BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22642_g1_i2 len=957 path=[4380:0-681 5062:682-705 5086:706-728
5109:729-755 5136:756-780 5161:781-816 7271:817-839 7294:840-849
7343:850-956]

Length=957
                                                                      Score     E

ref|XP_004230689.1|  PREDICTED: MAR-binding filament-like protein...    213   1e-59   
ref|XP_010315174.1|  PREDICTED: myosin heavy chain, cardiac muscl...    213   1e-59   
ref|XP_006346295.1|  PREDICTED: intracellular protein transport p...    209   2e-58   
ref|XP_006346293.1|  PREDICTED: intracellular protein transport p...    209   2e-58   
ref|XP_006346294.1|  PREDICTED: intracellular protein transport p...    209   2e-58   
ref|XP_009758361.1|  PREDICTED: uncharacterized protein LOC104211...    204   2e-57   
ref|XP_009758360.1|  PREDICTED: uncharacterized protein LOC104211...    204   5e-57   
ref|XP_009606150.1|  PREDICTED: liprin-alpha-2 isoform X2               196   2e-53   
ref|XP_009606148.1|  PREDICTED: liprin-alpha-2 isoform X1               196   2e-53   
ref|XP_007042659.1|  Myosin heavy chain-related protein, putative...    192   3e-52   
gb|EYU21870.1|  hypothetical protein MIMGU_mgv1a023746mg                187   2e-51   
ref|XP_010647912.1|  PREDICTED: myosin-10 isoform X2                    189   8e-51   
ref|XP_010647911.1|  PREDICTED: myosin-10 isoform X1                    189   1e-50   
emb|CAN60964.1|  hypothetical protein VITISV_013873                     187   2e-50   Vitis vinifera
ref|XP_011088079.1|  PREDICTED: myosin-2 heavy chain                    185   1e-49   
ref|XP_007042660.1|  Myosin heavy chain-related protein, putative...    183   7e-49   
ref|XP_007042658.1|  Myosin heavy chain-related protein, putative...    183   9e-49   
ref|XP_011030332.1|  PREDICTED: uncharacterized protein LOC105129...    181   3e-48   
ref|XP_011030328.1|  PREDICTED: nucleoprotein TPR-like isoform X2       181   5e-48   
ref|XP_011030333.1|  PREDICTED: nucleoprotein TPR-like isoform X5       181   5e-48   
ref|XP_011030326.1|  PREDICTED: protein GRIP-like isoform X1            181   6e-48   
ref|XP_011030329.1|  PREDICTED: protein GRIP-like isoform X3            180   8e-48   
emb|CDO97287.1|  unnamed protein product                                173   3e-45   
gb|KHG16396.1|  hypothetical protein F383_22976                         172   9e-45   
ref|XP_006422810.1|  hypothetical protein CICLE_v10027970mg             171   1e-44   
gb|AES93569.2|  myosin heavy chain-like protein                         171   1e-44   
gb|KDO57913.1|  hypothetical protein CISIN_1g006179mg                   170   2e-44   
ref|XP_004289779.1|  PREDICTED: uncharacterized protein LOC101308822    171   2e-44   
ref|XP_011002125.1|  PREDICTED: myosin-3 isoform X1                     171   2e-44   
ref|XP_006486913.1|  PREDICTED: centromere-associated protein E-like    170   2e-44   
gb|KDO57911.1|  hypothetical protein CISIN_1g006179mg                   170   4e-44   
ref|XP_011002132.1|  PREDICTED: myosin-3 isoform X2                     170   4e-44   
gb|KDO57912.1|  hypothetical protein CISIN_1g006179mg                   170   4e-44   
ref|XP_002300276.2|  hypothetical protein POPTR_0001s30010g             169   6e-44   Populus trichocarpa [western balsam poplar]
ref|XP_007199732.1|  hypothetical protein PRUPE_ppa002634mg             169   1e-43   
ref|XP_006379165.1|  hypothetical protein POPTR_0009s09030g             166   7e-43   
ref|XP_008236305.1|  PREDICTED: cingulin isoform X1                     164   3e-42   
ref|XP_008236307.1|  PREDICTED: cingulin isoform X3                     164   5e-42   
ref|XP_003516769.1|  PREDICTED: golgin subfamily B member 1-like ...    163   7e-42   
ref|XP_008455043.1|  PREDICTED: CAP-Gly domain-containing linker ...    162   1e-41   
ref|XP_006573902.1|  PREDICTED: golgin subfamily B member 1-like ...    162   2e-41   
ref|XP_008368764.1|  PREDICTED: uncharacterized protein LOC103432352    159   2e-41   
ref|XP_008455046.1|  PREDICTED: CAP-Gly domain-containing linker ...    160   4e-41   
gb|KDP44511.1|  hypothetical protein JCGZ_16344                         160   8e-41   
ref|XP_008455041.1|  PREDICTED: CAP-Gly domain-containing linker ...    160   9e-41   
ref|XP_002532426.1|  conserved hypothetical protein                     160   1e-40   Ricinus communis
ref|XP_004511316.1|  PREDICTED: kinesin-like protein KIF20B-like ...    160   1e-40   
ref|XP_008455045.1|  PREDICTED: CAP-Gly domain-containing linker ...    160   1e-40   
ref|XP_004511317.1|  PREDICTED: kinesin-like protein KIF20B-like ...    159   1e-40   
ref|XP_007157206.1|  hypothetical protein PHAVU_002G051500g             159   2e-40   
ref|XP_010274392.1|  PREDICTED: myosin-3 isoform X2                     157   4e-40   
ref|XP_010274390.1|  PREDICTED: TATA element modulatory factor is...    158   6e-40   
gb|KHN30437.1|  hypothetical protein glysoja_033175                     157   6e-40   
ref|XP_004137083.1|  PREDICTED: uncharacterized protein LOC101211967    155   5e-39   
ref|XP_009375663.1|  PREDICTED: uncharacterized protein LOC103964...    155   5e-39   
ref|XP_004155483.1|  PREDICTED: uncharacterized LOC101211967            155   6e-39   
ref|XP_008364382.1|  PREDICTED: cingulin-like isoform X1                154   9e-39   
ref|XP_008364384.1|  PREDICTED: spindle pole body component 110-l...    154   1e-38   
ref|XP_010028357.1|  PREDICTED: golgin subfamily A member 4             151   1e-37   
ref|XP_010091019.1|  hypothetical protein L484_005056                   149   9e-37   
ref|XP_009102315.1|  PREDICTED: myosin heavy chain, clone 203 iso...    147   2e-36   
emb|CDY49597.1|  BnaAnng10260D                                          147   4e-36   
emb|CDX71169.1|  BnaC07g04480D                                          147   7e-36   
ref|XP_006409644.1|  hypothetical protein EUTSA_v10022593mg             145   2e-35   
ref|XP_008236306.1|  PREDICTED: cingulin isoform X2                     144   4e-35   
dbj|BAC43422.2|  unknown protein                                        140   5e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102316.1|  PREDICTED: myosin heavy chain, clone 203 iso...    141   5e-34   
ref|XP_002883848.1|  predicted protein                                  140   9e-34   
ref|XP_010530702.1|  PREDICTED: TATA element modulatory factor          140   1e-33   
ref|XP_010942768.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-2 hea...    140   1e-33   
ref|NP_179075.1|  protein MATERNAL EFFECT EMBRYO ARREST 13              138   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691568.1|  PREDICTED: synaptonemal complex protein 1 is...    138   5e-33   
ref|XP_010691570.1|  PREDICTED: centrosomal protein of 128 kDa is...    138   5e-33   
ref|XP_010488904.1|  PREDICTED: myosin heavy chain, clone 203-lik...    137   6e-33   
ref|NP_001154517.1|  protein MATERNAL EFFECT EMBRYO ARREST 13           138   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496771.1|  PREDICTED: uncharacterized protein LOC104773...    137   7e-33   
ref|XP_010496767.1|  PREDICTED: myosin heavy chain, clone 203-lik...    137   8e-33   
ref|XP_010488901.1|  PREDICTED: myosin heavy chain, clone 203-lik...    137   1e-32   
ref|XP_010496769.1|  PREDICTED: myosin heavy chain, clone 203-lik...    137   1e-32   
ref|XP_010496768.1|  PREDICTED: myosin heavy chain, clone 203-lik...    137   1e-32   
ref|XP_010517645.1|  PREDICTED: myosin heavy chain, clone 203-lik...    137   1e-32   
ref|XP_010496763.1|  PREDICTED: myosin heavy chain, clone 203-lik...    136   2e-32   
ref|XP_010517639.1|  PREDICTED: myosin heavy chain, clone 203-lik...    136   2e-32   
ref|XP_006297176.1|  hypothetical protein CARUB_v10013180mg             135   5e-32   
ref|XP_008795652.1|  PREDICTED: myosin-10 isoform X2                    127   6e-29   
ref|XP_008795651.1|  PREDICTED: myosin-10 isoform X1                    127   6e-29   
ref|XP_009394357.1|  PREDICTED: myosin-10                               122   2e-27   
ref|XP_006857161.1|  hypothetical protein AMTR_s00065p00166970          119   2e-26   
ref|XP_004983921.1|  PREDICTED: putative leucine-rich repeat-cont...    116   3e-25   
ref|XP_004983919.1|  PREDICTED: putative leucine-rich repeat-cont...    116   3e-25   
gb|AFW89938.1|  hypothetical protein ZEAMMB73_155311                    113   5e-25   
gb|AFW89940.1|  hypothetical protein ZEAMMB73_155311                    113   6e-25   
ref|XP_002446611.1|  hypothetical protein SORBIDRAFT_06g018840          114   2e-24   Sorghum bicolor [broomcorn]
ref|XP_008660609.1|  PREDICTED: paramyosin isoform X1                   112   4e-24   
ref|XP_008660610.1|  PREDICTED: putative leucine-rich repeat-cont...    112   7e-24   
ref|XP_002465071.1|  hypothetical protein SORBIDRAFT_01g031580          109   5e-23   Sorghum bicolor [broomcorn]
dbj|BAJ94675.1|  predicted protein                                      108   7e-23   
ref|NP_001173486.1|  Os03g0431932                                       105   8e-23   
gb|EPS73785.1|  hypothetical protein M569_00972                         107   9e-23   
ref|XP_003577215.1|  PREDICTED: uncharacterized protein LOC100842072    108   2e-22   
gb|EMT02263.1|  hypothetical protein F775_07028                         105   2e-21   
gb|EMS67805.1|  hypothetical protein TRIUR3_20989                       105   3e-21   
gb|EEC75538.1|  hypothetical protein OsI_12160                          104   3e-21   Oryza sativa Indica Group [Indian rice]
gb|AAR87154.1|  expressed protein                                       104   3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650223.1|  PREDICTED: desmoplakin-like isoform X1           98.6    2e-19   
ref|XP_003610611.1|  hypothetical protein MTR_5g005010                97.1    7e-19   
ref|XP_003610612.1|  hypothetical protein MTR_5g005020                85.9    3e-17   
ref|XP_007042661.1|  Myosin heavy chain-related protein, putative...  72.8    3e-11   
ref|XP_010496770.1|  PREDICTED: myosin heavy chain, clone 203-lik...  69.3    1e-09   
ref|XP_010488905.1|  PREDICTED: myosin heavy chain, clone 203-lik...  68.6    2e-09   
ref|XP_001752008.1|  predicted protein                                64.3    5e-08   
ref|XP_008665796.1|  PREDICTED: uncharacterized protein LOC103644363  58.5    3e-07   
gb|AFW89939.1|  hypothetical protein ZEAMMB73_155311                  57.4    5e-06   
tpg|DAA52643.1|  TPA: hypothetical protein ZEAMMB73_102228            56.2    2e-05   
ref|XP_008660611.1|  PREDICTED: paramyosin isoform X3                 56.6    2e-05   
ref|XP_010647913.1|  PREDICTED: myosin-10 isoform X3                  56.2    2e-05   
ref|XP_004983922.1|  PREDICTED: putative leucine-rich repeat-cont...  54.7    7e-05   



>ref|XP_004230689.1| PREDICTED: MAR-binding filament-like protein 1-1 isoform X1 [Solanum 
lycopersicum]
Length=644

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 141/190 (74%), Gaps = 6/190 (3%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVN  666
            K +Q  +QGK   EI  KKT+Q+ +GR KNLLK +YL+RW G  DS+GNDA+ +  SE N
Sbjct  454  KVNQASRQGKSLGEIAVKKTLQEKDGRLKNLLKTSYLRRWTGLQDSDGNDADIHRDSEAN  513

Query  665  SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIY  492
            ++ FARMKIENATL+ESLE MEHL  ++RRLR SLLK KE   +K   N S ESL+NII 
Sbjct  514  NMDFARMKIENATLKESLESMEHLIRAVRRLRLSLLKFKEPAASKGMENCSSESLDNIIN  573

Query  491  EAKLLKTALGTSLPVSWSAESDSGYNKEMLDD--DCTHTSKEKIDFVSAAGFEMVELLVF  318
            EA  LKTALG SLP+SWS E+DSG +   +++  D  H+++E +DFVSAAGFEMVELLVF
Sbjct  574  EASQLKTALGISLPLSWSVEADSGSSSRCVEEEMDNGHSTRENMDFVSAAGFEMVELLVF  633

Query  317  AAQLLKEKTC  288
             AQLLKE  C
Sbjct  634  VAQLLKEYKC  643



>ref|XP_010315174.1| PREDICTED: myosin heavy chain, cardiac muscle isoform isoform 
X2 [Solanum lycopersicum]
Length=635

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 141/190 (74%), Gaps = 6/190 (3%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVN  666
            K +Q  +QGK   EI  KKT+Q+ +GR KNLLK +YL+RW G  DS+GNDA+ +  SE N
Sbjct  445  KVNQASRQGKSLGEIAVKKTLQEKDGRLKNLLKTSYLRRWTGLQDSDGNDADIHRDSEAN  504

Query  665  SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIY  492
            ++ FARMKIENATL+ESLE MEHL  ++RRLR SLLK KE   +K   N S ESL+NII 
Sbjct  505  NMDFARMKIENATLKESLESMEHLIRAVRRLRLSLLKFKEPAASKGMENCSSESLDNIIN  564

Query  491  EAKLLKTALGTSLPVSWSAESDSGYNKEMLDD--DCTHTSKEKIDFVSAAGFEMVELLVF  318
            EA  LKTALG SLP+SWS E+DSG +   +++  D  H+++E +DFVSAAGFEMVELLVF
Sbjct  565  EASQLKTALGISLPLSWSVEADSGSSSRCVEEEMDNGHSTRENMDFVSAAGFEMVELLVF  624

Query  317  AAQLLKEKTC  288
             AQLLKE  C
Sbjct  625  VAQLLKEYKC  634



>ref|XP_006346295.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X3 [Solanum tuberosum]
Length=632

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 143/190 (75%), Gaps = 6/190 (3%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVN  666
            K +Q  +QGK   EI  K+T+Q+ +GR KNLLK +YL+RW G  DS+GNDA+++  SE N
Sbjct  442  KVNQASRQGKSLGEIAVKRTLQEKDGRLKNLLKTSYLRRWTGIQDSDGNDADTHRDSEAN  501

Query  665  SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIY  492
            ++ FARMKIENATL+ESLE MEHL  ++RR R SLLK KE   +K   N S ESL+NII 
Sbjct  502  NMDFARMKIENATLKESLESMEHLICAVRRHRLSLLKFKEPAASKGMENCSLESLDNIIN  561

Query  491  EAKLLKTALGTSLPVSWSAESDSG-YNKEMLDD-DCTHTSKEKIDFVSAAGFEMVELLVF  318
            EA  LKTALG SLP+SWS E+DSG ++K + ++ D  H+++E +DFVSAAGFEMVELLVF
Sbjct  562  EASQLKTALGISLPLSWSVEADSGSFSKRVEEEIDNGHSTRENMDFVSAAGFEMVELLVF  621

Query  317  AAQLLKEKTC  288
             AQLLKE  C
Sbjct  622  VAQLLKENKC  631



>ref|XP_006346293.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X1 [Solanum tuberosum]
Length=645

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 143/190 (75%), Gaps = 6/190 (3%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVN  666
            K +Q  +QGK   EI  K+T+Q+ +GR KNLLK +YL+RW G  DS+GNDA+++  SE N
Sbjct  455  KVNQASRQGKSLGEIAVKRTLQEKDGRLKNLLKTSYLRRWTGIQDSDGNDADTHRDSEAN  514

Query  665  SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIY  492
            ++ FARMKIENATL+ESLE MEHL  ++RR R SLLK KE   +K   N S ESL+NII 
Sbjct  515  NMDFARMKIENATLKESLESMEHLICAVRRHRLSLLKFKEPAASKGMENCSLESLDNIIN  574

Query  491  EAKLLKTALGTSLPVSWSAESDSG-YNKEMLDD-DCTHTSKEKIDFVSAAGFEMVELLVF  318
            EA  LKTALG SLP+SWS E+DSG ++K + ++ D  H+++E +DFVSAAGFEMVELLVF
Sbjct  575  EASQLKTALGISLPLSWSVEADSGSFSKRVEEEIDNGHSTRENMDFVSAAGFEMVELLVF  634

Query  317  AAQLLKEKTC  288
             AQLLKE  C
Sbjct  635  VAQLLKENKC  644



>ref|XP_006346294.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X2 [Solanum tuberosum]
Length=636

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 143/190 (75%), Gaps = 6/190 (3%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVN  666
            K +Q  +QGK   EI  K+T+Q+ +GR KNLLK +YL+RW G  DS+GNDA+++  SE N
Sbjct  446  KVNQASRQGKSLGEIAVKRTLQEKDGRLKNLLKTSYLRRWTGIQDSDGNDADTHRDSEAN  505

Query  665  SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIY  492
            ++ FARMKIENATL+ESLE MEHL  ++RR R SLLK KE   +K   N S ESL+NII 
Sbjct  506  NMDFARMKIENATLKESLESMEHLICAVRRHRLSLLKFKEPAASKGMENCSLESLDNIIN  565

Query  491  EAKLLKTALGTSLPVSWSAESDSG-YNKEMLDD-DCTHTSKEKIDFVSAAGFEMVELLVF  318
            EA  LKTALG SLP+SWS E+DSG ++K + ++ D  H+++E +DFVSAAGFEMVELLVF
Sbjct  566  EASQLKTALGISLPLSWSVEADSGSFSKRVEEEIDNGHSTRENMDFVSAAGFEMVELLVF  625

Query  317  AAQLLKEKTC  288
             AQLLKE  C
Sbjct  626  VAQLLKENKC  635



>ref|XP_009758361.1| PREDICTED: uncharacterized protein LOC104211063 isoform X2 [Nicotiana 
sylvestris]
Length=474

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 141/197 (72%), Gaps = 13/197 (7%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEV-  669
            K +Q  +QGK   EI  K+ VQ+ +GR KNLLK +YL+RW G  DS+GNDA+++  SEV 
Sbjct  277  KVNQASRQGKSVGEIAVKRPVQEKDGRLKNLLKTSYLRRWTGIQDSDGNDADTHRDSEVI  336

Query  668  -------NSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNN--SP  516
                   NS+ +ARMKIENATL+ESLE M+HL  ++RRLR SLLKVKE   ++     S 
Sbjct  337  YADRRPTNSMDYARMKIENATLKESLESMDHLIRAVRRLRLSLLKVKESAASEGTEYCSS  396

Query  515  ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCT-HTSKEKIDFVSAAGFE  339
            ESL+ II EA  LKTALG+SLP+SWSAE+DSG   E ++ D   H++ E +DFVSAAGFE
Sbjct  397  ESLDTIINEANQLKTALGSSLPLSWSAEADSGSFSERIEIDVNGHSTGENMDFVSAAGFE  456

Query  338  MVELLVFAAQLLKEKTC  288
            MVELLVF AQLLKE  C
Sbjct  457  MVELLVFIAQLLKEDKC  473



>ref|XP_009758360.1| PREDICTED: uncharacterized protein LOC104211063 isoform X1 [Nicotiana 
sylvestris]
Length=546

