BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22612_g3_i1 len=521 path=[1583:0-412 1498:413-439 1525:440-520]

Length=521
                                                                      Score     E

ref|XP_002519978.1|  Protein kinase APK1B, chloroplast precursor,...  58.2    6e-07   Ricinus communis
ref|XP_011077189.1|  PREDICTED: uncharacterized protein LOC105161253  53.5    2e-06   
ref|XP_010653096.1|  PREDICTED: uncharacterized protein LOC100246776  53.1    3e-06   
ref|XP_010921249.1|  PREDICTED: uncharacterized protein LOC105044883  52.4    7e-06   
emb|CAN82885.1|  hypothetical protein VITISV_023156                   54.7    8e-06   Vitis vinifera
ref|XP_003624155.1|  hypothetical protein MTR_7g079830                51.2    1e-05   
ref|XP_010551280.1|  PREDICTED: uncharacterized protein LOC104821944  50.8    2e-05   
ref|XP_008782790.1|  PREDICTED: uncharacterized protein LOC103702238  50.8    2e-05   
ref|XP_004492831.1|  PREDICTED: uncharacterized protein LOC101505966  50.4    2e-05   
gb|ACJ84187.1|  unknown                                               50.4    2e-05   Medicago truncatula
ref|XP_007139734.1|  hypothetical protein PHAVU_008G054900g           50.1    2e-05   
ref|XP_009608257.1|  PREDICTED: uncharacterized protein LOC104102279  50.1    3e-05   
ref|XP_006391565.1|  hypothetical protein EUTSA_v10019335mg           49.7    4e-05   
ref|NP_001236622.1|  uncharacterized protein LOC100306040 precursor   49.3    5e-05   
ref|XP_002886836.1|  hypothetical protein ARALYDRAFT_475541           49.3    5e-05   
emb|CAQ58610.1|  Unknown gene                                         48.9    5e-05   Vitis vinifera
ref|XP_007032289.1|  Uncharacterized protein TCM_017867               49.3    6e-05   
ref|XP_009411244.1|  PREDICTED: uncharacterized protein LOC103993043  48.9    8e-05   
ref|XP_010528640.1|  PREDICTED: uncharacterized protein LOC104805696  48.9    8e-05   
ref|XP_010415072.1|  PREDICTED: uncharacterized protein LOC104701128  48.5    1e-04   
gb|KHG06088.1|  hypothetical protein F383_05586                       48.5    1e-04   
ref|XP_006381289.1|  hypothetical protein POPTR_0006s11440g           48.5    1e-04   
ref|XP_009411245.1|  PREDICTED: uncharacterized protein LOC103993044  48.1    1e-04   
ref|XP_010922835.1|  PREDICTED: uncharacterized protein LOC105046047  48.1    2e-04   
ref|XP_004250097.1|  PREDICTED: uncharacterized protein LOC101256442  48.1    2e-04   
ref|XP_009799713.1|  PREDICTED: uncharacterized protein LOC104245748  47.8    2e-04   
emb|CDP04216.1|  unnamed protein product                              47.8    2e-04   
ref|XP_010513517.1|  PREDICTED: uncharacterized protein LOC104789534  47.4    2e-04   
ref|XP_010278904.1|  PREDICTED: uncharacterized protein LOC104612940  48.1    3e-04   
ref|XP_009105146.1|  PREDICTED: uncharacterized protein LOC103831050  47.0    4e-04   
ref|XP_006353233.1|  PREDICTED: uncharacterized protein LOC102596787  47.0    4e-04   
ref|XP_008244241.1|  PREDICTED: uncharacterized protein LOC103342...  47.4    5e-04   
ref|XP_009127395.1|  PREDICTED: uncharacterized protein LOC103852230  47.0    5e-04   
emb|CDY39290.1|  BnaC06g27010D                                        46.6    6e-04   
ref|XP_007206003.1|  hypothetical protein PRUPE_ppa012325mg           47.8    6e-04   
ref|XP_002987896.1|  hypothetical protein SELMODRAFT_126915           45.8    6e-04   
ref|XP_010470431.1|  PREDICTED: uncharacterized protein LOC104750343  46.6    6e-04   
ref|XP_009600430.1|  PREDICTED: uncharacterized protein LOC104095890  46.6    6e-04   
ref|XP_006303018.1|  hypothetical protein CARUB_v10021174mg           46.6    6e-04   
ref|XP_010070148.1|  PREDICTED: uncharacterized protein LOC104456935  46.2    7e-04   
ref|XP_001751277.1|  predicted protein                                45.8    9e-04   
emb|CDY07445.1|  BnaA07g25240D                                        46.2    9e-04   
ref|XP_008804651.1|  PREDICTED: uncharacterized protein LOC103717879  45.8    9e-04   



