BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22622_g2_i1 len=1255 path=[2067:0-403 2471:404-762 2830:763-788
9054:789-1254]

Length=1255
                                                                      Score     E

ref|XP_011096119.1|  PREDICTED: uncharacterized protein LOC105175383    172   2e-47   
ref|XP_009781470.1|  PREDICTED: uncharacterized protein LOC104230...    164   3e-44   
ref|XP_006348070.1|  PREDICTED: uncharacterized protein LOC102582...    158   3e-42   
ref|XP_010316617.1|  PREDICTED: uncharacterized protein LOC101263...    158   4e-42   
ref|XP_009781471.1|  PREDICTED: uncharacterized protein LOC104230...    154   8e-41   
gb|EYU27832.1|  hypothetical protein MIMGU_mgv1a014265mg                150   3e-39   
ref|XP_006348071.1|  PREDICTED: uncharacterized protein LOC102582...    149   9e-39   
ref|XP_004232749.1|  PREDICTED: uncharacterized protein LOC101263...    149   1e-38   
gb|EYU27833.1|  hypothetical protein MIMGU_mgv1a014265mg                145   1e-37   
ref|XP_009619402.1|  PREDICTED: uncharacterized protein LOC104111...    140   1e-35   
ref|XP_009617224.1|  PREDICTED: uncharacterized protein LOC104109...    140   2e-35   
ref|XP_009775516.1|  PREDICTED: uncharacterized protein LOC104225...    139   5e-35   
emb|CDP20390.1|  unnamed protein product                                139   9e-35   
ref|XP_006348072.1|  PREDICTED: uncharacterized protein LOC102582...    132   1e-32   
ref|XP_007025975.1|  Uncharacterized protein TCM_030153                 133   1e-32   
ref|XP_010655351.1|  PREDICTED: uncharacterized protein LOC104880...    131   3e-32   
ref|XP_009619414.1|  PREDICTED: uncharacterized protein LOC104111...    131   4e-32   
ref|XP_009617225.1|  PREDICTED: uncharacterized protein LOC104109...    130   5e-32   
ref|XP_010655350.1|  PREDICTED: uncharacterized protein LOC104880...    131   6e-32   
ref|XP_011007887.1|  PREDICTED: uncharacterized protein LOC105113...    130   7e-32   
ref|XP_010655348.1|  PREDICTED: uncharacterized protein LOC104880...    131   8e-32   
ref|XP_009775517.1|  PREDICTED: uncharacterized protein LOC104225...    130   8e-32   
ref|XP_002518540.1|  conserved hypothetical protein                     129   4e-31   Ricinus communis
ref|XP_011007640.1|  PREDICTED: uncharacterized protein LOC105113...    128   4e-31   
ref|XP_011007638.1|  PREDICTED: uncharacterized protein LOC105113...    128   4e-31   
ref|XP_006383946.1|  hypothetical protein POPTR_0004s02220g             126   2e-30   
ref|XP_003538637.2|  PREDICTED: uncharacterized protein LOC100799187    129   2e-30   
ref|XP_002305617.2|  hypothetical protein POPTR_0004s02220g             126   3e-30   Populus trichocarpa [western balsam poplar]
ref|XP_002317214.1|  hypothetical protein POPTR_0011s00310g             126   3e-30   Populus trichocarpa [western balsam poplar]
ref|XP_007143196.1|  hypothetical protein PHAVU_007G051800g             125   5e-30   
ref|XP_007212063.1|  hypothetical protein PRUPE_ppa011520mg             125   8e-30   
gb|KHN15813.1|  hypothetical protein glysoja_012605                     123   2e-29   
ref|XP_003556023.1|  PREDICTED: uncharacterized protein LOC100791...    124   2e-29   
ref|XP_011007888.1|  PREDICTED: uncharacterized protein LOC105113...    121   1e-28   
ref|XP_008224770.1|  PREDICTED: uncharacterized protein LOC103324...    121   2e-28   
gb|KDP20804.1|  hypothetical protein JCGZ_21275                         120   3e-28   
ref|XP_003516763.1|  PREDICTED: uncharacterized protein LOC100816...    119   6e-28   
ref|NP_001236388.1|  uncharacterized protein LOC100527205               120   6e-28   
ref|XP_011007639.1|  PREDICTED: uncharacterized protein LOC105113...    119   7e-28   
ref|XP_004293254.1|  PREDICTED: uncharacterized protein LOC101307...    118   2e-27   
ref|XP_008224772.1|  PREDICTED: uncharacterized protein LOC103324...    117   4e-27   
ref|XP_010088073.1|  hypothetical protein L484_014819                   119   4e-27   
ref|XP_006606031.1|  PREDICTED: uncharacterized protein LOC100791...    115   3e-26   
ref|XP_006449101.1|  hypothetical protein CICLE_v10016643mg             110   5e-25   
ref|XP_006573892.1|  PREDICTED: uncharacterized protein LOC100816...    110   8e-25   
ref|XP_009357392.1|  PREDICTED: uncharacterized protein LOC103948...    110   1e-24   
ref|XP_006467971.1|  PREDICTED: uncharacterized protein LOC102624...    109   2e-24   
ref|XP_010686967.1|  PREDICTED: uncharacterized protein LOC104901121    109   2e-24   
ref|XP_004293255.1|  PREDICTED: uncharacterized protein LOC101307...    108   3e-24   
ref|XP_007157176.1|  hypothetical protein PHAVU_002G049100g             108   4e-24   
gb|KHN35201.1|  hypothetical protein glysoja_004967                     105   3e-23   
ref|XP_007157179.1|  hypothetical protein PHAVU_002G049100g             106   4e-23   
ref|XP_011086167.1|  PREDICTED: uncharacterized protein LOC105167...    104   1e-22   
ref|XP_011086166.1|  PREDICTED: uncharacterized protein LOC105167...    104   2e-22   
ref|XP_011086164.1|  PREDICTED: uncharacterized protein LOC105167...    104   2e-22   
ref|XP_010529369.1|  PREDICTED: uncharacterized protein LOC104806260    102   5e-22   
ref|XP_004248392.2|  PREDICTED: uncharacterized protein LOC101254737    101   8e-22   
ref|XP_009365687.1|  PREDICTED: uncharacterized protein LOC103955487    102   8e-22   
ref|XP_006449104.1|  hypothetical protein CICLE_v10016643mg             101   9e-22   
ref|XP_009357394.1|  PREDICTED: uncharacterized protein LOC103948...    101   1e-21   
gb|KDO75562.1|  hypothetical protein CISIN_1g029151mg                   100   3e-21   
ref|XP_010052437.1|  PREDICTED: uncharacterized protein LOC104441...  99.4    1e-20   
ref|XP_004511335.1|  PREDICTED: uncharacterized protein LOC101502...  99.0    1e-20   
ref|XP_011086165.1|  PREDICTED: uncharacterized protein LOC105167...  97.4    5e-20   
gb|KEH43931.1|  transmembrane protein, putative                       96.7    9e-20   
ref|XP_006352600.1|  PREDICTED: uncharacterized protein LOC102593693  94.7    4e-19   
ref|XP_009137182.1|  PREDICTED: uncharacterized protein LOC103861...  93.6    1e-18   
ref|XP_008441474.1|  PREDICTED: uncharacterized protein LOC103485...  93.6    1e-18   
ref|XP_006413802.1|  hypothetical protein EUTSA_v10026295mg           92.8    2e-18   
ref|XP_008441481.1|  PREDICTED: uncharacterized protein LOC103485...  92.4    3e-18   
ref|XP_010434207.1|  PREDICTED: uncharacterized protein LOC104718...  91.7    5e-18   
ref|XP_010538002.1|  PREDICTED: uncharacterized protein LOC104812...  90.9    1e-17   
ref|XP_010538011.1|  PREDICTED: uncharacterized protein LOC104812...  90.5    1e-17   
ref|XP_004145095.1|  PREDICTED: uncharacterized protein LOC101209875  90.1    2e-17   
ref|XP_010052438.1|  PREDICTED: uncharacterized protein LOC104441...  89.7    2e-17   
ref|XP_004511337.1|  PREDICTED: uncharacterized protein LOC101502...  89.7    3e-17   
gb|KHG23122.1|  WD repeat-containing 70                               88.2    3e-17   
gb|KHG07287.1|  Glutaminase                                           90.5    4e-17   
gb|KGN64553.1|  hypothetical protein Csa_1G064750                     89.0    8e-17   
ref|XP_006449100.1|  hypothetical protein CICLE_v10016643mg           88.2    1e-16   
ref|XP_009137183.1|  PREDICTED: uncharacterized protein LOC103861...  87.8    1e-16   
gb|KEH43929.1|  transmembrane protein, putative                       87.8    1e-16   
ref|XP_002867859.1|  hypothetical protein ARALYDRAFT_492760           87.0    2e-16   
emb|CDY58477.1|  BnaA03g58480D                                        87.0    2e-16   
ref|XP_010240932.1|  PREDICTED: uncharacterized protein LOC104585...  86.7    5e-16   
ref|XP_010240931.1|  PREDICTED: uncharacterized protein LOC104585...  86.3    8e-16   
ref|NP_974583.1|  uncharacterized protein                             85.1    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010538020.1|  PREDICTED: uncharacterized protein LOC104812...  83.2    4e-15   
ref|XP_009108501.1|  PREDICTED: uncharacterized protein LOC103834197  82.8    7e-15   
ref|XP_010434208.1|  PREDICTED: uncharacterized protein LOC104718...  82.4    8e-15   
ref|XP_009134573.1|  PREDICTED: uncharacterized protein LOC103858880  81.6    1e-14   
ref|XP_006282720.1|  hypothetical protein CARUB_v10005753mg           81.6    2e-14   
emb|CDX94030.1|  BnaC07g36640D                                        81.3    2e-14   
emb|CDX82813.1|  BnaC01g12630D                                        81.3    2e-14   
gb|AES93616.2|  transmembrane protein, putative                       81.3    3e-14   
emb|CDX76424.1|  BnaA08g09760D                                        80.9    3e-14   
ref|XP_004496780.1|  PREDICTED: uncharacterized protein LOC101508...  80.1    5e-14   
gb|KGN49136.1|  hypothetical protein Csa_6G515450                     80.1    6e-14   
ref|XP_006573893.1|  PREDICTED: uncharacterized protein LOC100816...  79.3    8e-14   
ref|XP_004496779.1|  PREDICTED: uncharacterized protein LOC101508...  79.7    1e-13   
ref|XP_003610658.1|  hypothetical protein MTR_5g005560                79.7    1e-13   
ref|XP_010267768.1|  PREDICTED: uncharacterized protein LOC104604898  77.4    7e-13   
ref|NP_680731.2|  uncharacterized protein                             76.3    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445237.1|  PREDICTED: uncharacterized protein LOC104727876  77.0    2e-12   
ref|XP_006449103.1|  hypothetical protein CICLE_v10016643mg           74.3    4e-12   
ref|XP_006467972.1|  PREDICTED: uncharacterized protein LOC102624...  73.9    6e-12   
ref|XP_010923935.1|  PREDICTED: uncharacterized protein LOC105046890  73.6    9e-12   
ref|XP_008439956.1|  PREDICTED: uncharacterized protein LOC103484...  71.6    5e-11   
gb|KHN02674.1|  hypothetical protein glysoja_015916                   68.6    4e-10   
ref|XP_010449101.1|  PREDICTED: uncharacterized protein LOC104731424  67.8    7e-10   
ref|XP_007140672.1|  hypothetical protein PHAVU_008G132100g           63.5    8e-09   
ref|XP_002462952.1|  hypothetical protein SORBIDRAFT_02g035220        63.9    2e-08   Sorghum bicolor [broomcorn]
ref|XP_006850454.1|  hypothetical protein AMTR_s00035p00016570        62.4    5e-08   
ref|XP_008384233.1|  PREDICTED: uncharacterized protein LOC103446856  61.2    5e-08   
ref|XP_008809846.1|  PREDICTED: uncharacterized protein LOC103721425  61.6    1e-07   
ref|XP_008801173.1|  PREDICTED: uncharacterized protein LOC103715352  61.6    1e-07   
ref|XP_008439957.1|  PREDICTED: uncharacterized protein LOC103484...  61.2    1e-07   
ref|XP_009405646.1|  PREDICTED: uncharacterized protein LOC103988740  60.8    2e-07   
emb|CDY71341.1|  BnaCnng72480D                                        58.9    4e-07   
ref|XP_010931141.1|  PREDICTED: uncharacterized protein LOC105052125  58.9    7e-07   
ref|XP_006657785.1|  PREDICTED: uncharacterized protein LOC102710713  57.8    2e-06   
ref|XP_004957909.1|  PREDICTED: uncharacterized protein LOC101776819  57.8    2e-06   
tpg|DAA41037.1|  TPA: hypothetical protein ZEAMMB73_790388            56.6    4e-06   
ref|XP_010237548.1|  PREDICTED: uncharacterized protein LOC100839374  55.8    6e-06   
ref|NP_001059849.1|  Os07g0530700                                     55.1    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001145470.1|  hypothetical protein                             54.7    1e-05   Zea mays [maize]
ref|XP_008670460.1|  PREDICTED: uncharacterized protein LOC103647721  54.3    2e-05   
ref|NP_001144496.1|  uncharacterized protein LOC100277476             54.7    2e-05   Zea mays [maize]
ref|XP_009417253.1|  PREDICTED: uncharacterized protein LOC103997679  53.9    3e-05   
dbj|BAJ91817.1|  predicted protein                                    53.9    4e-05   
ref|XP_002456462.1|  hypothetical protein SORBIDRAFT_03g036766        52.8    6e-05   Sorghum bicolor [broomcorn]
gb|EEC71614.1|  hypothetical protein OsI_04025                        52.4    7e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001044477.2|  Os01g0787400                                     52.4    8e-05   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD53263.1|  unknown protein                                      52.4    8e-05   Oryza sativa Japonica Group [Japonica rice]
gb|KEH43930.1|  transmembrane protein, putative                       51.2    2e-04   
gb|EAZ13791.1|  hypothetical protein OsJ_03716                        52.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004970218.1|  PREDICTED: uncharacterized protein LOC101772...  50.4    3e-04   
ref|XP_004970217.1|  PREDICTED: uncharacterized protein LOC101772...  50.4    3e-04   
ref|XP_006644823.1|  PREDICTED: uncharacterized protein LOC102703077  50.1    4e-04   



>ref|XP_011096119.1| PREDICTED: uncharacterized protein LOC105175383 [Sesamum indicum]
Length=212

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 125/198 (63%), Gaps = 13/198 (7%)
 Frame = -2

Query  918  MEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFT-SGTKPDSFVVDMERF----EKD  754
            M + N  S  LG   E   G K+  S +  +NGL    S  K DSFVVDMERF    EKD
Sbjct  19   MSSNNCESGELG---ERGAGLKICVSDN--VNGLQHHPSAAKSDSFVVDMERFSHLTEKD  73

Query  753  INSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVV  574
            +N+NSRITLQRNLSRKGS  RS EKKI   N     L+ATSPRA LHG  TPEKP+VVV+
Sbjct  74   MNANSRITLQRNLSRKGSA-RSGEKKIIATNERDTTLLATSPRATLHGGSTPEKPVVVVM  132

Query  573  GAGADHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMG  394
            G   DHS    +    +    +     GGKRF FRR S  +W  DPRRIL FFATLS +G
Sbjct  133  GP-TDHSTVPQLHHQISFTNGTVGSECGGKRFSFRRSS-HTWTTDPRRILLFFATLSCVG  190

Query  393  TLVLIYLSLSVGKYSGDE  340
            T+VLIY +LS+GK SGD+
Sbjct  191  TIVLIYFTLSIGKLSGDD  208



>ref|XP_009781470.1| PREDICTED: uncharacterized protein LOC104230381 isoform X1 [Nicotiana 
sylvestris]
Length=197

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 122/184 (66%), Gaps = 24/184 (13%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKKI  673
            SDH INGL + S TK DSFVVDMERF    EKDINSNSRITLQRNLSRKGS  RS E+K 
Sbjct  16   SDH-INGLQYAS-TKSDSFVVDMERFSHIIEKDINSNSRITLQRNLSRKGS-FRSGERKT  72

Query  672  PNPNAAVD---NLIATSPRAVLHGAG--TPEKPMVVVVGAGADHSAP-----VTIIAA--  529
             + NAA +   N  A+SPRA L G G  TPEKPM   +    D   P     +TI+A   
Sbjct  73   YS-NAANEKDTNFTASSPRASLLGGGISTPEKPMASTIVGTTDQPTPQTHNQITIVAGHG  131

Query  528  GANPLESKTMAAGGKRFGFRRPSLAS-WILDPRRILFFFATLSSMGTLVLIYLSLSVGKY  352
            GA   ESK     G+RF FRR S  S W +DPRRIL FFATLSSMGT++LIY +LS+ K 
Sbjct  132  GATATESKI---SGRRFSFRRTSSTSNWSIDPRRILLFFATLSSMGTILLIYFTLSIAKL  188

Query  351  SGDE  340
            +G++
Sbjct  189  NGED  192



>ref|XP_006348070.1| PREDICTED: uncharacterized protein LOC102582071 isoform X1 [Solanum 
tuberosum]
Length=198

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 121/182 (66%), Gaps = 24/182 (13%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKKI  673
            S+H +NGL +TS TK DSFVVDMERF    EKDIN+NSRITLQRNLSRKGS  RS EKK 
Sbjct  20   SEH-MNGLQYTS-TKSDSFVVDMERFSHIIEKDINANSRITLQRNLSRKGS-FRSGEKK-  75

Query  672  PNPNAAVD---NLIATSPRA--VLHGAGTPEKPMVVVVGAGAD----HSAPVTIIAA--G  526
             N NA  +   N  A SPRA  +L G  TPEKPM +   +       H+  +TI+A    
Sbjct  76   TNSNAVNEKDTNFTANSPRASSLLGGGSTPEKPMALTTSSDQHTPQTHNHQITIVAGHGA  135

Query  525  ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSG  346
            A   ESK    GG+RF FRR +  +W +DPRRIL FFATLSSMGT++LIY +LS+ K + 
Sbjct  136  AAATESKI---GGRRFSFRRST--NWTIDPRRILLFFATLSSMGTMLLIYFTLSIAKLNE  190

Query  345  DE  340
            ++
Sbjct  191  ED  192



>ref|XP_010316617.1| PREDICTED: uncharacterized protein LOC101263370 isoform X1 [Solanum 
lycopersicum]
Length=195

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 125/190 (66%), Gaps = 18/190 (9%)
 Frame = -2

Query  879  EFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLS  712
            EFE  G +++  S DH +NGL +TS TK DSFVVDMERF    EKDIN+NSRITLQRNLS
Sbjct  14   EFEEKGVEEICIS-DH-MNGLQYTS-TKSDSFVVDMERFSHIIEKDINANSRITLQRNLS  70

Query  711  RKGSQMRSVEKKIPNPNAAVDNLIATSPRA--VLHGAGTPEKPMVVVVGAGAD----HSA  550
            RKGS  RS EKK  N NA  +   A SPRA  +L G  TPEK M +   +       H+ 
Sbjct  71   RKGS-FRSGEKK-TNSNAVTEKDTANSPRASSLLGGGSTPEKAMALTTSSDQHTPQTHNH  128

Query  549  PVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLS  370
             +TI+A   +   +++   GG+RF +RR +  +W +DPRRIL F ATL+ MGT++LIY +
Sbjct  129  QITIVAGHGSATATESQ-IGGRRFSYRRST--NWTIDPRRILLFSATLTCMGTILLIYFT  185

Query  369  LSVGKYSGDE  340
            LS+ K +G+E
Sbjct  186  LSIPKVNGEE  195



>ref|XP_009781471.1| PREDICTED: uncharacterized protein LOC104230381 isoform X2 [Nicotiana 
sylvestris]
Length=195

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 120/184 (65%), Gaps = 26/184 (14%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKKI  673
            SDH INGL + S TK DSFVVDMERF    EKDINSNSRIT  RNLSRKGS  RS E+K 
Sbjct  16   SDH-INGLQYAS-TKSDSFVVDMERFSHIIEKDINSNSRIT--RNLSRKGS-FRSGERKT  70

Query  672  PNPNAAVD---NLIATSPRAVLHGAG--TPEKPMVVVVGAGADHSAP-----VTIIAA--  529
             + NAA +   N  A+SPRA L G G  TPEKPM   +    D   P     +TI+A   
Sbjct  71   YS-NAANEKDTNFTASSPRASLLGGGISTPEKPMASTIVGTTDQPTPQTHNQITIVAGHG  129

Query  528  GANPLESKTMAAGGKRFGFRRPSLAS-WILDPRRILFFFATLSSMGTLVLIYLSLSVGKY  352
            GA   ESK     G+RF FRR S  S W +DPRRIL FFATLSSMGT++LIY +LS+ K 
Sbjct  130  GATATESK---ISGRRFSFRRTSSTSNWSIDPRRILLFFATLSSMGTILLIYFTLSIAKL  186

Query  351  SGDE  340
            +G++
Sbjct  187  NGED  190



>gb|EYU27832.1| hypothetical protein MIMGU_mgv1a014265mg [Erythranthe guttata]
Length=194

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 113/180 (63%), Gaps = 25/180 (14%)
 Frame = -2

Query  831  QINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKKIPNP  664
            Q+NGL  +S TK DSFVVDMERF    EKDIN++SRITLQRNLSRKG+  R+ E K+   
Sbjct  20   QVNGLEHSS-TKSDSFVVDMERFSHILEKDINAHSRITLQRNLSRKGTA-RTGENKVDRD  77

Query  663  NAAVDNLIATSPRAVLHGAG--TPEKPMVVVVGAGADHSAP------VTIIAAGAN----  520
             A    L+A SP+A LHG G  TPEK   VV     D S        +TI     N    
Sbjct  78   TA----LLAISPKAALHGGGGSTPEKAEGVVAVGPTDQSITPQVHHQITITNGSLNGVPA  133

Query  519  PLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
             +ESK    GG+RF FRR S  +W L+P+RI  FFATLS MGT+VLIY +LS+G + GDE
Sbjct  134  AVESK---LGGRRFSFRRSSPPTWTLNPKRIFLFFATLSCMGTMVLIYFTLSMGNFKGDE  190



>ref|XP_006348071.1| PREDICTED: uncharacterized protein LOC102582071 isoform X2 [Solanum 
tuberosum]
Length=196

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 119/182 (65%), Gaps = 26/182 (14%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKKI  673
            S+H +NGL +TS TK DSFVVDMERF    EKDIN+NSRIT  RNLSRKGS  RS EKK 
Sbjct  20   SEH-MNGLQYTS-TKSDSFVVDMERFSHIIEKDINANSRIT--RNLSRKGS-FRSGEKK-  73

Query  672  PNPNAAVD---NLIATSPRA--VLHGAGTPEKPMVVVVGAGAD----HSAPVTIIAA--G  526
             N NA  +   N  A SPRA  +L G  TPEKPM +   +       H+  +TI+A    
Sbjct  74   TNSNAVNEKDTNFTANSPRASSLLGGGSTPEKPMALTTSSDQHTPQTHNHQITIVAGHGA  133