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 141/197 (72%), Gaps = 13/197 (7%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEV-  669
            K +Q  +QGK   EI  K+ VQ+ +GR KNLLK +YL+RW G  DS+GNDA+++  SEV 
Sbjct  349  KVNQASRQGKSVGEIAVKRPVQEKDGRLKNLLKTSYLRRWTGIQDSDGNDADTHRDSEVI  408

Query  668  -------NSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNN--SP  516
                   NS+ +ARMKIENATL+ESLE M+HL  ++RRLR SLLKVKE   ++     S 
Sbjct  409  YADRRPTNSMDYARMKIENATLKESLESMDHLIRAVRRLRLSLLKVKESAASEGTEYCSS  468

Query  515  ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCT-HTSKEKIDFVSAAGFE  339
            ESL+ II EA  LKTALG+SLP+SWSAE+DSG   E ++ D   H++ E +DFVSAAGFE
Sbjct  469  ESLDTIINEANQLKTALGSSLPLSWSAEADSGSFSERIEIDVNGHSTGENMDFVSAAGFE  528

Query  338  MVELLVFAAQLLKEKTC  288
            MVELLVF AQLLKE  C
Sbjct  529  MVELLVFIAQLLKEDKC  545



>ref|XP_009606150.1| PREDICTED: liprin-alpha-2 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009606151.1| PREDICTED: liprin-alpha-2 isoform X2 [Nicotiana tomentosiformis]
Length=643

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 140/199 (70%), Gaps = 15/199 (8%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEV-  669
            K +Q  +QGK   EI  K+ VQ+ +GR KNLLK +YL+RW G  D++GNDA+ +  SEV 
Sbjct  444  KVNQASRQGKSVGEITVKRPVQEKDGRLKNLLKTSYLRRWTGIQDADGNDADIHRDSEVI  503

Query  668  -------NSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNN--SP  516
                   NS+ +ARMKIENATL+ESLE M+HL  ++RRLR SLLKVKE   ++     S 
Sbjct  504  YADRRPANSMDYARMKIENATLKESLESMDHLIRAVRRLRLSLLKVKESAASEGTEYCSS  563

Query  515  ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCT---HTSKEKIDFVSAAG  345
            ESL+ II EA  LKTALG+SLP+SWSAE+DSG   E ++++     H++ E +DFVSAAG
Sbjct  564  ESLDTIINEANQLKTALGSSLPLSWSAEADSGSLSERVEEEIDVNGHSTGENMDFVSAAG  623

Query  344  FEMVELLVFAAQLLKEKTC  288
            FEMVELLV  AQLLKE  C
Sbjct  624  FEMVELLVLIAQLLKEDKC  642



>ref|XP_009606148.1| PREDICTED: liprin-alpha-2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009606149.1| PREDICTED: liprin-alpha-2 isoform X1 [Nicotiana tomentosiformis]
Length=652

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 140/199 (70%), Gaps = 15/199 (8%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEV-  669
            K +Q  +QGK   EI  K+ VQ+ +GR KNLLK +YL+RW G  D++GNDA+ +  SEV 
Sbjct  453  KVNQASRQGKSVGEITVKRPVQEKDGRLKNLLKTSYLRRWTGIQDADGNDADIHRDSEVI  512

Query  668  -------NSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNN--SP  516
                   NS+ +ARMKIENATL+ESLE M+HL  ++RRLR SLLKVKE   ++     S 
Sbjct  513  YADRRPANSMDYARMKIENATLKESLESMDHLIRAVRRLRLSLLKVKESAASEGTEYCSS  572

Query  515  ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCT---HTSKEKIDFVSAAG  345
            ESL+ II EA  LKTALG+SLP+SWSAE+DSG   E ++++     H++ E +DFVSAAG
Sbjct  573  ESLDTIINEANQLKTALGSSLPLSWSAEADSGSLSERVEEEIDVNGHSTGENMDFVSAAG  632

Query  344  FEMVELLVFAAQLLKEKTC  288
            FEMVELLV  AQLLKE  C
Sbjct  633  FEMVELLVLIAQLLKEDKC  651



>ref|XP_007042659.1| Myosin heavy chain-related protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOX98490.1| Myosin heavy chain-related protein, putative isoform 2 [Theobroma 
cacao]
Length=647

 Score =   192 bits (489),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 148/212 (70%), Gaps = 17/212 (8%)
 Frame = -2

Query  890  FQLLF*NVHHFVVTYCRKDDQDMKQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG  714
            +QLL   +H    TY RK   +MKQG   +E+  ++ +  + +GR +NLLKKTYL+RWVG
Sbjct  439  YQLLQERLH----TYHRKISNEMKQGNVLAEVANRRIITSERDGRLRNLLKKTYLRRWVG  494

Query  713  --DSEGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECI  540
              D+ G++AE+ PSS    + FARM+IENATLRES+  +EHLTS++ RLR SLLKV E I
Sbjct  495  AIDARGSEAEAQPSS----MDFARMRIENATLRESMGSLEHLTSAVHRLRLSLLKVTESI  550

Query  539  DTK--TNNSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH----TS  378
             ++   ++S E+L+ I+ EAKL+KTALG+SLPVSWSAE D     E    +  +    +S
Sbjct  551  TSEGTDSSSSEALDEIVTEAKLVKTALGSSLPVSWSAEGDGELIGENAGSEVGNIFEDSS  610

Query  377  KEKIDFVSAAGFEMVELLVFAAQLLKEKTCRG  282
             EKID VSAAGFEMV+LL+ AAQ+LKE+T  G
Sbjct  611  IEKIDSVSAAGFEMVDLLILAAQILKERTRTG  642



>gb|EYU21870.1| hypothetical protein MIMGU_mgv1a023746mg, partial [Erythranthe 
guttata]
Length=475

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 125/177 (71%), Gaps = 19/177 (11%)
 Frame = -2

Query  824  MKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDSEGNDAESYPSSEVNSIGFARM  645
            M +GK   E   ++TVQ+ +GR KNLLKK+YL RWVG   G+D    PS   + + FARM
Sbjct  316  MNEGKHLGETVERRTVQEKDGRLKNLLKKSYLTRWVG---GSDDYEKPS---HHMDFARM  369

Query  644  KIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSPESLENIIYEAKLLKTAL  465
            KIENATL+ESLE MEHL SS+RRLR SLL+VKE  + K+ NS ESLE II EA L+KTAL
Sbjct  370  KIENATLKESLESMEHLLSSVRRLRISLLEVKELGEGKSENSMESLERIIVEANLVKTAL  429

Query  464  GTSLPVSWSAESDSGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
            G+SLP+SW  E+D  Y+             EK+DFVS AGFEMVELL+FAA LLK++
Sbjct  430  GSSLPISWCGETDGSYD-------------EKMDFVSGAGFEMVELLIFAAHLLKDR  473



>ref|XP_010647912.1| PREDICTED: myosin-10 isoform X2 [Vitis vinifera]
Length=661

 Score =   189 bits (479),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 142/202 (70%), Gaps = 17/202 (8%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQ-DGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEV  669
            K   DMKQG   ++IG K+    + +G+ KNLLKKTYL+RW+G  D  GN AE++ +SE 
Sbjct  442  KISHDMKQGNFLADIGEKRNATLERDGKLKNLLKKTYLRRWIGALDYSGNQAEAHLNSEG  501

Query  668  N--------SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP-  516
            N        S+ FARMKIENATL+ES+E +EHLTSSIRRLR +LL+ KE + +    S  
Sbjct  502  NFSGRKSNYSMDFARMKIENATLKESMESIEHLTSSIRRLRLTLLEAKESVTSGGTVSSV  561

Query  515  -ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDD--DCTH--TSKEKIDFVSA  351
             E+L++II EAKL+KTALG+SLPVSWSAE+D     E +D+   C H  +S EKID V A
Sbjct  562  LEALDDIINEAKLVKTALGSSLPVSWSAEADGESFGESMDNAPGCFHGDSSSEKIDSVCA  621

Query  350  AGFEMVELLVFAAQLLKEKTCR  285
            AGFEMVELL+FA Q+LK+ T +
Sbjct  622  AGFEMVELLIFAVQVLKDSTIK  643



>ref|XP_010647911.1| PREDICTED: myosin-10 isoform X1 [Vitis vinifera]
 emb|CBI22439.3| unnamed protein product [Vitis vinifera]
Length=673

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 142/202 (70%), Gaps = 17/202 (8%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQ-DGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEV  669
            K   DMKQG   ++IG K+    + +G+ KNLLKKTYL+RW+G  D  GN AE++ +SE 
Sbjct  454  KISHDMKQGNFLADIGEKRNATLERDGKLKNLLKKTYLRRWIGALDYSGNQAEAHLNSEG  513

Query  668  N--------SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP-  516
            N        S+ FARMKIENATL+ES+E +EHLTSSIRRLR +LL+ KE + +    S  
Sbjct  514  NFSGRKSNYSMDFARMKIENATLKESMESIEHLTSSIRRLRLTLLEAKESVTSGGTVSSV  573

Query  515  -ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDD--DCTH--TSKEKIDFVSA  351
             E+L++II EAKL+KTALG+SLPVSWSAE+D     E +D+   C H  +S EKID V A
Sbjct  574  LEALDDIINEAKLVKTALGSSLPVSWSAEADGESFGESMDNAPGCFHGDSSSEKIDSVCA  633

Query  350  AGFEMVELLVFAAQLLKEKTCR  285
            AGFEMVELL+FA Q+LK+ T +
Sbjct  634  AGFEMVELLIFAVQVLKDSTIK  655



>emb|CAN60964.1| hypothetical protein VITISV_013873 [Vitis vinifera]
Length=655

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 142/202 (70%), Gaps = 17/202 (8%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQ-DGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEV  669
            K   DMKQG   ++IG K+    + +G+ KNLLKKTYL+RW+G  D  GN AE++ +SE 
Sbjct  436  KISHDMKQGNFLADIGEKRNATLERDGKLKNLLKKTYLRRWIGALDYSGNQAEAHLNSEG  495

Query  668  N--------SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP-  516
            N        S+ FARMKIENATL+ES+E +EHLTSSIRRLR +LL+ KE + +    S  
Sbjct  496  NFSGRKSNYSMDFARMKIENATLKESMESIEHLTSSIRRLRLTLLEAKESVTSGGTVSSV  555

Query  515  -ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDD--DCTH--TSKEKIDFVSA  351
             E+L++II EAKL+KTALG+SLPVSWSAE+D     E +D+   C H  +S EKID V A
Sbjct  556  LEALDDIINEAKLVKTALGSSLPVSWSAEADGESFGESMDNAPGCFHGDSSSEKIDSVCA  615

Query  350  AGFEMVELLVFAAQLLKEKTCR  285
            AGFEMVELL+FA Q+LK+ T +
Sbjct  616  AGFEMVELLIFAVQVLKDSTIK  637



>ref|XP_011088079.1| PREDICTED: myosin-2 heavy chain [Sesamum indicum]
Length=644

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 130/181 (72%), Gaps = 12/181 (7%)
 Frame = -2

Query  830  QDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDSEGNDAESYPSSEVNS--IG  657
            QD  QG    EI  ++ V + +G+ KNLLKK+Y  RWVG S+GN+A+ +   E  S  + 
Sbjct  458  QDKIQGTQSGEIAERRIVPEKDGKLKNLLKKSYFTRWVGGSDGNNADGHHHYEKTSHHMD  517

Query  656  FARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNN--SPESLENIIYEAK  483
            FARM+IENA+L+ESLE MEHL SS+RRLR +LLKVK+    +T N    E+L+ +I EA 
Sbjct  518  FARMRIENASLKESLESMEHLLSSVRRLRITLLKVKDSAAAETENGMHVEALDQVIAEAN  577

Query  482  LLKTALGTSLPVSWSAESDSGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLL  303
            L+KTAL +SLP+SWSAE+D  YN+  ++D+      EK+DFVSAAG EMVELL+FAAQ+L
Sbjct  578  LVKTALSSSLPISWSAETDQLYNE--INDN------EKVDFVSAAGLEMVELLIFAAQIL  629

Query  302  K  300
            K
Sbjct  630  K  630



>ref|XP_007042660.1| Myosin heavy chain-related protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOX98491.1| Myosin heavy chain-related protein, putative isoform 3 [Theobroma 
cacao]
Length=619

 Score =   183 bits (464),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 138/191 (72%), Gaps = 13/191 (7%)
 Frame = -2

Query  827  DMKQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVNSIG  657
            +MKQG   +E+  ++ +  + +GR +NLLKKTYL+RWVG  D+ G++AE+ PSS    + 
Sbjct  428  EMKQGNVLAEVANRRIITSERDGRLRNLLKKTYLRRWVGAIDARGSEAEAQPSS----MD  483

Query  656  FARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIYEAK  483
            FARM+IENATLRES+  +EHLTS++ RLR SLLKV E I ++   ++S E+L+ I+ EAK
Sbjct  484  FARMRIENATLRESMGSLEHLTSAVHRLRLSLLKVTESITSEGTDSSSSEALDEIVTEAK  543

Query  482  LLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH----TSKEKIDFVSAAGFEMVELLVFA  315
            L+KTALG+SLPVSWSAE D     E    +  +    +S EKID VSAAGFEMV+LL+ A
Sbjct  544  LVKTALGSSLPVSWSAEGDGELIGENAGSEVGNIFEDSSIEKIDSVSAAGFEMVDLLILA  603

Query  314  AQLLKEKTCRG  282
            AQ+LKE+T  G
Sbjct  604  AQILKERTRTG  614



>ref|XP_007042658.1| Myosin heavy chain-related protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOX98489.1| Myosin heavy chain-related protein, putative isoform 1 [Theobroma 
cacao]
Length=678

 Score =   183 bits (464),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 138/191 (72%), Gaps = 13/191 (7%)
 Frame = -2

Query  827  DMKQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVNSIG  657
            +MKQG   +E+  ++ +  + +GR +NLLKKTYL+RWVG  D+ G++AE+ PSS    + 
Sbjct  487  EMKQGNVLAEVANRRIITSERDGRLRNLLKKTYLRRWVGAIDARGSEAEAQPSS----MD  542

Query  656  FARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIYEAK  483
            FARM+IENATLRES+  +EHLTS++ RLR SLLKV E I ++   ++S E+L+ I+ EAK
Sbjct  543  FARMRIENATLRESMGSLEHLTSAVHRLRLSLLKVTESITSEGTDSSSSEALDEIVTEAK  602

Query  482  LLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH----TSKEKIDFVSAAGFEMVELLVFA  315
            L+KTALG+SLPVSWSAE D     E    +  +    +S EKID VSAAGFEMV+LL+ A
Sbjct  603  LVKTALGSSLPVSWSAEGDGELIGENAGSEVGNIFEDSSIEKIDSVSAAGFEMVDLLILA  662

Query  314  AQLLKEKTCRG  282
            AQ+LKE+T  G
Sbjct  663  AQILKERTRTG  673



>ref|XP_011030332.1| PREDICTED: uncharacterized protein LOC105129798 isoform X4 [Populus 
euphratica]
Length=567

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 139/205 (68%), Gaps = 27/205 (13%)
 Frame = -2

Query  818  QGKPHSEIGGKKTVQDGE---------GRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE  672
            Q K  SEI G  +   GE         G+ +NLLK+TYL+RW+G  D  GN+A++ PSSE
Sbjct  363  QKKVGSEIKGDFSADTGEIRLSNIERDGKIRNLLKRTYLRRWMGTMDFRGNEAQTCPSSE  422

Query  671  -------VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP-  516
                    N + FARMKIENATL+ES+ECM+HL SSI RL  +LLKVKE  DT+   S  
Sbjct  423  GNFSGKRANDMDFARMKIENATLKESMECMDHLISSIHRLHLALLKVKES-DTREGTSTG  481

Query  515  --ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCT----HTSKEKIDFVS  354
              E+L +II EA+L+KTALG+SLP+SWSAE+D     E + D+ +    + S+EKID VS
Sbjct  482  LLEALNDIISEARLVKTALGSSLPISWSAEADDASIGESVCDELSDIYGNPSREKIDSVS  541

Query  353  AAGFEMVELLVFAAQLLKE-KTCRG  282
            AAGFEMVELL+ AAQ+LK+ KT +G
Sbjct  542  AAGFEMVELLILAAQILKDNKTTKG  566



>ref|XP_011030328.1| PREDICTED: nucleoprotein TPR-like isoform X2 [Populus euphratica]
Length=652

 Score =   181 bits (459),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 139/205 (68%), Gaps = 27/205 (13%)
 Frame = -2

Query  818  QGKPHSEIGGKKTVQDGE---------GRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE  672
            Q K  SEI G  +   GE         G+ +NLLK+TYL+RW+G  D  GN+A++ PSSE
Sbjct  448  QKKVGSEIKGDFSADTGEIRLSNIERDGKIRNLLKRTYLRRWMGTMDFRGNEAQTCPSSE  507

Query  671  -------VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP-  516
                    N + FARMKIENATL+ES+ECM+HL SSI RL  +LLKVKE  DT+   S  
Sbjct  508  GNFSGKRANDMDFARMKIENATLKESMECMDHLISSIHRLHLALLKVKES-DTREGTSTG  566

Query  515  --ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCT----HTSKEKIDFVS  354
              E+L +II EA+L+KTALG+SLP+SWSAE+D     E + D+ +    + S+EKID VS
Sbjct  567  LLEALNDIISEARLVKTALGSSLPISWSAEADDASIGESVCDELSDIYGNPSREKIDSVS  626

Query  353  AAGFEMVELLVFAAQLLKE-KTCRG  282
            AAGFEMVELL+ AAQ+LK+ KT +G
Sbjct  627  AAGFEMVELLILAAQILKDNKTTKG  651



>ref|XP_011030333.1| PREDICTED: nucleoprotein TPR-like isoform X5 [Populus euphratica]
Length=631

 Score =   181 bits (458),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 139/205 (68%), Gaps = 27/205 (13%)
 Frame = -2

Query  818  QGKPHSEIGGKKTVQDGE---------GRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE  672
            Q K  SEI G  +   GE         G+ +NLLK+TYL+RW+G  D  GN+A++ PSSE
Sbjct  427  QKKVGSEIKGDFSADTGEIRLSNIERDGKIRNLLKRTYLRRWMGTMDFRGNEAQTCPSSE  486

Query  671  -------VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP-  516
                    N + FARMKIENATL+ES+ECM+HL SSI RL  +LLKVKE  DT+   S  
Sbjct  487  GNFSGKRANDMDFARMKIENATLKESMECMDHLISSIHRLHLALLKVKES-DTREGTSTG  545

Query  515  --ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCT----HTSKEKIDFVS  354
              E+L +II EA+L+KTALG+SLP+SWSAE+D     E + D+ +    + S+EKID VS
Sbjct  546  LLEALNDIISEARLVKTALGSSLPISWSAEADDASIGESVCDELSDIYGNPSREKIDSVS  605

Query  353  AAGFEMVELLVFAAQLLKE-KTCRG  282
            AAGFEMVELL+ AAQ+LK+ KT +G
Sbjct  606  AAGFEMVELLILAAQILKDNKTTKG  630



>ref|XP_011030326.1| PREDICTED: protein GRIP-like isoform X1 [Populus euphratica]
 ref|XP_011030327.1| PREDICTED: protein GRIP-like isoform X1 [Populus euphratica]
Length=669

 Score =   181 bits (458),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 139/205 (68%), Gaps = 27/205 (13%)
 Frame = -2

Query  818  QGKPHSEIGGKKTVQDGE---------GRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE  672
            Q K  SEI G  +   GE         G+ +NLLK+TYL+RW+G  D  GN+A++ PSSE
Sbjct  465  QKKVGSEIKGDFSADTGEIRLSNIERDGKIRNLLKRTYLRRWMGTMDFRGNEAQTCPSSE  524

Query  671  -------VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP-  516
                    N + FARMKIENATL+ES+ECM+HL SSI RL  +LLKVKE  DT+   S  
Sbjct  525  GNFSGKRANDMDFARMKIENATLKESMECMDHLISSIHRLHLALLKVKES-DTREGTSTG  583

Query  515  --ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCT----HTSKEKIDFVS  354
              E+L +II EA+L+KTALG+SLP+SWSAE+D     E + D+ +    + S+EKID VS
Sbjct  584  LLEALNDIISEARLVKTALGSSLPISWSAEADDASIGESVCDELSDIYGNPSREKIDSVS  643