>ref|XP_002519978.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF42302.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=534

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 31/104 (30%), Positives = 52/104 (50%), Gaps = 7/104 (7%)
 Frame = +1

Query  100  LVIAAGAESL-EKSSFNLSLIEEAEKVLVPVVETKIEFRDIG-DVFGRRKLGDFPKCLIC  273
            L++ A AES  E +S +++  +  E     ++ET +    +  D   RR+L  F  CL+C
Sbjct  429  LILTASAESFPENASSSVTEFKPVEPTGYRLIETSMMITALANDTARRRRLAPFQLCLLC  488

Query  274  RCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
            +CC      +C    CC+ + C+     +  C +VP  CNC +C
Sbjct  489  KCCAAPAATTCSTMPCCFGIDCQLPNKPYGVCAFVPKTCNCTSC  532



>ref|XP_011077189.1| PREDICTED: uncharacterized protein LOC105161253 [Sesamum indicum]
Length=114

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 48/106 (45%), Gaps = 7/106 (7%)
 Frame = +1

Query  91   VFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVE-TKIEFRDIGDVFGRRKLGDFPKCL  267
            +F  ++  G  +   S     L  E  + +VPVVE  K+E   + +   RRKLG F  C 
Sbjct  8    IFWSILLVGLFTYSLSGVRFCLATENVEEMVPVVEPGKVEMMVMVNE-SRRKLGSFQICA  66

Query  268  ICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
            +C CC  +    C    CCY + C      F  C++ P  CNC  C
Sbjct  67   LCTCCGGASKSYCLASPCCYAINCNIPNRPFGFCSFTPKTCNCFGC  112



>ref|XP_010653096.1| PREDICTED: uncharacterized protein LOC100246776 [Vitis vinifera]
 ref|XP_002264739.3| PREDICTED: uncharacterized protein LOC100246776 [Vitis vinifera]
 emb|CBI31133.3| unnamed protein product [Vitis vinifera]
Length=123

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 55/124 (44%), Gaps = 20/124 (16%)
 Frame = +1

Query  55   MNP--ATALPMFALVFSLVIAAGA-ESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGD  225
            MNP   T L +  L+    I+ G   +LE        +   E     VVE  +       
Sbjct  6    MNPTAGTQLILLLLIAHFTISPGRCHALE--------MRPVESTQYQVVEAALVGSHTSH  57

Query  226  VFGRRKLGDFPKCLICRCC--DKSDPK--SCFEKNCCYRLKCR-----FIACTWVPTACN  378
            + GRRKL  F  CL+C+CC    +DP   +C    CC+ + C+     F  C +VP  CN
Sbjct  58   LDGRRKLAPFQLCLVCKCCAAGGADPTTGTCATMPCCFGIDCQLPNKPFGVCAFVPKTCN  117

Query  379  CDNC  390
            C +C
Sbjct  118  CTSC  121



>ref|XP_010921249.1| PREDICTED: uncharacterized protein LOC105044883 [Elaeis guineensis]
Length=146

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 41/83 (49%), Gaps = 6/83 (7%)
 Frame = +1

