMELTYSHEARTDSTGSYKILVSEDHDDQFCDATLVRSSQLRCSNVSPGHDRARV  119

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLE  184
              T   G+ SD R AN L F++D A   C+++++
Sbjct  120  TLTRFNGIASDERFANSLGFVRDAAMPGCAEIMK  153



>ref|XP_006442530.1| hypothetical protein CICLE_v10024378mg [Citrus clementina]
 gb|ESR55770.1| hypothetical protein CICLE_v10024378mg [Citrus clementina]
Length=163

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 95/165 (58%), Gaps = 8/165 (5%)
 Frame = -2

Query  639  MARAVALI----SAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVR  472
            MA+++ L+    +A C  +L   A  A +   V G VYCD+CRV+++T +S  I  A V 
Sbjct  1    MAKSMKLVAVVATALCFTSLLSFALAAKDPKTVEGLVYCDSCRVKYKTELSDYIAGATVA  60

Query  471  LECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVK-GLEK  295
            LEC+  +   + YS E  +   G Y + ++G H + +C V +VKSP+ +C E V  GL  
Sbjct  61   LECKESEGGEVVYSREVVSDQSGTYKIPIEGCHAK-LCQVRLVKSPKPECSEIVADGLSS  119

Query  294  AIVVCTANVGMKSD-IRHANPLFFMKDLADERCSKVLEEIDFLPG  163
            A +  T +VG   + IR+AN L FMK  +   C+KVLEE+ F+ G
Sbjct  120  ARIDLTPSVGSDPELIRYANDLGFMKKESLPECAKVLEEM-FIHG  163



>ref|NP_001150330.1| pollen allergen Phl p 11 precursor [Zea mays]
 gb|ACG38668.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 76/132 (58%), Gaps = 1/132 (1%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F V G+VYCD CR  FET +S +I+ A V +ECR+ +++ +    E  T A G Y + + 
Sbjct  27   FVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYRMEIS  86

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMK-SDIRHANPLFFMKDLADE  205
            GDH+ ++C V ++KSP  DC E  +  E+  V  T N G++ S IR+ANP+ F +     
Sbjct  87   GDHQDEICEVLLLKSPEADCAEIERTRERCRVPLTRNDGIRQSGIRYANPIAFFRKEPLS  146

Query  204  RCSKVLEEIDFL  169
             C ++L   D  
Sbjct  147  NCGELLRAYDLF  158



>gb|EMS52933.1| hypothetical protein TRIUR3_31283 [Triticum urartu]
Length=169

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 76/135 (56%), Gaps = 3/135 (2%)
 Frame = -2

Query  570  PEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNL  391
            P +F V G+V+CDTCR  FET  S  I  A VR+EC++      T S EG T   G YN+
Sbjct  32   PTQFVVRGRVWCDTCRAGFETPASTFIAGAKVRVECKSRSTGAQTCSFEGHTDHTGTYNI  91

Query  390  TVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLA  211
             V  +HE ++C   +V SP   C + V G E+A V    N G+ S++R AN L F KD  
Sbjct  92   PVADEHEHELCESVLVSSPDTACAKAVAGRERAPVFLNNNNGVASNVRLANALGFEKDTP  151

Query  210  DERCSKVL---EEID  175
               C+++L   EE+D
Sbjct  152  LAACAQILKMYEEVD  166



>ref|XP_011006159.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011016058.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
Length=159

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 75/132 (57%), Gaps = 0/132 (0%)
 Frame = -2

Query  582  AHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADG  403
            A  A   F V G VYCDTC   FET  + +I  A VRLEC++   + L YS EG T + G
Sbjct  20   ARPARNPFVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTG  79

Query  402  NYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFM  223
             Y +TVD DH+  +C   +V SPR+DC+    G ++A V+ T N G+ S  R+ N + FM
Sbjct  80   KYTITVDEDHKDQICDCMLVSSPRKDCRSPSAGRDRARVILTNNNGLVSTTRYVNAMGFM  139