Query  353  AAGFEMVELLVFAAQLLKE-KTCRG  282
            AAGFEMVELL+ AAQ+LK+ KT +G
Sbjct  644  AAGFEMVELLILAAQILKDNKTTKG  668



>ref|XP_011030329.1| PREDICTED: protein GRIP-like isoform X3 [Populus euphratica]
 ref|XP_011030330.1| PREDICTED: protein GRIP-like isoform X3 [Populus euphratica]
 ref|XP_011030331.1| PREDICTED: protein GRIP-like isoform X3 [Populus euphratica]
Length=648

 Score =   180 bits (457),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 139/205 (68%), Gaps = 27/205 (13%)
 Frame = -2

Query  818  QGKPHSEIGGKKTVQDGE---------GRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE  672
            Q K  SEI G  +   GE         G+ +NLLK+TYL+RW+G  D  GN+A++ PSSE
Sbjct  444  QKKVGSEIKGDFSADTGEIRLSNIERDGKIRNLLKRTYLRRWMGTMDFRGNEAQTCPSSE  503

Query  671  -------VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP-  516
                    N + FARMKIENATL+ES+ECM+HL SSI RL  +LLKVKE  DT+   S  
Sbjct  504  GNFSGKRANDMDFARMKIENATLKESMECMDHLISSIHRLHLALLKVKES-DTREGTSTG  562

Query  515  --ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCT----HTSKEKIDFVS  354
              E+L +II EA+L+KTALG+SLP+SWSAE+D     E + D+ +    + S+EKID VS
Sbjct  563  LLEALNDIISEARLVKTALGSSLPISWSAEADDASIGESVCDELSDIYGNPSREKIDSVS  622

Query  353  AAGFEMVELLVFAAQLLKE-KTCRG  282
            AAGFEMVELL+ AAQ+LK+ KT +G
Sbjct  623  AAGFEMVELLILAAQILKDNKTTKG  647



>emb|CDO97287.1| unnamed protein product [Coffea canephora]
Length=661

 Score =   173 bits (438),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 144/219 (66%), Gaps = 27/219 (12%)
 Frame = -2

Query  890  FQLLF*NVHHFVVTYCRKDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVG-  714
            FQ+L  NV           +QD ++G+  +  GG++ +QD +G+ KNLLKKTYL+ WVG 
Sbjct  454  FQVLRENV-----------NQDKREGQACAASGGQRIIQDRDGKLKNLLKKTYLRHWVGN  502

Query  713  -DSEGNDAESYPSSE--------VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSL  561
             DS+ ++A ++ + E         +S+ FAR+KIENA L+E LE ME+LTSS+R+LR +L
Sbjct  503  IDSDTDNAVTHLNYEGHFNQKKSTSSVDFARIKIENAALQEILESMEYLTSSVRKLRLAL  562

Query  560  LKVKECIDTKTNNS--PESLENIIYEAKLLKTALGTSLPVSWSAESDSGYN----KEMLD  399
            LK  E    +  N+   E++ +II EA+LLKTALG+SLP+SWSAE+D        +E + 
Sbjct  563  LKANESAVLEGTNTGLAEAVYDIITEARLLKTALGSSLPISWSAEADVESQVDRFEEAIG  622

Query  398  DDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEKTCRG  282
                ++S EK+DFVSAAG EMV+LL+FAA+L KE+  R 
Sbjct  623  SSDANSSNEKVDFVSAAGLEMVDLLLFAAKLCKERLARS  661



>gb|KHG16396.1| hypothetical protein F383_22976 [Gossypium arboreum]
Length=664

 Score =   172 bits (435),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 136/194 (70%), Gaps = 14/194 (7%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQ-DGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEV  669
            K + ++KQG   +E+  ++    + +G+ K+LLKKTYL+RWVG  D+ GN+AE+ P    
Sbjct  470  KINNEVKQGNVLAEVADRRIATYERDGKLKSLLKKTYLRRWVGALDTGGNEAEASP----  525

Query  668  NSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK-TNNSPESLENIIY  492
            NS+ F RM+IENATL+ES+E M+HLTS++ RLR SLLKV E I++K  + +   L+ II 
Sbjct  526  NSMDFVRMRIENATLKESMESMDHLTSTLHRLRLSLLKVTESINSKDIDTNASELDEIIT  585

Query  491  EAKLLKTALGTSLPVSWSAESDSGYNKEMLD----DDCTHTSKEKIDFVSAAGFEMVELL  324
            EAKL+KTALG+SLP+SWSAE D     E +D    D    +  +KID V+AAGFEM++LL
Sbjct  586  EAKLVKTALGSSLPISWSAEGDGESIGERIDTETGDMFEDSGGQKIDSVTAAGFEMLDLL  645

Query  323  VFAAQLLKEK--TC  288
            + AAQ+LK K  TC
Sbjct  646  ILAAQVLKGKNQTC  659



>ref|XP_006422810.1| hypothetical protein CICLE_v10027970mg [Citrus clementina]
 gb|ESR36050.1| hypothetical protein CICLE_v10027970mg [Citrus clementina]
Length=658

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 133/198 (67%), Gaps = 18/198 (9%)
 Frame = -2

Query  827  DMKQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDA-------ESYPS  678
            +MK+ K  +  G K+ V  + +GR +NLLKKT L+RW+G  D  GND        E + +
Sbjct  459  EMKEEKVLAGNGEKRIVIPERDGRLRNLLKKTNLRRWIGTLDFSGNDGQADLNTREGFST  518

Query  677  SEVNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECI---DTKTNNSPESL  507
               NSI FARM+IENATL+ESLE M+HL SSI RLR SL KVKE     DT  + S E+L
Sbjct  519  RRSNSIDFARMRIENATLKESLENMDHLISSIHRLRLSLSKVKELATSEDTIASMS-ETL  577

Query  506  ENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLD----DDCTHTSKEKIDFVSAAGFE  339
            ++II EAKL+KTALG+SLPVSW AESD G   E  D    D    +S EK+D VSAAGFE
Sbjct  578  DDIITEAKLVKTALGSSLPVSWIAESDDGSINENTDSESGDIHGDSSNEKMDSVSAAGFE  637

Query  338  MVELLVFAAQLLKEKTCR  285
            MVELL+ AAQ+LK+ T +
Sbjct  638  MVELLILAAQILKDSTTK  655



>gb|AES93569.2| myosin heavy chain-like protein [Medicago truncatula]
Length=657

 Score =   171 bits (433),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 125/177 (71%), Gaps = 13/177 (7%)
 Frame = -2

Query  788  KKTVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE-------VNSIGFARMKIE  636
            K  +++ +G  KNLLKK+YL+RW+G  D+ G + +S P++E        +S+ FARMKIE
Sbjct  469  KLVIRERDGTLKNLLKKSYLRRWIGPLDASGKEVDSSPNNEGKFFNQRSSSVDFARMKIE  528

Query  635  NATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNS--PESLENIIYEAKLLKTALG  462
            NATL+ES++CMEHLTSS+ RLR SL KVKE + ++   S   E L   I EAKLL+TALG
Sbjct  529  NATLKESMDCMEHLTSSVHRLRLSLWKVKESVTSEGTVSGVSEVLNGAINEAKLLRTALG  588

Query  461  TSLPVSWSAESDSGYNKEMLDDDCTH--TSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
            +SLP+SWS E++ GY  +    +  H   S EKID VSAAG EMVELL+FAAQ+L++
Sbjct  589  SSLPISWSVETEVGYTGDSKGVETVHQQCSDEKIDTVSAAGLEMVELLIFAAQMLRD  645



>gb|KDO57913.1| hypothetical protein CISIN_1g006179mg [Citrus sinensis]
Length=552

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 132/197 (67%), Gaps = 16/197 (8%)
 Frame = -2

Query  827  DMKQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDA-------ESYPS  678
            +MK+ K  +  G K+ V  + +GR +NLLKKT L+RW+G  D  GN+        E   +
Sbjct  353  EMKEEKVLAGNGEKRIVIPERDGRLRNLLKKTNLRRWIGTLDFSGNEGQADLNIREGIST  412

Query  677  SEVNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLE  504
               NSI FARM+IENATL+ESLE M+HL SSIRRLR SL KVKE   ++    +  E+L+
Sbjct  413  RRSNSIDFARMRIENATLKESLENMDHLISSIRRLRLSLSKVKELATSEDTIGSMSETLD  472

Query  503  NIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLD----DDCTHTSKEKIDFVSAAGFEM  336
            +II EAKL+KTALG+SLPVSW AESD G   E  D    D    +S EK+D VSAAGFEM
Sbjct  473  DIITEAKLVKTALGSSLPVSWIAESDDGSINENTDSESGDIHGDSSNEKMDSVSAAGFEM  532

Query  335  VELLVFAAQLLKEKTCR  285
            VELL+ AAQ+LK+ T +
Sbjct  533  VELLILAAQILKDSTTK  549



>ref|XP_004289779.1| PREDICTED: uncharacterized protein LOC101308822 [Fragaria vesca 
subsp. vesca]
Length=644

 Score =   171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 134/192 (70%), Gaps = 14/192 (7%)
 Frame = -2

Query  830  QDMKQGKPHSEIGGKKTVQDG-EGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVNSI  660
            Q   +G   +E+G ++ V  G +G+ K+LLKKTYL RWVG  D +G++AE+    ++NS+
Sbjct  454  QGTSRGNSSAEVGDRRLVTHGRDGKLKSLLKKTYLSRWVGTLDFKGHEAEA----DLNSM  509

Query  659  GFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECI---DTKTNNSPESLENIIYE  489
             F RMKIENATLRES+  +EHLT+++ RLR SLLK KE +   DT   +  E+L++II E
Sbjct  510  EFVRMKIENATLRESIGGIEHLTTTVHRLRLSLLKAKESVSSGDTILASLLETLDDIINE  569

Query  488  AKLLKTALGTSLPVSWSAESDSGYNKEMLDDD----CTHTSKEKIDFVSAAGFEMVELLV  321
            AKL+KTALG+SLPVSWSAE+D  ++     ++        S EKID V AAGFEMVELL+
Sbjct  570  AKLVKTALGSSLPVSWSAEADEDFSSHSFSNEPGIVYGEPSHEKIDSVYAAGFEMVELLI  629

Query  320  FAAQLLKEKTCR  285
             A+Q+LK+ T +
Sbjct  630  LASQILKDNTSK  641



>ref|XP_011002125.1| PREDICTED: myosin-3 isoform X1 [Populus euphratica]
Length=650

 Score =   171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 126/179 (70%), Gaps = 20/179 (11%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDSEGNDAE-------SYPSSEVNSIGFARMKIENATLRESLE  609
            +GR +NLLK+TYL+RW+G  + N+A+       S+     N + FARMKIENATL ES+E
Sbjct  474  DGRIRNLLKRTYLRRWMGMLDRNEAQASTSGAGSFSGKRSNDMDFARMKIENATLNESME  533

Query  608  CMEHLTSSIRRLRHSLLKVKECIDTK---TNNSPESLENIIYEAKLLKTALGTSLPVSWS  438
             M+HL S I RLR +LLKV+E  DT+    ++ PE+L++II EA L+KTALG+SLPVSWS
Sbjct  534  SMDHLISVIHRLRLALLKVRES-DTREGTVSSRPEALDDIISEAGLVKTALGSSLPVSWS  592

Query  437  AESD------SGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE-KTCRG  282
            AE+D      S +NK  L D C   S EKID VSAAGFEMVELL+ A Q+LK+ KT +G
Sbjct  593  AEADDASFGESFHNK--LTDVCGEHSSEKIDPVSAAGFEMVELLILAGQILKDNKTIKG  649



>ref|XP_006486913.1| PREDICTED: centromere-associated protein E-like [Citrus sinensis]
Length=658

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 132/197 (67%), Gaps = 16/197 (8%)
 Frame = -2

Query  827  DMKQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDA-------ESYPS  678
            +MK+ K  +  G K+ V  + +GR +NLLKKT L+RW+G  D  GN+        E   +
Sbjct  459  EMKEEKVLAGNGEKRIVIPERDGRLRNLLKKTNLRRWIGTLDFSGNEGQADLNIREGIST  518

Query  677  SEVNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLE  504
               NSI FARM+IENATL+ESLE M+HL SSIRRLR SL KVKE   ++    +  E+L+
Sbjct  519  RRSNSIDFARMRIENATLKESLENMDHLISSIRRLRLSLSKVKELATSEDTIGSMSETLD  578

Query  503  NIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLD----DDCTHTSKEKIDFVSAAGFEM  336
            +II EAKL+KTALG+SLPVSW AESD G   E  D    D    +S EK+D VSAAGFEM
Sbjct  579  DIITEAKLVKTALGSSLPVSWIAESDDGSINENTDSESGDIHGDSSNEKMDSVSAAGFEM  638

Query  335  VELLVFAAQLLKEKTCR  285
            VELL+ AAQ+LK+ T +
Sbjct  639  VELLILAAQILKDSTTK  655



>gb|KDO57911.1| hypothetical protein CISIN_1g006179mg [Citrus sinensis]
Length=658

 Score =   170 bits (430),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 132/197 (67%), Gaps = 16/197 (8%)
 Frame = -2

Query  827  DMKQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDA-------ESYPS  678
            +MK+ K  +  G K+ V  + +GR +NLLKKT L+RW+G  D  GN+        E   +
Sbjct  459  EMKEEKVLAGNGEKRIVIPERDGRLRNLLKKTNLRRWIGTLDFSGNEGQADLNIREGIST  518

Query  677  SEVNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLE  504
               NSI FARM+IENATL+ESLE M+HL SSIRRLR SL KVKE   ++    +  E+L+
Sbjct  519  RRSNSIDFARMRIENATLKESLENMDHLISSIRRLRLSLSKVKELATSEDTIGSMSETLD  578

Query  503  NIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLD----DDCTHTSKEKIDFVSAAGFEM  336
            +II EAKL+KTALG+SLPVSW AESD G   E  D    D    +S EK+D VSAAGFEM
Sbjct  579  DIITEAKLVKTALGSSLPVSWIAESDDGSINENTDSESGDIHGDSSNEKMDSVSAAGFEM  638

Query  335  VELLVFAAQLLKEKTCR  285
            VELL+ AAQ+LK+ T +
Sbjct  639  VELLILAAQILKDSTTK  655



>ref|XP_011002132.1| PREDICTED: myosin-3 isoform X2 [Populus euphratica]
Length=629

 Score =   170 bits (430),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 126/179 (70%), Gaps = 20/179 (11%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDSEGNDAE-------SYPSSEVNSIGFARMKIENATLRESLE  609
            +GR +NLLK+TYL+RW+G  + N+A+       S+     N + FARMKIENATL ES+E
Sbjct  453  DGRIRNLLKRTYLRRWMGMLDRNEAQASTSGAGSFSGKRSNDMDFARMKIENATLNESME  512

Query  608  CMEHLTSSIRRLRHSLLKVKECIDTK---TNNSPESLENIIYEAKLLKTALGTSLPVSWS  438
             M+HL S I RLR +LLKV+E  DT+    ++ PE+L++II EA L+KTALG+SLPVSWS
Sbjct  513  SMDHLISVIHRLRLALLKVRES-DTREGTVSSRPEALDDIISEAGLVKTALGSSLPVSWS  571

Query  437  AESD------SGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE-KTCRG  282
            AE+D      S +NK  L D C   S EKID VSAAGFEMVELL+ A Q+LK+ KT +G
Sbjct  572  AEADDASFGESFHNK--LTDVCGEHSSEKIDPVSAAGFEMVELLILAGQILKDNKTIKG  628



>gb|KDO57912.1| hypothetical protein CISIN_1g006179mg [Citrus sinensis]
Length=630

 Score =   170 bits (430),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 132/197 (67%), Gaps = 16/197 (8%)
 Frame = -2

Query  827  DMKQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDA-------ESYPS  678
            +MK+ K  +  G K+ V  + +GR +NLLKKT L+RW+G  D  GN+        E   +
Sbjct  431  EMKEEKVLAGNGEKRIVIPERDGRLRNLLKKTNLRRWIGTLDFSGNEGQADLNIREGIST  490

Query  677  SEVNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLE  504
               NSI FARM+IENATL+ESLE M+HL SSIRRLR SL KVKE   ++    +  E+L+
Sbjct  491  RRSNSIDFARMRIENATLKESLENMDHLISSIRRLRLSLSKVKELATSEDTIGSMSETLD  550

Query  503  NIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLD----DDCTHTSKEKIDFVSAAGFEM  336
            +II EAKL+KTALG+SLPVSW AESD G   E  D    D    +S EK+D VSAAGFEM
Sbjct  551  DIITEAKLVKTALGSSLPVSWIAESDDGSINENTDSESGDIHGDSSNEKMDSVSAAGFEM  610

Query  335  VELLVFAAQLLKEKTCR  285
            VELL+ AAQ+LK+ T +
Sbjct  611  VELLILAAQILKDSTTK  627



>ref|XP_002300276.2| hypothetical protein POPTR_0001s30010g [Populus trichocarpa]
 gb|EEE85081.2| hypothetical protein POPTR_0001s30010g [Populus trichocarpa]
Length=615

 Score =   169 bits (428),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 132/199 (66%), Gaps = 26/199 (13%)
 Frame = -2

Query  818  QGKPHSEIGGKKTVQDGE---------GRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE  672
            Q K  SEI    + + GE         G+ +NLLK+TYL+RW+G  D  GN+A++  SSE
Sbjct  411  QKKVGSEIKRDFSAETGEMRLSNIERDGKIRNLLKRTYLRRWMGTMDFRGNEAQTCLSSE  470

Query  671  -------VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP-  516
                    N + FARMKIENATL+ES+ECM+HL SSI RL  +LLKVKE  DT+   S  
Sbjct  471  GNFSRKRANDMDFARMKIENATLKESMECMDHLISSIHRLHLALLKVKES-DTREGTSTG  529

Query  515  --ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCT----HTSKEKIDFVS  354
              E+L +II EA+L+KTALG+SLPVSWSAE+D     E + D+ +    +   EKID VS
Sbjct  530  LLEALNDIISEARLVKTALGSSLPVSWSAEADDASIGESVCDELSDIYGNPIGEKIDSVS  589

Query  353  AAGFEMVELLVFAAQLLKE  297
            AAGFEMVELL+ AAQ+LK+
Sbjct  590  AAGFEMVELLILAAQILKD  608



>ref|XP_007199732.1| hypothetical protein PRUPE_ppa002634mg [Prunus persica]
 gb|EMJ00931.1| hypothetical protein PRUPE_ppa002634mg [Prunus persica]
Length=650

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 127/184 (69%), Gaps = 15/184 (8%)
 Frame = -2

Query  803  SEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVN-----SIGFAR  648
            +E G +K V  + +GR K+LLKKTYL RWVG  DS G +AE   + E N     S+ FAR
Sbjct  460  AESGDRKAVTHERDGRLKSLLKKTYLSRWVGPPDSRGIEAEGGLNIEGNRRSNSSMEFAR  519

Query  647  MKIENATLRESLECMEHLTSSIRRLRHSLLKVKECI---DTKTNNSPESLENIIYEAKLL  477
            MKIE ATLRES+  MEHLT+++ RLR SL K KE +    T   +  E++ NIIYEAKL+
Sbjct  520  MKIEIATLRESMGSMEHLTTTVHRLRLSLSKAKESVTSGSTMVTSLSETVNNIIYEAKLV  579

Query  476  KTALGTSLPVSWSAESDSGYNKEMLDDDCTH----TSKEKIDFVSAAGFEMVELLVFAAQ  309
            KTALG+SLP+SWSA++D  +N   L ++  H    TS EKID V AAGFEMVELL+ AAQ
Sbjct  580  KTALGSSLPISWSADTDVEFNDHSLSNEPGHVSGETSHEKIDSVFAAGFEMVELLILAAQ  639

Query  308  LLKE  297
            +LK+
Sbjct  640  ILKD  643



>ref|XP_006379165.1| hypothetical protein POPTR_0009s09030g [Populus trichocarpa]
 gb|ERP56962.1| hypothetical protein POPTR_0009s09030g [Populus trichocarpa]
Length=646