Query  525  ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSG  346
            A   ESK    GG+RF FRR +  +W +DPRRIL FFATLSSMGT++LIY +LS+ K + 
Sbjct  134  AAATESKI---GGRRFSFRRST--NWTIDPRRILLFFATLSSMGTMLLIYFTLSIAKLNE  188

Query  345  DE  340
            ++
Sbjct  189  ED  190



>ref|XP_004232749.1| PREDICTED: uncharacterized protein LOC101263370 isoform X2 [Solanum 
lycopersicum]
Length=193

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 123/190 (65%), Gaps = 20/190 (11%)
 Frame = -2

Query  879  EFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLS  712
            EFE  G +++  S DH +NGL +TS TK DSFVVDMERF    EKDIN+NSRIT  RNLS
Sbjct  14   EFEEKGVEEICIS-DH-MNGLQYTS-TKSDSFVVDMERFSHIIEKDINANSRIT--RNLS  68

Query  711  RKGSQMRSVEKKIPNPNAAVDNLIATSPRA--VLHGAGTPEKPMVVVVGAGAD----HSA  550
            RKGS  RS EKK  N NA  +   A SPRA  +L G  TPEK M +   +       H+ 
Sbjct  69   RKGS-FRSGEKK-TNSNAVTEKDTANSPRASSLLGGGSTPEKAMALTTSSDQHTPQTHNH  126

Query  549  PVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLS  370
             +TI+A   +   +++   GG+RF +RR +  +W +DPRRIL F ATL+ MGT++LIY +
Sbjct  127  QITIVAGHGSATATESQI-GGRRFSYRRST--NWTIDPRRILLFSATLTCMGTILLIYFT  183

Query  369  LSVGKYSGDE  340
            LS+ K +G+E
Sbjct  184  LSIPKVNGEE  193



>gb|EYU27833.1| hypothetical protein MIMGU_mgv1a014265mg [Erythranthe guttata]
Length=195

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 113/181 (62%), Gaps = 26/181 (14%)
 Frame = -2

Query  831  QINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKKIPNP  664
            Q+NGL  +S TK DSFVVDMERF    EKDIN++SRITLQRNLSRKG+  R+ E K+   
Sbjct  20   QVNGLEHSS-TKSDSFVVDMERFSHILEKDINAHSRITLQRNLSRKGTA-RTGENKVDRD  77

Query  663  NAAVDNLIATSPRAV-LHGAG--TPEKPMVVVVGAGADHSAP------VTIIAAGAN---  520
             A    L+A SP+A  LHG G  TPEK   VV     D S        +TI     N   
Sbjct  78   TA----LLAISPKAAALHGGGGSTPEKAEGVVAVGPTDQSITPQVHHQITITNGSLNGVP  133

Query  519  -PLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGD  343
              +ESK    GG+RF FRR S  +W L+P+RI  FFATLS MGT+VLIY +LS+G + GD
Sbjct  134  AAVESK---LGGRRFSFRRSSPPTWTLNPKRIFLFFATLSCMGTMVLIYFTLSMGNFKGD  190

Query  342  E  340
            E
Sbjct  191  E  191



>ref|XP_009619402.1| PREDICTED: uncharacterized protein LOC104111410 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009619409.1| PREDICTED: uncharacterized protein LOC104111410 isoform X1 [Nicotiana 
tomentosiformis]
Length=200

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 121/214 (57%), Gaps = 48/214 (22%)
 Frame = -2

Query  918  MEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDI  751
            M AE  R  G   EFE  G Q++                TK DSFVVDMERF    EKDI
Sbjct  9    MSAEKQRIYG---EFEVKGSQEIC---------------TKSDSFVVDMERFSHIIEKDI  50

Query  750  NSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVD---NLIATSPRAVLHGAG--TPEKPM  586
            N+NSRITLQRNLSRKGS  RS E+K  + NAA +   N  A+SPRA L G G  TPEK +
Sbjct  51   NANSRITLQRNLSRKGS-FRSGERKTYS-NAAKEKDTNFTASSPRASLLGGGISTPEKTI  108

Query  585  VVVVGAGADHSAP-----VTIIAAGANPL------ESKTMAAGGKRFGFRRPSLAS-WIL  442
            V       D   P     +TI+A            ESK     G+RF FRR S  S W +
Sbjct  109  V----GTTDLPTPQTHNQITIVAGHGGATATATATESK---ISGRRFSFRRTSSTSNWTI  161

Query  441  DPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            DPRRIL FFATLS MGT++LIY +LS+ K +G++
Sbjct  162  DPRRILLFFATLSCMGTILLIYFTLSIAKLNGED  195



>ref|XP_009617224.1| PREDICTED: uncharacterized protein LOC104109589 isoform X1 [Nicotiana 
tomentosiformis]
Length=205

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 131/213 (62%), Gaps = 32/213 (15%)
 Frame = -2

Query  918  MEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDI  751
            M AEN   + L +EF   G +K+S S DH INGL  TS +K +SFVV+ME      EK+I
Sbjct  1    MGAEN---QSLNREFGEKGVEKISVS-DH-INGLKCTS-SKSESFVVNMETISHLVEKEI  54

Query  750  NSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVD---NLIATSPRAVLHGAGTPEKPMVV  580
            + NSRITLQRNLSRKGS +R  EK+  N NA  +   NL+ATSPRA L  A TPEK   V
Sbjct  55   SGNSRITLQRNLSRKGS-LRGGEKR-TNFNAMNEKDTNLMATSPRATLLAANTPEKTTAV  112

Query  579  VVGAGADHSAP-------------VTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILD  439
             VG  ADH  P                 A G    ESK    GG+RF FRR S  SW +D
Sbjct  113  TVGT-ADHRTPDIRNQITAAAATSSVAAANGVTTTESK---VGGRRFSFRRSSSPSWTVD  168

Query  438  PRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            PRRIL FFATLSS+GT++LIY +LS+ K +G++
Sbjct  169  PRRILIFFATLSSIGTILLIYFTLSMAKVNGED  201



>ref|XP_009775516.1| PREDICTED: uncharacterized protein LOC104225430 isoform X1 [Nicotiana 
sylvestris]
Length=205

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 130/210 (62%), Gaps = 26/210 (12%)
 Frame = -2

Query  918  MEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDI  751
            M AEN   + L +EF   G +K+S S DH INGL  TS TK +SFVV+ME      EK+I
Sbjct  1    MGAEN---QSLNREFGEKGVEKISIS-DH-INGLKCTS-TKSESFVVNMESISHLVEKEI  54

Query  750  NSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVD---NLIATSPRAVLHGAGTPEKPMVV  580
            N NSRITLQRNLSRKGS +R  EK+  N NA  +   NL+A SPRA L  A TPEK   V
Sbjct  55   NGNSRITLQRNLSRKGS-LRGGEKR-TNFNAMNEKDTNLMAISPRASLLAANTPEKTAAV  112

Query  579  VVGAGADHSAP----------VTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRR  430
             VG  ADH  P           T     AN + +     GG+RF FRR S  SW +DPRR
Sbjct  113  TVGT-ADHRTPDIHNQITAAAATSSVVAANGVTANESKVGGRRFSFRRSSSPSWTIDPRR  171

Query  429  ILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            IL FFATLSS+GT++LIY +LS+ K +G++
Sbjct  172  ILIFFATLSSIGTILLIYFTLSMTKVTGED  201



>emb|CDP20390.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 132/213 (62%), Gaps = 27/213 (13%)
 Frame = -2

Query  918  MEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLP-FTSGTKPDSFVVDMERF------E  760
            M +EN  S     E    G QK+S S  HQ NG+  +T+    DSF+VD+ERF      +
Sbjct  12   MGSENLSSINEVSELVDKGAQKISVS--HQTNGVEDYTARKASDSFIVDIERFASHLSTD  69

Query  759  KDINSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDN---LIATSPRAVLHGAG---TP  598
            KDIN+NSRIT  R+LSRK SQ R  EKK  NP A  +     IA+SPRA L   G   TP
Sbjct  70   KDINANSRIT--RSLSRKASQQRGGEKK-SNPIANGEKGYGSIASSPRASLLQGGSSSTP  126

Query  597  EKPMVVVVGAGADHSA------PVTIIAAG-ANPLESKTMAAGGKRFGFRRPSLASWILD  439
            EKPMV+VVGA  +HS       P+TI+    A P ES+ ++   +RF  RR S  SW +D
Sbjct  127  EKPMVLVVGA-TEHSHSPQVHNPITIVTGSLAGPTESR-ISTASRRFSLRRSSSPSWTID  184

Query  438  PRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            PRRILF FATLSSMGT++LIY +LS+ K++G +
Sbjct  185  PRRILFIFATLSSMGTILLIYFTLSMNKFTGHD  217



>ref|XP_006348072.1| PREDICTED: uncharacterized protein LOC102582071 isoform X3 [Solanum 
tuberosum]
Length=182

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 102/161 (63%), Gaps = 24/161 (15%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKKI  673
            S+H +NGL +TS TK DSFVVDMERF    EKDIN+NSRITLQRNLSRKGS  RS EKK 
Sbjct  20   SEH-MNGLQYTS-TKSDSFVVDMERFSHIIEKDINANSRITLQRNLSRKGS-FRSGEKKT  76

Query  672  PNPNAAVD---NLIATSPRA--VLHGAGTPEKPMVVVVGAGAD----HSAPVTIIA--AG  526
             N NA  +   N  A SPRA  +L G  TPEKPM +   +       H+  +TI+A    
Sbjct  77   -NSNAVNEKDTNFTANSPRASSLLGGGSTPEKPMALTTSSDQHTPQTHNHQITIVAGHGA  135

Query  525  ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLS  403
            A   ESK    GG+RF FRR +  +W +DPRRIL FFAT  
Sbjct  136  AAATESKI---GGRRFSFRRST--NWTIDPRRILLFFATFC  171



>ref|XP_007025975.1| Uncharacterized protein TCM_030153 [Theobroma cacao]
 gb|EOY28597.1| Uncharacterized protein TCM_030153 [Theobroma cacao]
Length=213

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 118/196 (60%), Gaps = 37/196 (19%)
 Frame = -2

Query  858  QKLSSSSDHQINGLPFTSGTKPDSFVVDMERF-----EKDINSNSRITLQRNLSRKGSQ-  697
            QK+S S DH +NG  +T+  K DSFV+DME F      K+IN NSRITLQRNLSRKGSQ 
Sbjct  28   QKISVS-DH-LNGFQYTTD-KSDSFVIDMESFSHGGANKEINPNSRITLQRNLSRKGSQR  84

Query  696  --MRSVEKKIPNPNAAV-----DNLIATS-PRAVLHGAGTPEKPMVVVVGAGADHSAPVT  541
               + +     NPN++      D+  ATS P+    G+ TPEKP  VVVG+  DH++   
Sbjct  85   GDKKMITPSCTNPNSSSSVNDRDSFAATSSPK----GSSTPEKPTAVVVGS-TDHASNPQ  139

Query  540  I-----IAAGANPLESKTMAAGGKRFGFRRPSL----ASWILDPRRILFFFATLSSMGTL  388
            I     I  G+      + AA   RF  RR S       W L+P+RILFFFATLSS+GT+
Sbjct  140  IHHQITITTGS------STAAPESRFSLRRNSFRRSHPQWQLNPKRILFFFATLSSLGTI  193

Query  387  VLIYLSLSVGKYSGDE  340
            +LIY +LS+ K +G+E
Sbjct  194  LLIYFTLSISKMNGEE  209



>ref|XP_010655351.1| PREDICTED: uncharacterized protein LOC104880450 isoform X3 [Vitis 
vinifera]
 emb|CBI23166.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 116/185 (63%), Gaps = 29/185 (16%)
 Frame = -2

Query  831  QINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKKIPNP  664
            Q+NG  + +  K DSFVVDME F     KD  +NSRITLQR+LSRKGSQ R  EKK PN 
Sbjct  14   QVNGFQYKT-EKSDSFVVDMEGFPNGVNKDTTANSRITLQRSLSRKGSQ-RGGEKK-PNS  70

Query  663  NAAVDN---LIATSPRAVLHGAGTPEKPMVVVV-----GAGADHSAPV-------TIIAA  529
             A++D    L  +SPRA L G  T EKP+ VVV     G   DH  PV         I A
Sbjct  71   VASIDADAVLATSSPRAALAGGSTLEKPVAVVVAAAAAGGTIDHH-PVGSQVHHHIAITA  129

Query  528  G--ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
            G  +   ES+ ++   +R+ FRR S  SW++DPRRILFFFATLSSMGT++LIY +LS+ +
Sbjct  130  GNISTITESRFIS---RRYSFRRAS-PSWLIDPRRILFFFATLSSMGTILLIYFTLSIKR  185

Query  354  YSGDE  340
              GD+
Sbjct  186  LGGDD  190



>ref|XP_009619414.1| PREDICTED: uncharacterized protein LOC104111410 isoform X2 [Nicotiana 
tomentosiformis]
Length=198

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 119/214 (56%), Gaps = 50/214 (23%)
 Frame = -2

Query  918  MEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDI  751
            M AE  R  G   EFE  G Q++                TK DSFVVDMERF    EKDI
Sbjct  9    MSAEKQRIYG---EFEVKGSQEIC---------------TKSDSFVVDMERFSHIIEKDI  50

Query  750  NSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVD---NLIATSPRAVLHGAG--TPEKPM  586
            N+NSRIT  RNLSRKGS  RS E+K  + NAA +   N  A+SPRA L G G  TPEK +
Sbjct  51   NANSRIT--RNLSRKGS-FRSGERKTYS-NAAKEKDTNFTASSPRASLLGGGISTPEKTI  106

Query  585  VVVVGAGADHSAP-----VTIIAAGANPL------ESKTMAAGGKRFGFRRPSLAS-WIL  442
            V       D   P     +TI+A            ESK     G+RF FRR S  S W +
Sbjct  107  V----GTTDLPTPQTHNQITIVAGHGGATATATATESK---ISGRRFSFRRTSSTSNWTI  159

Query  441  DPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            DPRRIL FFATLS MGT++LIY +LS+ K +G++
Sbjct  160  DPRRILLFFATLSCMGTILLIYFTLSIAKLNGED  193



>ref|XP_009617225.1| PREDICTED: uncharacterized protein LOC104109589 isoform X2 [Nicotiana 
tomentosiformis]
Length=203

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 129/213 (61%), Gaps = 34/213 (16%)
 Frame = -2

Query  918  MEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDI  751
            M AEN   + L +EF   G +K+S S DH INGL  TS +K +SFVV+ME      EK+I
Sbjct  1    MGAEN---QSLNREFGEKGVEKISVS-DH-INGLKCTS-SKSESFVVNMETISHLVEKEI  54

Query  750  NSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVD---NLIATSPRAVLHGAGTPEKPMVV  580
            + NSRIT  RNLSRKGS +R  EK+  N NA  +   NL+ATSPRA L  A TPEK   V
Sbjct  55   SGNSRIT--RNLSRKGS-LRGGEKR-TNFNAMNEKDTNLMATSPRATLLAANTPEKTTAV  110

Query  579  VVGAGADHSAP-------------VTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILD  439
             VG  ADH  P                 A G    ESK    GG+RF FRR S  SW +D
Sbjct  111  TVGT-ADHRTPDIRNQITAAAATSSVAAANGVTTTESK---VGGRRFSFRRSSSPSWTVD  166

Query  438  PRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            PRRIL FFATLSS+GT++LIY +LS+ K +G++
Sbjct  167  PRRILIFFATLSSIGTILLIYFTLSMAKVNGED  199



>ref|XP_010655350.1| PREDICTED: uncharacterized protein LOC104880450 isoform X2 [Vitis 
vinifera]
Length=221

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 116/185 (63%), Gaps = 29/185 (16%)
 Frame = -2

Query  831  QINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKKIPNP  664
            Q+NG  + +  K DSFVVDME F     KD  +NSRITLQR+LSRKGSQ R  EKK PN 
Sbjct  38   QVNGFQYKT-EKSDSFVVDMEGFPNGVNKDTTANSRITLQRSLSRKGSQ-RGGEKK-PNS  94

Query  663  NAAVDN---LIATSPRAVLHGAGTPEKPMVVVV-----GAGADHSAPV-------TIIAA  529
             A++D    L  +SPRA L G  T EKP+ VVV     G   DH  PV         I A
Sbjct  95   VASIDADAVLATSSPRAALAGGSTLEKPVAVVVAAAAAGGTIDHH-PVGSQVHHHIAITA  153

Query  528  G--ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
            G  +   ES+ ++   +R+ FRR S  SW++DPRRILFFFATLSSMGT++LIY +LS+ +
Sbjct  154  GNISTITESRFIS---RRYSFRRAS-PSWLIDPRRILFFFATLSSMGTILLIYFTLSIKR  209

Query  354  YSGDE  340
              GD+
Sbjct  210  LGGDD  214



>ref|XP_011007887.1| PREDICTED: uncharacterized protein LOC105113419 isoform X1 [Populus 
euphratica]
Length=204

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 113/184 (61%), Gaps = 33/184 (18%)
 Frame = -2

Query  837  DHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGS--QMRSVEKK  676
            DH ING   T   K DSFV+DMERF     KDIN+NSRITLQR+ SRKGS       EKK
Sbjct  28   DH-INGFQCT-KEKSDSFVIDMERFSHGINKDINTNSRITLQRSHSRKGSPRGGGGGEKK  85

Query  675  IPNPNAAV------DNLIAT-SPRAVLHGAGTPEKPMVVVVGAGADHSA------PVTII  535
            I N N +       D ++A+ SPR    G  TPEK  VV VG  ADHS+       +TI 
Sbjct  86   I-NSNLSHLSVSDRDAIVASASPR----GPSTPEKAAVVTVGT-ADHSSSPQLHHQITIT  139

Query  534  AAGANPL-ESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVG  358
                N   ES+ +    +R  F+R S  SW+LDP+R+LFFFATLSSMGT++LIYL+LS+G
Sbjct  140  TGNMNATPESRCI----RRNSFKRSS-PSWVLDPKRVLFFFATLSSMGTMLLIYLTLSIG  194

Query  357  KYSG  346
            K + 
Sbjct  195  KLNA  198



>ref|XP_010655348.1| PREDICTED: uncharacterized protein LOC104880450 isoform X1 [Vitis 
vinifera]
 ref|XP_010655349.1| PREDICTED: uncharacterized protein LOC104880450 isoform X1 [Vitis 
vinifera]
Length=226

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 116/185 (63%), Gaps = 29/185 (16%)
 Frame = -2

Query  831  QINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKKIPNP  664
            Q+NG  + +  K DSFVVDME F     KD  +NSRITLQR+LSRKGSQ R  EKK PN 
Sbjct  43   QVNGFQYKT-EKSDSFVVDMEGFPNGVNKDTTANSRITLQRSLSRKGSQ-RGGEKK-PNS  99

Query  663  NAAVDN---LIATSPRAVLHGAGTPEKPMVVVV-----GAGADHSAPV-------TIIAA  529
             A++D    L  +SPRA L G  T EKP+ VVV     G   DH  PV         I A
Sbjct  100  VASIDADAVLATSSPRAALAGGSTLEKPVAVVVAAAAAGGTIDHH-PVGSQVHHHIAITA  158

Query  528  G--ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
            G  +   ES+ ++   +R+ FRR S  SW++DPRRILFFFATLSSMGT++LIY +LS+ +
Sbjct  159  GNISTITESRFIS---RRYSFRRAS-PSWLIDPRRILFFFATLSSMGTILLIYFTLSIKR  214

Query  354  YSGDE  340
              GD+
Sbjct  215  LGGDD  219



>ref|XP_009775517.1| PREDICTED: uncharacterized protein LOC104225430 isoform X2 [Nicotiana 
sylvestris]
Length=203

 Score =   130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 128/210 (61%), Gaps = 28/210 (13%)
 Frame = -2

Query  918  MEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDI  751
            M AEN   + L +EF   G +K+S S DH INGL  TS TK +SFVV+ME      EK+I
Sbjct  1    MGAEN---QSLNREFGEKGVEKISIS-DH-INGLKCTS-TKSESFVVNMESISHLVEKEI  54

Query  750  NSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVD---NLIATSPRAVLHGAGTPEKPMVV  580
            N NSRIT  RNLSRKGS +R  EK+  N NA  +   NL+A SPRA L  A TPEK   V
Sbjct  55   NGNSRIT--RNLSRKGS-LRGGEKR-TNFNAMNEKDTNLMAISPRASLLAANTPEKTAAV  110

Query  579  VVGAGADHSAP----------VTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRR  430
             VG  ADH  P           T     AN + +     GG+RF FRR S  SW +DPRR
Sbjct  111  TVGT-ADHRTPDIHNQITAAAATSSVVAANGVTANESKVGGRRFSFRRSSSPSWTIDPRR  169

Query  429  ILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            IL FFATLSS+GT++LIY +LS+ K +G++
Sbjct  170  ILIFFATLSSIGTILLIYFTLSMTKVTGED  199



>ref|XP_002518540.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43927.1| conserved hypothetical protein [Ricinus communis]
Length=214

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 117/196 (60%), Gaps = 27/196 (14%)
 Frame = -2

Query  873  EGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF-----EKDINSNSRITLQRNLSR  709
            E  G QK+S   DH ING  + S  K D+FV+DME F      K++N NSRITLQR+LSR
Sbjct  24   ENMGTQKISVL-DH-INGFEY-SAEKSDNFVIDMESFSHATNNKEVNPNSRITLQRSLSR  80

Query  708  KGS---QMRSVEKKI---PNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADH---  556
            KGS     R  +KKI   P+PN     +  +SPR    G G PEK  +V VG  ADH   
Sbjct  81   KGSLRMSGRGGDKKINSNPSPNDRDAAVATSSPR----GPGMPEKGSMVSVGT-ADHPSS  135

Query  555  SAPV--TIIAAGANPLESKTMAAGG--KRFGFRRPSLASWILDPRRILFFFATLSSMGTL  388
            SA V   I     N L + +       +R  F+RPSL SW +DP+R+LFFFATLSSMGT+
Sbjct  136  SAQVHHQITITTTNNLNASSTEGRCTIRRNSFKRPSL-SWTIDPKRVLFFFATLSSMGTM  194

Query  387  VLIYLSLSVGKYSGDE  340
            +LIY +LS+GK   D+
Sbjct  195  LLIYFTLSIGKLGADD  210



>ref|XP_011007640.1| PREDICTED: uncharacterized protein LOC105113244 isoform X3 [Populus 
euphratica]
Length=195

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 110/197 (56%), Gaps = 24/197 (12%)
 Frame = -2

Query  876  FEGNGGQKLSSSSDHQ-------INGLPFTSGTKPDSFVVDMERF----EKDINSNSRIT  730
            + G+GG  L  + + Q       I+G  +T   K DSFV+DME F     KDIN+N RIT
Sbjct  4    YGGDGGLLLEETMEAQKLTVLDRIDGFQYTK-EKSDSFVIDMESFSHGINKDINTNQRIT  62

Query  729  LQRNLSRKGS---QMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGAD  559
            LQRNLSRKGS        EKKI +  + + +  A    A   G  TPEK  VV VG    
Sbjct  63   LQRNLSRKGSPRGGGGGGEKKIHSNLSHLCDKEAIVSSASPRGPSTPEKAAVVTVGTPDH  122