Query  222  KDLADERCSKVL  187
                   C+++L
Sbjct  140  AAHPMSGCTELL  151



>gb|EYU31033.1| hypothetical protein MIMGU_mgv1a015328mg [Erythranthe guttata]
Length=161

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 80/138 (58%), Gaps = 0/138 (0%)
 Frame = -2

Query  582  AHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADG  403
            AH A + F V G VYCD+CR  FET +++ +  A VR+ECR+ D+  LTY+ E  T   G
Sbjct  22   AHFAGDPFLVKGCVYCDSCRCGFETDVTKYMPSAKVRIECRDRDSAKLTYTQEAVTDESG  81

Query  402  NYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFM  223
             Y+  V  D   D C   +VKS  ++C     G ++A V+ T N GM  ++R+AN + F+
Sbjct  82   CYSAVVQSDRGEDFCDAVLVKSSDDECSVPNAGRDRARVILTRNNGMTDNVRYANNMGFL  141

Query  222  KDLADERCSKVLEEIDFL  169
            K++    C+++L +   +
Sbjct  142  KNIPLSNCAQILHKYQII  159



>gb|KDP21093.1| hypothetical protein JCGZ_21564 [Jatropha curcas]
Length=221

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MA  + L SA C L+L G+A+    KFNV G VYCDTCRVQF T+++  I+ A V LEC 
Sbjct  1    MANIICLASAICFLSLFGLAY-GEAKFNVEGVVYCDTCRVQFMTKVTTLIEGATVHLECF  59

Query  459  NLDNKTLTY-SMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDC  322
            N     LTY S E  T A G Y++ V+GDHE ++C V ++KSP  DC
Sbjct  60   NRTGDVLTYTSPEAVTDAAGKYSIPVEGDHEDELCQVMLLKSPNPDC  106



>emb|CDY52214.1| BnaAnng11370D [Brassica napus]
Length=174

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 87/163 (53%), Gaps = 7/163 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            ++S  C+ +L G +    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  
Sbjct  12   VVSVVCLSSLPGFSAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRT  71

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDC---KETVKGLEKAIVVC  280
            N TL  + E  T   G+Y + V GDHE ++C + +V+SP   C    E       A +  
Sbjct  72   NGTLALTKEAVTDKTGSYMMEVTGDHEEEVCELVLVQSPDSGCSDVSEEAYLRNAAKISL  131

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            TAN G+ S + R  NPL FM       C    +E+  +P  T 
Sbjct  132  TANDGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVPDVTF  174



>ref|XP_002392460.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
 gb|EEB93390.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
Length=160

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 80/143 (56%), Gaps = 1/143 (1%)
 Frame = -2

Query  597  ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGA  418
            A+A  A  A     V GKVYCDTCR  FET  S  I  A V++EC++  +  L YS E  
Sbjct  16   AIAFAARPARNPLTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQEAT  75

Query  417  TGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHAN  238
            T + G Y L V  DH+  +C   ++ SP+ +C++   G ++A V+ T   G+ SD R+AN
Sbjct  76   TDSTGTYKLFVSEDHQDQLCDAMLLSSPQPNCQKPAAGRDRARVILTRYNGIVSDTRYAN  135

Query  237  PLFFMKDLADERCSKVLEEI-DF  172
             + F  D     C++VL++  DF
Sbjct  136  NMGFEMDQPLAGCTQVLQQYQDF  158



>pir||S43242 allergen-like protein Syr v I isoform 1 - Syringa vulgaris
Length=145

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 83/134 (62%), Gaps = 2/134 (1%)
 Frame = -2

Query  564  KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTV  385
            +F++ G+VYCDTCR +F T +S+ I  A++RL+C++ +N  +T++  G T A+G Y++ V
Sbjct  10   QFHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDRENGKITFTEIGYTRAEGLYSMLV  69

Query  384  DGDHERDMCVVTVVKSPREDCKE-TVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLAD  208
            +GDH+ + C +T++ S REDC E  V+G  K  +    N  +    R  NP+ F K  A 
Sbjct  70   EGDHKNEFCEITLISSGREDCDEIPVEGWAKPSLKFKLNT-VNGTTRTINPIGFFKKEAL  128