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 136/202 (67%), Gaps = 23/202 (11%)
 Frame = -2

Query  830  QDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAE-------SYPS  678
            QD  +G   S+   + +  + +GR +NLLK+TYL+RW+G  DS GN+A        S+  
Sbjct  448  QDSPRGYSGSKSKRRLSNHERDGRIRNLLKRTYLRRWMGMLDS-GNEARASTSGAGSFSG  506

Query  677  SEVNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK---TNNSPESL  507
               N + FARMKIENATL+ES+E M+HL S+I RLR +LLKVKE  DT+    +  P +L
Sbjct  507  KRSNDMDFARMKIENATLKESMESMDHLISAIHRLRLALLKVKES-DTREGTVSGLPVAL  565

Query  506  ENIIYEAKLLKTALGTSLPVSWSAESD------SGYNKEMLDDDCTHTSKEKIDFVSAAG  345
            ++II EA+L+KTALG+SLP+SWSAE+D      S +NK  L D     S EKID VSAAG
Sbjct  566  DDIISEARLVKTALGSSLPISWSAEADDASIGESFHNK--LTDIYGEHSSEKIDPVSAAG  623

Query  344  FEMVELLVFAAQLLKE-KTCRG  282
            FEMVELL+ A Q+LK+ KT +G
Sbjct  624  FEMVELLILAGQILKDNKTIKG  645



>ref|XP_008236305.1| PREDICTED: cingulin isoform X1 [Prunus mume]
Length=653

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 127/184 (69%), Gaps = 15/184 (8%)
 Frame = -2

Query  803  SEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVN-----SIGFAR  648
            +E G +K V  + +GR K+LLKKTYL RWVG  DS G +AE   + E N     S+ FAR
Sbjct  463  AESGDRKAVTHERDGRLKSLLKKTYLSRWVGPPDSRGIEAEGGLNIEGNRRSNSSMEFAR  522

Query  647  MKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP---ESLENIIYEAKLL  477
            MKIE ATLRES+  MEHLT+++ RLR SL K KE + + +       E++ NIIYEAKL+
Sbjct  523  MKIEIATLRESMGSMEHLTTTVHRLRLSLSKAKESVTSGSTTVTTLSETVNNIIYEAKLV  582

Query  476  KTALGTSLPVSWSAESDSGYNKEMLDDDCTH----TSKEKIDFVSAAGFEMVELLVFAAQ  309
            KTALG+SLP+SWSA++D  +N   L ++  H    TS EKID V AAGFEMVELL+ AAQ
Sbjct  583  KTALGSSLPISWSADADVEFNDHSLSNEPGHVSGETSHEKIDSVFAAGFEMVELLILAAQ  642

Query  308  LLKE  297
            +LK+
Sbjct  643  ILKD  646



>ref|XP_008236307.1| PREDICTED: cingulin isoform X3 [Prunus mume]
Length=629

 Score =   164 bits (414),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 127/184 (69%), Gaps = 15/184 (8%)
 Frame = -2

Query  803  SEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVN-----SIGFAR  648
            +E G +K V  + +GR K+LLKKTYL RWVG  DS G +AE   + E N     S+ FAR
Sbjct  439  AESGDRKAVTHERDGRLKSLLKKTYLSRWVGPPDSRGIEAEGGLNIEGNRRSNSSMEFAR  498

Query  647  MKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP---ESLENIIYEAKLL  477
            MKIE ATLRES+  MEHLT+++ RLR SL K KE + + +       E++ NIIYEAKL+
Sbjct  499  MKIEIATLRESMGSMEHLTTTVHRLRLSLSKAKESVTSGSTTVTTLSETVNNIIYEAKLV  558

Query  476  KTALGTSLPVSWSAESDSGYNKEMLDDDCTH----TSKEKIDFVSAAGFEMVELLVFAAQ  309
            KTALG+SLP+SWSA++D  +N   L ++  H    TS EKID V AAGFEMVELL+ AAQ
Sbjct  559  KTALGSSLPISWSADADVEFNDHSLSNEPGHVSGETSHEKIDSVFAAGFEMVELLILAAQ  618

Query  308  LLKE  297
            +LK+
Sbjct  619  ILKD  622



>ref|XP_003516769.1| PREDICTED: golgin subfamily B member 1-like isoform X1 [Glycine 
max]
Length=653

 Score =   163 bits (413),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 129/189 (68%), Gaps = 14/189 (7%)
 Frame = -2

Query  821  KQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE-------  672
            KQGK     G ++ V ++ +G  KNLLKK+YL+RW+G  D  GN+ +S  ++E       
Sbjct  455  KQGKGVVNTGDRQLVTRERDGTLKNLLKKSYLRRWIGPLDVSGNEVDSSSNNEGKIFNHR  514

Query  671  VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNS--PESLENI  498
             +S+ FARMKIENATL+ES+E ME LTSSI RLR SLLK  E + ++   S   E L ++
Sbjct  515  SSSMDFARMKIENATLKESMESMERLTSSIHRLRLSLLKATESVISEGTISGVSEILNDV  574

Query  497  IYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH--TSKEKIDFVSAAGFEMVELL  324
            I+EA+LL+TALG+SLP SWSAE+D  Y    +  D  H   S EK+D VSAAG EMVELL
Sbjct  575  IHEAELLRTALGSSLPTSWSAEADISYIGYNVGSDTGHQECSDEKMDTVSAAGLEMVELL  634

Query  323  VFAAQLLKE  297
            +F+AQ+L++
Sbjct  635  IFSAQILRD  643



>ref|XP_008455043.1| PREDICTED: CAP-Gly domain-containing linker protein 1 isoform 
X2 [Cucumis melo]
Length=642

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 130/196 (66%), Gaps = 21/196 (11%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDSE--GNDAESYPSSEVN  666
            KD  D+K+G    E   K    + EG+ K LLK TYL+RWVG  E  G++A ++  +E N
Sbjct  441  KDAHDLKRGADTVE--RKIVTHEREGKLKGLLKGTYLRRWVGTPEISGSEAAAHLDNEEN  498

Query  665  ------SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP--ES  510
                  ++ FAR+KIENATLRES+E ME LTSSI RLR SLLK KE +  +   +   E+
Sbjct  499  YSSRKSAVDFARIKIENATLRESIESMEQLTSSIHRLRLSLLKAKESVTLEGPGTSMLEA  558

Query  509  LENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH-------TSKEKIDFVSA  351
            L+ II EAKL+KTAL +SLP+SWSAE+++G ++E L D  +H        S  KIDFVSA
Sbjct  559  LKGIINEAKLIKTALSSSLPISWSAEANAGSSEETLHD--SHDVLGQGDASLGKIDFVSA  616

Query  350  AGFEMVELLVFAAQLL  303
            AGFEMVELLV  A+LL
Sbjct  617  AGFEMVELLVSVAELL  632



>ref|XP_006573902.1| PREDICTED: golgin subfamily B member 1-like isoform X2 [Glycine 
max]
Length=646

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 129/189 (68%), Gaps = 14/189 (7%)
 Frame = -2

Query  821  KQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE-------  672
            KQGK     G ++ V ++ +G  KNLLKK+YL+RW+G  D  GN+ +S  ++E       
Sbjct  448  KQGKGVVNTGDRQLVTRERDGTLKNLLKKSYLRRWIGPLDVSGNEVDSSSNNEGKIFNHR  507

Query  671  VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNS--PESLENI  498
             +S+ FARMKIENATL+ES+E ME LTSSI RLR SLLK  E + ++   S   E L ++
Sbjct  508  SSSMDFARMKIENATLKESMESMERLTSSIHRLRLSLLKATESVISEGTISGVSEILNDV  567

Query  497  IYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH--TSKEKIDFVSAAGFEMVELL  324
            I+EA+LL+TALG+SLP SWSAE+D  Y    +  D  H   S EK+D VSAAG EMVELL
Sbjct  568  IHEAELLRTALGSSLPTSWSAEADISYIGYNVGSDTGHQECSDEKMDTVSAAGLEMVELL  627

Query  323  VFAAQLLKE  297
            +F+AQ+L++
Sbjct  628  IFSAQILRD  636



>ref|XP_008368764.1| PREDICTED: uncharacterized protein LOC103432352 [Malus domestica]
Length=415

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 126/190 (66%), Gaps = 17/190 (9%)
 Frame = -2

Query  803  SEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE-------VNSIGF  654
            +EIG +K V  + +GR K+LLKKTYL RWVG  D  G++A    + E        NS+ F
Sbjct  223  AEIGERKVVTHERDGRLKSLLKKTYLSRWVGNVDFRGHEAAGGLNVEGNLSGKGSNSMEF  282

Query  653  ARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTN---NSPESLENIIYEAK  483
            ARMKIE ATL+ES+  MEHLT+++ RLR SL K KE + + +    +  E++  II EAK
Sbjct  283  ARMKIEIATLQESMGSMEHLTTTVHRLRLSLSKAKELVTSGSRAVASLSETVNGIINEAK  342

Query  482  LLKTALGTSLPVSWSAESDSGYNKEMLDDDCTHT----SKEKIDFVSAAGFEMVELLVFA  315
            L+KTAL +SLP+SWSA+ D G N + + ++  H     S EKID V AAGFEMVELL+ A
Sbjct  343  LVKTALSSSLPISWSADEDVGVNGQSVSNEPGHAYGQPSHEKIDSVYAAGFEMVELLILA  402

Query  314  AQLLKEKTCR  285
            AQ+LK+ T +
Sbjct  403  AQILKDNTSK  412



>ref|XP_008455046.1| PREDICTED: CAP-Gly domain-containing linker protein 1 isoform 
X4 [Cucumis melo]
Length=517

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 129/196 (66%), Gaps = 21/196 (11%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDSE--GNDAESYPSSEVN  666
            K   D+K+G    E   K    + EG+ K LLK TYL+RWVG  E  G++A ++  +E N
Sbjct  316  KSAHDLKRGADTVE--RKIVTHEREGKLKGLLKGTYLRRWVGTPEISGSEAAAHLDNEEN  373

Query  665  ------SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP--ES  510
                  ++ FAR+KIENATLRES+E ME LTSSI RLR SLLK KE +  +   +   E+
Sbjct  374  YSSRKSAVDFARIKIENATLRESIESMEQLTSSIHRLRLSLLKAKESVTLEGPGTSMLEA  433

Query  509  LENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH-------TSKEKIDFVSA  351
            L+ II EAKL+KTAL +SLP+SWSAE+++G ++E L D  +H        S  KIDFVSA
Sbjct  434  LKGIINEAKLIKTALSSSLPISWSAEANAGSSEETLHD--SHDVLGQGDASLGKIDFVSA  491

Query  350  AGFEMVELLVFAAQLL  303
            AGFEMVELLV  A+LL
Sbjct  492  AGFEMVELLVSVAELL  507



>gb|KDP44511.1| hypothetical protein JCGZ_16344 [Jatropha curcas]
Length=655

 Score =   160 bits (405),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 118/174 (68%), Gaps = 13/174 (7%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDSEG--------NDAESYPSSEVNSIGFARMKIENATLRESL  612
            +GR +NLLK+TYL+RW+G  EG        N   ++ S   NSI FARMKIENAT +E +
Sbjct  475  DGRLRNLLKRTYLRRWIGTVEGGHEEITNLNSERNFSSRRSNSIDFARMKIENATFKEII  534

Query  611  ECMEHLTSSIRRLRHSLLKVKECIDTKTN-NSPESLENIIYEAKLLKTALGTSLPVSWSA  435
            + +EHLT++I RLR SLLKVKE +  ++   S E+L +II E KLLKTAL ++LPVSWSA
Sbjct  535  DSIEHLTTTIHRLRISLLKVKESVGCESALGSGEALGDIISETKLLKTALSSTLPVSWSA  594

Query  434  ESDSGYNKEMLDDDC----THTSKEKIDFVSAAGFEMVELLVFAAQLLKEKTCR  285
            E+D     E   +D       +S +K+D VSAAG EMVELL+ AAQ+LK+ + R
Sbjct  595  EADDSLIGESNHNDPGDFRGDSSSDKVDPVSAAGLEMVELLILAAQMLKDNSTR  648



>ref|XP_008455041.1| PREDICTED: CAP-Gly domain-containing linker protein 1 isoform 
X1 [Cucumis melo]
 ref|XP_008455042.1| PREDICTED: CAP-Gly domain-containing linker protein 1 isoform 
X1 [Cucumis melo]
Length=644

 Score =   160 bits (405),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 129/196 (66%), Gaps = 21/196 (11%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDSE--GNDAESYPSSEVN  666
            K   D+K+G    E   K    + EG+ K LLK TYL+RWVG  E  G++A ++  +E N
Sbjct  443  KSAHDLKRGADTVE--RKIVTHEREGKLKGLLKGTYLRRWVGTPEISGSEAAAHLDNEEN  500

Query  665  ------SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP--ES  510
                  ++ FAR+KIENATLRES+E ME LTSSI RLR SLLK KE +  +   +   E+
Sbjct  501  YSSRKSAVDFARIKIENATLRESIESMEQLTSSIHRLRLSLLKAKESVTLEGPGTSMLEA  560

Query  509  LENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH-------TSKEKIDFVSA  351
            L+ II EAKL+KTAL +SLP+SWSAE+++G ++E L D  +H        S  KIDFVSA
Sbjct  561  LKGIINEAKLIKTALSSSLPISWSAEANAGSSEETLHD--SHDVLGQGDASLGKIDFVSA  618

Query  350  AGFEMVELLVFAAQLL  303
            AGFEMVELLV  A+LL
Sbjct  619  AGFEMVELLVSVAELL  634



>ref|XP_002532426.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29967.1| conserved hypothetical protein [Ricinus communis]
Length=658

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 125/183 (68%), Gaps = 31/183 (17%)
 Frame = -2

Query  779  VQDGEGRFKNLLKKTYLKRWVGDSE--GNDAESYPSSEVN-------SIGFARMKIENAT  627
              D +GR +NLLK+TYLKRW+G S    N+ E++ ++E N       SI FARMKIENAT
Sbjct  472  THDKDGRLRNLLKRTYLKRWMGTSGIGVNEEEAHLNNEGNFSSRTHSSIDFARMKIENAT  531

Query  626  LRESLECMEHLTSSIRRLRHSLLKVKE-------CIDTKTNNSPESLENIIYEAKLLKTA  468
            L+ES+E MEHLTSSI RLR +LLKVKE       C+        E+L +I+ EAKLLKTA
Sbjct  532  LKESMESMEHLTSSIHRLRCALLKVKESAACEGTCVGV-----LEALHDIVSEAKLLKTA  586

Query  467  LGTSLPVSWSAES------DSGYNKEM-LDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQ  309
             G+SLP+SWSAE+       S +N+   LD+D   +S EK+D VSAAGFEMVELL+ AAQ
Sbjct  587  FGSSLPISWSAEAVDTSTGGSTHNEPGDLDED---SSYEKMDSVSAAGFEMVELLILAAQ  643

Query  308  LLK  300
            +L+
Sbjct  644  ILE  646



>ref|XP_004511316.1| PREDICTED: kinesin-like protein KIF20B-like isoform X1 [Cicer 
arietinum]
Length=652

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 119/173 (69%), Gaps = 13/173 (8%)
 Frame = -2

Query  782  TVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE-------VNSIGFARMKIENA  630
             +++ +G  KNLLKK+YL+RW+   D  G + +S P +E        +S+ FARMKIENA
Sbjct  466  VIRERDGTLKNLLKKSYLRRWISPVDVGGKEVDSSPDNEGKSFIQRSSSVDFARMKIENA  525

Query  629  TLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNS--PESLENIIYEAKLLKTALGTS  456
            TL+ES++ ME LTSSI RLR SL KVKE + ++   S   E L  +I EAKLL+TALG+S
Sbjct  526  TLKESMDSMELLTSSIHRLRLSLWKVKESVTSEGTVSGVSEVLNGVIKEAKLLRTALGSS  585

Query  455  LPVSWSAESDSGYNKEMLDDDCTH--TSKEKIDFVSAAGFEMVELLVFAAQLL  303
            LP+SWS E++ GY ++    D  H   S EKID VSAAG EMVELL+FAAQ+L
Sbjct  586  LPISWSVETEVGYFEDGEGRDTVHKECSAEKIDTVSAAGLEMVELLIFAAQML  638



>ref|XP_008455045.1| PREDICTED: CAP-Gly domain-containing linker protein 1 isoform 
X3 [Cucumis melo]
Length=634

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 129/196 (66%), Gaps = 21/196 (11%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDSE--GNDAESYPSSEVN  666
            K   D+K+G    E   K    + EG+ K LLK TYL+RWVG  E  G++A ++  +E N
Sbjct  433  KSAHDLKRGADTVE--RKIVTHEREGKLKGLLKGTYLRRWVGTPEISGSEAAAHLDNEEN  490

Query  665  ------SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP--ES  510
                  ++ FAR+KIENATLRES+E ME LTSSI RLR SLLK KE +  +   +   E+
Sbjct  491  YSSRKSAVDFARIKIENATLRESIESMEQLTSSIHRLRLSLLKAKESVTLEGPGTSMLEA  550

Query  509  LENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH-------TSKEKIDFVSA  351
            L+ II EAKL+KTAL +SLP+SWSAE+++G ++E L D  +H        S  KIDFVSA
Sbjct  551  LKGIINEAKLIKTALSSSLPISWSAEANAGSSEETLHD--SHDVLGQGDASLGKIDFVSA  608

Query  350  AGFEMVELLVFAAQLL  303
            AGFEMVELLV  A+LL
Sbjct  609  AGFEMVELLVSVAELL  624



>ref|XP_004511317.1| PREDICTED: kinesin-like protein KIF20B-like isoform X2 [Cicer 
arietinum]
 ref|XP_004511318.1| PREDICTED: kinesin-like protein KIF20B-like isoform X3 [Cicer 
arietinum]
Length=645

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 119/173 (69%), Gaps = 13/173 (8%)
 Frame = -2

Query  782  TVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE-------VNSIGFARMKIENA  630
             +++ +G  KNLLKK+YL+RW+   D  G + +S P +E        +S+ FARMKIENA
Sbjct  459  VIRERDGTLKNLLKKSYLRRWISPVDVGGKEVDSSPDNEGKSFIQRSSSVDFARMKIENA  518

Query  629  TLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNS--PESLENIIYEAKLLKTALGTS  456
            TL+ES++ ME LTSSI RLR SL KVKE + ++   S   E L  +I EAKLL+TALG+S
Sbjct  519  TLKESMDSMELLTSSIHRLRLSLWKVKESVTSEGTVSGVSEVLNGVIKEAKLLRTALGSS  578

Query  455  LPVSWSAESDSGYNKEMLDDDCTH--TSKEKIDFVSAAGFEMVELLVFAAQLL  303
            LP+SWS E++ GY ++    D  H   S EKID VSAAG EMVELL+FAAQ+L
Sbjct  579  LPISWSVETEVGYFEDGEGRDTVHKECSAEKIDTVSAAGLEMVELLIFAAQML  631



>ref|XP_007157206.1| hypothetical protein PHAVU_002G051500g [Phaseolus vulgaris]
 gb|ESW29200.1| hypothetical protein PHAVU_002G051500g [Phaseolus vulgaris]
Length=654

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 126/193 (65%), Gaps = 15/193 (8%)
 Frame = -2

Query  818  QGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE--------  672
            QGK    IG +  V ++ +G  KNLLKK+YL+RW+   D  GN+ +S  ++E        
Sbjct  452  QGKCVVNIGDRNFVTRERDGTLKNLLKKSYLRRWIAPLDVSGNEVDSSSNNEGKIFNHQS  511

Query  671  VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNS--PESLENI  498
             +S+ FARMKIENATL+ES+E MEHLTSSI RLR SL K KEC+ ++   S   E L ++
Sbjct  512  SSSMDFARMKIENATLKESMESMEHLTSSIHRLRLSLSKAKECVTSEGTISGVSEILSDV  571