Query  558  HSAP-----VTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMG  394
             S+P     +TI     N         G +R  F+R S  SW+LDP+R+LFFFATLSSMG
Sbjct  123  SSSPQVHHQITITTGSINGTPE---GRGIRRNSFKRAS-PSWVLDPKRVLFFFATLSSMG  178

Query  393  TLVLIYLSLSVGKYSGD  343
            T++LIYL+LS+GK   D
Sbjct  179  TMLLIYLTLSIGKLKTD  195



>ref|XP_011007638.1| PREDICTED: uncharacterized protein LOC105113244 isoform X1 [Populus 
euphratica]
Length=205

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 110/197 (56%), Gaps = 24/197 (12%)
 Frame = -2

Query  876  FEGNGGQKLSSSSDHQ-------INGLPFTSGTKPDSFVVDMERF----EKDINSNSRIT  730
            + G+GG  L  + + Q       I+G  +T   K DSFV+DME F     KDIN+N RIT
Sbjct  14   YGGDGGLLLEETMEAQKLTVLDRIDGFQYTK-EKSDSFVIDMESFSHGINKDINTNQRIT  72

Query  729  LQRNLSRKGS---QMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGAD  559
            LQRNLSRKGS        EKKI +  + + +  A    A   G  TPEK  VV VG    
Sbjct  73   LQRNLSRKGSPRGGGGGGEKKIHSNLSHLCDKEAIVSSASPRGPSTPEKAAVVTVGTPDH  132

Query  558  HSAP-----VTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMG  394
             S+P     +TI     N         G +R  F+R S  SW+LDP+R+LFFFATLSSMG
Sbjct  133  SSSPQVHHQITITTGSIN---GTPEGRGIRRNSFKRAS-PSWVLDPKRVLFFFATLSSMG  188

Query  393  TLVLIYLSLSVGKYSGD  343
            T++LIYL+LS+GK   D
Sbjct  189  TMLLIYLTLSIGKLKTD  205



>ref|XP_006383946.1| hypothetical protein POPTR_0004s02220g [Populus trichocarpa]
 gb|ERP61743.1| hypothetical protein POPTR_0004s02220g [Populus trichocarpa]
Length=195

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 111/196 (57%), Gaps = 26/196 (13%)
 Frame = -2

Query  870  GNGGQKLSSSSDHQ-------INGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQ  724
            G+GG  L  + + Q       I+G  +T   K DSF++DME F     KDIN+N RITLQ
Sbjct  6    GDGGLLLEETMEAQKLTVLDRIDGFQYTK-EKSDSFIIDMESFSHGINKDINTNQRITLQ  64

Query  723  RNLSRKGS---QMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHS  553
            RNLSRKGS        EKKI +  + + +  A    A   G  TPEK  VV VG     S
Sbjct  65   RNLSRKGSPRGGGGGGEKKIHSNLSHLCDKEAIVASASPRGPSTPEKAAVVTVGTPDHSS  124

Query  552  AP-----VTIIAAGANPL-ESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGT  391
            +P     +TI     N   E + +    +R  F+R S  SW+LDP+R+LFFFATLSSMGT
Sbjct  125  SPQVHHQITITTGSINGTPEGRCI----RRNSFKRAS-PSWVLDPKRVLFFFATLSSMGT  179

Query  390  LVLIYLSLSVGKYSGD  343
            ++LIYL+LS+GK   D
Sbjct  180  MLLIYLTLSIGKLKTD  195



>ref|XP_003538637.2| PREDICTED: uncharacterized protein LOC100799187 [Glycine max]
Length=302

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 110/178 (62%), Gaps = 20/178 (11%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERF----EKD-INSNSRITLQRNLSRKGSQMRSVEKK  676
            SDH IN   +T+    DSFV+DM+ F     KD  N+NSRITLQR+LSRKGSQ R  ++K
Sbjct  127  SDH-INAFQYTA----DSFVIDMDAFSSGHNKDATNANSRITLQRSLSRKGSQ-RLGDRK  180

Query  675  IPNPNAAVDNLIA---TSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTI---IAAGANPL  514
            + N     D  IA    SP+  L G  TPEKP  + VG   DHS    +   I   AN +
Sbjct  181  VNNNATLYDKDIAPAICSPKGALVGPFTPEKPAGMEVGT-MDHSMNPHVHHPITTTANNI  239

Query  513  ESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
             +++  +  +R  FRRPS  SW +DP+R+L FFATLSSMGT++LIY +L++ K S DE
Sbjct  240  PTESKCSITRRNSFRRPS--SWAIDPKRVLLFFATLSSMGTMLLIYFTLTISKQSADE  295



>ref|XP_002305617.2| hypothetical protein POPTR_0004s02220g [Populus trichocarpa]
 gb|EEE86128.2| hypothetical protein POPTR_0004s02220g [Populus trichocarpa]
Length=205

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 111/196 (57%), Gaps = 26/196 (13%)
 Frame = -2

Query  870  GNGGQKLSSSSDHQ-------INGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQ  724
            G+GG  L  + + Q       I+G  +T   K DSF++DME F     KDIN+N RITLQ
Sbjct  16   GDGGLLLEETMEAQKLTVLDRIDGFQYTK-EKSDSFIIDMESFSHGINKDINTNQRITLQ  74

Query  723  RNLSRKGS---QMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHS  553
            RNLSRKGS        EKKI +  + + +  A    A   G  TPEK  VV VG     S
Sbjct  75   RNLSRKGSPRGGGGGGEKKIHSNLSHLCDKEAIVASASPRGPSTPEKAAVVTVGTPDHSS  134

Query  552  AP-----VTIIAAGANPL-ESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGT  391
            +P     +TI     N   E + +    +R  F+R S  SW+LDP+R+LFFFATLSSMGT
Sbjct  135  SPQVHHQITITTGSINGTPEGRCI----RRNSFKRAS-PSWVLDPKRVLFFFATLSSMGT  189

Query  390  LVLIYLSLSVGKYSGD  343
            ++LIYL+LS+GK   D
Sbjct  190  MLLIYLTLSIGKLKTD  205



>ref|XP_002317214.1| hypothetical protein POPTR_0011s00310g [Populus trichocarpa]
 gb|EEE97826.1| hypothetical protein POPTR_0011s00310g [Populus trichocarpa]
Length=204

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 111/184 (60%), Gaps = 33/184 (18%)
 Frame = -2

Query  837  DHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGS--QMRSVEKK  676
            DH ING   T   K DSFV+DMERF     KD N+NSRITLQR+ SRKGS       EKK
Sbjct  28   DH-INGFQCT-KEKSDSFVIDMERFSHGINKDSNTNSRITLQRSHSRKGSPRGGGGGEKK  85

Query  675  IPNPNAAV------DNLIAT-SPRAVLHGAGTPEKPMVVVVGAGADHSA------PVTII  535
            I N N +       D ++A+ SPR    G  TPEK   V VG  ADHS+       +TI 
Sbjct  86   I-NSNLSHLSVSDRDAIVASASPR----GPSTPEKAAAVTVGT-ADHSSSPQLHHQITIT  139

Query  534  AAGANPL-ESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVG  358
                N   ES+ +    +R  F+R S  SW+LDP+R+LFFFATLSSMGT++LIYL+LS+G
Sbjct  140  TGNMNATPESRCI----RRNSFKRSS-PSWVLDPKRVLFFFATLSSMGTMLLIYLTLSIG  194

Query  357  KYSG  346
            K + 
Sbjct  195  KLNA  198



>ref|XP_007143196.1| hypothetical protein PHAVU_007G051800g [Phaseolus vulgaris]
 gb|ESW15190.1| hypothetical protein PHAVU_007G051800g [Phaseolus vulgaris]
Length=205

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 116/203 (57%), Gaps = 23/203 (11%)
 Frame = -2

Query  909  ENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERFEKDIN-----S  745
            ++S  + L  E +  G Q++S S DH IN   + S  + DSFV+DM+ F   IN     +
Sbjct  13   DSSSREALESEQKNMGTQRISVS-DH-INAYQY-SAEEADSFVIDMDSFSSAINKDSTNA  69

Query  744  NSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAG  565
            NSRITLQRNLSRKGSQ R  ++ +   +         SP+A L G+ T EK   V VG+ 
Sbjct  70   NSRITLQRNLSRKGSQ-RGGDRMVNTLHDRDTVPTTCSPKAALAGSCTAEKSAAVAVGS-  127

Query  564  ADHSA------PVTIIAAGA--NPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFAT  409
              HS        +TI A+       ESK +    +R  F+R S  S +LDPRR+L FFAT
Sbjct  128  TQHSTNTQVHHQITITASNMCNTNTESKCVT---RRNSFKRTS--SCLLDPRRVLLFFAT  182

Query  408  LSSMGTLVLIYLSLSVGKYSGDE  340
            LSSMGT++LIY +L++ K S DE
Sbjct  183  LSSMGTMLLIYFTLTISKQSADE  205



>ref|XP_007212063.1| hypothetical protein PRUPE_ppa011520mg [Prunus persica]
 gb|EMJ13262.1| hypothetical protein PRUPE_ppa011520mg [Prunus persica]
Length=207

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 111/192 (58%), Gaps = 25/192 (13%)
 Frame = -2

Query  873  EGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRK  706
            E  G QK+S S DH ING  +T+  K DSFV+DME F    +KDI  NSR+++QRNLSRK
Sbjct  20   EKMGTQKISVS-DH-INGFHYTAD-KSDSFVIDMESFSHGTDKDITPNSRVSMQRNLSRK  76

Query  705  GSQMRSVEKKIPNPNAAVDNLI----ATSPRAVLHGAGTPEKPMVVVVGAGADHSA----  550
             SQ R VEKKI     + D  +    A+SP A L G+ TP+ P+ +      DHS+    
Sbjct  77   WSQ-RDVEKKINYNAISTDRDVLAGGASSPLAALVGSSTPKSPLAM---GTIDHSSNPQV  132

Query  549  --PVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIY  376
               +T+ AA                        +SW +DP+R+LFFFAT+SS+GT++LIY
Sbjct  133  HHQITVTAANIGTTTDGRCVVRRNS----FRRSSSWAIDPKRVLFFFATMSSIGTILLIY  188

Query  375  LSLSVGKYSGDE  340
             +LS+ KY+ DE
Sbjct  189  FTLSIAKYNADE  200



>gb|KHN15813.1| hypothetical protein glysoja_012605 [Glycine soja]
Length=192

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 110/187 (59%), Gaps = 30/187 (16%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERFEKDIN-----SNSRITLQRNLSRKGSQMRSVEKK  676
            SDH  NG  + S  + DSFV+DM+ F   IN     +NSRITLQR+LSRKGSQ R  ++K
Sbjct  9    SDH-TNGYQY-SAEEADSFVIDMDSFSSGINKDSTKANSRITLQRSLSRKGSQ-RGGDRK  65

Query  675  IPNPNAAVDNL----IATSPRAVLHGAGTPEKPMVVVVGAGADHSA------PVTIIAAG  526
            + N N  + +        SP+A L G+ T EK  VV VG+   HS        +TI A+ 
Sbjct  66   V-NGNVTLHDRDTAPTTCSPKAALAGSCTAEKSAVVAVGS-THHSTNTQVHHQITITASN  123

Query  525  A-----NPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSV  361
                   P ESK +    +R  F+RPS  SW+LDP+R+L  FATLSSMGT++LIY +L++
Sbjct  124  MCTTTPTPNESKFIT---RRNSFKRPS--SWLLDPKRVLLLFATLSSMGTMLLIYFTLTI  178

Query  360  GKYSGDE  340
             K   DE
Sbjct  179  SKQKADE  185



>ref|XP_003556023.1| PREDICTED: uncharacterized protein LOC100791649 isoform X1 [Glycine 
max]
Length=219

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 110/187 (59%), Gaps = 30/187 (16%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERFEKDIN-----SNSRITLQRNLSRKGSQMRSVEKK  676
            SDH  NG  + S  + DSFV+DM+ F   IN     +NSRITLQR+LSRKGSQ R  ++K
Sbjct  36   SDH-TNGYQY-SAEEADSFVIDMDSFSSGINKDSTKANSRITLQRSLSRKGSQ-RGGDRK  92

Query  675  IPNPNAAVDNL----IATSPRAVLHGAGTPEKPMVVVVGAGADHSA------PVTIIAAG  526
            + N N  + +        SP+A L G+ T EK  VV VG+   HS        +TI A+ 
Sbjct  93   V-NGNVTLHDRDTAPTTCSPKAALAGSCTAEKSAVVAVGS-THHSTNTQVHHQITITASN  150

Query  525  A-----NPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSV  361
                   P ESK +    +R  F+RPS  SW+LDP+R+L  FATLSSMGT++LIY +L++
Sbjct  151  MCTTTPTPNESKFIT---RRNSFKRPS--SWLLDPKRVLLLFATLSSMGTMLLIYFTLTI  205

Query  360  GKYSGDE  340
             K   DE
Sbjct  206  SKQKADE  212



>ref|XP_011007888.1| PREDICTED: uncharacterized protein LOC105113419 isoform X2 [Populus 
euphratica]
Length=202

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 111/184 (60%), Gaps = 35/184 (19%)
 Frame = -2

Query  837  DHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGS--QMRSVEKK  676
            DH ING   T   K DSFV+DMERF     KDIN+NSRIT  R+ SRKGS       EKK
Sbjct  28   DH-INGFQCTK-EKSDSFVIDMERFSHGINKDINTNSRIT--RSHSRKGSPRGGGGGEKK  83

Query  675  IPNPNAAV------DNLIAT-SPRAVLHGAGTPEKPMVVVVGAGADHSA------PVTII  535
            I N N +       D ++A+ SPR    G  TPEK  VV VG  ADHS+       +TI 
Sbjct  84   I-NSNLSHLSVSDRDAIVASASPR----GPSTPEKAAVVTVGT-ADHSSSPQLHHQITIT  137

Query  534  AAGANPL-ESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVG  358
                N   ES+ +    +R  F+R S  SW+LDP+R+LFFFATLSSMGT++LIYL+LS+G
Sbjct  138  TGNMNATPESRCI----RRNSFKRSS-PSWVLDPKRVLFFFATLSSMGTMLLIYLTLSIG  192

Query  357  KYSG  346
            K + 
Sbjct  193  KLNA  196



>ref|XP_008224770.1| PREDICTED: uncharacterized protein LOC103324488 isoform X1 [Prunus 
mume]
 ref|XP_008224771.1| PREDICTED: uncharacterized protein LOC103324488 isoform X1 [Prunus 
mume]
Length=206

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 110/192 (57%), Gaps = 25/192 (13%)
 Frame = -2

Query  873  EGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRK  706
            E  G QK+S S DH ING  +T+  K DSFV+DME F    +KDI  NSR+++QRNLSRK
Sbjct  20   EKMGTQKISVS-DH-INGFHYTAD-KSDSFVIDMESFSHGTDKDITPNSRVSMQRNLSRK  76

Query  705  GSQMRSVEKKIPNPNAAVDNLI----ATSPRAVLHGAGTPEKPMVVVVGAGADHSA----  550
             SQ R VEKKI     + D  +    A+SP A   G+ TP+ P+ +      DHS+    
Sbjct  77   WSQ-RDVEKKINYNAISTDRDVLAGGASSPLAAPVGSSTPKSPLAM---GTIDHSSNPQV  132

Query  549  --PVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIY  376
               +T+ AA                        +SW +DP+R+LFFFAT+SS+GT++LIY
Sbjct  133  HHQITVTAANIGTTTDGRCVVRRNS----FRRSSSWAIDPKRVLFFFATMSSIGTILLIY  188

Query  375  LSLSVGKYSGDE  340
             +LS+ KY+ DE
Sbjct  189  FTLSIAKYNADE  200



>gb|KDP20804.1| hypothetical protein JCGZ_21275 [Jatropha curcas]
Length=212

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 115/196 (59%), Gaps = 26/196 (13%)
 Frame = -2

Query  873  EGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERFE-----KDINSNSRITLQRNLSR  709
            E  G QK+S   DH ING  +T+  K DSFV+DME F      KDIN NSRITLQR+LSR
Sbjct  21   ENLGNQKISFL-DH-INGFQYTT-EKSDSFVIDMESFSRGSNIKDINPNSRITLQRSLSR  77

Query  708  KGSQMRS-------VEKKIP-NPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHS  553
            KGS +RS        EKK+  +PN   ++ +  S  ++  G    EK ++V  G      
Sbjct  78   KGS-LRSPGGGGTGSEKKVNGSPNDRDNDTVVAS--SLPKGPNMTEKSLLVAAGTTDYSG  134

Query  552  AP-----VTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTL  388
            +P     +TI   G N   S      G+R  F+RP   SW +DP+RILFFFATLSSMGT+
Sbjct  135  SPQVHHQITINTTG-NMNASTESRYIGRRNSFKRPPF-SWAIDPKRILFFFATLSSMGTI  192

Query  387  VLIYLSLSVGKYSGDE  340
            +LIY +LS+GK S D+
Sbjct  193  LLIYFTLSMGKLSADD  208



>ref|XP_003516763.1| PREDICTED: uncharacterized protein LOC100816371 isoform X1 [Glycine 
max]
Length=203

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 110/177 (62%), Gaps = 18/177 (10%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERF----EKD-INSNSRITLQRNLSRKGSQMRSVEKK  676
            SDH IN   + +  K DSFV+DM+ F     KD  N+NSRITLQR+LSRKGSQ R  + K
Sbjct  32   SDH-INAFQY-ADEKADSFVIDMDAFSSGHNKDATNANSRITLQRSLSRKGSQ-RLGDWK  88

Query  675  IPNPNAAV---DNLIA-TSPRAVLHGAGTPEKPMVVVVG-AGADHSAPVTIIAAGANPLE  511
            + N NA +   D + A  SP+  L G  TPEKP  + VG  G   +  V  + A   P E
Sbjct  89   LNN-NATLYDKDTVPAICSPKGTLVGPFTPEKPAGMAVGPMGHSMNPHVHNLTADNIPTE  147

Query  510  SKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            SK   +  +R  FRRPS  SW +DP+R+L FFATLSSMGT++LIY +L++ K S +E
Sbjct  148  SK--CSITRRNSFRRPS--SWAIDPKRVLLFFATLSSMGTMLLIYFTLTISKQSAEE  200



>ref|NP_001236388.1| uncharacterized protein LOC100527205 [Glycine max]
 gb|ACU16257.1| unknown [Glycine max]
Length=214

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 111/193 (58%), Gaps = 30/193 (16%)
 Frame = -2

Query  873  EGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERFEKDIN-----SNSRITLQRNLSR  709
            E N G +    SDH IN   + S  + DSFV+DM+ F   IN     +NSRITLQR+LSR
Sbjct  25   EKNMGTQRILVSDH-INAYQY-SAEEADSFVIDMDSFSSGINKDSNNANSRITLQRSLSR  82

Query  708  KGSQMRSVEKKIPNPNAAVDNL----IATSPRAVLHGAGTPEKPMVVVVGAGADHSA---  550
            KGSQ R  ++K+ N N  + +        SP+A L G+ T EK  VV VG+   HS    
Sbjct  83   KGSQ-RGGDRKV-NGNVTLHDRDTAPTTCSPKAALAGSCTAEKSAVVAVGS-THHSTNTQ  139

Query  549  ---PVTIIAAG-----ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMG  394
                +TI A+          ESK +    +R  F+R S  SW+LDP+R+L FFATLSSMG
Sbjct  140  VRHQITITASSMCTTTTPTTESKCIT---RRNSFKRSS--SWLLDPKRVLLFFATLSSMG  194

Query  393  TLVLIYLSLSVGK  355
            T++LIY +L++ K
Sbjct  195  TMLLIYFTLTLSK  207



>ref|XP_011007639.1| PREDICTED: uncharacterized protein LOC105113244 isoform X2 [Populus 
euphratica]
Length=203

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 108/197 (55%), Gaps = 26/197 (13%)
 Frame = -2

Query  876  FEGNGGQKLSSSSDHQ-------INGLPFTSGTKPDSFVVDMERF----EKDINSNSRIT  730
            + G+GG  L  + + Q       I+G  +T   K DSFV+DME F     KDIN+N RIT
Sbjct  14   YGGDGGLLLEETMEAQKLTVLDRIDGFQYTK-EKSDSFVIDMESFSHGINKDINTNQRIT  72

Query  729  LQRNLSRKGS---QMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGAD  559
              RNLSRKGS        EKKI +  + + +  A    A   G  TPEK  VV VG    
Sbjct  73   --RNLSRKGSPRGGGGGGEKKIHSNLSHLCDKEAIVSSASPRGPSTPEKAAVVTVGTPDH  130

Query  558  HSAP-----VTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMG  394
             S+P     +TI     N         G +R  F+R S  SW+LDP+R+LFFFATLSSMG
Sbjct  131  SSSPQVHHQITITTGSIN---GTPEGRGIRRNSFKRAS-PSWVLDPKRVLFFFATLSSMG  186

Query  393  TLVLIYLSLSVGKYSGD  343
            T++LIYL+LS+GK   D
Sbjct  187  TMLLIYLTLSIGKLKTD  203



>ref|XP_004293254.1| PREDICTED: uncharacterized protein LOC101307567 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=202

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 110/191 (58%), Gaps = 25/191 (13%)
 Frame = -2

Query  873  EGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF-----EKDINSNSRITLQRNLSR  709
            E  G QK+S S DH ING  +T+  K DSFV+DME F     +KD+ +NSR +LQRNLSR
Sbjct  20   EKMGTQKISVS-DH-INGFHYTAD-KSDSFVIDMESFNHAITDKDVTANSRTSLQRNLSR  76

Query  708  KGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADH------SAP  547
            KGSQ R  EKKI     + D  ++ S      G  TP+KP   VV   ADH         
Sbjct  77   KGSQ-RVGEKKISTNGNSNDRDVSASAVTSPTGPLTPKKP--TVVAGTADHPGSPQVHHQ  133

Query  546  VTIIAAGANPLESKTMAAGGKRF--GFRRPSLASWILDPRRILFFFATLSSMGTLVLIYL  373
            +T+ AA           A G+           +SW +DP+R+LFFFATLSS+GT++LIY 
Sbjct  134  ITVTAANIG------TTADGRCVVRRNSFRRSSSWAVDPKRVLFFFATLSSIGTILLIYF  187

Query  372  SLSVGKYSGDE  340
            +L++GKY+ +E
Sbjct  188  TLAIGKYNLEE  198



>ref|XP_008224772.1| PREDICTED: uncharacterized protein LOC103324488 isoform X2 [Prunus 
mume]
Length=202

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 109/192 (57%), Gaps = 29/192 (15%)
 Frame = -2

Query  873  EGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRK  706
            E  G QK+S S DH ING  +T+  K DSFV+DME F    +KDI  NSR+++QRNLSRK
Sbjct  20   EKMGTQKISVS-DH-INGFHYTAD-KSDSFVIDMESFSHGTDKDITPNSRVSMQRNLSRK  76