Query  207  ERCSKVLEEIDFLP  166
             +C++V  ++   P
Sbjct  129  PKCTQVYNKLGMYP  142



>ref|XP_002489221.1| hypothetical protein SORBIDRAFT_0012s014630 [Sorghum bicolor]
 gb|EES20226.1| hypothetical protein SORBIDRAFT_0012s014630 [Sorghum bicolor]
Length=171

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F V G+V+CD CR  FET  S  I  A VR++C++      T S EG T   G YN+ V 
Sbjct  37   FVVRGRVWCDNCRTGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVA  96

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADER  202
             +HE ++C   +V SP + C   V G E+A V  T+N G+ S+IR AN L F KD+A  R
Sbjct  97   DEHEHELCESILVSSPDKGCSNVVVGRERAPVFLTSNNGVASNIRLANALGFEKDVALPR  156

Query  201  CSKVLE  184
            C+++L+
Sbjct  157  CAQILK  162



>ref|XP_007149396.1| hypothetical protein PHAVU_005G066700g [Phaseolus vulgaris]
 gb|ESW21390.1| hypothetical protein PHAVU_005G066700g [Phaseolus vulgaris]
Length=162

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 80/139 (58%), Gaps = 3/139 (2%)
 Frame = -2

Query  591  AGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATG  412
            + +A  +PEKF V GK+YCD C+  FE+R+S ++    V L+C   +N  ++Y     T 
Sbjct  19   SALARKSPEKFFVEGKIYCDPCQFAFESRLSFALSGVNVTLKCIKEENDIVSYLKNSTTD  78

Query  411  ADGNYNLTVDGDHERDMCVVTVVKSPRE-DCKETVKGLEKAIVVCTANVGMKSDIRHANP  235
            A+G YN+ V GDHE ++C+V V   P E  CKE +      I++ T N+G  S  R+ NP
Sbjct  79   ANGMYNIPVRGDHEEEICMV-VADPPNEGQCKEAMPNKSDRIIL-TKNMGAASMTRYVNP  136

Query  234  LFFMKDLADERCSKVLEEI  178
            L FM    D +C  V+ E+
Sbjct  137  LGFMTQTTDSQCFSVVHEL  155



>emb|CDY65576.1| BnaC09g52000D [Brassica napus]
Length=174

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 85/158 (54%), Gaps = 7/158 (4%)
 Frame = -2

Query  606  CILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLT  436
            C+ +LAG +    +   +F + G VYCDTCRVQF TR+S+ ++ A V+LECR+  N TL 
Sbjct  17   CLSSLAGFSAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLA  76

Query  435  YSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDC---KETVKGLEKAIVVCTANVG  265
             + E  T   G+Y + V GDHE ++C + +V+SP   C    E       A +  TAN G
Sbjct  77   LTKEAVTDKTGSYMMEVTGDHEEEVCQLVLVQSPDSGCSDVSEEAYLRNAAKISLTANDG  136

Query  264  MKS-DIRHANPLFFMKDLADERCSKVLEEIDFLPGQTM  154
            + S + R  NPL FM       C    +E+  +P  T 
Sbjct  137  IVSHETRIVNPLGFMVKTPSADCPAAFKELGIVPDVTF  174



>ref|NP_001146979.1| LOC100280588 precursor [Zea mays]
 gb|ACG24873.1| pollen-specific protein C13 precursor [Zea mays]
 gb|ACN27364.1| unknown [Zea mays]
 tpg|DAA46881.1| TPA: pollen-specific protein C13 [Zea mays]
Length=172

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F V G+V+CD CR  FET  S  I  A VR++C++      T S EG T   G YN+ V 
Sbjct  38   FVVRGRVWCDNCRAGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVI  97

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADER  202
             +HE ++C   +V SP + C   V G E+A V  T+N G+ S++R AN L F KD+A  R
Sbjct  98   DEHEHELCESVLVSSPDKGCANVVAGRERAPVFLTSNNGVASNVRLANALGFQKDVALPR  157