Query  497  IYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTHTS--KEKIDFVSAAGFEMVELL  324
            I EA+LL+TALG+SLP SWS E+D  Y    +  D        EK+D VSAAG EMVELL
Sbjct  572  IREAELLRTALGSSLPTSWSVEADISYIGYSVSSDRGDQEGIDEKMDTVSAAGLEMVELL  631

Query  323  VFAAQLLKEKTCR  285
            +F+AQ+L++   R
Sbjct  632  IFSAQILRDLQTR  644



>ref|XP_010274392.1| PREDICTED: myosin-3 isoform X2 [Nelumbo nucifera]
Length=554

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 135/215 (63%), Gaps = 28/215 (13%)
 Frame = -2

Query  890  FQLLF*NVHHFVVTYCRKDDQDMKQGKPHSEIGGKK-TVQDGEGRFKNLLKKTYLKRWVG  714
            +QLL  N+ H           +M QG   + IG +     + +GR +NLLKKTYL+RWVG
Sbjct  346  YQLLQENISH-----------EMNQGSHLANIGHRSIATHEKDGRLRNLLKKTYLRRWVG  394

Query  713  --DSEGNDAESYPSSE--------VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHS  564
              ++ GN+A+   +++          ++ FAR+K+ENA+L+ESLE M+HLTS I RLR S
Sbjct  395  RLEASGNEADDSINNQGIFTNKRSNQAVDFARIKVENASLKESLESMDHLTSLIHRLRIS  454

Query  563  LLKVKE--CIDTKTNNSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGYN----KEML  402
            LLKVK+         ++P++L+ II EAKL+KTAL +SLP+SWSA++D G +     ++ 
Sbjct  455  LLKVKDPATFQDPVTSTPKALDEIIAEAKLMKTALSSSLPISWSADADPGTHGGNSNDVS  514

Query  401  DDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
             D    +  EK+D VSAAG EMVELL+ A Q LKE
Sbjct  515  CDGSGDSWSEKVDSVSAAGLEMVELLILACQNLKE  549



>ref|XP_010274390.1| PREDICTED: TATA element modulatory factor isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274391.1| PREDICTED: TATA element modulatory factor isoform X1 [Nelumbo 
nucifera]
Length=656

 Score =   158 bits (399),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 135/215 (63%), Gaps = 28/215 (13%)
 Frame = -2

Query  890  FQLLF*NVHHFVVTYCRKDDQDMKQGKPHSEIGGKK-TVQDGEGRFKNLLKKTYLKRWVG  714
            +QLL  N+ H           +M QG   + IG +     + +GR +NLLKKTYL+RWVG
Sbjct  448  YQLLQENISH-----------EMNQGSHLANIGHRSIATHEKDGRLRNLLKKTYLRRWVG  496

Query  713  --DSEGNDAESYPSSE--------VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHS  564
              ++ GN+A+   +++          ++ FAR+K+ENA+L+ESLE M+HLTS I RLR S
Sbjct  497  RLEASGNEADDSINNQGIFTNKRSNQAVDFARIKVENASLKESLESMDHLTSLIHRLRIS  556

Query  563  LLKVKE--CIDTKTNNSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGYN----KEML  402
            LLKVK+         ++P++L+ II EAKL+KTAL +SLP+SWSA++D G +     ++ 
Sbjct  557  LLKVKDPATFQDPVTSTPKALDEIIAEAKLMKTALSSSLPISWSADADPGTHGGNSNDVS  616

Query  401  DDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
             D    +  EK+D VSAAG EMVELL+ A Q LKE
Sbjct  617  CDGSGDSWSEKVDSVSAAGLEMVELLILACQNLKE  651



>gb|KHN30437.1| hypothetical protein glysoja_033175 [Glycine soja]
Length=653

 Score =   157 bits (398),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 127/189 (67%), Gaps = 14/189 (7%)
 Frame = -2

Query  821  KQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE-------  672
            KQGK     G ++ V ++ +G  KNLLKK+YL+RW+G  D  GN+ +S  ++E       
Sbjct  455  KQGKGVVNTGDRQLVTRERDGTLKNLLKKSYLRRWIGPLDVSGNEVDSSSNNEGKIFNHR  514

Query  671  VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNS--PESLENI  498
             +S+ FAR  IENATL+ES+E ME LTSSI RLR SLLK  E + ++   S   E L ++
Sbjct  515  SSSMDFARHVIENATLKESMESMERLTSSIHRLRLSLLKATESVISEGTISGVSEILNDV  574

Query  497  IYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH--TSKEKIDFVSAAGFEMVELL  324
            I+EA+LL+TALG+SLP SWSAE+D  Y    +  D  H   S EK+D VSAAG EMVELL
Sbjct  575  IHEAELLRTALGSSLPTSWSAEADISYIGYNVGSDTGHQECSDEKMDTVSAAGLEMVELL  634

Query  323  VFAAQLLKE  297
            +F+AQ+L++
Sbjct  635  IFSAQILRD  643



>ref|XP_004137083.1| PREDICTED: uncharacterized protein LOC101211967 [Cucumis sativus]
 gb|KGN43844.1| hypothetical protein Csa_7G071330 [Cucumis sativus]
Length=641

 Score =   155 bits (392),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 128/199 (64%), Gaps = 27/199 (14%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDSE--GNDAESYPSSEVN  666
            K   D+K+G    E   K    + EG+ K LLK TYL+RWVG  E  G++A ++  +E N
Sbjct  440  KSVHDLKRGADTVE--RKLVTHEREGKLKGLLKGTYLRRWVGTPEISGSEAAAHLDNEEN  497

Query  665  ------SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP----  516
                  ++ FAR+KIENATLRES+E ME LTSSI RLR  LLK KE   + T+  P    
Sbjct  498  YSSRKSAVDFARIKIENATLRESIESMEQLTSSIHRLRLYLLKAKE---SATSEGPGTSV  554

Query  515  -ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH-------TSKEKIDF  360
             E L+ II EAKL+KTAL +SLP+SWSAE ++G ++E L D  +H       +S  KIDF
Sbjct  555  LEGLKGIINEAKLIKTALCSSLPISWSAEVNAGSSEETLHD--SHDVLGEGDSSLGKIDF  612

Query  359  VSAAGFEMVELLVFAAQLL  303
            VSAAGFEMVELLV  A+LL
Sbjct  613  VSAAGFEMVELLVSVAELL  631



>ref|XP_009375663.1| PREDICTED: uncharacterized protein LOC103964454 isoform X1 [Pyrus 
x bretschneideri]
Length=655

 Score =   155 bits (392),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 125/190 (66%), Gaps = 17/190 (9%)
 Frame = -2

Query  803  SEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE-------VNSIGF  654
            +EIG +K V ++ +GR K+LLKKTYL RW G  D  G++A    + E        NS+ F
Sbjct  463  AEIGERKVVTRERDGRLKSLLKKTYLSRWAGNVDFRGHEAAGGRNVEGNLSGKGSNSMEF  522

Query  653  ARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECI---DTKTNNSPESLENIIYEAK  483
            ARMKIE ATLRES+  MEHLT+++ RLR SL K KE +    T   +  E++  II EAK
Sbjct  523  ARMKIEIATLRESMGSMEHLTTTVHRLRLSLSKAKELVTSGSTAVASLSEAVNGIINEAK  582

Query  482  LLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH----TSKEKIDFVSAAGFEMVELLVFA  315
            L+KTAL +SLP+SWSA+ + G +++ + ++  H     S EK D V AAGFEMVELL+ A
Sbjct  583  LVKTALSSSLPISWSADEEDGVDRQSVSNEPGHAYGKASHEKTDSVYAAGFEMVELLILA  642

Query  314  AQLLKEKTCR  285
            AQ+LK+ T +
Sbjct  643  AQILKDNTSK  652



>ref|XP_004155483.1| PREDICTED: uncharacterized LOC101211967 [Cucumis sativus]
Length=641

 Score =   155 bits (391),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 128/199 (64%), Gaps = 27/199 (14%)
 Frame = -2

Query  839  KDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDSE--GNDAESYPSSEVN  666
            K   D+K+G    E   K    + EG+ K LLK TYL+RWVG  E  G++A ++  +E N
Sbjct  440  KSVHDLKRGADTVE--RKLVTHEREGKLKGLLKGTYLRRWVGTPEISGSEAAAHLDNEEN  497

Query  665  ------SIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP----  516
                  ++ FAR+KIENATLRES+E ME LTSSI RLR  LLK KE   + T+  P    
Sbjct  498  YSSRKSAVDFARIKIENATLRESIESMEQLTSSIHRLRLYLLKAKE---SATSEGPGTSV  554

Query  515  -ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH-------TSKEKIDF  360
             E L+ II EAKL+KTAL +SLP+SWSAE ++G ++E L D  +H       +S  KIDF
Sbjct  555  LEGLKGIINEAKLIKTALCSSLPISWSAEVNAGSSEETLHD--SHDVLGEGDSSLGKIDF  612

Query  359  VSAAGFEMVELLVFAAQLL  303
            VSAAGFEMVELLV  A+LL
Sbjct  613  VSAAGFEMVELLVSVAELL  631



>ref|XP_008364382.1| PREDICTED: cingulin-like isoform X1 [Malus domestica]
 ref|XP_008364383.1| PREDICTED: cingulin-like isoform X1 [Malus domestica]
Length=642

 Score =   154 bits (390),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 124/186 (67%), Gaps = 17/186 (9%)
 Frame = -2

Query  803  SEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVN-------SIGF  654
            +EIG +K +  + +GR K+LLKKTYL RWVG  D  G +A S  + E N       S+ F
Sbjct  445  AEIGDRKVITHERDGRLKSLLKKTYLSRWVGNVDFRGREAASGLNVEGNLSGKRSDSMEF  504

Query  653  ARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECI---DTKTNNSPESLENIIYEAK  483
            ARMKIE ATL+ES+  MEHLT+++ RLR SL KVKE +    T   +  E++ +II EAK
Sbjct  505  ARMKIEIATLQESMGSMEHLTTTVHRLRLSLSKVKESVTSGSTTFASLSETINDIINEAK  564

Query  482  LLKTALGTSLPVSWSAESDSGYNKEMLDDDCTHT----SKEKIDFVSAAGFEMVELLVFA  315
            L+KTAL +SLP+SWSA+ D  +N + + ++  H     S EKID V AAG EMVELL+ A
Sbjct  565  LVKTALSSSLPISWSADEDVEFNGQSIRNEPGHAYWEPSHEKIDSVYAAGLEMVELLILA  624

Query  314  AQLLKE  297
            AQ+LK+
Sbjct  625  AQILKD  630



>ref|XP_008364384.1| PREDICTED: spindle pole body component 110-like isoform X2 [Malus 
domestica]
Length=621

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 124/186 (67%), Gaps = 17/186 (9%)
 Frame = -2

Query  803  SEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVN-------SIGF  654
            +EIG +K +  + +GR K+LLKKTYL RWVG  D  G +A S  + E N       S+ F
Sbjct  424  AEIGDRKVITHERDGRLKSLLKKTYLSRWVGNVDFRGREAASGLNVEGNLSGKRSDSMEF  483

Query  653  ARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECI---DTKTNNSPESLENIIYEAK  483
            ARMKIE ATL+ES+  MEHLT+++ RLR SL KVKE +    T   +  E++ +II EAK
Sbjct  484  ARMKIEIATLQESMGSMEHLTTTVHRLRLSLSKVKESVTSGSTTFASLSETINDIINEAK  543

Query  482  LLKTALGTSLPVSWSAESDSGYNKEMLDDDCTHT----SKEKIDFVSAAGFEMVELLVFA  315
            L+KTAL +SLP+SWSA+ D  +N + + ++  H     S EKID V AAG EMVELL+ A
Sbjct  544  LVKTALSSSLPISWSADEDVEFNGQSIRNEPGHAYWEPSHEKIDSVYAAGLEMVELLILA  603

Query  314  AQLLKE  297
            AQ+LK+
Sbjct  604  AQILKD  609



>ref|XP_010028357.1| PREDICTED: golgin subfamily A member 4 [Eucalyptus grandis]
Length=650

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 124/200 (62%), Gaps = 21/200 (11%)
 Frame = -2

Query  821  KQGKPHSEIGGKK-TVQDGEGRFKNLLKKTYLKRW--VGDSEGNDAESYPSSE-------  672
            +QG+  +  G KK      +G+ +N+LK+TYLKRW  VGD  G  AE++PSS+       
Sbjct  455  RQGRVLAFAGEKKIAAHQQDGKLRNILKRTYLKRWITVGDF-GGAAEAHPSSDGGISGRK  513

Query  671  -VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSPESLENII  495
              +S+  ARM+IENATL+ESL+ MEH+TSSI RLR ++L+ KE +        E+LE++I
Sbjct  514  SSDSMDIARMRIENATLKESLDSMEHITSSIHRLRLAILQAKESVGI-----SETLEDVI  568

Query  494  YEAKLLKTALGTSLPVSWSA----ESDSGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVEL  327
             EAKL+KTALG+ LPVSWSA    ES          D       EK+D VSAAGFEMVEL
Sbjct  569  SEAKLVKTALGSCLPVSWSAGMDEESSLDSVSSDSGDLFGDPGGEKVDSVSAAGFEMVEL  628

Query  326  LVFAAQLLKEKTCRGEAKKP  267
            L+  AQ LKE   + E   P
Sbjct  629  LILTAQTLKETATKTEHGIP  648



>ref|XP_010091019.1| hypothetical protein L484_005056 [Morus notabilis]
 gb|EXB41830.1| hypothetical protein L484_005056 [Morus notabilis]
Length=635

 Score =   149 bits (375),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 113/171 (66%), Gaps = 15/171 (9%)
 Frame = -2

Query  764  GRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            GR  NLLKKT LKRWVG  D   N+AE +       + FAR+KIENATL+ES+E MEHL 
Sbjct  462  GRLTNLLKKTNLKRWVGTLDLRVNEAEVH-------MDFARLKIENATLKESMESMEHLI  514

Query  590  SSIRRLRHSLLKVKE--CIDTKTNNSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            +SI RLR SL+K KE    +       E L  I+  AKL+KTALG+SLP+SWSA ++ G 
Sbjct  515  TSIHRLRLSLVKAKELAAFEGTAATMSEHLNEIVSGAKLVKTALGSSLPISWSAAAEFGL  574

Query  416  NKEMLDDDCT----HTSKEKIDFVSAAGFEMVELLVFAAQLLKEKTCRGEA  276
            +   L ++ +    ++S EK DFV+AAG EMVELL+ AAQ+LK+ T +  A
Sbjct  575  DGGNLGNEASGVSGNSSNEKKDFVTAAGVEMVELLILAAQILKDYTTKSAA  625



>ref|XP_009102315.1| PREDICTED: myosin heavy chain, clone 203 isoform X1 [Brassica 
rapa]
Length=658

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 117/180 (65%), Gaps = 10/180 (6%)
 Frame = -2

Query  821  KQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDS--EGNDAESYPSSEVNSIGFAR  648
            + G+   + GG     + EGR KN+ KK+Y+ RW+  S  EG    +  +    +I +AR
Sbjct  483  RDGEATEKSGGMVMSNEKEGRLKNMWKKSYINRWIDPSSREGGSHSNTEADYAGNIDYAR  542

Query  647  MKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKT--NNSPESLENIIYEAKLLK  474
            MK+E A L+ESLE M HLT+SIRRLR +LLKVKE  DT+T       ++ NI+ EA  LK
Sbjct  543  MKVEYAALKESLESMGHLTTSIRRLRLALLKVKETNDTETAARTCEVAISNILVEATHLK  602

Query  473  TALGTSLPVSWSAESDSGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
            TALG S+P+SWSAESD     E + D    +S +K D VSAAGFEMVEL++ AA++LKE+
Sbjct  603  TALGISIPISWSAESD----MESVAD--GESSCDKTDSVSAAGFEMVELVILAAEILKEQ  656



>emb|CDY49597.1| BnaAnng10260D [Brassica napus]
Length=680

 Score =   147 bits (371),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 117/180 (65%), Gaps = 10/180 (6%)
 Frame = -2

Query  821  KQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDS--EGNDAESYPSSEVNSIGFAR  648
            + G+   + GG     + EGR KN+ KK+Y+ RW+  S  EG    +  +    +I +AR
Sbjct  505  RDGEATEKSGGMVMSNEKEGRLKNMWKKSYINRWIDPSSREGGSHSNTEADNAGNIDYAR  564

Query  647  MKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKT--NNSPESLENIIYEAKLLK  474
            MK+E A ++ESLE M HLT+SIRRLR +LLKVKE  DT+T       ++ NI+ EA  LK
Sbjct  565  MKVEYAAVKESLESMGHLTTSIRRLRLALLKVKETNDTETAARTCEVAISNILVEATHLK  624

Query  473  TALGTSLPVSWSAESDSGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
            TALG S+P+SWSAESD     E + D    +S +K D VSAAGFEMVEL++ AA++LKE+
Sbjct  625  TALGISIPISWSAESD----MESVADG--ESSCDKTDSVSAAGFEMVELVILAAEILKEQ  678



>emb|CDX71169.1| BnaC07g04480D [Brassica napus]
Length=683

 Score =   147 bits (370),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = -2

Query  821  KQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDS--EGNDAESYPSSEVNSIGFAR  648
            + G+   + GG     + EGR KN+ KK+Y+ RW+  S  EG    +  +    +I +AR
Sbjct  508  RDGEATEKSGGMVMSNEKEGRLKNMWKKSYINRWIDPSSREGGSHSNTEADHAGNIDYAR  567

Query  647  MKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKT--NNSPESLENIIYEAKLLK  474
            M +E A L+ESLE M HLT+SIRRLR +LLKVKE  DT+T       ++ NI+ EA  LK
Sbjct  568  MNVEYAALKESLESMGHLTTSIRRLRLALLKVKETNDTETAARTCEVAISNILVEATHLK  627

Query  473  TALGTSLPVSWSAESDSGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
            TALG S+P+SWSAESD     E + D    +S +K D VSAAGFEMVEL++ AA++LKE+
Sbjct  628  TALGISIPISWSAESD----MESVADG--ESSCDKTDSVSAAGFEMVELVILAAEILKEQ  681



>ref|XP_006409644.1| hypothetical protein EUTSA_v10022593mg [Eutrema salsugineum]
 gb|ESQ51097.1| hypothetical protein EUTSA_v10022593mg [Eutrema salsugineum]
Length=631

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 113/171 (66%), Gaps = 10/171 (6%)
 Frame = -2

Query  794  GGKKTVQDGEGRFKNLLKKTYLKRWVGDS--EGNDAESYPSSEVNSIGFARMKIENATLR  621
            GG     + EGR KN+ KK+Y+ RW+  S  EG    +  +    +I ++RMK+E A L+
Sbjct  465  GGIVISNEKEGRLKNMWKKSYINRWIDPSSREGGSHSNTEAEYAGNIDYSRMKVEYAALK  524

Query  620  ESLECMEHLTSSIRRLRHSLLKVKECIDTKT--NNSPESLENIIYEAKLLKTALGTSLPV  447
            ESLE M HLT+SIRRLR +LLKVKE  DT+T       ++ NI+ EA  LKTALG S+P+
Sbjct  525  ESLESMGHLTTSIRRLRLALLKVKESNDTETAARRCEIAIANILVEATHLKTALGISIPI  584

Query  446  SWSAESDSGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
            SWSAESD     E + D    +S EK D VSAAGFEMVEL++ AA+++KE+
Sbjct  585  SWSAESDM----ESVAD--GESSCEKTDSVSAAGFEMVELVILAAEIMKEQ  629



>ref|XP_008236306.1| PREDICTED: cingulin isoform X2 [Prunus mume]
Length=644

 Score =   144 bits (363),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 118/179 (66%), Gaps = 14/179 (8%)
 Frame = -2

Query  803  SEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVNSIGFARMKIEN  633
            +E G +K V  + +GR K+LLKKTYL RWVG  DS G +AE   + E N    + M+   
Sbjct  463  AESGDRKAVTHERDGRLKSLLKKTYLSRWVGPPDSRGIEAEGGLNIEGNRRSNSSMEF--  520

Query  632  ATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP---ESLENIIYEAKLLKTALG  462
               RES+  MEHLT+++ RLR SL K KE + + +       E++ NIIYEAKL+KTALG
Sbjct  521  --ARESMGSMEHLTTTVHRLRLSLSKAKESVTSGSTTVTTLSETVNNIIYEAKLVKTALG  578