Query  705  GSQMRSVEKKIPNPNAAVDNLI----ATSPRAVLHGAGTPEKPMVVVVGAGADHSA----  550
             SQ R VEKKI     + D  +    A+SP     G+ TP+ P+ +      DHS+    
Sbjct  77   WSQ-RDVEKKINYNAISTDRDVLAGGASSPL----GSSTPKSPLAM---GTIDHSSNPQV  128

Query  549  --PVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIY  376
               +T+ AA                        +SW +DP+R+LFFFAT+SS+GT++LIY
Sbjct  129  HHQITVTAANIGTTTDGRCVVRRNS----FRRSSSWAIDPKRVLFFFATMSSIGTILLIY  184

Query  375  LSLSVGKYSGDE  340
             +LS+ KY+ DE
Sbjct  185  FTLSIAKYNADE  196



>ref|XP_010088073.1| hypothetical protein L484_014819 [Morus notabilis]
 gb|EXB31392.1| hypothetical protein L484_014819 [Morus notabilis]
Length=273

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 110/178 (62%), Gaps = 24/178 (13%)
 Frame = -2

Query  831  QINGLPFTSGTKPDSFVVDMERF-----EKDINSNSRITLQRNLSRKGSQMRSVEKKI--  673
            QIN   +T+ +  D+FV+DM  F     +KDI ++SRI  +R+LSRKGSQ R  EKKI  
Sbjct  32   QINDFHYTADSS-DNFVIDMGSFSHGSSDKDITTSSRI--KRSLSRKGSQ-RVPEKKINS  87

Query  672  -PNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAP-----VTIIAAGANP-L  514
              N N     ++  SPR    G+ TPEKP +V VG   + S+P     +TI A    P  
Sbjct  88   YTNANDRDSAVVGPSPR----GSCTPEKPSMVAVGTIDNSSSPQVHHQITITAGNITPAT  143

Query  513  ESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            + +++ +  +R  F+  S   W+LDP++ILF FATLSSMGT++LIYL+LS+ KYS DE
Sbjct  144  DGRSIRSVLRRNSFKHSSF--WVLDPKKILFLFATLSSMGTILLIYLTLSISKYSTDE  199



>ref|XP_006606031.1| PREDICTED: uncharacterized protein LOC100791649 isoform X2 [Glycine 
max]
Length=217

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 108/187 (58%), Gaps = 32/187 (17%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERFEKDIN-----SNSRITLQRNLSRKGSQMRSVEKK  676
            SDH  NG  + S  + DSFV+DM+ F   IN     +NSRIT  R+LSRKGSQ R  ++K
Sbjct  36   SDH-TNGYQY-SAEEADSFVIDMDSFSSGINKDSTKANSRIT--RSLSRKGSQ-RGGDRK  90

Query  675  IPNPNAAVDNL----IATSPRAVLHGAGTPEKPMVVVVGAGADHSA------PVTIIAAG  526
            + N N  + +        SP+A L G+ T EK  VV VG+   HS        +TI A+ 
Sbjct  91   V-NGNVTLHDRDTAPTTCSPKAALAGSCTAEKSAVVAVGS-THHSTNTQVHHQITITASN  148

Query  525  A-----NPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSV  361
                   P ESK +    +R  F+RPS  SW+LDP+R+L  FATLSSMGT++LIY +L++
Sbjct  149  MCTTTPTPNESKFIT---RRNSFKRPS--SWLLDPKRVLLLFATLSSMGTMLLIYFTLTI  203

Query  360  GKYSGDE  340
             K   DE
Sbjct  204  SKQKADE  210



>ref|XP_006449101.1| hypothetical protein CICLE_v10016643mg [Citrus clementina]
 ref|XP_006449102.1| hypothetical protein CICLE_v10016643mg [Citrus clementina]
 gb|ESR62341.1| hypothetical protein CICLE_v10016643mg [Citrus clementina]
 gb|ESR62342.1| hypothetical protein CICLE_v10016643mg [Citrus clementina]
Length=198

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 100/179 (56%), Gaps = 24/179 (13%)
 Frame = -2

Query  837  DHQINGLPFTSGTKPDSFVVDMERFEKDIN------SNSRITLQRNLSRKGSQ---MRSV  685
            DH +NG  + +  K D+FV+DM+ F   IN      +NSRITLQ++LSRKGSQ     + 
Sbjct  24   DH-VNGFHYNALKKSDNFVIDMDAFSHGINKDSTNNANSRITLQKSLSRKGSQRGGCGAE  82

Query  684  EKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESK  505
            +K   N N     L A+SPR    G GTPEKP    +G     S  +  +          
Sbjct  83   KKSNSNANDRDATLAASSPR----GPGTPEKPAGAAIG-----STDIPQVHHQITITTGN  133

Query  504  TMAAGGKRFGFRRPSLA----SWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
             +     + GF+R SL     SW +DP+R+L FFATLSS+GT++LIY +LS+ K+S +E
Sbjct  134  IITTPDSKSGFKRNSLKRSSHSWAIDPKRVLLFFATLSSLGTILLIYFTLSL-KHSAEE  191



>ref|XP_006573892.1| PREDICTED: uncharacterized protein LOC100816371 isoform X2 [Glycine 
max]
 gb|KHN30452.1| hypothetical protein glysoja_033190 [Glycine soja]
Length=201

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 108/177 (61%), Gaps = 20/177 (11%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERF----EKD-INSNSRITLQRNLSRKGSQMRSVEKK  676
            SDH IN   + +  K DSFV+DM+ F     KD  N+NSRIT  R+LSRKGSQ R  + K
Sbjct  32   SDH-INAFQY-ADEKADSFVIDMDAFSSGHNKDATNANSRIT--RSLSRKGSQ-RLGDWK  86

Query  675  IPNPNAAV---DNLIA-TSPRAVLHGAGTPEKPMVVVVG-AGADHSAPVTIIAAGANPLE  511
            + N NA +   D + A  SP+  L G  TPEKP  + VG  G   +  V  + A   P E
Sbjct  87   LNN-NATLYDKDTVPAICSPKGTLVGPFTPEKPAGMAVGPMGHSMNPHVHNLTADNIPTE  145

Query  510  SKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            SK   +  +R  FRRPS  SW +DP+R+L FFATLSSMGT++LIY +L++ K S +E
Sbjct  146  SK--CSITRRNSFRRPS--SWAIDPKRVLLFFATLSSMGTMLLIYFTLTISKQSAEE  198



>ref|XP_009357392.1| PREDICTED: uncharacterized protein LOC103948127 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357393.1| PREDICTED: uncharacterized protein LOC103948127 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009340930.1| PREDICTED: uncharacterized protein LOC103933006 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009340931.1| PREDICTED: uncharacterized protein LOC103933006 isoform X1 [Pyrus 
x bretschneideri]
Length=203

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 111/187 (59%), Gaps = 24/187 (13%)
 Frame = -2

Query  864  GGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF-----EKDINSNSRITLQRNLSRKGS  700
            G QK+S S DH ING  +T+  K DSFV+DME F     +KD+ +NSR+++QRNLSRK S
Sbjct  22   GTQKISVS-DH-INGFHYTAD-KSDSFVIDMESFSHGGTDKDVTANSRVSMQRNLSRKWS  78

Query  699  QMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEK-PMVVVVGAGADHSAP-----VTI  538
            Q R  EKKI     + D  ++++  + + G+ TPEK P+ V  G     S P     +T+
Sbjct  79   Q-RGGEKKIICKGDSNDKEVSSTTSSPV-GSSTPEKSPLAV--GTIDQSSNPHVHHQITV  134

Query  537  IAAG-ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSV  361
             AA      E + +              +SW +DP+R+L FFAT+SS+GT++LIY +LS+
Sbjct  135  TAANIGTTTEGRCVVRRNSF-----RRSSSWGIDPKRVLLFFATMSSVGTILLIYFTLSI  189

Query  360  GKYSGDE  340
             KY+ DE
Sbjct  190  AKYNADE  196



>ref|XP_006467971.1| PREDICTED: uncharacterized protein LOC102624937 isoform X1 [Citrus 
sinensis]
 gb|KDO75563.1| hypothetical protein CISIN_1g029151mg [Citrus sinensis]
Length=198

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 99/179 (55%), Gaps = 24/179 (13%)
 Frame = -2

Query  837  DHQINGLPFTSGTKPDSFVVDMERFEKDIN------SNSRITLQRNLSRKGSQ---MRSV  685
            DH +NG  + +  K D+FV+DM+ F   IN      +NSRITLQ++LSRKGSQ     + 
Sbjct  24   DH-VNGFHYNALKKSDNFVIDMDAFAHGINKDSTNNANSRITLQKSLSRKGSQRGGCGAE  82

Query  684  EKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESK  505
            +K   N N     L A+SPR    G  TPEKP    +G     S  +  +          
Sbjct  83   KKSNSNANDRDATLAASSPR----GPSTPEKPAGAAIG-----STDIPQVHHQITITTGN  133

Query  504  TMAAGGKRFGFRRPSLA----SWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
             +     + GFRR SL     SW +DP+R+L FFATLSS+GT++LIY +LS+ K+S +E
Sbjct  134  IITTPDSKSGFRRNSLKRSSHSWAIDPKRVLLFFATLSSLGTILLIYFTLSL-KHSAEE  191



>ref|XP_010686967.1| PREDICTED: uncharacterized protein LOC104901121 [Beta vulgaris 
subsp. vulgaris]
Length=210

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 108/198 (55%), Gaps = 35/198 (18%)
 Frame = -2

Query  861  GQKLSSSSDHQINGLPFTSGT-KPDSFVVDMERF------EKDINS----NSRITLQRNL  715
            G K  + SDHQ+NG  + SG  K D ++VD+E F      E  I+S    NSRITLQR+L
Sbjct  18   GNKKMAVSDHQMNGFKYESGADKSDCYIVDLENFSNGVDNEHSIHSTTTPNSRITLQRSL  77

Query  714  SRKGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPM--VVVVGAGADHSA---  550
            SRK  Q R  E+K+ + +       ++SPRA      TPEK +    +  A  DH+    
Sbjct  78   SRKVPQ-RGAERKLNDRDTFAP---SSSPRAA-QVVSTPEKCLSPTTLPLASQDHTMNNH  132

Query  549  ------PVTIIAAGANPLESKTMAAG--GKRFGFRRPSLASWILDPRRILFFFATLSSMG  394
                   +TI   G N     T+A G  G+R  F+RP+  SW  DP+RIL FFATLSS+G
Sbjct  133  QQLPQHQITIKTGGIN-----TIADGKWGRRSSFKRPA-HSWFSDPKRILLFFATLSSIG  186

Query  393  TLVLIYLSLSVGKYSGDE  340
            T+ LIY +LS+ K    E
Sbjct  187  TMFLIYFTLSISKADDKE  204



>ref|XP_004293255.1| PREDICTED: uncharacterized protein LOC101307567 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=200

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 108/191 (57%), Gaps = 27/191 (14%)
 Frame = -2

Query  873  EGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF-----EKDINSNSRITLQRNLSR  709
            E  G QK+S S DH ING  +T+  K DSFV+DME F     +KD+ +NSR +  RNLSR
Sbjct  20   EKMGTQKISVS-DH-INGFHYTAD-KSDSFVIDMESFNHAITDKDVTANSRTS--RNLSR  74

Query  708  KGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADH------SAP  547
            KGSQ R  EKKI     + D  ++ S      G  TP+KP   VV   ADH         
Sbjct  75   KGSQ-RVGEKKISTNGNSNDRDVSASAVTSPTGPLTPKKP--TVVAGTADHPGSPQVHHQ  131

Query  546  VTIIAAGANPLESKTMAAGGKRF--GFRRPSLASWILDPRRILFFFATLSSMGTLVLIYL  373
            +T+ AA           A G+           +SW +DP+R+LFFFATLSS+GT++LIY 
Sbjct  132  ITVTAANIG------TTADGRCVVRRNSFRRSSSWAVDPKRVLFFFATLSSIGTILLIYF  185

Query  372  SLSVGKYSGDE  340
            +L++GKY+ +E
Sbjct  186  TLAIGKYNLEE  196



>ref|XP_007157176.1| hypothetical protein PHAVU_002G049100g [Phaseolus vulgaris]
 ref|XP_007157177.1| hypothetical protein PHAVU_002G049100g [Phaseolus vulgaris]
 ref|XP_007157178.1| hypothetical protein PHAVU_002G049100g [Phaseolus vulgaris]
 gb|ESW29170.1| hypothetical protein PHAVU_002G049100g [Phaseolus vulgaris]
 gb|ESW29171.1| hypothetical protein PHAVU_002G049100g [Phaseolus vulgaris]
 gb|ESW29172.1| hypothetical protein PHAVU_002G049100g [Phaseolus vulgaris]
Length=212

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 121/211 (57%), Gaps = 30/211 (14%)
 Frame = -2

Query  918  MEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKD-  754
            ++  +S S+ L  E +  G   LSS  DH +N   + S  K DSFV+D++ F     KD 
Sbjct  7    LDLSSSCSEALNSEEKNRGSVILSS--DH-VNAFEY-SAEKDDSFVIDIDAFSSANHKDP  62

Query  753  INSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAV---DNLIA-TSPRAVLHGAGTPEKPM  586
             N+NSRIT Q++LSRKGS +R  ++K+ N +A +   D + A  SP+  L  + T EK +
Sbjct  63   TNANSRIT-QKSLSRKGS-LRLGDRKV-NSSATLYGKDTVPAICSPKGTLVRSCTLEKTL  119

Query  585  VVVVGAGADHS---------APVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPR  433
             + VG+  DHS         A  T   +  NP E+K   +  +R  FRRPS  SW LDP+
Sbjct  120  GMAVGS-MDHSINPLVYQQIAMTTNNISAGNPTETK--CSITRRNSFRRPS--SWTLDPK  174

Query  432  RILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            R+L FFAT+SSMGT++LIY  L   K S DE
Sbjct  175  RVLLFFATVSSMGTMLLIYFILMTSKQSADE  205



>gb|KHN35201.1| hypothetical protein glysoja_004967 [Glycine soja]
Length=157

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 89/143 (62%), Gaps = 12/143 (8%)
 Frame = -2

Query  750  NSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIA---TSPRAVLHGAGTPEKPMVV  580
            N+NSRIT  R+LSRKGSQ R  ++K+ N     D  IA    SP+  L G  TPEKP  +
Sbjct  14   NANSRIT--RSLSRKGSQ-RLGDRKVNNNATLYDKDIAPAICSPKVALVGPFTPEKPAGM  70

Query  579  VVGAGADHSAPVTI---IAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFAT  409
             VG   DHS    +   I   AN + +++  +  +R  FRRPS  SW +DP+R+L FFAT
Sbjct  71   EVGT-MDHSMNPHVHHPITTTANNIPTESKCSITRRNSFRRPS--SWAIDPKRVLLFFAT  127

Query  408  LSSMGTLVLIYLSLSVGKYSGDE  340
            LSSMGT++LIY +L++ K S DE
Sbjct  128  LSSMGTMLLIYFTLTISKQSADE  150



>ref|XP_007157179.1| hypothetical protein PHAVU_002G049100g [Phaseolus vulgaris]
 gb|ESW29173.1| hypothetical protein PHAVU_002G049100g [Phaseolus vulgaris]
Length=211

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 120/211 (57%), Gaps = 31/211 (15%)
 Frame = -2

Query  918  MEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKD-  754
            ++  +S S+ L  E +  G   LSS  DH +N   + S  K DSFV+D++ F     KD 
Sbjct  7    LDLSSSCSEALNSEEKNRGSVILSS--DH-VNAFEY-SAEKDDSFVIDIDAFSSANHKDP  62

Query  753  INSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAV---DNLIA-TSPRAVLHGAGTPEKPM  586
             N+NSRIT  ++LSRKGS +R  ++K+ N +A +   D + A  SP+  L  + T EK +
Sbjct  63   TNANSRIT--KSLSRKGS-LRLGDRKV-NSSATLYGKDTVPAICSPKGTLVRSCTLEKTL  118

Query  585  VVVVGAGADHS---------APVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPR  433
             + VG+  DHS         A  T   +  NP E+K   +  +R  FRRPS  SW LDP+
Sbjct  119  GMAVGS-MDHSINPLVYQQIAMTTNNISAGNPTETK--CSITRRNSFRRPS--SWTLDPK  173

Query  432  RILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            R+L FFAT+SSMGT++LIY  L   K S DE
Sbjct  174  RVLLFFATVSSMGTMLLIYFILMTSKQSADE  204



>ref|XP_011086167.1| PREDICTED: uncharacterized protein LOC105167966 isoform X4 [Sesamum 
indicum]
Length=207

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 107/185 (58%), Gaps = 17/185 (9%)
 Frame = -2

Query  879  EFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLS  712
            E    GGQK   S D   NGL  +S TK DSFVVDMERF    EKDI+SNSRI  QR  S
Sbjct  16   ELFQKGGQKFPVSED--ANGLQHSS-TKSDSFVVDMERFSHLIEKDISSNSRIGAQRTPS  72

Query  711  RKGSQMRSVEKKIPNPNAAVDNL--IATSPRAVLHGAGTPEKPMVVVVGAGADHSAP---  547
            R+G  MR V+  I +    + +L  + TSP A LHG  TP+K   V      +H  P   
Sbjct  73   RQG-WMRGVDNNINSATPDLKDLSTLPTSPTATLHGGSTPQKASAVGAVGATNHHVPQVH  131

Query  546  --VTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYL  373
              +TI     + + ++    GGKR  FRR +L S +  P RILF  AT+SS+G+++LIY+
Sbjct  132  HQITIKNGSMSSIAAEGQR-GGKRLSFRRSTLTS-LFHPTRILFICATISSIGSIILIYV  189

Query  372  SLSVG  358
            +L++G
Sbjct  190  TLTIG  194



>ref|XP_011086166.1| PREDICTED: uncharacterized protein LOC105167966 isoform X3 [Sesamum 
indicum]
Length=216

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 106/180 (59%), Gaps = 17/180 (9%)
 Frame = -2

Query  864  GGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQ  697
            GGQK   S D   NGL  +S TK DSFVVDMERF    EKDI+SNSRI  QR  SR+G  
Sbjct  30   GGQKFPVSED--ANGLQHSS-TKSDSFVVDMERFSHLIEKDISSNSRIGAQRTPSRQG-W  85

Query  696  MRSVEKKIPNPNAAVDNL--IATSPRAVLHGAGTPEKPMVVVVGAGADHSAP-----VTI  538
            MR V+  I +    + +L  + TSP A LHG  TP+K   V      +H  P     +TI
Sbjct  86   MRGVDNNINSATPDLKDLSTLPTSPTATLHGGSTPQKASAVGAVGATNHHVPQVHHQITI  145

Query  537  IAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVG  358
                 + + ++    GGKR  FRR +L S +  P RILF  AT+SS+G+++LIY++L++G
Sbjct  146  KNGSMSSIAAEGQR-GGKRLSFRRSTLTS-LFHPTRILFICATISSIGSIILIYVTLTIG  203



>ref|XP_011086164.1| PREDICTED: uncharacterized protein LOC105167966 isoform X1 [Sesamum 
indicum]
Length=220

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 106/180 (59%), Gaps = 17/180 (9%)
 Frame = -2

Query  864  GGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQ  697
            GGQK   S D   NGL  +S TK DSFVVDMERF    EKDI+SNSRI  QR  SR+G  
Sbjct  34   GGQKFPVSED--ANGLQHSS-TKSDSFVVDMERFSHLIEKDISSNSRIGAQRTPSRQG-W  89

Query  696  MRSVEKKIPNPNAAVDNL--IATSPRAVLHGAGTPEKPMVVVVGAGADHSAP-----VTI  538
            MR V+  I +    + +L  + TSP A LHG  TP+K   V      +H  P     +TI
Sbjct  90   MRGVDNNINSATPDLKDLSTLPTSPTATLHGGSTPQKASAVGAVGATNHHVPQVHHQITI  149

Query  537  IAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVG  358
                 + + ++    GGKR  FRR +L S +  P RILF  AT+SS+G+++LIY++L++G
Sbjct  150  KNGSMSSIAAEGQR-GGKRLSFRRSTLTS-LFHPTRILFICATISSIGSIILIYVTLTIG  207



>ref|XP_010529369.1| PREDICTED: uncharacterized protein LOC104806260 [Tarenaya hassleriana]
Length=194

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 112/194 (58%), Gaps = 20/194 (10%)
 Frame = -2

Query  873  EGNGGQKLSSSSDHQINGLPFTSGTKPDSFV-VDMERF----EKDINSNSRITLQRNLSR  709
            E NGG+  S + D + NG  +    KP+ FV +D+E F     KDI+S+ R ++QRN+SR
Sbjct  2    ETNGGR--SPNPDRE-NGFGYKKSEKPEEFVMIDVESFASVLHKDISSSPRFSMQRNVSR  58

Query  708  KGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADH---SAPVTI  538
            K S   S   +  + +A  +   +++P++ L G+GTPEK     VGA  D    S   T 
Sbjct  59   KFSGRSSSNDRKLHYDANGNGKDSSTPQSPLRGSGTPEK-STAAVGAPVDPTDLSVAATA  117

Query  537  IAAGANPLESKTMAAGG------KRFGFRRPS--LASWILDPRRILFFFATLSSMGTLVL  382
             +   +PL   T+ AG       +RFG+ + +    SWILDP++++ FFATLSSMG+++L
Sbjct  118  ESVAGSPLHQITITAGNLSDQTERRFGYSKKTSFKRSWILDPKKVVLFFATLSSMGSILL  177

Query  381  IYLSLSVGKYSGDE  340
            I  +LS+ K S ++
Sbjct  178  IIFTLSMRKSSPED  191



>ref|XP_004248392.2| PREDICTED: uncharacterized protein LOC101254737 [Solanum lycopersicum]
Length=184

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 97/170 (57%), Gaps = 30/170 (18%)
 Frame = -2

Query  792  DSFVVDMERF-----EKDINSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIATSP  628
            +SFVVDME       EK+IN+NSRITLQRN SRKGS  +   +   + N    NL+A SP
Sbjct  22   ESFVVDMEHISHHLVEKEINANSRITLQRNHSRKGSLKK---QNFNDINEKDTNLMAISP  78

Query  627  RAVLHGAGTPEKPMVVVVGAGADHSAP--------VTIIAAGANPLESKTMAAGGK----  484
            +    GA  PEK +VV     +DHS P        V   ++GA    + T A  GK    
Sbjct  79   K----GASMPEKSIVVT----SDHSIPHVHNQNTSVVAASSGAAATTTTTTAIDGKVAVS  130

Query  483  --RFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
                  R  S + W +DPRRIL FFATLSSMGT++LIY +LS+ K +G++
Sbjct  131  KRFSFRRSSSSSPWTIDPRRILIFFATLSSMGTILLIYFTLSMTKLNGED  180



>ref|XP_009365687.1| PREDICTED: uncharacterized protein LOC103955487 [Pyrus x bretschneideri]
 ref|XP_009365759.1| PREDICTED: uncharacterized protein LOC103955487 [Pyrus x bretschneideri]
 ref|XP_009349599.1| PREDICTED: uncharacterized protein LOC103941132 [Pyrus x bretschneideri]
 ref|XP_009349600.1| PREDICTED: uncharacterized protein LOC103941132 [Pyrus x bretschneideri]
Length=201