Query  201  CSKVLE  184
            C+++L+
Sbjct  158  CAQILK  163



>ref|XP_010549400.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=171

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 82/138 (59%), Gaps = 4/138 (3%)
 Frame = -2

Query  567  EKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLT  388
            ++F++ G VYCDTCRVQF TR+S+ ++ A V+LEC+N  N+T+T + E  T   GNY + 
Sbjct  30   DRFHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKNRVNQTVTLTKEAVTDKSGNYEME  89

Query  387  VDGDHERDMCVVTVVKSPREDCKETVK---GLEKAIVVCTANVGMKS-DIRHANPLFFMK  220
            V GDHE ++C + + +SP  +C E          A +  TAN G+ S + R  NPL FM+
Sbjct  90   VMGDHEEEVCEIVLGESPDAECSEINNEEFTRNAARISLTANDGIVSNETRSVNPLGFMR  149

Query  219  DLADERCSKVLEEIDFLP  166
                  C +  +E+  +P
Sbjct  150  KTPLGDCPEAFKELGIVP  167



>ref|XP_010911793.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=175

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F V G+V+CDTCR  FET  S  I  A VRLECR+      T S +G T   G YN+ V 
Sbjct  41   FVVQGRVFCDTCRAGFETPKSTYIAGAKVRLECRSRTTGAKTCSFDGVTDRSGTYNILVA  100

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADER  202
             +HE + C   +V SP + C +T++G E+A V  T N G+ S  R AN L F +D+A   
Sbjct  101  DEHEHETCEAVLVSSPVKGCAKTLEGRERARVFLTNNNGIASTKRFANSLGFQRDIALAG  160

Query  201  CSKVLE  184
            C+++L+
Sbjct  161  CAQLLK  166



>ref|XP_003573867.1| PREDICTED: pollen-specific protein C13 [Brachypodium distachyon]
Length=169

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = -2

Query  564  KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTV  385
            +F V G V+CDTCR  FET  S  I  A VR+EC++      T S EG T   G YN++V
Sbjct  34   QFVVRGSVWCDTCRAGFETPASTYIAGAKVRVECKSKSTGVKTCSFEGHTDHTGTYNISV  93

Query  384  DGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADE  205
            D +HE ++C   +V SP   C + V G E+A V      G+ S++R AN L F KD+A  
Sbjct  94   DDEHEHELCESVLVSSPDRGCAKLVAGRERAPVFLNNKNGVASNVRLANALGFQKDVALA  153

Query  204  RCSKVLE  184
             C+++L+
Sbjct  154  ACAQILK  160



>ref|XP_010518802.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=172

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 86/159 (54%), Gaps = 7/159 (4%)
 Frame = -2

Query  621  LISAFCILALAGIAHCAPE---KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            + SA C+  + G A    +   +F + G VYCDTCRVQF TR+S+ ++ A VRLEC+N  
Sbjct  10   MASAICVSYVVGFAAADADDLDRFQIQGSVYCDTCRVQFITRLSKFLQGAKVRLECKNRV  69

Query  450  NKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGL---EKAIVVC  280
               LT S E  T   G++ + V GDHE ++C + +V+SP ++C +  K       A V  
Sbjct  70   TGALTVSKEAVTDDTGSFLMQVTGDHEEEVCEIMLVESPDQECSDVSKDAYLRNAAKVSL  129

Query  279  TANVGMKS-DIRHANPLFFMKDLADERCSKVLEEIDFLP  166
            TAN G+ S + R  NPL FM       C    +E+   P
Sbjct  130  TANDGIVSNETRIVNPLGFMVKTPSADCPAAFQELGITP  168



>ref|NP_001238723.1| uncharacterized protein LOC100499710 precursor [Glycine max]
 gb|ACU13342.1| unknown [Glycine max]
 gb|KHN09136.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 82/156 (53%), Gaps = 1/156 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIA-HCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA    L+ A C+L    +A   A   F V G+VYCD CR  FET  +  I  A + L+C
Sbjct  1    MASRAVLLLAMCVLPAMVVAIRPAKNPFCVKGRVYCDPCRAGFETSATTYIAGAEIMLQC  60