Query  461  TSLPVSWSAESDSGYNKEMLDDDCTH----TSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
            +SLP+SWSA++D  +N   L ++  H    TS EKID V AAGFEMVELL+ AAQ+LK+
Sbjct  579  SSLPISWSADADVEFNDHSLSNEPGHVSGETSHEKIDSVFAAGFEMVELLILAAQILKD  637



>dbj|BAC43422.2| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   140 bits (352),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 111/161 (69%), Gaps = 9/161 (6%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVG-DSEGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            +GR KN+ KK+Y+ RW+   S G    S  +   ++I ++RMK+E A ++E+LE M HLT
Sbjct  335  DGRLKNMWKKSYINRWIDPSSRGGSHLSTEADYASNIEYSRMKVEYAAIKENLESMGHLT  394

Query  590  SSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            +SIRRLR +LLKVKE  DT+T   +   ++ NI+ EA  LKTALG S+P+SWSAESD   
Sbjct  395  TSIRRLRLALLKVKELTDTETTARSCEVAIANILVEATHLKTALGISIPISWSAESDI--  452

Query  416  NKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
              E + D    +S E+ D VSAAGFEMVEL++ AA+++KE+
Sbjct  453  --ESVTDG--ESSCERTDSVSAAGFEMVELVILAAEIMKEQ  489



>ref|XP_009102316.1| PREDICTED: myosin heavy chain, clone 203 isoform X2 [Brassica 
rapa]
Length=656

 Score =   141 bits (355),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 112/178 (63%), Gaps = 8/178 (4%)
 Frame = -2

Query  821  KQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDS--EGNDAESYPSSEVNSIGFAR  648
            + G+   + GG     + EGR KN+ KK+Y+ RW+  S  EG    +  +    +I +AR
Sbjct  483  RDGEATEKSGGMVMSNEKEGRLKNMWKKSYINRWIDPSSREGGSHSNTEADYAGNIDYAR  542

Query  647  MKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSPESLENIIYEAKLLKTA  468
            MK+E A L+ESLE M HLT+SIRRLR +LLK     +T       ++ NI+ EA  LKTA
Sbjct  543  MKVEYAALKESLESMGHLTTSIRRLRLALLKETNDTETAARTCEVAISNILVEATHLKTA  602

Query  467  LGTSLPVSWSAESDSGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
            LG S+P+SWSAESD     E + D    +S +K D VSAAGFEMVEL++ AA++LKE+
Sbjct  603  LGISIPISWSAESD----MESVAD--GESSCDKTDSVSAAGFEMVELVILAAEILKEQ  654



>ref|XP_002883848.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60107.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   140 bits (353),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 111/161 (69%), Gaps = 9/161 (6%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVG-DSEGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+Y+ RW+   S G    +  +   ++I ++RMK+E A ++E+LE M HLT
Sbjct  473  EGRLKNMWKKSYINRWIDPSSRGGSHLNIEADYASNIDYSRMKVEYAAIKENLESMGHLT  532

Query  590  SSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            +SIRRLR +LLKVKE  DT+T   +   ++ NI+ EA  LKTALG S+P+SWSAESD   
Sbjct  533  TSIRRLRLALLKVKESNDTETTARSCEVAIANILVEATHLKTALGISIPISWSAESD---  589

Query  416  NKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
              E + D    +S E+ D VSAAGFEMVEL++ AA+++KE+
Sbjct  590  -MESVSDG--ESSCERTDSVSAAGFEMVELVILAAEIMKEQ  627



>ref|XP_010530702.1| PREDICTED: TATA element modulatory factor [Tarenaya hassleriana]
Length=635

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 112/173 (65%), Gaps = 15/173 (9%)
 Frame = -2

Query  806  HSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDSEGNDAE--SYPSSEVNSIGFARMKIEN  633
            H  I  +    + EGR KNLLKKT + RW+G  E +  E  ++  SE +   +ARMKIE 
Sbjct  462  HENIERRIITHEKEGRLKNLLKKTNINRWIGVMEPSSREVGAHLYSEAD---YARMKIEY  518

Query  632  ATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIYEAKLLKTALGT  459
            A  +ESLE M HLT+S+RRLR +LLKVKE +DT+       E++  II EA  LKTALG 
Sbjct  519  AAFKESLESMGHLTNSVRRLRLALLKVKESMDTEMAIGRYGEAINKIIMEANRLKTALGI  578

Query  458  SLPVSWSAESDSGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLK  300
            S+P+SWSAE+D+        +    +S+  +D VSAAGFEMVEL+V A+++L+
Sbjct  579  SIPISWSAEADA--------EASGDSSEGVVDSVSAAGFEMVELVVLASEILR  623



>ref|XP_010942768.1| PREDICTED: LOW QUALITY PROTEIN: myosin-2 heavy chain [Elaeis 
guineensis]
Length=680

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 121/214 (57%), Gaps = 30/214 (14%)
 Frame = -2

Query  890  FQLLF*NVHHFVVTYCRKDDQDMKQGKPHSEIGGKKT-VQDGEGRFKNLLKKTYLKRWVG  714
            FQLL  N  H V           K G   ++   K   + + EGR KNLLKKTYLKRW+G
Sbjct  470  FQLLQENCSHSV-----------KHGNYLADDSDKNVAIHEREGRLKNLLKKTYLKRWMG  518

Query  713  -DSEGNDAESYPSS---------EVNSIGFARMKIENATLRESLECMEHLTSSIRRLRHS  564
             D   +D +SY SS         ++ S+  AR+KIENA L+E++  ME +TSS+RRL   
Sbjct  519  NDHSQHDGDSYGSSGEGNSNNKKDLKSMDLARLKIENAALQETMANMERVTSSVRRLHVL  578

Query  563  LLKVKECIDTKTNNSP-----ESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLD  399
            LLKV+   D   +  P     ++L NII EA  +KTALG+SLPVSWS   +     E L 
Sbjct  579  LLKVQ---DDAASAGPTESIIQALSNIISEANHMKTALGSSLPVSWSGNEEDAITYENLY  635

Query  398  DDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
            +       EK+D VSAAG EMV+LL+ A +L KE
Sbjct  636  EPTEAPKIEKVDPVSAAGLEMVDLLILAVELQKE  669



>ref|NP_179075.1| protein MATERNAL EFFECT EMBRYO ARREST 13 [Arabidopsis thaliana]
 ref|NP_001189526.1| protein MATERNAL EFFECT EMBRYO ARREST 13 [Arabidopsis thaliana]
 gb|AAC69374.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06319.1| myosin heavy chain-related protein [Arabidopsis thaliana]
 gb|AEC06321.1| myosin heavy chain-related protein [Arabidopsis thaliana]
Length=629

 Score =   138 bits (348),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 17/165 (10%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWV-----GDSEGNDAESYPSSEVNSIGFARMKIENATLRESLECM  603
            +GR KN+ KK+Y+ RW+     G S  N    Y S+    I ++RMK+E A ++E+LE M
Sbjct  473  DGRLKNMWKKSYINRWIDPSSRGGSHLNTEADYASN----IEYSRMKVEYAAIKENLESM  528

Query  602  EHLTSSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSAES  429
             HLT+SIRRLR +LLKVKE  DT+T   +   ++ NI+ EA  LKTALG S+P+SWSAES
Sbjct  529  GHLTTSIRRLRLALLKVKELNDTETTARSCEVAIANILVEATHLKTALGISIPISWSAES  588

Query  428  DSGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
            D     E + D    +S E+ D VSAAGFEMVEL++ AA+++KE+
Sbjct  589  DI----ESVTDG--ESSCERTDSVSAAGFEMVELVILAAEIMKEQ  627



>ref|XP_010691568.1| PREDICTED: synaptonemal complex protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691569.1| PREDICTED: synaptonemal complex protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=631

 Score =   138 bits (347),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 126/190 (66%), Gaps = 17/190 (9%)
 Frame = -2

Query  794  GGKKTVQDG-EGRFKNLLKKTYLKRWVGDSEGND-AESYPSSEV---------NSIGFAR  648
            G K+ V  G +GRFKNLLKKT LK W+G SEGN  A ++P  E          +S+  AR
Sbjct  441  GEKRIVALGRDGRFKNLLKKTSLKHWLG-SEGNPPALAHPKLESAGSLNRGCNHSMNDAR  499

Query  647  MKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIYEAKLLK  474
            ++IE ATL+ES++ +E LT  IR+LR SL++VK    +K  ++++ + L+ II EA+++K
Sbjct  500  LRIEIATLKESMQNLERLTYDIRKLRVSLIQVKHTRSSKGASSSTTKVLDEIIREAEMVK  559

Query  473  TALGTSLPVSWSAESDSGYNKE-MLDDDCTH--TSKEKIDFVSAAGFEMVELLVFAAQLL  303
            TAL  +LP+SWS E D   + + + +++  H  +  EKID VSAAG EMVELL+ AAQ++
Sbjct  560  TALSAALPLSWSGEGDVASSSDNIFEENSNHGDSYNEKIDSVSAAGIEMVELLILAAQIM  619

Query  302  KEKTCRGEAK  273
            KEK  R E +
Sbjct  620  KEKKIRREHR  629



>ref|XP_010691570.1| PREDICTED: centrosomal protein of 128 kDa isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=622

 Score =   138 bits (347),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 126/190 (66%), Gaps = 17/190 (9%)
 Frame = -2

Query  794  GGKKTVQDG-EGRFKNLLKKTYLKRWVGDSEGND-AESYPSSEV---------NSIGFAR  648
            G K+ V  G +GRFKNLLKKT LK W+G SEGN  A ++P  E          +S+  AR
Sbjct  432  GEKRIVALGRDGRFKNLLKKTSLKHWLG-SEGNPPALAHPKLESAGSLNRGCNHSMNDAR  490

Query  647  MKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIYEAKLLK  474
            ++IE ATL+ES++ +E LT  IR+LR SL++VK    +K  ++++ + L+ II EA+++K
Sbjct  491  LRIEIATLKESMQNLERLTYDIRKLRVSLIQVKHTRSSKGASSSTTKVLDEIIREAEMVK  550

Query  473  TALGTSLPVSWSAESDSGYNKE-MLDDDCTH--TSKEKIDFVSAAGFEMVELLVFAAQLL  303
            TAL  +LP+SWS E D   + + + +++  H  +  EKID VSAAG EMVELL+ AAQ++
Sbjct  551  TALSAALPLSWSGEGDVASSSDNIFEENSNHGDSYNEKIDSVSAAGIEMVELLILAAQIM  610

Query  302  KEKTCRGEAK  273
            KEK  R E +
Sbjct  611  KEKKIRREHR  620



>ref|XP_010488904.1| PREDICTED: myosin heavy chain, clone 203-like isoform X2 [Camelina 
sativa]
Length=598

 Score =   137 bits (346),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS-EGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+Y+ RW+  S  G    +  +   ++I +ARMK+E A ++ESLE + HLT
Sbjct  442  EGRLKNMWKKSYINRWIDPSARGGGHLNTEADYASNIDYARMKVEYAAIKESLESLGHLT  501

Query  590  SSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            +SIRRLR +LL+VKE  DT+T       ++ NI+ EA  LKTALG S+P+SWSAESD   
Sbjct  502  TSIRRLRLALLQVKESNDTETTERRCEVAIANILVEATHLKTALGISIPISWSAESDV--  559

Query  416  NKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
              E + D    +S E+ D VSAAG+EMVEL++ AA+++KE+
Sbjct  560  --ESVADG--ESSCERTDSVSAAGYEMVELVILAAEIMKEQ  596



>ref|NP_001154517.1| protein MATERNAL EFFECT EMBRYO ARREST 13 [Arabidopsis thaliana]
 gb|AEC06320.1| myosin heavy chain-related protein [Arabidopsis thaliana]
Length=652

 Score =   138 bits (347),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 17/165 (10%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWV-----GDSEGNDAESYPSSEVNSIGFARMKIENATLRESLECM  603
            +GR KN+ KK+Y+ RW+     G S  N    Y S+    I ++RMK+E A ++E+LE M
Sbjct  496  DGRLKNMWKKSYINRWIDPSSRGGSHLNTEADYASN----IEYSRMKVEYAAIKENLESM  551

Query  602  EHLTSSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSAES  429
             HLT+SIRRLR +LLKVKE  DT+T   +   ++ NI+ EA  LKTALG S+P+SWSAES
Sbjct  552  GHLTTSIRRLRLALLKVKELNDTETTARSCEVAIANILVEATHLKTALGISIPISWSAES  611

Query  428  DSGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
            D     E + D    +S E+ D VSAAGFEMVEL++ AA+++KE+
Sbjct  612  DI----ESVTDG--ESSCERTDSVSAAGFEMVELVILAAEIMKEQ  650



>ref|XP_010496771.1| PREDICTED: uncharacterized protein LOC104773805 isoform X6 [Camelina 
sativa]
Length=502

 Score =   137 bits (344),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS-EGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+YL RW+  S  G    +  +   ++I +ARMK+E A ++ESLE + HLT
Sbjct  346  EGRLKNMWKKSYLNRWIDPSARGGGHLNTEADYASNIDYARMKVEYAAIKESLESLGHLT  405

Query  590  SSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            +SIRRLR +LL+VKE  DT+T       ++ NI+ EA  LKTALG S+P+SWSAESD   
Sbjct  406  TSIRRLRLALLQVKESNDTETTERRCEVAIANILVEATHLKTALGISIPISWSAESDV--  463

Query  416  NKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
              E + D    +S E+ D VSA+G+EMVEL++ AA+++KE+
Sbjct  464  --ESVADG--ESSCERTDSVSASGYEMVELVILAAEIMKEQ  500



>ref|XP_010496767.1| PREDICTED: myosin heavy chain, clone 203-like isoform X2 [Camelina 
sativa]
Length=596

 Score =   137 bits (345),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS-EGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+YL RW+  S  G    +  +   ++I +ARMK+E A ++ESLE + HLT
Sbjct  440  EGRLKNMWKKSYLNRWIDPSARGGGHLNTEADYASNIDYARMKVEYAAIKESLESLGHLT  499

Query  590  SSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            +SIRRLR +LL+VKE  DT+T       ++ NI+ EA  LKTALG S+P+SWSAESD   
Sbjct  500  TSIRRLRLALLQVKESNDTETTERRCEVAIANILVEATHLKTALGISIPISWSAESDV--  557

Query  416  NKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
              E + D    +S E+ D VSA+G+EMVEL++ AA+++KE+
Sbjct  558  --ESVADG--ESSCERTDSVSASGYEMVELVILAAEIMKEQ  594



>ref|XP_010488901.1| PREDICTED: myosin heavy chain, clone 203-like isoform X1 [Camelina 
sativa]
 ref|XP_010488903.1| PREDICTED: myosin heavy chain, clone 203-like isoform X1 [Camelina 
sativa]
Length=631

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS-EGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+Y+ RW+  S  G    +  +   ++I +ARMK+E A ++ESLE + HLT
Sbjct  475  EGRLKNMWKKSYINRWIDPSARGGGHLNTEADYASNIDYARMKVEYAAIKESLESLGHLT  534

Query  590  SSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            +SIRRLR +LL+VKE  DT+T       ++ NI+ EA  LKTALG S+P+SWSAESD   
Sbjct  535  TSIRRLRLALLQVKESNDTETTERRCEVAIANILVEATHLKTALGISIPISWSAESDV--  592

Query  416  NKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
              E + D    +S E+ D VSAAG+EMVEL++ AA+++KE+
Sbjct  593  --ESVADG--ESSCERTDSVSAAGYEMVELVILAAEIMKEQ  629



>ref|XP_010496769.1| PREDICTED: myosin heavy chain, clone 203-like isoform X4 [Camelina 
sativa]
Length=596

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS-EGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+YL RW+  S  G    +  +   ++I +ARMK+E A ++ESLE + HLT
Sbjct  440  EGRLKNMWKKSYLNRWIDPSARGGGHLNTEADYASNIDYARMKVEYAAIKESLESLGHLT  499

Query  590  SSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            +SIRRLR +LL+VKE  DT+T       ++ NI+ EA  LKTALG S+P+SWSAESD   
Sbjct  500  TSIRRLRLALLQVKESNDTETTERRCEVAIANILVEATHLKTALGISIPISWSAESDV--  557

Query  416  NKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
              E + D    +S E+ D VSA+G+EMVEL++ AA+++KE+
Sbjct  558  --ESVADG--ESSCERTDSVSASGYEMVELVILAAEIMKEQ  594



>ref|XP_010496768.1| PREDICTED: myosin heavy chain, clone 203-like isoform X3 [Camelina 
sativa]
Length=596

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS-EGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+YL RW+  S  G    +  +   ++I +ARMK+E A ++ESLE + HLT
Sbjct  440  EGRLKNMWKKSYLNRWIDPSARGGGHLNTEADYASNIDYARMKVEYAAIKESLESLGHLT  499

Query  590  SSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            +SIRRLR +LL+VKE  DT+T       ++ NI+ EA  LKTALG S+P+SWSAESD   
Sbjct  500  TSIRRLRLALLQVKESNDTETTERRCEVAIANILVEATHLKTALGISIPISWSAESDV--  557

Query  416  NKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
              E + D    +S E+ D VSA+G+EMVEL++ AA+++KE+
Sbjct  558  --ESVADG--ESSCERTDSVSASGYEMVELVILAAEIMKEQ  594



>ref|XP_010517645.1| PREDICTED: myosin heavy chain, clone 203-like isoform X2 [Camelina 
sativa]
Length=598

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 109/161 (68%), Gaps = 9/161 (6%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS-EGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+YL RW+  S  G    +  +   ++I +AR K+E A ++ESLE + HLT
Sbjct  442  EGRLKNMWKKSYLNRWIDPSARGGGHLNTEADYASNIDYARTKVEYAAIKESLESLGHLT  501

Query  590  SSIRRLRHSLLKVKECIDTKT--NNSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            +SIRRLR +LL+VKE  DT+T       ++ NI+ EA  LKTALG S+P+SWSAESD   
Sbjct  502  TSIRRLRLALLQVKESNDTETAERRCEVAIANILVEATHLKTALGISIPISWSAESDV--  559

Query  416  NKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
              E + D    +S E+ D VSAAG+EMVEL++ AA+++KE+
Sbjct  560  --ESVADG--QSSSERTDSVSAAGYEMVELVILAAKIMKEQ  596



>ref|XP_010496763.1| PREDICTED: myosin heavy chain, clone 203-like isoform X1 [Camelina 
sativa]
 ref|XP_010496764.1| PREDICTED: myosin heavy chain, clone 203-like isoform X1 [Camelina 
sativa]
 ref|XP_010496765.1| PREDICTED: myosin heavy chain, clone 203-like isoform X1 [Camelina 
sativa]
 ref|XP_010496766.1| PREDICTED: myosin heavy chain, clone 203-like isoform X1 [Camelina 
sativa]
Length=629

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS-EGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+YL RW+  S  G    +  +   ++I +ARMK+E A ++ESLE + HLT
Sbjct  473  EGRLKNMWKKSYLNRWIDPSARGGGHLNTEADYASNIDYARMKVEYAAIKESLESLGHLT  532

Query  590  SSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            +SIRRLR +LL+VKE  DT+T       ++ NI+ EA  LKTALG S+P+SWSAESD   
Sbjct  533  TSIRRLRLALLQVKESNDTETTERRCEVAIANILVEATHLKTALGISIPISWSAESDV--  590

Query  416  NKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
              E + D    +S E+ D VSA+G+EMVEL++ AA+++KE+
Sbjct  591  --ESVADG--ESSCERTDSVSASGYEMVELVILAAEIMKEQ  627



>ref|XP_010517639.1| PREDICTED: myosin heavy chain, clone 203-like isoform X1 [Camelina 
sativa]
Length=631

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 109/161 (68%), Gaps = 9/161 (6%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS-EGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+YL RW+  S  G    +  +   ++I +AR K+E A ++ESLE + HLT
Sbjct  475  EGRLKNMWKKSYLNRWIDPSARGGGHLNTEADYASNIDYARTKVEYAAIKESLESLGHLT  534