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 109/185 (59%), Gaps = 26/185 (14%)
 Frame = -2

Query  858  QKLSSSSDHQINGLPFTSGTKPDSFVVDMERF-----EKDINSNSRITLQRNLSRKGSQM  694
            QK+S S DH ING  +T+  K DSFV+DME F     +KD+ +NSR++  RN+SRK SQ 
Sbjct  24   QKISVS-DH-INGFHYTAD-KSDSFVIDMESFSHGGTDKDVTANSRVS--RNVSRKWSQ-  77

Query  693  RSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEK-PMVVVVGAGADHSAP-----VTIIA  532
            R  EKKI     + D  ++++  + L G+ TPEK P+ V  G     S P     +T+ A
Sbjct  78   RGGEKKIIRNVNSNDKEVSSTTSSPL-GSSTPEKSPLAV--GTIDQSSNPHVHHQITVTA  134

Query  531  AG-ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
            A      E + +              +SW +DP+R+LFFFAT+SS+GT++LIY +LS+ K
Sbjct  135  ANIGTTTEGRCVVRRNSF-----RRSSSWGIDPKRVLFFFATMSSIGTILLIYFTLSIAK  189

Query  354  YSGDE  340
            Y+ DE
Sbjct  190  YNADE  194



>ref|XP_006449104.1| hypothetical protein CICLE_v10016643mg [Citrus clementina]
 gb|ESR62344.1| hypothetical protein CICLE_v10016643mg [Citrus clementina]
Length=196

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 98/179 (55%), Gaps = 26/179 (15%)
 Frame = -2

Query  837  DHQINGLPFTSGTKPDSFVVDMERFEKDIN------SNSRITLQRNLSRKGSQ---MRSV  685
            DH +NG  + +  K D+FV+DM+ F   IN      +NSRIT  ++LSRKGSQ     + 
Sbjct  24   DH-VNGFHYNALKKSDNFVIDMDAFSHGINKDSTNNANSRIT--KSLSRKGSQRGGCGAE  80

Query  684  EKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESK  505
            +K   N N     L A+SPR    G GTPEKP    +G     S  +  +          
Sbjct  81   KKSNSNANDRDATLAASSPR----GPGTPEKPAGAAIG-----STDIPQVHHQITITTGN  131

Query  504  TMAAGGKRFGFRRPSLA----SWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
             +     + GF+R SL     SW +DP+R+L FFATLSS+GT++LIY +LS+ K+S +E
Sbjct  132  IITTPDSKSGFKRNSLKRSSHSWAIDPKRVLLFFATLSSLGTILLIYFTLSL-KHSAEE  189



>ref|XP_009357394.1| PREDICTED: uncharacterized protein LOC103948127 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009340932.1| PREDICTED: uncharacterized protein LOC103933006 isoform X2 [Pyrus 
x bretschneideri]
Length=201

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 109/187 (58%), Gaps = 26/187 (14%)
 Frame = -2

Query  864  GGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF-----EKDINSNSRITLQRNLSRKGS  700
            G QK+S S DH ING  +T+  K DSFV+DME F     +KD+ +NSR++  RNLSRK S
Sbjct  22   GTQKISVS-DH-INGFHYTAD-KSDSFVIDMESFSHGGTDKDVTANSRVS--RNLSRKWS  76

Query  699  QMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEK-PMVVVVGAGADHSAP-----VTI  538
            Q R  EKKI     + D  ++++  + + G+ TPEK P+ V  G     S P     +T+
Sbjct  77   Q-RGGEKKIICKGDSNDKEVSSTTSSPV-GSSTPEKSPLAV--GTIDQSSNPHVHHQITV  132

Query  537  IAAG-ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSV  361
             AA      E + +              +SW +DP+R+L FFAT+SS+GT++LIY +LS+
Sbjct  133  TAANIGTTTEGRCVVRRNSF-----RRSSSWGIDPKRVLLFFATMSSVGTILLIYFTLSI  187

Query  360  GKYSGDE  340
             KY+ DE
Sbjct  188  AKYNADE  194



>gb|KDO75562.1| hypothetical protein CISIN_1g029151mg [Citrus sinensis]
Length=196

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 97/179 (54%), Gaps = 26/179 (15%)
 Frame = -2

Query  837  DHQINGLPFTSGTKPDSFVVDMERFEKDIN------SNSRITLQRNLSRKGSQ---MRSV  685
            DH +NG  + +  K D+FV+DM+ F   IN      +NSRIT  ++LSRKGSQ     + 
Sbjct  24   DH-VNGFHYNALKKSDNFVIDMDAFAHGINKDSTNNANSRIT--KSLSRKGSQRGGCGAE  80

Query  684  EKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESK  505
            +K   N N     L A+SPR    G  TPEKP    +G     S  +  +          
Sbjct  81   KKSNSNANDRDATLAASSPR----GPSTPEKPAGAAIG-----STDIPQVHHQITITTGN  131

Query  504  TMAAGGKRFGFRRPSLA----SWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
             +     + GFRR SL     SW +DP+R+L FFATLSS+GT++LIY +LS+ K+S +E
Sbjct  132  IITTPDSKSGFRRNSLKRSSHSWAIDPKRVLLFFATLSSLGTILLIYFTLSL-KHSAEE  189



>ref|XP_010052437.1| PREDICTED: uncharacterized protein LOC104441128 isoform X1 [Eucalyptus 
grandis]
 gb|KCW76428.1| hypothetical protein EUGRSUZ_D00816 [Eucalyptus grandis]
Length=203

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 108/207 (52%), Gaps = 50/207 (24%)
 Frame = -2

Query  864  GGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERFE-------KDINSNSRITLQRNLSRK  706
            G QK++ S DH +NGLP     K D  V+DME F        KDINS  RITLQR+LSRK
Sbjct  2    GTQKITVS-DH-MNGLP---ADKSDDLVIDMESFSHLVPPPCKDINS--RITLQRSLSRK  54

Query  705  GSQMRSVEKKIPNPNAAVDN------LIATS---------PRAVLHGAGTPEKPMVVVVG  571
            GSQ    +K I NP+AA  N      ++ATS         PRA L G+ + +   +  +G
Sbjct  55   GSQRVGEDKVISNPSAADKNDSQPGIVLATSSPRGTPRGTPRASLLGSNSMDTATMAAIG  114

Query  570  AGADHSAP------VTIIAAGANPLESKTMAAGGKRFGFRRPSLAS----WILDPRRILF  421
               DH++       +T+              A   RF  RR S       WILDP+RILF
Sbjct  115  T-TDHTSKLQNHHQITVTTGSIG-------TANESRFTIRRNSFRRSSSSWILDPKRILF  166

Query  420  FFATLSSMGTLVL---IYLSLSVGKYS  349
             FATLSSMGT++L   IY +LS+ K S
Sbjct  167  IFATLSSMGTILLIYFIYFTLSISKSS  193



>ref|XP_004511335.1| PREDICTED: uncharacterized protein LOC101502614 isoform X1 [Cicer 
arietinum]
 ref|XP_004511336.1| PREDICTED: uncharacterized protein LOC101502614 isoform X2 [Cicer 
arietinum]
Length=211

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 115/214 (54%), Gaps = 36/214 (17%)
 Frame = -2

Query  921  VMEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERFEKDIN--  748
            +++  +S   G G   E    Q+++ S DH +N   +T G K DSFV+DM+ +   IN  
Sbjct  7    LVDLSSSCYYGCGDGIEMEQKQRITES-DH-MNAFQYT-GDKVDSFVIDMDAYSSGINKD  63

Query  747  ---SNSRITLQRNLSRKGSQMRSVEKK-------------IPNPNAAVDNLIA-TSPRAV  619
               +NSRITLQR+LSRKGSQ R  ++K             I N N   D + A  SP+  
Sbjct  64   ATNTNSRITLQRSLSRKGSQ-RVGDRKLNGITTLSPHSHDINNNNNNKDAISALCSPKGT  122

Query  618  LHG-AGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWIL  442
            L G   TP+K   + VG+  DH    T         E+K++    +R  F R S +S  L
Sbjct  123  LTGSCSTPDKAASMAVGS-TDHFINTT-------ATETKSIT---RRNSFIRSS-SSCPL  170

Query  441  DPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            DP+R+L FFATLSSMGT++LIY +L   K + D+
Sbjct  171  DPKRVLIFFATLSSMGTMLLIYFTLITNKQNEDQ  204



>ref|XP_011086165.1| PREDICTED: uncharacterized protein LOC105167966 isoform X2 [Sesamum 
indicum]
Length=218

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 105/180 (58%), Gaps = 19/180 (11%)
 Frame = -2

Query  864  GGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQ  697
            GGQK   S D   NGL  +S TK DSFVVDMERF    EKDI+SNSRI   R  SR+G  
Sbjct  34   GGQKFPVSED--ANGLQHSS-TKSDSFVVDMERFSHLIEKDISSNSRIG--RTPSRQG-W  87

Query  696  MRSVEKKIPNPNAAVDNL--IATSPRAVLHGAGTPEKPMVVVVGAGADHSAP-----VTI  538
            MR V+  I +    + +L  + TSP A LHG  TP+K   V      +H  P     +TI
Sbjct  88   MRGVDNNINSATPDLKDLSTLPTSPTATLHGGSTPQKASAVGAVGATNHHVPQVHHQITI  147

Query  537  IAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVG  358
                 + + ++    GGKR  FRR +L S +  P RILF  AT+SS+G+++LIY++L++G
Sbjct  148  KNGSMSSIAAEGQR-GGKRLSFRRSTLTS-LFHPTRILFICATISSIGSIILIYVTLTIG  205



>gb|KEH43931.1| transmembrane protein, putative [Medicago truncatula]
Length=210

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 111/205 (54%), Gaps = 19/205 (9%)
 Frame = -2

Query  918  MEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDI  751
            ++  +S  + L  E    G Q++  S DH IN   ++S  K DSFV+DM+ F     KDI
Sbjct  12   LDLVSSSCEALESEQMKIGSQRILVS-DH-INAYQYSSE-KVDSFVIDMDSFSSTINKDI  68

Query  750  -NSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIA---TSPRAVLHGAGTPEKPMV  583
             N+NSR TLQR+LSRKGSQ R  ++ +       D  I     SP+A L G+    K  V
Sbjct  69   INANSRTTLQRSLSRKGSQ-RGGDRNVSGNVTLQDKDIVPTTCSPKAALLGSC---KSTV  124

Query  582  VVVGAGADHSAPVT----IIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFF  415
            V VG+  + + P      I    A+ + +                 +SW+LDP+++L  F
Sbjct  125  VPVGSTQNSTNPQQVHHQITVTTASNMCNTNAENKSITRRSSFGRSSSWLLDPKKVLLVF  184

Query  414  ATLSSMGTLVLIYLSLSVGKYSGDE  340
            ATLSS+GTL+LI+L+LS+ K++G E
Sbjct  185  ATLSSVGTLLLIFLTLSISKHNGVE  209



>ref|XP_006352600.1| PREDICTED: uncharacterized protein LOC102593693 [Solanum tuberosum]
Length=209

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 89/174 (51%), Gaps = 34/174 (20%)
 Frame = -2

Query  792  DSFVVDMERF-----EKDINSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIATSP  628
            +SFVVDME       EK+IN+NSRITLQRN SRKGS  +   +   + N    NL+A SP
Sbjct  43   ESFVVDMEHISHHLVEKEINANSRITLQRNHSRKGSLKK---QNFNDVNEKDTNLMAISP  99

Query  627  RAVLHGAGTPEKPMVVVVGAGADHSAP------------------VTIIAAGANPLESKT  502
            +    GA   EK MV+     +DHS P                                 
Sbjct  100  K----GASMLEKSMVIT----SDHSTPHAHNQNTSVVAASSGAASSGAAITTTTTAIDGK  151

Query  501  MAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            +A   +    R  S + W +DPRRIL FFATLSSMGT++LIY +LS+ K +G++
Sbjct  152  VAVSKRFSFRRSSSSSPWTIDPRRILIFFATLSSMGTILLIYFTLSMTKLNGED  205



>ref|XP_009137182.1| PREDICTED: uncharacterized protein LOC103861223 isoform X1 [Brassica 
rapa]
Length=197

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 101/176 (57%), Gaps = 24/176 (14%)
 Frame = -2

Query  813  FTSGTKPDSFV-VDMERF----EKDINSNSRI-TLQRNLSRKGSQMRSVEKKIPNPNAAV  652
            F +   PD +V +D+E F     KD +S+S I TLQR++SRK S   + E+K+ + NA  
Sbjct  16   FHTPVNPDGYVTIDVESFSHVIHKDFSSSSPIVTLQRSVSRKESLRSNNERKL-HSNANG  74

Query  651  DNLIATSPRAVLHGAGTPEKPMVV--VVGAGADHSAPVTIIAAGANPLESKTMAAGGK--  484
            ++   +SP++ + G+ TPEK   V  +   G D +A   + A+  + +   T +A G+  
Sbjct  75   NDKETSSPQSPVRGSCTPEKASTVRPIDHVGTDTTAATIVSASPLHQITVTTTSATGRNM  134

Query  483  --------RFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
                    RFGF R S       SW+LDP++IL FFATLSSMG+++LI  +LS+ K
Sbjct  135  ISEQNRERRFGFARKSSFKRSRTSWMLDPKKILIFFATLSSMGSILLIIFTLSISK  190



>ref|XP_008441474.1| PREDICTED: uncharacterized protein LOC103485579 isoform X1 [Cucumis 
melo]
Length=204

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 103/194 (53%), Gaps = 28/194 (14%)
 Frame = -2

Query  873  EGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERFE-----KDINSNSRITLQRNLSR  709
            E    QK+S  S  Q NG+ ++  T  DSFV+DM  F      K+  +N RITLQRN SR
Sbjct  19   ETRNSQKISVCS--QPNGVHYS--TNSDSFVIDMNGFSSNGGTKESTTNPRITLQRNSSR  74

Query  708  KGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVV-----------VGAGA  562
            KGSQ R  +K I N +A +D   ++SP   + GA   EK                +G   
Sbjct  75   KGSQ-RGGDKMIANNSAPIDR-DSSSPTVAV-GATMAEKAAGSAVAVAVGSQQDHLGVPQ  131

Query  561  DHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVL  382
             H        + A P+E   +    +R  FRRP  + W+LDP+++L  FAT+S +G++VL
Sbjct  132  VHHQITITTGSTAAPVERPIL----RRNSFRRPP-SYWMLDPKKVLLLFATVSCIGSMVL  186

Query  381  IYLSLSVGKYSGDE  340
            IY +L++GK + ++
Sbjct  187  IYFTLAIGKPNAEQ  200



>ref|XP_006413802.1| hypothetical protein EUTSA_v10026295mg [Eutrema salsugineum]
 gb|ESQ55255.1| hypothetical protein EUTSA_v10026295mg [Eutrema salsugineum]
Length=197

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 104/188 (55%), Gaps = 29/188 (15%)
 Frame = -2

Query  831  QINGLPFTSGTKPDSFV-VDMERF-----EKDINSNS-RITLQRNLSRKGSQMRSVEKKI  673
            Q  G  F     PD FV +D+E F      KD++S+S RITLQR++SRKGS   + E+K+
Sbjct  10   QDTGSGFQKPVNPDGFVTIDVESFSSPLFHKDLSSSSPRITLQRSVSRKGSPRSNNERKL  69

Query  672  PNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGAN--PLESKTM  499
             + +A  ++   + P++ L G+ TPEKP  +      DH+   +  A   +  PL   T+
Sbjct  70   -HCDANGNDKETSFPQSPLRGSSTPEKPSTL---GSIDHAGTTSTTATAVSASPLHQITV  125

Query  498  AAGG----------KRFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLS  364
                          +RFGF R S       SW+LDP++I+ FFATLSSMG+++LI  +LS
Sbjct  126  TTAAPATISDQSRERRFGFSRKSSFKRSHTSWMLDPKKIVLFFATLSSMGSILLIIFTLS  185

Query  363  VGKY-SGD  343
            + K  SGD
Sbjct  186  ISKSNSGD  193



>ref|XP_008441481.1| PREDICTED: uncharacterized protein LOC103485579 isoform X2 [Cucumis 
melo]
Length=202

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 102/194 (53%), Gaps = 30/194 (15%)
 Frame = -2

Query  873  EGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERFE-----KDINSNSRITLQRNLSR  709
            E    QK+S  S  Q NG+ ++  T  DSFV+DM  F      K+  +N RITLQRN SR
Sbjct  19   ETRNSQKISVCS--QPNGVHYS--TNSDSFVIDMNGFSSNGGTKESTTNPRITLQRNSSR  74

Query  708  KGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVV-----------VGAGA  562
            KGSQ R  +K I N +A +D   ++SP     GA   EK                +G   
Sbjct  75   KGSQ-RGGDKMIANNSAPIDR-DSSSPTV---GATMAEKAAGSAVAVAVGSQQDHLGVPQ  129

Query  561  DHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVL  382
             H        + A P+E   +    +R  FRRP  + W+LDP+++L  FAT+S +G++VL
Sbjct  130  VHHQITITTGSTAAPVERPIL----RRNSFRRPP-SYWMLDPKKVLLLFATVSCIGSMVL  184

Query  381  IYLSLSVGKYSGDE  340
            IY +L++GK + ++
Sbjct  185  IYFTLAIGKPNAEQ  198



>ref|XP_010434207.1| PREDICTED: uncharacterized protein LOC104718209 isoform X1 [Camelina 
sativa]
Length=197

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 95/171 (56%), Gaps = 24/171 (14%)
 Frame = -2

Query  795  PDSFV-VDMERF----EKDINSNS-RITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIAT  634
            PD FV +D+E F     KD +S+S RITLQRN+SRKGS   +  ++    +A  ++   +
Sbjct  18   PDGFVTIDVESFSHVMHKDFSSSSPRITLQRNVSRKGSPRSNNNERKLQFDANCNDKETS  77

Query  633  SPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESKTM-----AAGG------  487
             P++ L G+ TPEKP  V     A  +      A  A+PL   T+     AAG       
Sbjct  78   FPQSPLRGSSTPEKPNTVGTIDHAGTATTAATAAVSASPLHQITITTAAPAAGNMITDQN  137

Query  486  --KRFGFRRP-----SLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
              +RFGF R      S  SW+LDP++I+  FATLSSMG+++LI  +LS+ K
Sbjct  138  RERRFGFSRKSSFKRSHTSWMLDPKKIVLLFATLSSMGSILLIIFTLSISK  188



>ref|XP_010538002.1| PREDICTED: uncharacterized protein LOC104812510 isoform X1 [Tarenaya 
hassleriana]
Length=199

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 99/190 (52%), Gaps = 27/190 (14%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFV-VDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKK  676
            S  Q NG   T   K + FV +D+E F     +D+ S    T+QR+LSRKGS     +++
Sbjct  10   SPDQGNGFGCTKTEKGEGFVMIDVESFAPLLHRDLPSTPTFTMQRSLSRKGSGRNYSDRR  69

Query  675  IP-NPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPV------TIIAAGANP  517
            I  +PN          P+ +  G GTPEK    +  AG  H  P+      T +     P
Sbjct  70   IHYDPNGVEKETSMPQPQLLGVGLGTPEK----LAAAGDHHVGPIDLTATSTAVPTAGLP  125

Query  516  LESKTMAAGG------KRFGF-RRPSL----ASWILDPRRILFFFATLSSMGTLVLIYLS  370
            +   T+ AG       +R  F ++ SL     SWILDP++++ FFATLSS+G+++LI  +
Sbjct  126  VHHTTVTAGSISDQSERRLAFSKKTSLKRSPTSWILDPKKVVLFFATLSSVGSILLIIFT  185

Query  369  LSVGKYSGDE  340
            LS+ K SG++
Sbjct  186  LSMTKSSGED  195



>ref|XP_010538011.1| PREDICTED: uncharacterized protein LOC104812510 isoform X2 [Tarenaya 
hassleriana]
Length=198

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 100/190 (53%), Gaps = 28/190 (15%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFV-VDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKK  676
            S  Q NG   T   K + FV +D+E F     +D+ S    T+QR+LSRKGS     +++
Sbjct  10   SPDQGNGFGCTKTEKGEGFVMIDVESFAPLLHRDLPSTPTFTMQRSLSRKGSGRNYSDRR  69

Query  675  IP-NPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGAN------P  517
            I  +PN          P+ +L G GTPEK    +  AG  H  P+ + A          P
Sbjct  70   IHYDPNGVEKETSMPQPQ-LLGGLGTPEK----LAAAGDHHVGPIDLTATSTAVPTAGLP  124

Query  516  LESKTMAAGG------KRFGF-RRPSL----ASWILDPRRILFFFATLSSMGTLVLIYLS  370
            +   T+ AG       +R  F ++ SL     SWILDP++++ FFATLSS+G+++LI  +
Sbjct  125  VHHTTVTAGSISDQSERRLAFSKKTSLKRSPTSWILDPKKVVLFFATLSSVGSILLIIFT  184

Query  369  LSVGKYSGDE  340
            LS+ K SG++
Sbjct  185  LSMTKSSGED  194



>ref|XP_004145095.1| PREDICTED: uncharacterized protein LOC101209875 [Cucumis sativus]
 ref|XP_004153454.1| PREDICTED: uncharacterized protein LOC101220245 [Cucumis sativus]
 ref|XP_004158019.1| PREDICTED: uncharacterized protein LOC101227650 [Cucumis sativus]
Length=203

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 104/200 (52%), Gaps = 22/200 (11%)
 Frame = -2

Query  903  SRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERFE-----KDINSNS  739
            S  + L    E    QK+S  S  Q NG+ ++  T  DSFV+DM  F      K+  +N 
Sbjct  10   STHRELNPSEETRNSQKISVCS--QSNGVHYS--TNSDSFVIDMNGFSSNGGTKESTTNP  65

Query  738  RITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGAD  559
            RITLQRN SRKG Q R  +K I N +A +D   ++                 V VG+  D
Sbjct  66   RITLQRNSSRKGPQ-RGGDKMIANNSAPIDRDSSSPTVGATMAEKAAGPAAAVAVGSQQD  124

Query  558  H------SAPVTIIAAG-ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSS  400
            H         +TI     A P+E   +    +R  FRRP  +SW+LDP+++L  FAT+S 
Sbjct  125  HLGVPQVHHQITITTGNTAAPVERAIL----RRNSFRRPP-SSWMLDPKKVLLLFATVSC  179

Query  399  MGTLVLIYLSLSVGKYSGDE  340
            +G++VLIY +L++GK + ++
Sbjct  180  IGSMVLIYFTLAIGKPNAEQ  199



>ref|XP_010052438.1| PREDICTED: uncharacterized protein LOC104441128 isoform X2 [Eucalyptus 
grandis]
 gb|KCW76427.1| hypothetical protein EUGRSUZ_D00816 [Eucalyptus grandis]
Length=201

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 106/207 (51%), Gaps = 52/207 (25%)
 Frame = -2