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++  +  + Y+ +G T + G Y + VD DH   +C   +V SP   CKE   G ++A+V+
Sbjct  61   KSRVSNEVVYTKKGYTDSTGAYTMYVDEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVI  120

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEEID  175
             T   G+ SD R AN + FM       C++VL + +
Sbjct  121  LTRYNGIASDDRFANAMGFMSQEVASGCAEVLRQYE  156



>ref|XP_006428158.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
 gb|ESR41398.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
Length=250

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 80/132 (61%), Gaps = 0/132 (0%)
 Frame = -2

Query  573  APEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYN  394
            A + F++ G+VYCDTCR  FET  +  I+ A VR+EC++ ++  L YS++G T + G YN
Sbjct  21   AGDPFHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYN  80

Query  393  LTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDL  214
            + VDGDH+  +C   ++ SP  DCK    G   + V+ T + G  S++  AN L F+K  
Sbjct  81   IHVDGDHQDQICYSKLISSPLADCKTADPGRACSQVILTRSNGAVSNLHFANALGFLKAR  140

Query  213  ADERCSKVLEEI  178
                C ++L+++
Sbjct  141  PLAFCPELLKKL  152



>gb|AFW77548.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 76/132 (58%), Gaps = 1/132 (1%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F V G+VYCD CR  FET +S +I+ A V +ECR+ +++ +    E  T A G Y + + 
Sbjct  27   FVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYRMEIS  86

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMK-SDIRHANPLFFMKDLADE  205
            GDH+ ++C V ++KSP  DC E  +  ++  V  T N G++ S IR+ANP+ F +     
Sbjct  87   GDHQDEICEVLLLKSPEADCAEIERTRDRCRVPLTRNDGIRQSGIRYANPIAFFRKEPLS  146

Query  204  RCSKVLEEIDFL  169
             C ++L   D  
Sbjct  147  NCGELLRAYDLF  158



>ref|XP_010060161.1| PREDICTED: protein DOWNSTREAM OF FLC [Eucalyptus grandis]
 gb|KCW66732.1| hypothetical protein EUGRSUZ_F00490 [Eucalyptus grandis]
Length=160

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 80/143 (56%), Gaps = 1/143 (1%)
 Frame = -2

Query  597  ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGA  418
            A+A  A  A     V GKVYCDTCR  FET  S  I  A V++EC++  +  L YS E  
Sbjct  16   AIAVAARPARNPLTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQEAT  75

Query  417  TGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHAN  238
            T + G Y L V  DH+  +C   ++ SP+ +C++   G ++A V+ T   G+ SD R+AN
Sbjct  76   TDSTGTYKLFVSEDHQDQLCDAMLLSSPQLNCQKPAAGRDRARVILTRYNGIVSDTRYAN  135

Query  237  PLFFMKDLADERCSKVLEEI-DF  172
             + F  D     C++VL++  DF
Sbjct  136  NMGFEMDQPLAGCTQVLQQYQDF  158



>gb|ABP58635.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 83/134 (62%), Gaps = 2/134 (1%)
 Frame = -2

Query  564  KFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTV  385
            +F++ G+VYCDTCR +F T +S+ I  A+VRL+CR+ +N ++T++  G+T A+G Y++ +
Sbjct  5    QFHIQGQVYCDTCRARFITELSEFIPGASVRLQCRDGENGSITFTEVGSTRAEGLYSMLI  64

Query  384  DGDHERDMCVVTVVKSPREDCKE-TVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLAD  208
            + DH+ + C +T++ S R+DC E  V+G  K  +    N  +    R  NPL F K  A 
Sbjct  65   ERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNT-VNGTTRTVNPLGFFKKEAL  123