Query  590  SSIRRLRHSLLKVKECIDTKT--NNSPESLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            +SIRRLR +LL+VKE  DT+T       ++ NI+ EA  LKTALG S+P+SWSAESD   
Sbjct  535  TSIRRLRLALLQVKESNDTETAERRCEVAIANILVEATHLKTALGISIPISWSAESDV--  592

Query  416  NKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
              E + D    +S E+ D VSAAG+EMVEL++ AA+++KE+
Sbjct  593  --ESVADG--QSSSERTDSVSAAGYEMVELVILAAKIMKEQ  629



>ref|XP_006297176.1| hypothetical protein CARUB_v10013180mg, partial [Capsella rubella]
 gb|EOA30074.1| hypothetical protein CARUB_v10013180mg, partial [Capsella rubella]
Length=647

 Score =   135 bits (341),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 109/163 (67%), Gaps = 13/163 (8%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS-EGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+YL RW+  S  G    +  +   ++I +ARMK+E A ++E+LE + HLT
Sbjct  491  EGRLKNMWKKSYLNRWIDPSARGGGHVNTEADYASNIDYARMKVEYAAIKENLESLGHLT  550

Query  590  SSIRRLRHSLLKVKECIDT-KTNNSPE-SLENIIYEAKLLKTALGTSLPVSWSAESDSGY  417
            ++IRRLR +LLKVKE  DT +T    E ++ NI+ EA  LKTALG S+P+SWSAESD   
Sbjct  551  TTIRRLRLALLKVKEENDTERTERRREVAIANILVEATHLKTALGISIPISWSAESDM--  608

Query  416  NKEMLDDDCT--HTSKEKIDFVSAAGFEMVELLVFAAQLLKEK  294
                  D  T   +S EK D VSAAGFEMVEL++ A +++KE+
Sbjct  609  ------DPVTDGESSCEKTDSVSAAGFEMVELVILAGEIMKEQ  645



>ref|XP_008795652.1| PREDICTED: myosin-10 isoform X2 [Phoenix dactylifera]
Length=683

 Score =   127 bits (319),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 105/180 (58%), Gaps = 21/180 (12%)
 Frame = -2

Query  782  TVQDGEGRFKNLLKKTYLKRWVG-DSEGNDAESYPSS---------EVNSIGFARMKIEN  633
             + + EGR KN+LKKTYLKRW+G D   +D + Y SS         +   + FAR+KIEN
Sbjct  496  ALHEREGRLKNILKKTYLKRWMGNDHSQHDTDIYGSSGKSNSTNKKDFKCMDFARLKIEN  555

Query  632  ATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP-----ESLENIIYEAKLLKTA  468
            A L+ES+  ME +TSS+RRL   LL+ +   D   +  P     ++L NII EA  +KTA
Sbjct  556  AALQESMANMERVTSSVRRLHVLLLRAQ---DDAASAGPTESIIQALSNIISEANHMKTA  612

Query  467  LGTSLPVSWSAESDSGYNKEML---DDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
            LG+SLP+SWS   +     E L    D       EK+D VS AG EMV+LL+ A +L KE
Sbjct  613  LGSSLPISWSGSGEDAVTYENLYEPTDPLEVPKIEKVDPVSIAGLEMVDLLILAVELQKE  672



>ref|XP_008795651.1| PREDICTED: myosin-10 isoform X1 [Phoenix dactylifera]
Length=686

 Score =   127 bits (319),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 105/180 (58%), Gaps = 21/180 (12%)
 Frame = -2

Query  782  TVQDGEGRFKNLLKKTYLKRWVG-DSEGNDAESYPSS---------EVNSIGFARMKIEN  633
             + + EGR KN+LKKTYLKRW+G D   +D + Y SS         +   + FAR+KIEN
Sbjct  499  ALHEREGRLKNILKKTYLKRWMGNDHSQHDTDIYGSSGKSNSTNKKDFKCMDFARLKIEN  558

Query  632  ATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSP-----ESLENIIYEAKLLKTA  468
            A L+ES+  ME +TSS+RRL   LL+ +   D   +  P     ++L NII EA  +KTA
Sbjct  559  AALQESMANMERVTSSVRRLHVLLLRAQ---DDAASAGPTESIIQALSNIISEANHMKTA  615

Query  467  LGTSLPVSWSAESDSGYNKEML---DDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
            LG+SLP+SWS   +     E L    D       EK+D VS AG EMV+LL+ A +L KE
Sbjct  616  LGSSLPISWSGSGEDAVTYENLYEPTDPLEVPKIEKVDPVSIAGLEMVDLLILAVELQKE  675



>ref|XP_009394357.1| PREDICTED: myosin-10 [Musa acuminata subsp. malaccensis]
 ref|XP_009394358.1| PREDICTED: myosin-10 [Musa acuminata subsp. malaccensis]
 ref|XP_009394359.1| PREDICTED: myosin-10 [Musa acuminata subsp. malaccensis]
Length=661

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 113/191 (59%), Gaps = 16/191 (8%)
 Frame = -2

Query  824  MKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRW-VGDSEGNDAESYPSSEVNS-----  663
            +K G    + G   T+++ EG+ KN+LK+TYL+ W V D    +      +E NS     
Sbjct  457  IKHGSHMVDPGKSTTIREQEGKLKNILKRTYLRHWMVRDQSQQETNFLKITEENSPIIKT  516

Query  662  ---IGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKE---CIDTKTNNSPESLEN  501
               I  AR+K+ENA LRES+  +EHLTSSI RL   LLKV++    + T+   +  ++ N
Sbjct  517  DSSIDIARLKVENAALRESIANLEHLTSSIHRLHILLLKVQDEASSVGTEEGTT-RAVSN  575

Query  500  IIYEAKLLKTALGTSLPVSWSA-ESDS-GYNKEMLDDDCTHTSK-EKIDFVSAAGFEMVE  330
            I+ EA  +KTALG SLPVSWS  E+D+  Y       D +  SK  K D VSAAG EMV+
Sbjct  576  IVMEANQVKTALGGSLPVSWSGDEADAIIYTSLHEPSDPSEASKPAKPDAVSAAGLEMVD  635

Query  329  LLVFAAQLLKE  297
            LL+ AAQL +E
Sbjct  636  LLILAAQLQQE  646



>ref|XP_006857161.1| hypothetical protein AMTR_s00065p00166970 [Amborella trichopoda]
 gb|ERN18628.1| hypothetical protein AMTR_s00065p00166970 [Amborella trichopoda]
Length=664

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 122/194 (63%), Gaps = 20/194 (10%)
 Frame = -2

Query  821  KQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSE------V  669
            KQ  P    G K  +  + +GR K+LLK+TYLKRW+G  D  GN A  + + +       
Sbjct  466  KQYHPFGWPGVKNIIAHERDGRLKSLLKRTYLKRWMGEVDIHGNQANVFKNDDGSTRTPK  525

Query  668  NSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTN--NSPESLENII  495
            N++  AR+KIENATL+E +  +EHLTSSI RLR +L++ K+   T T+  ++ E+L+ I+
Sbjct  526  NAVDIARLKIENATLQEGMASLEHLTSSIHRLRLALVQAKDIARTTTHAKSTVETLDGIV  585

Query  494  YEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTHTSK----EKIDFVSAAGFEMVEL  327
             EA  LKTALG+SLP+SWS+E+D      +  +D    S+    EK+D ++A G E+VEL
Sbjct  586  VEANHLKTALGSSLPLSWSSETDP-----LPFEDQPELSRDLKTEKLDSITAVGLELVEL  640

Query  326  LVFAAQLLKEKTCR  285
            L+ A QL K++  R
Sbjct  641  LLMATQLQKDEIVR  654



>ref|XP_004983921.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X3 [Setaria italica]
Length=681

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 109/191 (57%), Gaps = 22/191 (12%)
 Frame = -2

Query  824  MKQGKPHSEIGGKKTV--QDGEGRFKNLLKKTYLKRWV-------GDSEGNDAESYPSSE  672
            MK+G  H      K +   D +G  KN+LK+T L+ W+       G S+GND        
Sbjct  492  MKEG--HGSGDSSKVIPGHDQQGMLKNMLKRTSLRHWMRNSNIGHGSSDGNDQSVCKE--  547

Query  671  VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSPES----LE  504
             + +  AR+++ENATL E +  +E LTSS+ RL   LLK  +  D K+ +S ES    L 
Sbjct  548  -HLMDIARLRVENATLLEGVGTVERLTSSVHRLHIVLLKAYD--DVKSASSLESTFQDLN  604

Query  503  NIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDD--DCTHTSKEKIDFVSAAGFEMVE  330
            ++I EA L+KTAL   LPVSWS +S      E L D  D   +  EK D +S+AG EMVE
Sbjct  605  SLITEANLMKTALSVVLPVSWSGDSSDAITYEALCDPSDSPKSKSEKADPLSSAGMEMVE  664

Query  329  LLVFAAQLLKE  297
            LL+FAA++LKE
Sbjct  665  LLIFAAEVLKE  675



>ref|XP_004983919.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X1 [Setaria italica]
 ref|XP_004983920.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X2 [Setaria italica]
Length=682

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 109/191 (57%), Gaps = 22/191 (12%)
 Frame = -2

Query  824  MKQGKPHSEIGGKKTV--QDGEGRFKNLLKKTYLKRWV-------GDSEGNDAESYPSSE  672
            MK+G  H      K +   D +G  KN+LK+T L+ W+       G S+GND        
Sbjct  493  MKEG--HGSGDSSKVIPGHDQQGMLKNMLKRTSLRHWMRNSNIGHGSSDGNDQSVCKE--  548

Query  671  VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSPES----LE  504
             + +  AR+++ENATL E +  +E LTSS+ RL   LLK  +  D K+ +S ES    L 
Sbjct  549  -HLMDIARLRVENATLLEGVGTVERLTSSVHRLHIVLLKAYD--DVKSASSLESTFQDLN  605

Query  503  NIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDD--DCTHTSKEKIDFVSAAGFEMVE  330
            ++I EA L+KTAL   LPVSWS +S      E L D  D   +  EK D +S+AG EMVE
Sbjct  606  SLITEANLMKTALSVVLPVSWSGDSSDAITYEALCDPSDSPKSKSEKADPLSSAGMEMVE  665

Query  329  LLVFAAQLLKE  297
            LL+FAA++LKE
Sbjct  666  LLIFAAEVLKE  676



>gb|AFW89938.1| hypothetical protein ZEAMMB73_155311 [Zea mays]
Length=375

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 102/173 (59%), Gaps = 16/173 (9%)
 Frame = -2

Query  776  QDGEGRFKNLLKKTYLKRWV---------GDSEGNDAESYPSSEVNSIGFARMKIENATL  624
             D +G  K +LK+T L+ W+         G S+GND   +   + +S+  AR+++ENA L
Sbjct  200  HDQQGMLKTMLKRTSLRHWMRKESNTIGHGSSDGND---HTVCKEHSVDVARLRVENAML  256

Query  623  RESLECMEHLTSSIRRLRHSLLKVKECIDT--KTNNSPESLENIIYEAKLLKTALGTSLP  450
             E +  +EHLTSS+ RL   LLK  + I +     ++ E+L ++I EA L+KTAL   LP
Sbjct  257  LEGVGTVEHLTSSVHRLHIVLLKAYDDIKSADPLESTFEALNSLITEANLMKTALNVVLP  316

Query  449  VSWSAESDSGYNKEMLDD--DCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
            VSWS +S      E + D  D   +   K+D +S+AG EMVELL+ AA++LKE
Sbjct  317  VSWSGDSSDAIKYEAMCDPSDSPKSKSGKVDPLSSAGMEMVELLILAAEILKE  369



>gb|AFW89940.1| hypothetical protein ZEAMMB73_155311 [Zea mays]
Length=384

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 102/173 (59%), Gaps = 16/173 (9%)
 Frame = -2

Query  776  QDGEGRFKNLLKKTYLKRWV---------GDSEGNDAESYPSSEVNSIGFARMKIENATL  624
             D +G  K +LK+T L+ W+         G S+GND   +   + +S+  AR+++ENA L
Sbjct  209  HDQQGMLKTMLKRTSLRHWMRKESNTIGHGSSDGND---HTVCKEHSVDVARLRVENAML  265

Query  623  RESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIYEAKLLKTALGTSLP  450
             E +  +EHLTSS+ RL   LLK  + I +     ++ E+L ++I EA L+KTAL   LP
Sbjct  266  LEGVGTVEHLTSSVHRLHIVLLKAYDDIKSADPLESTFEALNSLITEANLMKTALNVVLP  325

Query  449  VSWSAESDSGYNKEMLDD--DCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
            VSWS +S      E + D  D   +   K+D +S+AG EMVELL+ AA++LKE
Sbjct  326  VSWSGDSSDAIKYEAMCDPSDSPKSKSGKVDPLSSAGMEMVELLILAAEILKE  378



>ref|XP_002446611.1| hypothetical protein SORBIDRAFT_06g018840 [Sorghum bicolor]
 gb|EES10939.1| hypothetical protein SORBIDRAFT_06g018840 [Sorghum bicolor]
Length=711

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 103/174 (59%), Gaps = 20/174 (11%)
 Frame = -2

Query  773  DGEGRFKNLLKKTYLKRWV---------GDSEGNDAESYPSSEVNSIGFARMKIENATLR  621
            D +G  K +LK+T L+ W+         G S+GND   +   + +S+  AR+++ENA L 
Sbjct  537  DQQGMLKTMLKRTSLRHWMRKESSTIGHGSSDGND---HTVCKEHSVDVARLRVENAMLL  593

Query  620  ESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSPES----LENIIYEAKLLKTALGTSL  453
            E +  +E LTSS+RRL   LLK  +  D K+ +S ES    L ++I EA L+KTAL   L
Sbjct  594  EGVGTVERLTSSVRRLHIVLLKAYD--DIKSADSLESTFEALNSLITEANLMKTALNVVL  651

Query  452  PVSWSAESDSGYNKEMLDD--DCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
            PVSWS +S      E L D  D   +   K+D +S+AG EMVELL+ AA++LKE
Sbjct  652  PVSWSGDSSDAITYEALCDPSDSPKSKSWKVDPLSSAGMEMVELLILAAEILKE  705



>ref|XP_008660609.1| PREDICTED: paramyosin isoform X1 [Zea mays]
Length=682

 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 102/172 (59%), Gaps = 16/172 (9%)
 Frame = -2

Query  773  DGEGRFKNLLKKTYLKRWV---------GDSEGNDAESYPSSEVNSIGFARMKIENATLR  621
            D +G  K +LK+T L+ W+         G S+GND   +   + +S+  AR+++ENA L 
Sbjct  508  DQQGMLKTMLKRTSLRHWMRKESNTIGHGSSDGND---HTVCKEHSVDVARLRVENAMLL  564

Query  620  ESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIYEAKLLKTALGTSLPV  447
            E +  +EHLTSS+ RL   LLK  + I +     ++ E+L ++I EA L+KTAL   LPV
Sbjct  565  EGVGTVEHLTSSVHRLHIVLLKAYDDIKSADPLESTFEALNSLITEANLMKTALNVVLPV  624

Query  446  SWSAESDSGYNKEMLDD--DCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
            SWS +S      E + D  D   +   K+D +S+AG EMVELL+ AA++LKE
Sbjct  625  SWSGDSSDAIKYEAMCDPSDSPKSKSGKVDPLSSAGMEMVELLILAAEILKE  676



>ref|XP_008660610.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X2 [Zea mays]
Length=681

 Score =   112 bits (280),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 102/172 (59%), Gaps = 16/172 (9%)
 Frame = -2

Query  773  DGEGRFKNLLKKTYLKRWV---------GDSEGNDAESYPSSEVNSIGFARMKIENATLR  621
            D +G  K +LK+T L+ W+         G S+GND   +   + +S+  AR+++ENA L 
Sbjct  507  DQQGMLKTMLKRTSLRHWMRKESNTIGHGSSDGND---HTVCKEHSVDVARLRVENAMLL  563

Query  620  ESLECMEHLTSSIRRLRHSLLKVKECIDTK--TNNSPESLENIIYEAKLLKTALGTSLPV  447
            E +  +EHLTSS+ RL   LLK  + I +     ++ E+L ++I EA L+KTAL   LPV
Sbjct  564  EGVGTVEHLTSSVHRLHIVLLKAYDDIKSADPLESTFEALNSLITEANLMKTALNVVLPV  623

Query  446  SWSAESDSGYNKEMLDD--DCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
            SWS +S      E + D  D   +   K+D +S+AG EMVELL+ AA++LKE
Sbjct  624  SWSGDSSDAIKYEAMCDPSDSPKSKSGKVDPLSSAGMEMVELLILAAEILKE  675



>ref|XP_002465071.1| hypothetical protein SORBIDRAFT_01g031580 [Sorghum bicolor]
 gb|EER92069.1| hypothetical protein SORBIDRAFT_01g031580 [Sorghum bicolor]
Length=661

 Score =   109 bits (273),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 102/174 (59%), Gaps = 20/174 (11%)
 Frame = -2

Query  773  DGEGRFKNLLKKTYLKRWV---------GDSEGNDAESYPSSEVNSIGFARMKIENATLR  621
            D +G  K +LK+T L+ W+         G S+GND   +   + +S+  AR+++EN+TL 
Sbjct  487  DQQGMLKTMLKRTSLRHWMRKESSTIGHGSSDGND---HTVCKEHSVDVARLRVENSTLL  543

Query  620  ESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSPES----LENIIYEAKLLKTALGTSL  453
            E +  +E LTSS+ RL   LLK  +  D K+ +S ES    L ++I EA ++KTAL   L
Sbjct  544  EGVGTVERLTSSVHRLHIVLLKAYD--DIKSADSLESTFEALNSLITEANVMKTALNVVL  601

Query  452  PVSWSAESDSGYNKEML--DDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
            PVSWS +S      E L    D   +   K+D +S+AG EMVELL+ AA++LKE
Sbjct  602  PVSWSGDSSDAITYEALCEPSDSPKSKSGKVDPLSSAGMEMVELLILAAEILKE  655



>dbj|BAJ94675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=627

 Score =   108 bits (271),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 100/169 (59%), Gaps = 17/169 (10%)
 Frame = -2

Query  773  DGEGRFKNLLKKTYLKRWV--GDSEGN---DAESYPSSEVNSIGFARMKIENATLRESLE  609
            D +G  K +L +T L++W+  G++ G+   D          S+  +R+K+ENATL ES+ 
Sbjct  460  DQQGMLKTILNRTSLRQWIKKGNNSGHERSDGNDLTICRGCSVDLSRLKVENATLLESVA  519

Query  608  CMEHLTSSIRRLRHSLLKVKECIDTKTNNSPES----LENIIYEAKLLKTALGTSLPVSW  441
             ME LTS + RL   L+K  +  D K+  S ES    L ++I EA L++TALG  LPVSW
Sbjct  520  TMERLTSLVHRLHRVLMKAYD--DVKSGCSLESTYEVLNSLITEANLMRTALGVVLPVSW  577

Query  440  SAESDSGYNKEMLDDDCTHTSK-EKIDFVSAAGFEMVELLVFAAQLLKE  297
            S +S  G     +  D   +SK EK+D + +A  EMVELL+FAA +LKE
Sbjct  578  SGDSSGG-----ITSDSPKSSKSEKVDPLGSASVEMVELLIFAADILKE  621



>ref|NP_001173486.1| Os03g0431932 [Oryza sativa Japonica Group]
 dbj|BAH92214.1| Os03g0431932, partial [Oryza sativa Japonica Group]
Length=278

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 98/185 (53%), Gaps = 17/185 (9%)
 Frame = -2

Query  806  HSEIGGKKTV--QDGEGRFKNLLKKTYLKRWVGDSEGNDAESYPSSEVNSI------GFA  651
            H  +   K +   D +G FK ++ +T L+ W+     N         V+++        A
Sbjct  89   HGAVDNMKIIPAHDRQGMFKTIMNRTSLRHWIKKENTNIGHECSDENVHTVRKHHSEDLA  148