Query  864  GGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERFE-------KDINSNSRITLQRNLSRK  706
            G QK++ S DH +NGLP     K D  V+DME F        KDINS  RIT  R+LSRK
Sbjct  2    GTQKITVS-DH-MNGLP---ADKSDDLVIDMESFSHLVPPPCKDINS--RIT--RSLSRK  52

Query  705  GSQMRSVEKKIPNPNAAVDN------LIATS---------PRAVLHGAGTPEKPMVVVVG  571
            GSQ    +K I NP+AA  N      ++ATS         PRA L G+ + +   +  +G
Sbjct  53   GSQRVGEDKVISNPSAADKNDSQPGIVLATSSPRGTPRGTPRASLLGSNSMDTATMAAIG  112

Query  570  AGADHSAP------VTIIAAGANPLESKTMAAGGKRFGFRRPSLAS----WILDPRRILF  421
               DH++       +T+              A   RF  RR S       WILDP+RILF
Sbjct  113  T-TDHTSKLQNHHQITVTTGSIG-------TANESRFTIRRNSFRRSSSSWILDPKRILF  164

Query  420  FFATLSSMGTLVL---IYLSLSVGKYS  349
             FATLSSMGT++L   IY +LS+ K S
Sbjct  165  IFATLSSMGTILLIYFIYFTLSISKSS  191



>ref|XP_004511337.1| PREDICTED: uncharacterized protein LOC101502614 isoform X3 [Cicer 
arietinum]
 ref|XP_004511338.1| PREDICTED: uncharacterized protein LOC101502614 isoform X4 [Cicer 
arietinum]
Length=209

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 113/214 (53%), Gaps = 38/214 (18%)
 Frame = -2

Query  921  VMEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERFEKDIN--  748
            +++  +S   G G   E    Q+++ S DH +N   +T G K DSFV+DM+ +   IN  
Sbjct  7    LVDLSSSCYYGCGDGIEMEQKQRITES-DH-MNAFQYT-GDKVDSFVIDMDAYSSGINKD  63

Query  747  ---SNSRITLQRNLSRKGSQMRSVEKK-------------IPNPNAAVDNLIA-TSPRAV  619
               +NSRIT  R+LSRKGSQ R  ++K             I N N   D + A  SP+  
Sbjct  64   ATNTNSRIT--RSLSRKGSQ-RVGDRKLNGITTLSPHSHDINNNNNNKDAISALCSPKGT  120

Query  618  LHG-AGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWIL  442
            L G   TP+K   + VG+  DH    T         E+K++    +R  F R S +S  L
Sbjct  121  LTGSCSTPDKAASMAVGS-TDHFINTT-------ATETKSIT---RRNSFIRSS-SSCPL  168

Query  441  DPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            DP+R+L FFATLSSMGT++LIY +L   K + D+
Sbjct  169  DPKRVLIFFATLSSMGTMLLIYFTLITNKQNEDQ  202



>gb|KHG23122.1| WD repeat-containing 70 [Gossypium arboreum]
Length=153

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 81/153 (53%), Gaps = 23/153 (15%)
 Frame = -2

Query  765  FEKDINSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDN----LIATSPRAVLHGAGTP  598
              K+IN N RIT  ++LSRKGS MR  +KKI   N    N     +ATSP+    G+ T 
Sbjct  9    LNKEINQNPRIT--KSLSRKGS-MRG-DKKIITSNCTNSNDKDFFVATSPK----GSNTV  60

Query  597  EKPMVVVVGAG-------ADHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILD  439
            EKP  V VG+          H   +T     A P    ++           P    W+LD
Sbjct  61   EKPTTVSVGSTDRTNNPQVHHQITITTGNIKAPPDSRFSLLRRSNSRRSSSP----WVLD  116

Query  438  PRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            P+RILF FATLSSMGT++LIY +LS+GK  GDE
Sbjct  117  PKRILFLFATLSSMGTILLIYFTLSIGKTDGDE  149



>gb|KHG07287.1| Glutaminase [Gossypium arboreum]
Length=274

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 113/253 (45%), Gaps = 80/253 (32%)
 Frame = -2

Query  873  EGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF-----EKDINSNSRITLQRNLSR  709
            E    QK+S   DH  NG  +T+  + DSFV++ME F      K++N NSRIT  R+LSR
Sbjct  23   EKTSTQKISVL-DH-TNGFQYTTD-QSDSFVINMESFSHGGFNKEVNPNSRIT--RSLSR  77

Query  708  KGSQMRSVEKKIPNPNAA--VDNLIAT-SPR---AVLHGAGTPEKP--------------  589
            KGSQ    +  IPN   +  +D+L++T SPR   ++ H    P  P              
Sbjct  78   KGSQRGDKKTIIPNHTNSNDMDSLVSTSSPRDGNSLAHHQPGPTSPPGFSSHLVQVQILE  137

Query  588  ----MVVVVGAGADHSA--------------------------PVTIIAAGANPLES---  508
                ++V + +    SA                          P T++A   +P      
Sbjct  138  RMSFLLVALFSWMQSSACMPVSSHYFGIIETAIALVGSSMPEKPRTVVAGATDPATDPAT  197

Query  507  -------------KTMAAGGKRFGFRRPSL----ASWILDPRRILFFFATLSSMGTLVLI  379
                            AA   RF  RR S       W+LDP+RIL  FATLSSMGT++LI
Sbjct  198  NQQVHHQITITTGNIAAATESRFSLRRNSFRRYPPPWLLDPKRILMLFATLSSMGTILLI  257

Query  378  YLSLSVGKYSGDE  340
            Y +LS+ K +GDE
Sbjct  258  YFTLSISKMNGDE  270



>gb|KGN64553.1| hypothetical protein Csa_1G064750 [Cucumis sativus]
Length=240

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 104/200 (52%), Gaps = 22/200 (11%)
 Frame = -2

Query  903  SRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERFE-----KDINSNS  739
            S  + L    E    QK+S  S  Q NG+ ++  T  DSFV+DM  F      K+  +N 
Sbjct  47   STHRELNPSEETRNSQKISVCS--QSNGVHYS--TNSDSFVIDMNGFSSNGGTKESTTNP  102

Query  738  RITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGAD  559
            RITLQRN SRKG Q R  +K I N +A +D   ++                 V VG+  D
Sbjct  103  RITLQRNSSRKGPQ-RGGDKMIANNSAPIDRDSSSPTVGATMAEKAAGPAAAVAVGSQQD  161

Query  558  H------SAPVTIIAAG-ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSS  400
            H         +TI     A P+E   +    +R  FRRP  +SW+LDP+++L  FAT+S 
Sbjct  162  HLGVPQVHHQITITTGNTAAPVERAIL----RRNSFRRPP-SSWMLDPKKVLLLFATVSC  216

Query  399  MGTLVLIYLSLSVGKYSGDE  340
            +G++VLIY +L++GK + ++
Sbjct  217  IGSMVLIYFTLAIGKPNAEQ  236



>ref|XP_006449100.1| hypothetical protein CICLE_v10016643mg [Citrus clementina]
 gb|ESR62340.1| hypothetical protein CICLE_v10016643mg [Citrus clementina]
Length=218

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 81/157 (52%), Gaps = 23/157 (15%)
 Frame = -2

Query  837  DHQINGLPFTSGTKPDSFVVDMERFEKDIN------SNSRITLQRNLSRKGSQ---MRSV  685
            DH +NG  + +  K D+FV+DM+ F   IN      +NSRITLQ++LSRKGSQ     + 
Sbjct  24   DH-VNGFHYNALKKSDNFVIDMDAFSHGINKDSTNNANSRITLQKSLSRKGSQRGGCGAE  82

Query  684  EKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESK  505
            +K   N N     L A+SPR    G GTPEKP    +G     S  +  +          
Sbjct  83   KKSNSNANDRDATLAASSPR----GPGTPEKPAGAAIG-----STDIPQVHHQITITTGN  133

Query  504  TMAAGGKRFGFRRPSLA----SWILDPRRILFFFATL  406
             +     + GF+R SL     SW +DP+R+L FFATL
Sbjct  134  IITTPDSKSGFKRNSLKRSSHSWAIDPKRVLLFFATL  170



>ref|XP_009137183.1| PREDICTED: uncharacterized protein LOC103861223 isoform X2 [Brassica 
rapa]
Length=195

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 99/175 (57%), Gaps = 24/175 (14%)
 Frame = -2

Query  813  FTSGTKPDSFV-VDMERF----EKDINSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVD  649
            F +   PD +V +D+E F     KD +S+S I + R++SRK S   + E+K+ + NA  +
Sbjct  16   FHTPVNPDGYVTIDVESFSHVIHKDFSSSSPI-VTRSVSRKESLRSNNERKL-HSNANGN  73

Query  648  NLIATSPRAVLHGAGTPEKPMVV--VVGAGADHSAPVTIIAAGANPLESKTMAAGGK---  484
            +   +SP++ + G+ TPEK   V  +   G D +A   + A+  + +   T +A G+   
Sbjct  74   DKETSSPQSPVRGSCTPEKASTVRPIDHVGTDTTAATIVSASPLHQITVTTTSATGRNMI  133

Query  483  -------RFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
                   RFGF R S       SW+LDP++IL FFATLSSMG+++LI  +LS+ K
Sbjct  134  SEQNRERRFGFARKSSFKRSRTSWMLDPKKILIFFATLSSMGSILLIIFTLSISK  188



>gb|KEH43929.1| transmembrane protein, putative [Medicago truncatula]
Length=208

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 109/205 (53%), Gaps = 21/205 (10%)
 Frame = -2

Query  918  MEAENSRSKGLGKEFEGNGGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF----EKDI  751
            ++  +S  + L  E    G Q++  S DH IN   ++S  K DSFV+DM+ F     KDI
Sbjct  12   LDLVSSSCEALESEQMKIGSQRILVS-DH-INAYQYSSE-KVDSFVIDMDSFSSTINKDI  68

Query  750  -NSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIA---TSPRAVLHGAGTPEKPMV  583
             N+NSR T  R+LSRKGSQ R  ++ +       D  I     SP+A L G+    K  V
Sbjct  69   INANSRTT--RSLSRKGSQ-RGGDRNVSGNVTLQDKDIVPTTCSPKAALLGSC---KSTV  122

Query  582  VVVGAGADHSAPVT----IIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFF  415
            V VG+  + + P      I    A+ + +                 +SW+LDP+++L  F
Sbjct  123  VPVGSTQNSTNPQQVHHQITVTTASNMCNTNAENKSITRRSSFGRSSSWLLDPKKVLLVF  182

Query  414  ATLSSMGTLVLIYLSLSVGKYSGDE  340
            ATLSS+GTL+LI+L+LS+ K++G E
Sbjct  183  ATLSSVGTLLLIFLTLSISKHNGVE  207



>ref|XP_002867859.1| hypothetical protein ARALYDRAFT_492760 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44118.1| hypothetical protein ARALYDRAFT_492760 [Arabidopsis lyrata subsp. 
lyrata]
Length=199

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 97/179 (54%), Gaps = 30/179 (17%)
 Frame = -2

Query  813  FTSGTKPDSFV-VDMERF----EKDINSNS-RITLQRNLSRKGSQMRSVEKKIPNPNAAV  652
            F     PD FV +D+E F     KD +S+S RITLQRN+SRKGS   + E+K+   +A  
Sbjct  16   FQKPVNPDGFVTIDVESFSNVIHKDFSSSSPRITLQRNVSRKGSPRSNNERKL-QFDANG  74

Query  651  DNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGAN--PLESK---------  505
            ++   + P++ L G+ TPEKP +V      +H+   T  A   +  PL            
Sbjct  75   NDKETSFPQSPLRGSSTPEKPSIV---GPTEHAGTATSAATAVSASPLHQITITTAATAA  131

Query  504  ----TMAAGGKRFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
                T     +RFGF R S       SW+LDP++I+ FFATLSSMG+++LI  +LS+ K
Sbjct  132  GNMITDQNRERRFGFSRKSSFKRSHTSWMLDPKKIVLFFATLSSMGSILLIIFTLSISK  190



>emb|CDY58477.1| BnaA03g58480D [Brassica napus]
Length=195

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 100/176 (57%), Gaps = 26/176 (15%)
 Frame = -2

Query  813  FTSGTKPDSFV-VDMERF----EKDINSNS-RITLQRNLSRKGSQMRSVEKKIPNPNAAV  652
            F +   PD +V +D+E F     KD +S+S R+T  R++SRK S   + E+K+ + NA  
Sbjct  16   FHTPVNPDGYVTIDVESFSHVIHKDFSSSSPRVT--RSVSRKESLRSNNERKL-HSNANG  72

Query  651  DNLIATSPRAVLHGAGTPEKPMVV--VVGAGADHSAPVTIIAAGANPLESKTMAAGG---  487
            ++   +SP++ + G+ TPEK   V  +   G D +A   + A+  + +   T +A G   
Sbjct  73   NDKETSSPQSPVRGSCTPEKASTVRPIDHVGTDTTAATIVSASPLHQITVTTTSATGGNM  132

Query  486  -------KRFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
                   +RFGF R S       SW+LDP++IL FFATLSSMG+++LI  +LS+ K
Sbjct  133  ISEQNRERRFGFARKSSFKRSRTSWMLDPKKILIFFATLSSMGSILLIIFTLSISK  188



>ref|XP_010240932.1| PREDICTED: uncharacterized protein LOC104585675 isoform X2 [Nelumbo 
nucifera]
Length=239

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 86/178 (48%), Gaps = 35/178 (20%)
 Frame = -2

Query  804  GTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQ-----MRSVEKKIPNPNAAV  652
            G + +SFV+DME      EKD+ +NSRITLQR+LSRKGSQ     M +    I       
Sbjct  53   GDRSESFVLDMESLARSTEKDVTANSRITLQRSLSRKGSQREERKMTATLSSISTSERGD  112

Query  651  DNLIA-------------TSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLE  511
              ++A             T  + ++  + T +K  VV +G     + P  +I      + 
Sbjct  113  STIVASADDDSNKGAAATTEAQGLIECSTTAKKTTVVAMGT----TEP--MINGQQGQMM  166

Query  510  SKTMAAGGKRFGFRRPSLAS-------WILDPRRILFFFATLSSMGTLVLIYLSLSVG  358
               M    K   F R +          W LDPRR++ FFATLSSMGT++LIY +LS+ 
Sbjct  167  MMMMNNNNKLESFNRCNSRRYSGRRSSWFLDPRRVVVFFATLSSMGTILLIYFTLSIS  224



>ref|XP_010240931.1| PREDICTED: uncharacterized protein LOC104585675 isoform X1 [Nelumbo 
nucifera]
Length=240

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 86/179 (48%), Gaps = 36/179 (20%)
 Frame = -2

Query  804  GTKPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQ-----MRSVEKKIPNPNAAV  652
            G + +SFV+DME      EKD+ +NSRITLQR+LSRKGSQ     M +    I       
Sbjct  53   GDRSESFVLDMESLARSTEKDVTANSRITLQRSLSRKGSQREERKMTATLSSISTSERGD  112

Query  651  DNLIA--------------TSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPL  514
              ++A              T  + ++  + T +K  VV +G     + P  +I      +
Sbjct  113  STIVASADDDSNKAGAAATTEAQGLIECSTTAKKTTVVAMGT----TEP--MINGQQGQM  166

Query  513  ESKTMAAGGKRFGFRRPSLAS-------WILDPRRILFFFATLSSMGTLVLIYLSLSVG  358
                M    K   F R +          W LDPRR++ FFATLSSMGT++LIY +LS+ 
Sbjct  167  MMMMMNNNNKLESFNRCNSRRYSGRRSSWFLDPRRVVVFFATLSSMGTILLIYFTLSIS  225



>ref|NP_974583.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH19544.1| AT4G21215 [Arabidopsis thaliana]
 gb|AEE84427.1| uncharacterized protein AT4G21215 [Arabidopsis thaliana]
Length=199

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 93/170 (55%), Gaps = 24/170 (14%)
 Frame = -2

Query  795  PDSFV-VDMERF----EKDINSNS-RITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIAT  634
            PD FV +D+E F     KD +S+S RITLQRN+SRKGS   + E+K+       D  I+ 
Sbjct  22   PDGFVTIDVESFSNVIHKDFSSSSPRITLQRNVSRKGSPRSNNERKLHFDANGNDKEISF  81

Query  633  SPRAVLHGAGTPEKPMVV--VVGAGADHSAPVTIIAAGANPLESK----------TMAAG  490
             P++ L G+ TPEK   V     AG   +A   + A+  + +             T    
Sbjct  82   -PQSPLRGSSTPEKASTVGPTEHAGTATTAATAVSASPLHQITVTTAATAAGNMITDQNR  140

Query  489  GKRFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
             +RFGF R S       SW+LDP++I+ FFATLSSMG+++LI  +LS+ K
Sbjct  141  ERRFGFSRKSSFKRSHTSWMLDPKKIVLFFATLSSMGSILLIIFTLSISK  190



>ref|XP_010538020.1| PREDICTED: uncharacterized protein LOC104812510 isoform X3 [Tarenaya 
hassleriana]
Length=197

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 95/188 (51%), Gaps = 25/188 (13%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFV-VDMERFEKDINSN--SRITLQRNLSRKGSQMRSVEKKIP  670
            S  Q NG   T   K + FV +D+E F   ++ +  S  T  R+LSRKGS     +++I 
Sbjct  10   SPDQGNGFGCTKTEKGEGFVMIDVESFAPLLHRDLPSTPTFTRSLSRKGSGRNYSDRRIH  69

Query  669  -NPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGAN------PLE  511
             +PN          P+ +  G GTPEK    +  AG  H  P+ + A          P+ 
Sbjct  70   YDPNGVEKETSMPQPQLLGVGLGTPEK----LAAAGDHHVGPIDLTATSTAVPTAGLPVH  125

Query  510  SKTMAAGG------KRFGFRRP-----SLASWILDPRRILFFFATLSSMGTLVLIYLSLS  364
              T+ AG       +R  F +      S  SWILDP++++ FFATLSS+G+++LI  +LS
Sbjct  126  HTTVTAGSISDQSERRLAFSKKTSLKRSPTSWILDPKKVVLFFATLSSVGSILLIIFTLS  185

Query  363  VGKYSGDE  340
            + K SG++
Sbjct  186  MTKSSGED  193



>ref|XP_009108501.1| PREDICTED: uncharacterized protein LOC103834197 [Brassica rapa]
 ref|XP_009108502.1| PREDICTED: uncharacterized protein LOC103834197 [Brassica rapa]
Length=196

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 93/182 (51%), Gaps = 27/182 (15%)
 Frame = -2

Query  831  QINGLPFTSGTKPDSFV-VDMERFEKDINSN--SRITLQRNLSRKGSQMRSVEKKIPNPN  661
            Q  G  F    KPD FV +D+E F   ++++  S   L R++SRKGS   + E+K+   +
Sbjct  10   QETGSGFQKPVKPDGFVTIDVESFSPVLHTDFFSSSPLHRSVSRKGSSRNNNERKLHGDS  69

Query  660  AAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTI--IAAGANPLESKTMAAGG  487
             + D   +  P+  L G+  PEKP  V      DH+  VT    A  ++PL   T+    
Sbjct  70   NSNDKETSF-PQIPLRGSSAPEKPSTV---GPIDHAGTVTTANTAVPSSPLHQITITTSA  125

Query  486  -------------KRFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLSV  361
                         +RFGF R S       SW+L+P++IL F ATLSSMG+++LI  +LS+
Sbjct  126  ATAGNMISDQNKERRFGFARKSSFKRSHTSWMLNPKKILLFCATLSSMGSILLIIFTLSI  185

Query  360  GK  355
             K
Sbjct  186  SK  187



>ref|XP_010434208.1| PREDICTED: uncharacterized protein LOC104718209 isoform X2 [Camelina 
sativa]
Length=195

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 93/171 (54%), Gaps = 26/171 (15%)
 Frame = -2

Query  795  PDSFV-VDMERF----EKDINSNS-RITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIAT  634
            PD FV +D+E F     KD +S+S RIT  RN+SRKGS   +  ++    +A  ++   +
Sbjct  18   PDGFVTIDVESFSHVMHKDFSSSSPRIT--RNVSRKGSPRSNNNERKLQFDANCNDKETS  75

Query  633  SPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESKTM-----AAGG------  487
             P++ L G+ TPEKP  V     A  +      A  A+PL   T+     AAG       
Sbjct  76   FPQSPLRGSSTPEKPNTVGTIDHAGTATTAATAAVSASPLHQITITTAAPAAGNMITDQN  135

Query  486  --KRFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
              +RFGF R S       SW+LDP++I+  FATLSSMG+++LI  +LS+ K
Sbjct  136  RERRFGFSRKSSFKRSHTSWMLDPKKIVLLFATLSSMGSILLIIFTLSISK  186



>ref|XP_009134573.1| PREDICTED: uncharacterized protein LOC103858880 [Brassica rapa]
 ref|XP_009134580.1| PREDICTED: uncharacterized protein LOC103858880 [Brassica rapa]
 emb|CDX79047.1| BnaA01g11140D [Brassica napus]
Length=200

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 96/183 (52%), Gaps = 25/183 (14%)
 Frame = -2

Query  831  QINGLPFTSGTKPDSFV-VDMERF----EKDINSNS-RITLQRNLSRKGSQMRSVEKKIP  670
            Q  G  +     PD FV +D+E F     KD +S+S RITLQR++SRKGS   +  ++  
Sbjct  10   QETGSGYQPPVNPDGFVTIDVESFTPVFNKDFSSSSPRITLQRSVSRKGSPRSNNNERKL  69

Query  669  NPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESKTMAAG  490
            + +A  ++   + P++ L G  TPEK M +V       +   T  A  A+PL   T+   
Sbjct  70   HCDANGNDSETSFPQSPLRGTSTPEK-MSIVGSTDNAGTPTATATAVSASPLHQITITTA  128

Query  489  G-------------KRFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLS  364
                          +RFGF R S       SW+ DP++++ FFATLSSMG+++LI  +LS
Sbjct  129  AATAGNMISDQNRERRFGFARKSSFKRSHTSWLFDPKKVVLFFATLSSMGSILLIIFTLS  188

Query  363  VGK  355
            + K
Sbjct  189  ISK  191



>ref|XP_006282720.1| hypothetical protein CARUB_v10005753mg [Capsella rubella]
 gb|EOA15618.1| hypothetical protein CARUB_v10005753mg [Capsella rubella]
Length=204

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 98/192 (51%), Gaps = 30/192 (16%)
 Frame = -2

Query  831  QINGLPFTSGTKPDSFV-VDMERF----EKDINSNS-RITLQRNLSRKGS---QMRSVEK  679
            Q  G  F +   PD FV +D+E F     KD +S+S RITLQRN+SRKGS      + E+
Sbjct  10   QETGSGFQNTVNPDGFVTIDVESFSHVMHKDFSSSSPRITLQRNVSRKGSPRSNNNNNER  69

Query  678  KIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESK--  505
            K+       D  ++  P++ L G+ TPEKP  V     A  +      A   +PL     
Sbjct  70   KLQCDANGNDKELSL-PQSPLRGSSTPEKPNTVGSTDHAGTATTAATSAVSVSPLHQITI  128