Query  207  ERCSKVLEEIDFLP  166
             +C +V  ++   P
Sbjct  124  PKCPQVFNKLGMYP  137



>ref|XP_004237415.1| PREDICTED: pollen-specific protein C13 [Solanum lycopersicum]
Length=159

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 89/160 (56%), Gaps = 2/160 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MAR V  + A C L+++ +A      F V GK YCDTCR  FET  ++ +  + V++EC+
Sbjct  1    MARLVVFV-ALCFLSVS-LATTTSNPFLVKGKCYCDTCRCGFETPATKYLAGSKVKVECK  58

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            N     +TY+++G T + G YN+ V  D   D+C V +V+S  + C     G ++A V  
Sbjct  59   NRVTNKITYTIDGVTNSQGEYNILVKRDCGDDVCDVVLVESGDKSCNIPNAGRDRARVAL  118

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDFLPGQ  160
            T N GM SD+R AN + F+ +     C+++L++      Q
Sbjct  119  TRNNGMTSDVRFANNMGFLSNEPLAACTQILQQYQLTEDQ  158



>gb|KHN19737.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 81/154 (53%), Gaps = 1/154 (1%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIA-HCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            MA    L+ A C+L    +A   A   F V G+VYCD CR  FET  +  I  A + L+C
Sbjct  1    MASRAVLLLAMCVLPAMVVAIRPAKNPFCVKGRVYCDPCRAGFETSATTYIAGAEIMLQC  60

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++  +  + Y+ +G T + G Y + VD DH   +C   +V SP   CKE   G ++A+V+
Sbjct  61   KSRVSNEVVYTKKGYTDSTGAYTMYVDEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVI  120

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
             T   G+ SD R AN + FM       C+++L +
Sbjct  121  LTRYNGIASDDRFANAMGFMSQEVASGCAEILRQ  154



>ref|XP_008782123.1| PREDICTED: pollen-specific protein C13-like [Phoenix dactylifera]
Length=175

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 75/130 (58%), Gaps = 0/130 (0%)
 Frame = -2

Query  573  APEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYN  394
            A ++F V G+V+CDTCR  FET  +  I  A VR+ECR+      T S +G T   G YN
Sbjct  37   ANQRFVVQGRVFCDTCRAGFETPKTTYIAGAKVRVECRSRTTGAKTCSFDGTTDGSGAYN  96

Query  393  LTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDL  214
            + V  +HE + C   +V SP + C + ++G E+A V  T N G+ S  R AN L F KD+
Sbjct  97   ILVADEHEHETCEAMLVSSPVKGCDKMLEGRERARVFLTHNNGIASSKRFANSLGFQKDI  156

Query  213  ADERCSKVLE  184
                C+++LE
Sbjct  157  PLAGCAQLLE  166



>gb|AAM08621.1|AC107314_12 Putative Pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
 gb|AAN31783.1| Putataive pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
 gb|AAP53386.1| Pollen proteins Ole e I family protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAY78230.1| hypothetical protein OsI_33275 [Oryza sativa Indica Group]
 gb|EAZ15857.1| hypothetical protein OsJ_31276 [Oryza sativa Japonica Group]
Length=172

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 75/132 (57%), Gaps = 3/132 (2%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F V G+V+CDTC   FET  S  I  A V++ECR+      T S EG T   G YN+ V+
Sbjct  38   FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGQTDHTGTYNIPVN  97

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADER  202
             +HE ++C   +V SP   C + V G E+A V  T N G+ S++R AN L F KD     
Sbjct  98   DEHEHELCESVLVSSPDAKCGKIVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLAA  157

Query  201  CSKVL---EEID  175
            C+++L   EE+D
Sbjct  158  CAQILKMYEEVD  169



>emb|CDY12288.1| BnaA09g24880D [Brassica napus]
 emb|CDX90693.1| BnaA03g23730D [Brassica napus]
Length=159