Query  650  RMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSPES----LENIIYEAK  483
            R+K ENA L ES+  MEHLTSS+ RL   L+K  E  D K+ +S ES    L ++I EA 
Sbjct  149  RVKAENAALLESVATMEHLTSSVHRLHIVLMKAFE--DVKSAHSLESTYEALNSLITEAN  206

Query  482  LLKTALGTSLPVSWSAESDSGYNKEMLDDDCTHTSKEKI---DFVSAAGFEMVELLVFAA  312
            L+KTALG +LPVSW  +S      + L D        K    D +S+AG EMVELL+ AA
Sbjct  207  LMKTALGVALPVSWLGDSSDAITSDALYDPSESPKSSKSEKQDPLSSAGMEMVELLILAA  266

Query  311  QLLKE  297
             +LK+
Sbjct  267  DILKD  271



>gb|EPS73785.1| hypothetical protein M569_00972, partial [Genlisea aurea]
Length=466

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 100/181 (55%), Gaps = 22/181 (12%)
 Frame = -2

Query  824  MKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVGDSEGNDAESYPSSEVNSIGFARM  645
            + QG+   EIG +K    G  + K++LK+  L RWVG  EG+    +    +  + F  M
Sbjct  303  VAQGRRPDEIGREKE-GGGGSKIKSMLKRASLTRWVGGVEGD---LHHDKSIRDVDFTSM  358

Query  644  KIENATLRESLECMEHLTSSIRRLRHSLLKVK----ECIDTKTNNSPESLENIIYEAKLL  477
            KIENATL+ESLE M HL  S++RLR SL K+K    EC D       ES++ II E  LL
Sbjct  359  KIENATLKESLESMNHLLCSVQRLRISLEKIKESAAECADDALT---ESVDRIIAEGNLL  415

Query  476  KTALGTSLPVSWSAESDSGYNKEMLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLKE  297
            KTALG+S+PV  S    +G        +C          V+A G EMVELL+ AA +LK 
Sbjct  416  KTALGSSIPV-VSGGVTAGQKGGSGGYEC----------VTAVGVEMVELLITAADILKH  464

Query  296  K  294
            +
Sbjct  465  Q  465



>ref|XP_003577215.1| PREDICTED: uncharacterized protein LOC100842072 [Brachypodium 
distachyon]
Length=641

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 100/183 (55%), Gaps = 13/183 (7%)
 Frame = -2

Query  806  HSEIGGKKTV--QDGEGRFKNLLKKTYLKRWVGDSEGN------DAESYPSSEVNSIGFA  651
            H  +   K +   D +G    +LK+T L+ W+     N      D   +      S+  A
Sbjct  453  HGTVDPPKAIPGHDQQGMLNTILKRTSLRHWMRKENSNIGLESSDGNDHTVRNECSLDLA  512

Query  650  RMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLL  477
            RMK+ENATL ES+  ME LTS + RL   L+KV + + +  +  +S E+L ++I EA L+
Sbjct  513  RMKVENATLLESVATMERLTSLVHRLHVVLMKVYDDVKSACSLESSFEALNSLITEANLM  572

Query  476  KTALGTSLPVSWSAESDSGYNKEML---DDDCTHTSKEKIDFVSAAGFEMVELLVFAAQL  306
            KTAL   LPVSWS +S      + L    D    +  EK+D +S+AG EMVELLV AA +
Sbjct  573  KTALSVVLPVSWSGDSSGAITSDGLHDPSDSPKSSKSEKVDPISSAGLEMVELLVLAADI  632

Query  305  LKE  297
            LKE
Sbjct  633  LKE  635



>gb|EMT02263.1| hypothetical protein F775_07028 [Aegilops tauschii]
Length=953

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 98/167 (59%), Gaps = 13/167 (8%)
 Frame = -2

Query  773  DGEGRFKNLLKKTYLKRWVGDSEGNDAESYPSSEVN-----SIGFARMKIENATLRESLE  609
            D +G  K +L +T L++W+        ES   ++       S+  +RMK+ENATL ES+ 
Sbjct  786  DQQGMLKTILNRTSLRQWIKKENNTGHESSRGNDQTVCRGCSVDLSRMKVENATLLESVA  845

Query  608  CMEHLTSSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSA  435
             MEHLTS + RL   L+KV + + +  +  +S E+L ++I EA L++TALG  LPVSWS 
Sbjct  846  TMEHLTSLVHRLHRVLMKVYDDVKSGCSLESSYEALSSLITEANLMRTALGVVLPVSWSG  905

Query  434  ESDSGYNKEMLDDDCTHTSK-EKIDFVSAAGFEMVELLVFAAQLLKE  297
            +S  G     +      +SK EK D + +A  EM+ELL+ AA +L+E
Sbjct  906  DSSGG-----ITSGSPKSSKSEKADPLGSASMEMLELLILAADILRE  947



>gb|EMS67805.1| hypothetical protein TRIUR3_20989 [Triticum urartu]
Length=815

 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 99/167 (59%), Gaps = 13/167 (8%)
 Frame = -2

Query  773  DGEGRFKNLLKKTYLKRWVGDSEGNDAESYPSSEVN-----SIGFARMKIENATLRESLE  609
            D +G  K +L +T L++W+        ES   ++       S+  +RMK+ENATL ES+ 
Sbjct  648  DQQGMLKTILNRTSLRQWIKKENNTGHESSGGNDQTVCRGCSVDLSRMKVENATLLESVA  707

Query  608  CMEHLTSSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSA  435
             +E LTS + RL   L+KV + + +  +  +S E+L ++I EA L++TALG  LPVSWS 
Sbjct  708  TVERLTSLVHRLHRVLMKVYDDVKSGCSLESSYEALSSLITEANLMRTALGVVLPVSWSG  767

Query  434  ESDSGYNKEMLDDDCTHTSK-EKIDFVSAAGFEMVELLVFAAQLLKE  297
            +S  G     +  D   +SK EK+D + +A  EM+ELL+ AA +L+E
Sbjct  768  DSSGG-----ITSDSPKSSKSEKVDPLGSASMEMLELLILAADILRE  809



>gb|EEC75538.1| hypothetical protein OsI_12160 [Oryza sativa Indica Group]
Length=677

 Score =   104 bits (259),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 98/185 (53%), Gaps = 17/185 (9%)
 Frame = -2

Query  806  HSEIGGKKTV--QDGEGRFKNLLKKTYLKRWVGDSEGNDAESYPSSEVNSI------GFA  651
            H  +   K +   D +G FK ++ +T L+ W+     N         V+++        A
Sbjct  488  HGAVDNMKIIPAHDRQGMFKTIMNRTSLRHWIKKENTNIGHECSDENVHTVRKHHSEDLA  547

Query  650  RMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSPES----LENIIYEAK  483
            R+K ENA L ES+  MEHLTSS+ RL   L+K  E  D K+ +S ES    L ++I EA 
Sbjct  548  RVKAENAALLESVATMEHLTSSVHRLHIVLMKAFE--DVKSAHSLESTYEALNSLITEAN  605

Query  482  LLKTALGTSLPVSWSAESDSGYNKEMLDDDCTHTSKEKI---DFVSAAGFEMVELLVFAA  312
            L+KTALG +LPVSW  +S      + L D        K    D +S+AG EMVELL+ AA
Sbjct  606  LMKTALGVALPVSWLGDSSDAITSDALYDPSESPKSSKSEKQDPLSSAGMEMVELLILAA  665

Query  311  QLLKE  297
             +LK+
Sbjct  666  DILKD  670



>gb|AAR87154.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF96767.1| expressed protein [Oryza sativa Japonica Group]
 gb|EEE59312.1| hypothetical protein OsJ_11369 [Oryza sativa Japonica Group]
Length=677

 Score =   104 bits (259),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 98/185 (53%), Gaps = 17/185 (9%)
 Frame = -2

Query  806  HSEIGGKKTV--QDGEGRFKNLLKKTYLKRWVGDSEGNDAESYPSSEVNSI------GFA  651
            H  +   K +   D +G FK ++ +T L+ W+     N         V+++        A
Sbjct  488  HGAVDNMKIIPAHDRQGMFKTIMNRTSLRHWIKKENTNIGHECSDENVHTVRKHHSEDLA  547

Query  650  RMKIENATLRESLECMEHLTSSIRRLRHSLLKVKECIDTKTNNSPES----LENIIYEAK  483
            R+K ENA L ES+  MEHLTSS+ RL   L+K  E  D K+ +S ES    L ++I EA 
Sbjct  548  RVKAENAALLESVATMEHLTSSVHRLHIVLMKAFE--DVKSAHSLESTYEALNSLITEAN  605

Query  482  LLKTALGTSLPVSWSAESDSGYNKEMLDDDCTHTSKEKI---DFVSAAGFEMVELLVFAA  312
            L+KTALG +LPVSW  +S      + L D        K    D +S+AG EMVELL+ AA
Sbjct  606  LMKTALGVALPVSWLGDSSDAITSDALYDPSESPKSSKSEKQDPLSSAGMEMVELLILAA  665

Query  311  QLLKE  297
             +LK+
Sbjct  666  DILKD  670



>ref|XP_006650223.1| PREDICTED: desmoplakin-like isoform X1 [Oryza brachyantha]
 ref|XP_006650224.1| PREDICTED: desmoplakin-like isoform X2 [Oryza brachyantha]
Length=683

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 95/168 (57%), Gaps = 11/168 (7%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS------EGNDAESYPSSEVNSIGFARMKIENATLRESLEC  606
            +G F ++L +  LK W+         E +D   +  ++  S+  AR+K+ENA L ES+  
Sbjct  510  QGMFTSILNRASLKHWMRKENINIGHEYSDENDHTVAKDYSVDLARVKVENAALLESVAT  569

Query  605  MEHLTSSIRRLRHSLLKVKECIDTKTN--NSPESLENIIYEAKLLKTALGTSLPVSWSAE  432
            ME LTSS+ RL   L+K  E + +  +  ++ E+L+++I EA L+KTA+G +LPVSW  +
Sbjct  570  MERLTSSVHRLHIVLMKAYESVKSTASLESTYEALDSLITEANLMKTAVGVALPVSWLGD  629

Query  431  SDSGYNKEMLDDDCTHTSKEKI---DFVSAAGFEMVELLVFAAQLLKE  297
            S      + L D        K    D +S+A  EMVELL+ AA +LKE
Sbjct  630  SSDAITSDALHDPSESPKSSKSEKQDPLSSASLEMVELLILAADILKE  677



>ref|XP_003610611.1| hypothetical protein MTR_5g005010 [Medicago truncatula]
Length=586

 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 73/108 (68%), Gaps = 11/108 (10%)
 Frame = -2

Query  848  YCRKDDQDMKQGKPHSEIGGKKTVQDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSS  675
            + RK D +  QG    E   K  +++ +G  KNLLKK+YL+RW+G  D+ G + +S P++
Sbjct  473  FIRKLDPETNQGVDSGE--RKLVIRERDGTLKNLLKKSYLRRWIGPLDASGKEVDSSPNN  530

Query  674  E-------VNSIGFARMKIENATLRESLECMEHLTSSIRRLRHSLLKV  552
            E        +S+ FARMKIENATL+ES++CMEHLTSS+ RLR SL KV
Sbjct  531  EGKFFNQRSSSVDFARMKIENATLKESMDCMEHLTSSVHRLRLSLWKV  578



>ref|XP_003610612.1| hypothetical protein MTR_5g005020 [Medicago truncatula]
Length=110

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 62/91 (68%), Gaps = 4/91 (4%)
 Frame = -2

Query  557  KVKECIDTKTNNS--PESLENIIYEAKLLKTALGTSLPVSWSAESDSGYNKEMLDDDCTH  384
            +VKE + ++   S   E L   I EAKLL+TALG+SLP+SWS E++ GY  +    +  H
Sbjct  8    RVKESVTSEGTVSGVSEVLNGAINEAKLLRTALGSSLPISWSVETEVGYTGDSKGVETVH  67

Query  383  T--SKEKIDFVSAAGFEMVELLVFAAQLLKE  297
               S EKID VSAAG EMVELL+FAAQ+L++
Sbjct  68   QQCSDEKIDTVSAAGLEMVELLIFAAQMLRD  98



>ref|XP_007042661.1| Myosin heavy chain-related protein, putative isoform 4, partial 
[Theobroma cacao]
 gb|EOX98492.1| Myosin heavy chain-related protein, putative isoform 4, partial 
[Theobroma cacao]
Length=296

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 51/70 (73%), Gaps = 7/70 (10%)
 Frame = -2

Query  827  DMKQGKPHSEIGGKKTV-QDGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVNSIG  657
            +MKQG   +E+  ++ +  + +GR +NLLKKTYL+RWVG  D+ G++AE+ PS    S+ 
Sbjct  231  EMKQGNVLAEVANRRIITSERDGRLRNLLKKTYLRRWVGAIDARGSEAEAQPS----SMD  286

Query  656  FARMKIENAT  627
            FARM+IENAT
Sbjct  287  FARMRIENAT  296



>ref|XP_010496770.1| PREDICTED: myosin heavy chain, clone 203-like isoform X5 [Camelina 
sativa]
Length=565

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS-EGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+YL RW+  S  G    +  +   ++I +ARMK+E A ++ESLE + HLT
Sbjct  473  EGRLKNMWKKSYLNRWIDPSARGGGHLNTEADYASNIDYARMKVEYAAIKESLESLGHLT  532

Query  590  SSIRRLRHSLLK  555
            +SIRRLR +LL+
Sbjct  533  TSIRRLRLALLQ  544



>ref|XP_010488905.1| PREDICTED: myosin heavy chain, clone 203-like isoform X3 [Camelina 
sativa]
 ref|XP_010488906.1| PREDICTED: myosin heavy chain, clone 203-like isoform X4 [Camelina 
sativa]
Length=552

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -2

Query  767  EGRFKNLLKKTYLKRWVGDS-EGNDAESYPSSEVNSIGFARMKIENATLRESLECMEHLT  591
            EGR KN+ KK+Y+ RW+  S  G    +  +   ++I +ARMK+E A ++ESLE + HLT
Sbjct  475  EGRLKNMWKKSYINRWIDPSARGGGHLNTEADYASNIDYARMKVEYAAIKESLESLGHLT  534

Query  590  SSIRRLRHSLLK  555
            +SIRRLR +LL+
Sbjct  535  TSIRRLRLALLQ  546



>ref|XP_001752008.1| predicted protein [Physcomitrella patens]
 gb|EDQ83443.1| predicted protein [Physcomitrella patens]
Length=933

 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 64/216 (30%), Positives = 100/216 (46%), Gaps = 54/216 (25%)
 Frame = -2

Query  821  KQGKPHSEIGGKKTVQDGEGRFKNLLKKT------YLKRWVGDSE-----GNDAESYPSS  675
            +Q KPH+       V + + +  N++ K       YLK W+   +     G  A S PS 
Sbjct  710  RQEKPHA-------VTENQLQSYNIVPKPSLSTSGYLKSWLRGIDMSGPGGLRALSEPSK  762

Query  674  EVNSIG------FARMKIENATLRESLECMEHLTSSIRRLRHSLLKV----------KEC  543
            +  S         A++++ENA L+E +  ++ LT+S  RLR +L+KV           EC
Sbjct  763  QSKSPATDEPADLAKLRVENAALQERVAGVQRLTASAHRLRMTLVKVIILVPKSAYFVEC  822

Query  542  --------IDTKTNNSPESLENIIYEAKLLKTALGTSLPVSWSAES-------DSGYNKE  408
                    +  + N     ++ +  EA  L+ ALG SLPVS + ES       D G +K 
Sbjct  823  QVVYGVAVLFCEKNIELPVVDGVKSEASHLRVALGCSLPVSVTPESPPQQSDADEGMSKT  882

Query  407  MLDDDCTHTSKEKIDFVSAAGFEMVELLVFAAQLLK  300
             + +   H +   +D  + AG EMVELL+ A +L K
Sbjct  883  SVGE--VHAA---VDVATGAGIEMVELLLVACELQK  913



>ref|XP_008665796.1| PREDICTED: uncharacterized protein LOC103644363 [Zea mays]
Length=118

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 12/84 (14%)
 Frame = -2

Query  776  QDGEGRFKNLLKKTYLKRWV---------GDSEGNDAESYPSSEVNSIGFARMKIENATL  624
             D +G  K +LK+T L+ W+         G S+GND   +   + +S+  AR+++ENA L
Sbjct  34   HDQQGMMKTMLKRTSLRHWMRKESSTIGHGSSDGND---HIVCKEHSVDVARLRVENAML  90

Query  623  RESLECMEHLTSSIRRLRHSLLKV  552
             E +  +EHLTSS+ RL   LLKV
Sbjct  91   LEGVGTVEHLTSSVHRLHIVLLKV  114



>gb|AFW89939.1| hypothetical protein ZEAMMB73_155311 [Zea mays]
Length=289

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 48/83 (58%), Gaps = 12/83 (14%)
 Frame = -2

Query  776  QDGEGRFKNLLKKTYLKRWV---------GDSEGNDAESYPSSEVNSIGFARMKIENATL  624
             D +G  K +LK+T L+ W+         G S+GND   +   + +S+  AR+++ENA L
Sbjct  200  HDQQGMLKTMLKRTSLRHWMRKESNTIGHGSSDGND---HTVCKEHSVDVARLRVENAML  256

Query  623  RESLECMEHLTSSIRRLRHSLLK  555
             E +  +EHLTSS+ RL   LLK
Sbjct  257  LEGVGTVEHLTSSVHRLHIVLLK  279



>tpg|DAA52643.1| TPA: hypothetical protein ZEAMMB73_102228 [Zea mays]
Length=418

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 12/82 (15%)
 Frame = -2

Query  773  DGEGRFKNLLKKTYLKRWV---------GDSEGNDAESYPSSEVNSIGFARMKIENATLR  621
            D +G  K +LK+T L+ W+         G S+GND   +   + +S+  AR+++ENA L 
Sbjct  307  DQQGMMKTMLKRTSLRHWMRKESSTIGHGSSDGND---HIVCKEHSVDVARLRVENAMLL  363

Query  620  ESLECMEHLTSSIRRLRHSLLK  555
            E +  +EHLTSS+ RL   LLK
Sbjct  364  EGVGTVEHLTSSVHRLHIVLLK  385



>ref|XP_008660611.1| PREDICTED: paramyosin isoform X3 [Zea mays]
Length=596

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 48/83 (58%), Gaps = 12/83 (14%)
 Frame = -2

Query  773  DGEGRFKNLLKKTYLKRWV---------GDSEGNDAESYPSSEVNSIGFARMKIENATLR  621
            D +G  K +LK+T L+ W+         G S+GND   +   + +S+  AR+++ENA L 
Sbjct  508  DQQGMLKTMLKRTSLRHWMRKESNTIGHGSSDGND---HTVCKEHSVDVARLRVENAMLL  564

Query  620  ESLECMEHLTSSIRRLRHSLLKV  552
            E +  +EHLTSS+ RL   LLK 
Sbjct  565  EGVGTVEHLTSSVHRLHIVLLKA  587



>ref|XP_010647913.1| PREDICTED: myosin-10 isoform X3 [Vitis vinifera]
Length=517

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = -2

Query  827  DMKQGKPHSEIGGKKTVQ-DGEGRFKNLLKKTYLKRWVG--DSEGNDAESYPSSEVN  666
            DMKQG   ++IG K+    + +G+ KNLLKKTYL+RW+G  D  GN AE++ +SE N
Sbjct  458  DMKQGNFLADIGEKRNATLERDGKLKNLLKKTYLRRWIGALDYSGNQAEAHLNSEGN  514



>ref|XP_004983922.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X4 [Setaria italica]
Length=645

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 10/80 (13%)
 Frame = -2

Query  773  DGEGRFKNLLKKTYLKRWV-------GDSEGNDAESYPSSEVNSIGFARMKIENATLRES  615
            D +G  KN+LK+T L+ W+       G S+GND       + + +  AR+++ENATL E 
Sbjct  510  DQQGMLKNMLKRTSLRHWMRNSNIGHGSSDGNDQ---SVCKEHLMDIARLRVENATLLEG  566

Query  614  LECMEHLTSSIRRLRHSLLK  555
            +  +E LTSS+ RL   LLK
Sbjct  567  VGTVERLTSSVHRLHIVLLK  586



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2060434175780