Query  504  -----------TMAAGGKRFGFRRPSL------ASWILDPRRILFFFATLSSMGTLVLIY  376
                       T     +RFGF R S        SW+LDP++I+ FFATLSSMG+++LI 
Sbjct  129  TTAAAAAGNMITDQNRERRFGFSRKSSSFKRSNTSWMLDPKKIVLFFATLSSMGSILLII  188

Query  375  LSLSVGK-YSGD  343
             +LS+ K  SGD
Sbjct  189  FTLSISKSNSGD  200



>emb|CDX94030.1| BnaC07g36640D [Brassica napus]
Length=195

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 96/173 (55%), Gaps = 32/173 (18%)
 Frame = -2

Query  795  PDSFV-VDMERF----EKDINSNS-RITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIAT  634
            PD +V +D+E F     KDI+S+S R+T  R++SRK S   + E+K+ + NA  ++   +
Sbjct  22   PDGYVTIDVESFSHVIHKDISSSSPRVT--RSVSRKESLRSNNERKL-HSNANGNDKETS  78

Query  633  SPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAA--GANPLESKTMAAGG---------  487
            SP++ L G+ TPEK   V      DH    TI A    A+PL   T+             
Sbjct  79   SPQSPLRGSCTPEKASTV---RPIDHVGTDTIAATIVSASPLHQITVTTTAATGGNVISD  135

Query  486  ----KRFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
                +RFGF R S       SW+LDP++IL FFATLSSMG+++LI  +LS+ K
Sbjct  136  QNRERRFGFARKSSFKRSRTSWMLDPKKILIFFATLSSMGSILLIIFTLSISK  188



>emb|CDX82813.1| BnaC01g12630D [Brassica napus]
Length=200

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 95/183 (52%), Gaps = 25/183 (14%)
 Frame = -2

Query  831  QINGLPFTSGTKPDSFV-VDMERF----EKDINSNS-RITLQRNLSRKGSQMRSVEKKIP  670
            Q  G  +     PD FV +D+E F     KD +S+S RITLQR++SRKGS   +  ++  
Sbjct  10   QETGSGYQPPVNPDGFVTIDVESFTPVFNKDFSSSSPRITLQRSVSRKGSPRSNNNERKL  69

Query  669  NPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESKTMAAG  490
              +A  ++   + P++ L G  TPEK M +V       +   T  A  A+PL   T+   
Sbjct  70   YCDANGNDSETSFPQSPLRGTSTPEK-MSIVGSTDNAGTPTATATAVSASPLHQITITTA  128

Query  489  G-------------KRFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLS  364
                          +RFGF R S       SW+ DP++++ FFATLSSMG+++LI  +LS
Sbjct  129  AATAGNMISDQSRERRFGFARKSSFKRSHTSWVFDPKKVVLFFATLSSMGSILLIIFTLS  188

Query  363  VGK  355
            + K
Sbjct  189  ISK  191



>gb|AES93616.2| transmembrane protein, putative [Medicago truncatula]
Length=220

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 99/192 (52%), Gaps = 32/192 (17%)
 Frame = -2

Query  858  QKLSSSSDHQINGLPFTSGTKPDSFVVDMER-----FEKD--INSNSRIT--LQRNLSRK  706
            Q++S S    +NG  + +  K DS+V+DM+        KD   N+N RIT  LQR+LSRK
Sbjct  31   QRMSVSVSDHMNGFQYPT-EKFDSYVIDMDAAFSSGINKDSSANANPRITKGLQRSLSRK  89

Query  705  GSQMRSVEKKIPNPNAA----VDNLIATSPRAVLHGAGTPEKPMVVVVGAGA-DHS----  553
            GSQ R V++K+   +      ++N  A S      G+ TP       + AG+ DHS    
Sbjct  90   GSQ-RGVDRKVNGLSMLQVHDINNKDAISALCSPLGSCTP-----TAMAAGSPDHSINPH  143

Query  552  --APVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLI  379
                + II           +    +R  F R S  SW LDP+R+L FFATLSSMGT++LI
Sbjct  144  NHHQINIIGTTTATTGESRLT---RRNSFIRSS--SWTLDPKRVLIFFATLSSMGTMLLI  198

Query  378  YLSLSVGKYSGD  343
            Y +L   K + D
Sbjct  199  YFTLISNKQNFD  210



>emb|CDX76424.1| BnaA08g09760D [Brassica napus]
Length=205

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 93/191 (49%), Gaps = 36/191 (19%)
 Frame = -2

Query  831  QINGLPFTSGTKPDSFV-VDMERF----EKDINSNSRIT-------LQRNLSRKGSQMRS  688
            Q  G  F    KPD FV +D+E F      D  S+S +        L R++SRKGS   +
Sbjct  10   QETGFGFQKPVKPDGFVTIDVESFSPVLHTDFFSSSPVNNLSFFLKLHRSVSRKGSSRNN  69

Query  687  VEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTI--IAAGANPL  514
             E+K+   + + D   +  P+  L G+  PEKP  V      DH+  VT    A  ++PL
Sbjct  70   NERKLHGDSNSNDKETSF-PQIPLRGSSAPEKPSTV---GPIDHAGTVTTANTAVPSSPL  125

Query  513  ESKTMAAGG-------------KRFGFRRPS-----LASWILDPRRILFFFATLSSMGTL  388
               T+                 +RFGF R S       SW+L+P++IL F ATLSSMG++
Sbjct  126  HQITITTSAATAGNMISDQNKERRFGFARKSSFKRSHTSWMLNPKKILLFCATLSSMGSI  185

Query  387  VLIYLSLSVGK  355
            +LI  +LS+ K
Sbjct  186  LLIIFTLSISK  196



>ref|XP_004496780.1| PREDICTED: uncharacterized protein LOC101508033 isoform X2 [Cicer 
arietinum]
Length=193

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 101/189 (53%), Gaps = 34/189 (18%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERF-----EKDINSNSRITLQRNLSRKGSQMRSVEKK  676
            SDH IN   ++S  K DSFV+DM+ F     + +IN+NSR T QR+LSRKGSQ       
Sbjct  11   SDH-INACQYSS-EKVDSFVIDMDSFSSSINKDNINANSRTTFQRSLSRKGSQRWGDRNV  68

Query  675  IPNPNAAVDNL-------IATSPRAVLHGAGTPEKPMVVVVGAGAD---------HSAPV  544
            I N N  VD L          SP+A L G+    K  V   G+  +         H   V
Sbjct  69   IVNGN--VDTLNDKDTVPTTYSPKAALVGSC---KSTVTAAGSTQNSTNSQQQVHHQITV  123

Query  543  TIIAAGANP-LESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSL  367
            T      N   E+K +    +R  F R S  SW+LDP+++L  FATLSS+GTL+LIYL+L
Sbjct  124  TASNNMCNTNTENKCIT---RRNSFGRSS--SWLLDPKKVLLAFATLSSVGTLLLIYLTL  178

Query  366  SVGKYSGDE  340
            ++ K +G E
Sbjct  179  TISKQNGAE  187



>gb|KGN49136.1| hypothetical protein Csa_6G515450 [Cucumis sativus]
Length=194

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 82/165 (50%), Gaps = 28/165 (17%)
 Frame = -2

Query  813  FTSGTKPDSFVVDMERF-EKDINSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIA  637
            F   TK DSF++DM+    K+I+ NSRI+  RN SRKG  M     KI   N   D    
Sbjct  34   FQYNTKSDSFIIDMDNLSNKEISHNSRIS--RNFSRKG--MLRGGNKIGQDNGDGDEAGG  89

Query  636  TSPRAVLHG-AGTPEKPMVV-----VVGAGADHSAPVTIIAAGANPLESKTMAAGGKRFG  475
             S   +  G + T EK  VV     VVGA +  +A           + S   ++G ++  
Sbjct  90   ESISPIGGGGSSTLEKQAVVGREELVVGALSHETA-----------ISSTQRSSGAEKLS  138

Query  474  FRRPSL------ASWILDPRRILFFFATLSSMGTLVLIYLSLSVG  358
             RR S        SW LDPR+I  F ATLS +GT++LIYL+ S G
Sbjct  139  MRRNSFKRSTQPCSWYLDPRKIFLFCATLSCVGTMLLIYLTFSSG  183



>ref|XP_006573893.1| PREDICTED: uncharacterized protein LOC100816371 isoform X3 [Glycine 
max]
Length=186

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 85/148 (57%), Gaps = 18/148 (12%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERF----EKD-INSNSRITLQRNLSRKGSQMRSVEKK  676
            SDH IN   + +  K DSFV+DM+ F     KD  N+NSRITLQR+LSRKGSQ R  + K
Sbjct  32   SDH-INAFQY-ADEKADSFVIDMDAFSSGHNKDATNANSRITLQRSLSRKGSQ-RLGDWK  88

Query  675  IPNPNAAV---DNLIA-TSPRAVLHGAGTPEKPMVVVVGA-GADHSAPVTIIAAGANPLE  511
            + N NA +   D + A  SP+  L G  TPEKP  + VG  G   +  V  + A   P E
Sbjct  89   L-NNNATLYDKDTVPAICSPKGTLVGPFTPEKPAGMAVGPMGHSMNPHVHNLTADNIPTE  147

Query  510  SKTMAAGGKRFGFRRPSLASWILDPRRI  427
            SK      +R  FRRPS  SW +DP+R+
Sbjct  148  SKCSIT--RRNSFRRPS--SWAIDPKRV  171



>ref|XP_004496779.1| PREDICTED: uncharacterized protein LOC101508033 isoform X1 [Cicer 
arietinum]
Length=222

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 101/189 (53%), Gaps = 34/189 (18%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERF-----EKDINSNSRITLQRNLSRKGSQMRSVEKK  676
            SDH IN   ++S  K DSFV+DM+ F     + +IN+NSR T QR+LSRKGSQ       
Sbjct  40   SDH-INACQYSS-EKVDSFVIDMDSFSSSINKDNINANSRTTFQRSLSRKGSQRWGDRNV  97

Query  675  IPNPNAAVDNL-------IATSPRAVLHGAGTPEKPMVVVVGAGAD---------HSAPV  544
            I N N  VD L          SP+A L G+    K  V   G+  +         H   V
Sbjct  98   IVNGN--VDTLNDKDTVPTTYSPKAALVGSC---KSTVTAAGSTQNSTNSQQQVHHQITV  152

Query  543  TIIAAGANP-LESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSL  367
            T      N   E+K +    +R  F R S  SW+LDP+++L  FATLSS+GTL+LIYL+L
Sbjct  153  TASNNMCNTNTENKCIT---RRNSFGRSS--SWLLDPKKVLLAFATLSSVGTLLLIYLTL  207

Query  366  SVGKYSGDE  340
            ++ K +G E
Sbjct  208  TISKQNGAE  216



>ref|XP_003610658.1| hypothetical protein MTR_5g005560 [Medicago truncatula]
Length=224

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 99/196 (51%), Gaps = 36/196 (18%)
 Frame = -2

Query  858  QKLSSSSDHQINGLPFTSGTKPDSFVVDMER-----FEKD--INSNSRIT------LQRN  718
            Q++S S    +NG  + +  K DS+V+DM+        KD   N+N RIT      LQR+
Sbjct  31   QRMSVSVSDHMNGFQYPT-EKFDSYVIDMDAAFSSGINKDSSANANPRITYSDQKGLQRS  89

Query  717  LSRKGSQMRSVEKKIPNPNAA----VDNLIATSPRAVLHGAGTPEKPMVVVVGAGA-DHS  553
            LSRKGSQ R V++K+   +      ++N  A S      G+ TP       + AG+ DHS
Sbjct  90   LSRKGSQ-RGVDRKVNGLSMLQVHDINNKDAISALCSPLGSCTP-----TAMAAGSPDHS  143

Query  552  ------APVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGT  391
                    + II           +    +R  F R S  SW LDP+R+L FFATLSSMGT
Sbjct  144  INPHNHHQINIIGTTTATTGESRLT---RRNSFIRSS--SWTLDPKRVLIFFATLSSMGT  198

Query  390  LVLIYLSLSVGKYSGD  343
            ++LIY +L   K + D
Sbjct  199  MLLIYFTLISNKQNFD  214



>ref|XP_010267768.1| PREDICTED: uncharacterized protein LOC104604898 [Nelumbo nucifera]
Length=229

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 95/189 (50%), Gaps = 45/189 (24%)
 Frame = -2

Query  798  KPDSFVVDMERF----EKDINSNSRITLQRNLSRKGSQM--RSVEKKIPNPN-----AAV  652
            + DSFVVDME      +KD+ +NSRITLQRNLSRKGSQ   R +   +   N      ++
Sbjct  45   RSDSFVVDMESLCRGIDKDVTANSRITLQRNLSRKGSQRGERRITATLSPINISEKAGSI  104

Query  651  DNLIAT---SPRAV-----LHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESKTMA  496
            +   AT   SP        + G+  PEK ++V V    + + P T     A  + + T  
Sbjct  105  NTTSATGDVSPSKAAGGGSMRGSIPPEKSVIVAV----ESTEPATY----AQMMNTSTAT  156

Query  495  AGGKRFGFRRPSL----------------ASWILDPRRILFFFATLSSMGTLVLIYLSLS  364
            +    +  R  S+                + +++DPR ++  FATLSSMGT++LI+ +LS
Sbjct  157  STENNYS-RSNSINISVSRRQGSRRSSTNSGFVVDPRSVVILFATLSSMGTILLIFFTLS  215

Query  363  V-GKYSGDE  340
            +    SGD+
Sbjct  216  INNNLSGDD  224



>ref|NP_680731.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84426.1| uncharacterized protein AT4G21215 [Arabidopsis thaliana]
Length=197

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 91/170 (54%), Gaps = 26/170 (15%)
 Frame = -2

Query  795  PDSFV-VDMERF----EKDINSNS-RITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIAT  634
            PD FV +D+E F     KD +S+S RIT  RN+SRKGS   + E+K+       D  I+ 
Sbjct  22   PDGFVTIDVESFSNVIHKDFSSSSPRIT--RNVSRKGSPRSNNERKLHFDANGNDKEISF  79

Query  633  SPRAVLHGAGTPEKPMVV--VVGAGADHSAPVTIIAAGANPLESK----------TMAAG  490
             P++ L G+ TPEK   V     AG   +A   + A+  + +             T    
Sbjct  80   -PQSPLRGSSTPEKASTVGPTEHAGTATTAATAVSASPLHQITVTTAATAAGNMITDQNR  138

Query  489  GKRFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
             +RFGF R S       SW+LDP++I+ FFATLSSMG+++LI  +LS+ K
Sbjct  139  ERRFGFSRKSSFKRSHTSWMLDPKKIVLFFATLSSMGSILLIIFTLSISK  188



>ref|XP_010445237.1| PREDICTED: uncharacterized protein LOC104727876 [Camelina sativa]
Length=306

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 90/176 (51%), Gaps = 26/176 (15%)
 Frame = -2

Query  810  TSGTKPDSFV-VDMERF----EKDINSNS-RITLQRNLSRKGSQMRSVEKKIPNPNAAVD  649
            T    PD FV +D+E F     KD +S+S RIT  RN+SRKGS   +  ++    +A  +
Sbjct  13   TGSVNPDGFVTIDVESFSHVMHKDFSSSSPRIT--RNVSRKGSPRSNNNERKLQFDANGN  70

Query  648  NLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESK------------  505
            +   + P++ L G+ TPEKP  V     A  +      A  A+PL               
Sbjct  71   DKETSFPQSPLRGSSTPEKPNTVGTIDHAGTATTAATAAVSASPLHQITITTAATAAGNM  130

Query  504  -TMAAGGKRFGFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
             T     +RFGF R S       SW+LDP++I+  FATLSSMG+++LI  +LS+ K
Sbjct  131  ITDQNRERRFGFSRKSSFKRSHTSWMLDPKKIVLLFATLSSMGSILLIIFTLSISK  186


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 51/104 (49%), Gaps = 18/104 (17%)
 Frame = -2

Query  612  GAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESK-------------TMAAGGKRFGF  472
            G+ TPEKP  V     A  +      A  A+PL                T     +RFGF
Sbjct  194  GSSTPEKPNTVGTIDHAGTATTAATAAVSASPLHQITITTAATAAGNMITDQNRERRFGF  253

Query  471  RRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
             R S       SW+LDP++I+  FATLSSMG+++LI  +LS+ K
Sbjct  254  SRKSSFKRSHTSWMLDPKKIVLLFATLSSMGSILLIIFTLSISK  297



>ref|XP_006449103.1| hypothetical protein CICLE_v10016643mg [Citrus clementina]
 gb|ESR62343.1| hypothetical protein CICLE_v10016643mg [Citrus clementina]
Length=170

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 75/133 (56%), Gaps = 17/133 (13%)
 Frame = -2

Query  717  LSRKGSQ---MRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAG----AD  559
            LSRKGSQ     + +K   N N     L A+SPR    G GTPEKP    +G+       
Sbjct  41   LSRKGSQRGGCGAEKKSNSNANDRDATLAASSPR----GPGTPEKPAGAAIGSTDIPQVH  96

Query  558  HSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLI  379
            H   +T       P +SK+   G KR   +R S  SW +DP+R+L FFATLSS+GT++LI
Sbjct  97   HQITITTGNIITTP-DSKS---GFKRNSLKRSS-HSWAIDPKRVLLFFATLSSLGTILLI  151

Query  378  YLSLSVGKYSGDE  340
            Y +LS+ K+S +E
Sbjct  152  YFTLSL-KHSAEE  163



>ref|XP_006467972.1| PREDICTED: uncharacterized protein LOC102624937 isoform X2 [Citrus 
sinensis]
Length=181

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 74/150 (49%), Gaps = 23/150 (15%)
 Frame = -2

Query  837  DHQINGLPFTSGTKPDSFVVDMERFEKDIN------SNSRITLQRNLSRKGSQ---MRSV  685
            DH +NG  + +  K D+FV+DM+ F   IN      +NSRITLQ++LSRKGSQ     + 
Sbjct  24   DH-VNGFHYNALKKSDNFVIDMDAFAHGINKDSTNNANSRITLQKSLSRKGSQRGGCGAE  82

Query  684  EKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESK  505
            +K   N N     L A+SPR    G  TPEKP    +G     S  +  +          
Sbjct  83   KKSNSNANDRDATLAASSPR----GPSTPEKPAGAAIG-----STDIPQVHHQITITTGN  133

Query  504  TMAAGGKRFGFRRPSLA----SWILDPRRI  427
             +     + GFRR SL     SW +DP+R+
Sbjct  134  IITTPDSKSGFRRNSLKRSSHSWAIDPKRV  163



>ref|XP_010923935.1| PREDICTED: uncharacterized protein LOC105046890 [Elaeis guineensis]
Length=180

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 80/145 (55%), Gaps = 25/145 (17%)
 Frame = -2

Query  762  EKDINSNSRITLQRNLSRKGSQMRS--VEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKP  589
            +KD  S+ R ++ +NLSRKGSQ     +E+K     AA      +SP     G G  EK 
Sbjct  53   DKDSTSSPRDSMVKNLSRKGSQRSGGRLERK-----AAEVETANSSP----GGPGGAEKT  103

Query  588  MVVVVGAGADHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPS--LASWILDPRRILFFF  415
               V  AG   S+ +         +++ T  A G R   RRPS   A W LDPRR+L FF
Sbjct  104  PAWVHVAGERESSGL---------IQATTPTASGGRC--RRPSRKQAPW-LDPRRVLVFF  151

Query  414  ATLSSMGTLVLIYLSLSVGKYSGDE  340
            ATLSSMGTL+L+Y ++S+GK +G +
Sbjct  152  ATLSSMGTLILLYFTISMGKMAGSD  176



>ref|XP_008439956.1| PREDICTED: uncharacterized protein LOC103484588 isoform X1 [Cucumis 
melo]
Length=203

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 78/168 (46%), Gaps = 24/168 (14%)
 Frame = -2

Query  813  FTSGTKPDSFVVDMERF-EKDINSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDNL--  643
            F   TK DSF++DM+    K+I+ NSRI+  RN SRKG  M     KI   N   D    
Sbjct  33   FQYNTKSDSFIIDMDNLSNKEISHNSRIS--RNFSRKG--MLRGGSKIGQDNGDGDEAGE  88

Query  642  -IATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESKT------MAAGGK  484
             I+        G+ T EK  VV    G +          G   L  +T       + G +
Sbjct  89   SISPLGGGGGGGSSTLEKQAVV----GREELVVGGSGGVGVGALSHETAISSTQWSVGAE  144

Query  483  RFGFRR------PSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVG  358
            +   RR      P   SW LDPR+I  F ATLS +GT++LIYL+ S G
Sbjct  145  KLSIRRNSFKRSPQPCSWYLDPRKIFLFCATLSCVGTMLLIYLTFSSG  192



>gb|KHN02674.1| hypothetical protein glysoja_015916 [Glycine soja]
Length=192

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 86/182 (47%), Gaps = 47/182 (26%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERFEKDI-----NSNSRITLQRNLSRKGSQMRSVEKK  676
            SDH  NG  + S  + DSFV+DM+ F   I     N+NSRIT  R+LSRKGSQ R  ++K
Sbjct  36   SDH-TNGYQY-SAEEADSFVIDMDSFSSGINKDSNNANSRIT--RSLSRKGSQ-RGGDRK  90

Query  675  IPNPNAAVDNL----IATSPRAVLHGAGTPEKPMVVVVGAGADHSA------PVTIIAAG  526
            + N N  + +        SP+A L G+ T EK  VV VG+   HS        +TI A+ 
Sbjct  91   V-NGNVTLHDRDTAPTTCSPKAALAGSCTAEKSAVVAVGS-THHSTNTQVHHQITITASN  148

Query  525  ANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSG  346
                    M          R                   +SSMGT++LIY +L++ K + 
Sbjct  149  --------MCTTTPTHPHHRKQ-----------------MSSMGTMLLIYFTLTLSKQNA  183

Query  345  DE  340
            DE
Sbjct  184  DE  185



>ref|XP_010449101.1| PREDICTED: uncharacterized protein LOC104731424 [Camelina sativa]
Length=171

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 78/159 (49%), Gaps = 24/159 (15%)
 Frame = -2

Query  810  TSGTKPDSFV-VDMERF----EKDINSNS-RITLQRNLSRKGSQMRSVEKKIPNPNAAVD  649
            T    PD FV +D+E F     KD +S+S RITLQRN+SRKGS   +  ++    +A  +
Sbjct  13   TGSVNPDGFVTIDVESFSHVMHKDFSSSSPRITLQRNVSRKGSPRSNNNERKLQFDANGN  72

Query  648  NLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESK------------  505
            +   + P++ L G+ TPEKP  V     A  +      A  A+PL               
Sbjct  73   DKETSFPQSPLRGSSTPEKPNTVGTIDHAGTATTAATAAVSASPLHQITITTAATAAGNM  132

Query  504  -TMAAGGKRFGFRRP-----SLASWILDPRRILFFFATL  406
             T     +RFGF R      S  SW+LDP++I+  FATL
Sbjct  133  ITDQNRERRFGFSRKSSFKRSHTSWMLDPKKIVLLFATL  171