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 83/154 (54%), Gaps = 2/154 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            M++A+ L+ A C L ALA  A      F V G+VYCDTC   FET  S  I  A VRLEC
Sbjct  1    MSKAILLV-ALCFLPALAMSARPNKNPFVVRGRVYCDTCLAGFETSASTFIPGAVVRLEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++     LTY  E  T + G+Y + V  DHE   C   +V S +  C     G ++A V 
Sbjct  60   KDRRTMELTYRHEARTDSTGSYKILVSEDHEDQFCDTMLVSSSQLRCSNVSPGHDRARVT  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
             T   G+ SD R AN L F++D A   C++++++
Sbjct  120  LTRFNGIASDERFANNLGFLRDAASPGCAEIMKQ  153



>gb|ACG32277.1| pollen-specific protein C13 precursor [Zea mays]
Length=172

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F V G+V+CD CR  FET  S  I  A VR++C++      T S EG T   G YN+ V 
Sbjct  38   FVVRGRVWCDNCRAGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVI  97

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADER  202
             +HE ++C   +V SP + C   V G E+A V   +N G+ S++R AN L F KD+A  R
Sbjct  98   DEHEHELCESVLVSSPDKGCANVVAGRERAPVFLASNNGVASNVRLANALGFQKDVALPR  157

Query  201  CSKVLE  184
            C+++L+
Sbjct  158  CAQILK  163



>ref|XP_004289324.1| PREDICTED: pollen-specific protein C13-like [Fragaria vesca subsp. 
vesca]
Length=163

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 75/129 (58%), Gaps = 0/129 (0%)
 Frame = -2

Query  567  EKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLT  388
            + F+V G+VYCDTCR  FET  +  I  A V ++C N ++ +L YS+EG T   G YN+ 
Sbjct  27   KPFHVQGRVYCDTCRCGFETSATIYIAGATVGIKCMNRNSMSLAYSVEGVTDETGTYNIL  86

Query  387  VDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLAD  208
            V+ DHE  +C   +V SP  DCK    G  +A VV T   G+    R AN + F KD A 
Sbjct  87   VEDDHEDQICESVLVSSPISDCKSADPGRSRANVVLTRFNGVVKTKRFANNMGFFKDQAL  146

Query  207  ERCSKVLEE  181
              C+++L++
Sbjct  147  PECTELLKQ  155



>ref|XP_010942359.1| PREDICTED: major pollen allergen Lol p 11-like [Elaeis guineensis]
Length=174

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 83/170 (49%), Gaps = 15/170 (9%)
 Frame = -2

Query  639  MARAVALISAFCILALA----GIAH----------CAPEKFNVVGKVYCDTCRVQFETRI  502
            MAR + L+  F +L+L      +AH             + F + G+VYCDTCR  FET I
Sbjct  1    MAR-LQLLPVFVMLSLTLSGVALAHDSATIISSEALKTKDFVLTGRVYCDTCRAGFETDI  59

Query  501  SQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDC  322
            + S+  A VRLEC+      LTY  E  T   G Y + V  DH  D C V +VKS    C
Sbjct  60   TSSMPGAKVRLECKRYGTDELTYEAEATTQLSGMYQMIVPDDHSNDQCSVVLVKSSFNKC  119

Query  321  KETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEIDF  172
             E   G ++  +    + G+ S+ R AN L F+ D     C K+L++  F
Sbjct  120  TEIEPGRDRVRITLAQDGGLLSNSRQANALGFLIDEPLPSCGKLLQKYGF  169



>ref|XP_009134109.1| PREDICTED: pollen-specific protein C13 [Brassica rapa]
Length=159

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 83/154 (54%), Gaps = 2/154 (1%)
 Frame = -2

Query  639  MARAVALISAFCIL-ALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLEC  463
            M++A+ L+ A C L ALA  A      F V G+VYCDTC   FET  S  I  A VRLEC
Sbjct  1    MSKAILLV-ALCFLPALAMSARPNKNPFVVRGRVYCDTCLAGFETSASTFIPGAVVRLEC  59

Query  462  RNLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVV  283
            ++     LTY  E  T + G+Y + V  DHE   C   +V S +  C     G ++A V 
Sbjct  60   KDRRTMELTYRHEARTDSTGSYRILVSEDHEDQFCDTMLVSSSQLRCSNVSPGHDRARVT  119