>ref|XP_007140672.1| hypothetical protein PHAVU_008G132100g, partial [Phaseolus vulgaris]
 gb|ESW12666.1| hypothetical protein PHAVU_008G132100g, partial [Phaseolus vulgaris]
Length=102

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 14/93 (15%)
 Frame = -2

Query  618  LHGAGTPEKPMVVVVGAGADHS------APVTIIA---AGANPLESKTMAAGGKRFGFRR  466
            L G  T EK   + VG+  DHS        +T+     +G+NP+E+K   +  +    RR
Sbjct  2    LLGPCTLEKTTGMAVGS-MDHSINPLVYQEITMTTNNTSGSNPIETK--CSTTRINSSRR  58

Query  465  PSLASWILDPRRILFFFATLSSMGTLVLIYLSL  367
            PS  SW LDP+R+LFFFAT+SSMGT++LIY  L
Sbjct  59   PS--SWALDPKRVLFFFATVSSMGTMLLIYFYL  89



>ref|XP_002462952.1| hypothetical protein SORBIDRAFT_02g035220 [Sorghum bicolor]
 gb|EER99473.1| hypothetical protein SORBIDRAFT_02g035220 [Sorghum bicolor]
Length=183

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 71/126 (56%), Gaps = 18/126 (14%)
 Frame = -2

Query  729  LQRNLSRKGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVV-VGAGADHS  553
            + R+LSRKG      ++K P P+A  +        AV    G  E+P + V V AG    
Sbjct  61   VMRSLSRKG------DRKPPPPDADANGT------AVQRRRGGSERPQLFVHVAAGDLGD  108

Query  552  APVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYL  373
            AP +       PL + T  +  +RFG RRP  A W LDPRR++F FATLSS+GTL+L+Y 
Sbjct  109  APGSARLVVHTPL-AGTPGSKSRRFG-RRP--APW-LDPRRVVFLFATLSSVGTLILLYF  163

Query  372  SLSVGK  355
            +LS+ +
Sbjct  164  TLSMSR  169



>ref|XP_006850454.1| hypothetical protein AMTR_s00035p00016570 [Amborella trichopoda]
 gb|ERN12035.1| hypothetical protein AMTR_s00035p00016570 [Amborella trichopoda]
Length=182

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 86/153 (56%), Gaps = 21/153 (14%)
 Frame = -2

Query  789  SFVVDMERFEKDINSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHG  610
            S ++D+E   +  + +   + +RN+SRKGS  R+ +K +      V+  IA +   +   
Sbjct  42   SVILDVESLTQLADKDFAGSPKRNISRKGSCNRAEKKAVERE--IVEVAIAATKGLLYEN  99

Query  609  AGT--PEKPMVVVVGAGADHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDP  436
            + +  PEK ++V +  G+ +S  V         LE ++  +  +R   RR   ++W LDP
Sbjct  100  SSSMNPEKSVMVPIN-GSCNSPSV---------LERESSNSRCRRL--RR---STW-LDP  143

Query  435  RRILFFFATLSSMGTLVLIYLSLSVGKY-SGDE  340
            RRI+  FATLSSMGT++LIY +L++ K  +GDE
Sbjct  144  RRIVLIFATLSSMGTIILIYFTLAMSKINTGDE  176



>ref|XP_008384233.1| PREDICTED: uncharacterized protein LOC103446856 [Malus domestica]
Length=112

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 9/83 (11%)
 Frame = -2

Query  864  GGQKLSSSSDHQINGLPFTSGTKPDSFVVDMERF-----EKDINSNSRITLQRNLSRKGS  700
            G QK+S S DH ING  +T+  K DSFV+DME F     +KD  +NSR+++QRNLSRK S
Sbjct  22   GTQKISVS-DH-INGFHYTA-DKSDSFVIDMESFSHGGTDKDATANSRVSMQRNLSRKWS  78

Query  699  QMRSVEKKIPNPNAAVDNLIATS  631
            Q R  EKKI     + D  ++++
Sbjct  79   Q-RGGEKKIICKGVSNDKEVSST  100



>ref|XP_008809846.1| PREDICTED: uncharacterized protein LOC103721425 [Phoenix dactylifera]
Length=180

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 76/144 (53%), Gaps = 23/144 (16%)
 Frame = -2

Query  762  EKDINSNSRITLQRNLSRKGSQMRS---VEKKIPNPNAAVDNLIATSPRAVLHGAGTPEK  592
            +KD  S+ R+++ ++LSRKGSQ RS   +E+K      A +   A S      G G  EK
Sbjct  53   DKDSTSSPRVSMVKSLSRKGSQ-RSGGGLERK------AAEGETANS---FPGGPGGGEK  102

Query  591  PMVVVVGAGADHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFA  412
            P   V  AG   ++ +   A         T  A G R          W LDPRR+L FFA
Sbjct  103  PAAWVHVAGEREASGLQSAA---------TPTAAGGRSRRLGRRQTPW-LDPRRVLVFFA  152

Query  411  TLSSMGTLVLIYLSLSVGKYSGDE  340
            +LSSMGTL+L+Y +LS+GK +G +
Sbjct  153  SLSSMGTLILLYFTLSMGKMAGSD  176



>ref|XP_008801173.1| PREDICTED: uncharacterized protein LOC103715352 [Phoenix dactylifera]
Length=180

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = -2

Query  450  WILDPRRILFFFATLSSMGTLVLIYLSLSVGKYSGDE  340
            W LDPRR+LFFFATLSSMGT++L+Y +LS+GK +G++
Sbjct  141  W-LDPRRVLFFFATLSSMGTMILLYFTLSMGKMAGND  176



>ref|XP_008439957.1| PREDICTED: uncharacterized protein LOC103484588 isoform X2 [Cucumis 
melo]
Length=194

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 70/167 (42%), Gaps = 31/167 (19%)
 Frame = -2

Query  813  FTSGTKPDSFVVDMERFEKDINSNSRITLQRNLSRKGSQMRSVEKKIPNPNAAVDNL---  643
            F   TK DSF++DM+              +RN SRKG  M     KI   N   D     
Sbjct  33   FQYNTKSDSFIIDMDNLSN----------KRNFSRKG--MLRGGSKIGQDNGDGDEAGES  80

Query  642  IATSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESKT------MAAGGKR  481
            I+        G+ T EK  VV    G +          G   L  +T       + G ++
Sbjct  81   ISPLGGGGGGGSSTLEKQAVV----GREELVVGGSGGVGVGALSHETAISSTQWSVGAEK  136

Query  480  FGFRR------PSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVG  358
               RR      P   SW LDPR+I  F ATLS +GT++LIYL+ S G
Sbjct  137  LSIRRNSFKRSPQPCSWYLDPRKIFLFCATLSCVGTMLLIYLTFSSG  183



>ref|XP_009405646.1| PREDICTED: uncharacterized protein LOC103988740 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 79/161 (49%), Gaps = 35/161 (22%)
 Frame = -2

Query  792  DSFV-VDMERFEKDINSNSR----------ITLQRNLSRKGSQMRSVEKKIPNPNAAVDN  646
            DSFV VD++   + + +N +            +++NLSRKGSQ  S  K+  N     D 
Sbjct  30   DSFVAVDIDELSQQLMANIKDRSSSTPRVVSVMKKNLSRKGSQG-SGAKREKNKTEQRD-  87

Query  645  LIATSPRAVLHGAGTPEK-PMVVVVGAGADHSAPVTIIAAGANPLESKTMAAG-GKRFGF  472
                      H  GT +K P+ + V    +        AA    +   T  AG  +R G 
Sbjct  88   ----------HHQGTGDKSPLSMRVETDGE--------AASLYHVSGPTAEAGRWRRVGP  129

Query  471  RRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGKYS  349
            RRP L  W LDP R++  FATLSSMGTL+L+Y +L +GK +
Sbjct  130  RRPPLP-W-LDPNRVVIVFATLSSMGTLILLYFTLFMGKVT  168



>emb|CDY71341.1| BnaCnng72480D [Brassica napus]
Length=119

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 54/106 (51%), Gaps = 23/106 (22%)
 Frame = -2

Query  612  GAGTPEKPMVVVVGAGADHSAPVTI--IAAGANPLESKTMAAGG-------------KRF  478
            G+  PEKP  V      DH+  VT    AA ++PL   T+                 +RF
Sbjct  8    GSSAPEKPSTV---GPIDHAGTVTTANTAAPSSPLHQITITTSAATAGNMISDQNRERRF  64

Query  477  GFRRPS-----LASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
            GF R S       SW+LDP++I+ F A LSSMG+++LI  +LS+ K
Sbjct  65   GFARKSSFKRSHTSWMLDPKKIVLFCAILSSMGSILLIIFTLSISK  110



>ref|XP_010931141.1| PREDICTED: uncharacterized protein LOC105052125 [Elaeis guineensis]
Length=180

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 71/141 (50%), Gaps = 21/141 (15%)
 Frame = -2

Query  762  EKDINSNSRITLQRNLSRKGSQMR--SVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKP  589
            EKD  S+ R++  ++LSRKGSQ    S E+K      A +   A S    L G G+  K 
Sbjct  53   EKDSISSPRVSRLKSLSRKGSQRSGGSEERK------AAEGETADSS---LGGPGSDVKS  103

Query  588  MVVVVGAGADHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFAT  409
             ++V  AG     P     A        T  A G R          W LD RR+LFFFAT
Sbjct  104  ALLVHVAG--DGEPSAFCHA-------TTPTAAGGRCRRLGRRQTPW-LDSRRVLFFFAT  153

Query  408  LSSMGTLVLIYLSLSVGKYSG  346
            LSSMGTL+L+Y +LS+ K +G
Sbjct  154  LSSMGTLILLYFTLSMKKMAG  174



>ref|XP_006657785.1| PREDICTED: uncharacterized protein LOC102710713 [Oryza brachyantha]
Length=192

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 13/84 (15%)
 Frame = -2

Query  600  PEKPMVVVVGAGADHSA--PVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRI  427
            P  P+ V V A  D S   PV    AG       T     +R G R+P  A W LDPRR+
Sbjct  107  PLSPLFVHVAAADDMSGLRPVHTPVAG-------TPGGKSRRLG-RQP--APW-LDPRRV  155

Query  426  LFFFATLSSMGTLVLIYLSLSVGK  355
            +FFFATLSS+GTL+L+Y +LS+ K
Sbjct  156  VFFFATLSSVGTLILLYFTLSMSK  179



>ref|XP_004957909.1| PREDICTED: uncharacterized protein LOC101776819 [Setaria italica]
Length=190

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  606  GTPEKPMVVV-VGAGADHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRR  430
            G  E+P + V V AG    AP +       PL S T  +  +RFG RRP  A W LDPRR
Sbjct  96   GGGERPQLFVHVAAGDLGDAPSSARLVVHTPLAS-TPGSKSRRFG-RRP--APW-LDPRR  150

Query  429  ILFFFATLSSMGTLVLIYLSLSV  361
            ++F FATLSS+GTL+L+Y +LS+
Sbjct  151  VVFLFATLSSVGTLILLYFTLSM  173



>tpg|DAA41037.1| TPA: hypothetical protein ZEAMMB73_790388, partial [Zea mays]
Length=177

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 68/124 (55%), Gaps = 17/124 (14%)
 Frame = -2

Query  723  RNLSRKGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVV-VGAGADHSAP  547
            R+LSRKG +          P  A  N  AT+  +V   +G  E+P + V V AG    AP
Sbjct  59   RSLSRKGDR---------KPADADAN--ATAGTSVQTISGGRERPQLFVHVAAGDLGDAP  107

Query  546  VTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSL  367
             +       PL + T  +  +RFG R    A W LDPRR++F FATLSS+GTL+L+Y +L
Sbjct  108  GSARLVVHTPL-AGTPGSKSRRFGRR---AAPW-LDPRRVVFLFATLSSVGTLILLYFTL  162

Query  366  SVGK  355
            S+ +
Sbjct  163  SMSR  166



>ref|XP_010237548.1| PREDICTED: uncharacterized protein LOC100839374 [Brachypodium 
distachyon]
Length=183

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 58/123 (47%), Gaps = 17/123 (14%)
 Frame = -2

Query  723  RNLSRKGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVVVGAGADHSAPV  544
            R+LSRKGS+ +  +                S R        P  P+ V V A  D     
Sbjct  62   RSLSRKGSERKQADGDTNGTAGGGGGAGTGSER-------PPLSPLFVHVAAADDG----  110

Query  543  TIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLS  364
              +     P    T     +R G RRP  A W LDPRR++F FATLSS+GTL+L+Y +LS
Sbjct  111  --LRLAHTPGAVGTPGGKSRRLG-RRP--APW-LDPRRVVFLFATLSSVGTLILLYFTLS  164

Query  363  VGK  355
            + K
Sbjct  165  MSK  167



>ref|NP_001059849.1| Os07g0530700 [Oryza sativa Japonica Group]
 dbj|BAC45150.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21763.1| Os07g0530700 [Oryza sativa Japonica Group]
 dbj|BAG94179.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82175.1| hypothetical protein OsI_26289 [Oryza sativa Indica Group]
 gb|EEE67307.1| hypothetical protein OsJ_24537 [Oryza sativa Japonica Group]
Length=179

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = -2

Query  492  GGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
            GGK     R   A W LDPRR++FFFATLSS+GTL+L+Y +LS+ K
Sbjct  121  GGKSRRLGRQPAAPW-LDPRRVVFFFATLSSVGTLILLYFTLSMSK  165



>ref|NP_001145470.1| hypothetical protein [Zea mays]
 gb|ACG47816.1| hypothetical protein [Zea mays]
 gb|AFW84874.1| hypothetical protein ZEAMMB73_519612 [Zea mays]
Length=141

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 6/79 (8%)
 Frame = -2

Query  573  GAGADHSAPVTIIAAGANPLESKTMAAGG---KRFGFRRPSLASWILDPRRILFFFATLS  403
            GA    + PV +       L+  T  AGG   +R   RR  +  W  DPR+ILF FA LS
Sbjct  60   GAYEKQTVPVHVDDCPREHLQPSTPTAGGGAKRRRSSRR--VLGW-RDPRKILFAFAALS  116

Query  402  SMGTLVLIYLSLSVGKYSG  346
            S+GTL+L+Y +LS+GK +G
Sbjct  117  SVGTLILLYFTLSMGKMTG  135



>ref|XP_008670460.1| PREDICTED: uncharacterized protein LOC103647721 [Zea mays]
Length=186

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 63/124 (51%), Gaps = 24/124 (19%)
 Frame = -2

Query  723  RNLSRKGSQMRSVEKKIPNPNAAVDNLIATSPRAVLHGAGTPEKPMVVV-VGAGADHSAP  547
            R+LSRKG +          P  A  N  A   R         E+P + V V AG    AP
Sbjct  69   RSLSRKGDR---------KPADADANATAGGGR---------ERPQLFVHVAAGDLGDAP  110

Query  546  VTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSL  367
             +       PL + T  +  +RFG R    A W LDPRR++F FATLSS+GTL+L+Y +L
Sbjct  111  GSARLVVHTPL-AGTPGSKSRRFGRR---AAPW-LDPRRVVFLFATLSSVGTLILLYFTL  165

Query  366  SVGK  355
            S+ +
Sbjct  166  SMSR  169



>ref|NP_001144496.1| uncharacterized protein LOC100277476 [Zea mays]
 gb|ACG40897.1| hypothetical protein [Zea mays]
Length=194

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 6/82 (7%)
 Frame = -2

Query  597  EKPMVVV-VGAGADHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILF  421
            E+P + V V AG    AP +       PL + T  +  +RFG RRP  A W LDPRR++ 
Sbjct  106  ERPQLFVHVAAGELGDAPGSARLVVHTPL-AGTPGSKSRRFG-RRP--APW-LDPRRVVL  160

Query  420  FFATLSSMGTLVLIYLSLSVGK  355
             FATLSS+GTL+L+Y +LS+ +
Sbjct  161  LFATLSSVGTLILLYFTLSMSR  182



>ref|XP_009417253.1| PREDICTED: uncharacterized protein LOC103997679 [Musa acuminata 
subsp. malaccensis]
Length=176

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 79/154 (51%), Gaps = 23/154 (15%)
 Frame = -2

Query  792  DSFV-VDMERFEKDI------NSNSRITLQRNL-SRKGSQMRSVEKKIPNPNAAVDNLIA  637
            D FV VD++   + +      +S+S   L + + SRKGS    VEK+  +     + L  
Sbjct  29   DCFVAVDVDEISQQLVVNTKGHSSSSPRLTKKIPSRKGSHGSGVEKE-KSKTVEGEEL--  85

Query  636  TSPRAVLHGAGTPEKPMVVVVGAGADHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSL  457
              P A  HG    + P+ V V   A     V I  A A  L+     A  +R G RRP+ 
Sbjct  86   --PGAGGHGWAE-KSPLSVHV---AMEGEAVGIPRAMAPTLD----GARWRRVGARRPT-  134

Query  456  ASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
            + W LDP  I+  FATLS MGTL+L+YL+LS+GK
Sbjct  135  SRW-LDPSGIVVVFATLSCMGTLILLYLTLSMGK  167



>dbj|BAJ91817.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00129.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04040.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=183

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 4/44 (9%)
 Frame = -2

Query  486  KRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLIYLSLSVGK  355
            +R G RRP  A W LDPRR++F FATLSS+GTL+L+Y +LS+ K
Sbjct  129  RRLG-RRP--APW-LDPRRVVFLFATLSSVGTLILLYFTLSMSK  168



>ref|XP_002456462.1| hypothetical protein SORBIDRAFT_03g036766 [Sorghum bicolor]
 gb|EES01582.1| hypothetical protein SORBIDRAFT_03g036766 [Sorghum bicolor]
Length=159

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = -2

Query  576  VGAGADHSAPVTIIAAGANPLESKTMAAGGKRFGFRRPSLASWILDPRRILFFFATLSSM  397
             GA    + P+ +  +        T  AGG +          W  DPR+ILF FA LSS+
Sbjct  78   TGAYEKQTVPLHVDDSPREHFHPSTPTAGGAKRRRSSRRAPGW-RDPRKILFAFAALSSV  136

Query  396  GTLVLIYLSLSVGKYSG  346
            GTL+L+Y +LS+GK +G
Sbjct  137  GTLILLYFTLSMGKMAG  153



>gb|EEC71614.1| hypothetical protein OsI_04025 [Oryza sativa Indica Group]
Length=145

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 7/73 (10%)
 Frame = -2

Query  549  PVTIIAAGANPLESKTMAAGG---KRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLI  379
            PV + ++        T  AGG   +R G R P    W  DPR+ILF FA LSS+GTL+L+
Sbjct  73   PVHVDSSPKEQFHPSTPTAGGAKRRRTGRRVPG---W-RDPRKILFAFAALSSVGTLILL  128

Query  378  YLSLSVGKYSGDE  340
            Y +LS+G+ +G +
Sbjct  129  YFTLSMGRMTGGQ  141



>ref|NP_001044477.2| Os01g0787400 [Oryza sativa Japonica Group]
 dbj|BAG87802.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06391.2| Os01g0787400 [Oryza sativa Japonica Group]
Length=145

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (59%), Gaps = 7/73 (10%)
 Frame = -2

Query  549  PVTIIAAGANPLESKTMAAGG---KRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLI  379
            PV +  +        T  AGG   +R G R P    W  DPR+ILF FA LSS+GTL+L+
Sbjct  73   PVHVDGSPKEQFHPSTPTAGGAKRRRTGRRVPG---W-RDPRKILFAFAALSSVGTLILL  128

Query  378  YLSLSVGKYSGDE  340
            Y +LS+G+ +G +
Sbjct  129  YFTLSMGRMTGGQ  141



>dbj|BAD53263.1| unknown protein [Oryza sativa Japonica Group]
Length=143

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (59%), Gaps = 7/73 (10%)
 Frame = -2

Query  549  PVTIIAAGANPLESKTMAAGG---KRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLI  379
            PV +  +        T  AGG   +R G R P    W  DPR+ILF FA LSS+GTL+L+
Sbjct  71   PVHVDGSPKEQFHPSTPTAGGAKRRRTGRRVPG---W-RDPRKILFAFAALSSVGTLILL  126

Query  378  YLSLSVGKYSGDE  340
            Y +LS+G+ +G +
Sbjct  127  YFTLSMGRMTGGQ  139



>gb|KEH43930.1| transmembrane protein, putative [Medicago truncatula]
Length=157

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 7/53 (13%)
 Frame = -2

Query  840  SDHQINGLPFTSGTKPDSFVVDMERF----EKDI-NSNSRITLQRNLSRKGSQ  697
            SDH IN   ++S  K DSFV+DM+ F     KDI N+NSR TLQR+LSRKGSQ
Sbjct  37   SDH-INAYQYSS-EKVDSFVIDMDSFSSTINKDIINANSRTTLQRSLSRKGSQ  87



>gb|EAZ13791.1| hypothetical protein OsJ_03716 [Oryza sativa Japonica Group]
Length=265

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (59%), Gaps = 7/73 (10%)
 Frame = -2

Query  549  PVTIIAAGANPLESKTMAAGG---KRFGFRRPSLASWILDPRRILFFFATLSSMGTLVLI  379
            PV +  +        T  AGG   +R G R P    W  DPR+ILF FA LSS+GTL+L+
Sbjct  193  PVHVDGSPKEQFHPSTPTAGGAKRRRTGRRVPG---W-RDPRKILFAFAALSSVGTLILL  248

Query  378  YLSLSVGKYSGDE  340
            Y +LS+G+ +G +
Sbjct  249  YFTLSMGRMTGGQ  261



>ref|XP_004970218.1| PREDICTED: uncharacterized protein LOC101772312 isoform X2 [Setaria 
italica]
Length=138

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  441  DPRRILFFFATLSSMGTLVLIYLSLSVGKYSG  346
            DPR+ILF FA LSS+GTL+L+Y +LS+GK +G
Sbjct  101  DPRKILFAFAALSSVGTLILLYFTLSMGKMTG  132



>ref|XP_004970217.1| PREDICTED: uncharacterized protein LOC101772312 isoform X1 [Setaria 
italica]
Length=137

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  441  DPRRILFFFATLSSMGTLVLIYLSLSVGKYSG  346
            DPR+ILF FA LSS+GTL+L+Y +LS+GK +G
Sbjct  100  DPRKILFAFAALSSVGTLILLYFTLSMGKMTG  131



>ref|XP_006644823.1| PREDICTED: uncharacterized protein LOC102703077 [Oryza brachyantha]
Length=143

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 45/83 (54%), Gaps = 7/83 (8%)
 Frame = -2

Query  579  VVGAGADHSAPVTIIAAGANPLESKTMAAGG---KRFGFRRPSLASWILDPRRILFFFAT  409
            V+ A      PV +  +        T  A G   +R G R P    W  DPR+ILF FA 
Sbjct  61   VLCAYEKQVVPVHVDGSPKEQFHPSTPTASGAKRRRTGRRVPG---W-RDPRKILFAFAA  116

Query  408  LSSMGTLVLIYLSLSVGKYSGDE  340
            LSS+GTL+L+Y +LS+G+ +G +
Sbjct  117  LSSVGTLILLYFTLSMGRMAGGQ  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3177808337144