Query  282  CTANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
             T   G+ SD R AN L F++D A   C++++++
Sbjct  120  LTRFNGIASDERFANNLGFLRDAASPGCAEIMKQ  153



>ref|XP_004150698.1| PREDICTED: pollen-specific protein C13-like [Cucumis sativus]
 ref|XP_004163322.1| PREDICTED: pollen-specific protein C13-like [Cucumis sativus]
 gb|KGN62176.1| hypothetical protein Csa_2G309370 [Cucumis sativus]
Length=159

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 84/153 (55%), Gaps = 0/153 (0%)
 Frame = -2

Query  639  MARAVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECR  460
            MAR + L +   + ALA  +      F V GKV+CDTC   FET  +  I  A VR+EC+
Sbjct  1    MARVIILFALIMLPALALASRPVRTPFVVRGKVFCDTCLAGFETSATTYIPGAKVRIECK  60

Query  459  NLDNKTLTYSMEGATGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETVKGLEKAIVVC  280
            + ++  L Y+ E  T + G+Y L V+ DH  ++C   +V SP+E C    +G ++A V+ 
Sbjct  61   DRNSMELQYTHEATTDSTGSYTLLVNEDHGDELCDAVLVSSPQEKCSSVSEGRDRARVIL  120

Query  279  TANVGMKSDIRHANPLFFMKDLADERCSKVLEE  181
            T   G+ S+ R+ N + F  D     C++V+ +
Sbjct  121  TRYNGIASNERYVNAMGFAMDEPMSGCNQVMSQ  153



>ref|NP_001064462.2| Os10g0371000 [Oryza sativa Japonica Group]
 dbj|BAF26376.2| Os10g0371000, partial [Oryza sativa Japonica Group]
Length=196

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 75/132 (57%), Gaps = 3/132 (2%)
 Frame = -2

Query  561  FNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLDNKTLTYSMEGATGADGNYNLTVD  382
            F V G+V+CDTC   FET  S  I  A V++ECR+      T S EG T   G YN+ V+
Sbjct  62   FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGQTDHTGTYNIPVN  121

Query  381  GDHERDMCVVTVVKSPREDCKETVKGLEKAIVVCTANVGMKSDIRHANPLFFMKDLADER  202
             +HE ++C   +V SP   C + V G E+A V  T N G+ S++R AN L F KD     
Sbjct  122  DEHEHELCESVLVSSPDAKCGKIVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLAA  181

Query  201  CSKVL---EEID  175
            C+++L   EE+D
Sbjct  182  CAQILKMYEEVD  193



>ref|XP_011078225.1| PREDICTED: pollen allergen Che a 1-like [Sesamum indicum]
Length=170

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 85/156 (54%), Gaps = 5/156 (3%)
 Frame = -2

Query  630  AVALISAFCILALAGIAHCAPEKFNVVGKVYCDTCRVQFETRISQSIKDAAVRLECRNLD  451
            A+ L  A C L+LA +A+    +F V G VYCD CRV F  + S+ +  A V+LEC++ +
Sbjct  8    AIILAGALCFLSLADVANSQGPEFIVKGMVYCDVCRVNFFNKFSEPMSGAQVKLECKDKE  67

Query  450  NKTLTYSMEGA-TGADGNYNLTVDGDHERDMCVVTVVKSPREDCKETV----KGLEKAIV  286
            +  +TY M G  T  +G Y L  +GDH  ++C VT+VKS R +C E           + V
Sbjct  68   SGKVTYRMTGGETDDNGIYTLPAEGDHLGEVCEVTLVKSSRAECSEIPIDRSGKSPTSEV  127

Query  285  VCTANVGMKSDIRHANPLFFMKDLADERCSKVLEEI  178
               A      +IR ANPL F +  A  +C + L+++
Sbjct  128  TLVATSSFMDNIRLANPLVFTRKEALRKCIEFLKDV  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1201164684765