Query  157  IEEAEKVLVPVVETKIEFRDIGDVFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLK  336
            I  A    VP+   + +  +  DV  RR L  F  CL CRCC  SDP +C    CC+ + 
Sbjct  64   IPGATAGFVPIDVVRFQPFNHTDV-ARRVLAPFQLCLQCRCCAASDPSNCSSMPCCFGID  122

Query  337  C-----RFIACTWVPTACNCDNC  390
            C      +  C +VP +CNC +C
Sbjct  123  CDLPNKPYGVCAFVPKSCNCTSC  145



>emb|CAN82885.1| hypothetical protein VITISV_023156 [Vitis vinifera]
Length=567

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 39/77 (51%), Gaps = 9/77 (12%)
 Frame = +1

Query  187  VVETKIEFRDIGDVFGRRKLGDFPKCLICRCCDK--SDPK--SCFEKNCCYRLKCR----  342
            VVE  +       + GRRKL  F  CL+C+CC    +DP   +C    CC+ + C+    
Sbjct  489  VVEAALVGSHTSHLDGRRKLAPFQLCLVCKCCAAGGADPTTGTCATMPCCFGIDCQLPNK  548

Query  343  -FIACTWVPTACNCDNC  390
             F  C +VP  CNC +C
Sbjct  549  PFGVCAFVPKTCNCTSC  565



>ref|XP_003624155.1| hypothetical protein MTR_7g079830 [Medicago truncatula]
 gb|ABD28368.1| hypothetical protein MtrDRAFT_AC148289g12v2 [Medicago truncatula]
 gb|AES80373.1| putative MEG related family [Medicago truncatula]
Length=118

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 60/121 (50%), Gaps = 21/121 (17%)
 Frame = +1

Query  49   TTMNPATALPMFALVFSLVIAAGAESLEKS--SFNLSLIEEAEKVLVPVVETKIEFRDIG  222
            T M P+  L +F+L+F  ++A  A  L ++  SF +  + EA K+++ + E+        
Sbjct  10   TMMVPSHCL-IFSLIFVSILANEATLLHEANGSFPMVPVMEAGKMMMMMNES--------  60

Query  223  DVFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDN  387
                RRKLG F  C IC CC  +    C    CCY + C      F  C+++P ACNC  
Sbjct  61   ----RRKLGSFRICAICTCCGGAK-GICIASPCCYAIDCNIPNKPFGLCSFIPKACNCFG  115

Query  388  C  390
            C
Sbjct  116  C  116



>ref|XP_010551280.1| PREDICTED: uncharacterized protein LOC104821944 [Tarenaya hassleriana]
Length=114

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 52/109 (48%), Gaps = 13/109 (12%)
 Frame = +1

Query  79   MFALVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLGDFP  258
            +F LVFS  I  G  + E    N S  EE E  +VP++E +  F  + +   RRKLG F 
Sbjct  12   IFLLVFSSFIGFGRANSEIQG-NGSSTEEGE--MVPLMEER--FVLVNET--RRKLGSFQ  64

Query  259  KCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
             C +C CC  S    C    CC+ + C      F  C++ P  CNC  C
Sbjct  65   LCSVCTCCGGSK-GICLASPCCFAINCNIPNRPFGYCSFTPKTCNCFGC  112



>ref|XP_008782790.1| PREDICTED: uncharacterized protein LOC103702238 [Phoenix dactylifera]
Length=113

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 41/86 (48%), Gaps = 8/86 (9%)
 Frame = +1

Query  157  IEEAEKVLVPVVETKIEFRDIGDVFG---RRKLGDFPKCLICRCCDKSDPKSCFEKNCCY  327
            I  A    VPV   K +  +   V G   RR L  F  CL CRCC  +DP +C    CC+
Sbjct  27   IPAATAGFVPVDLAKFQPFNRAGVAGGSPRRALAPFQLCLQCRCCAANDPSNCSLMPCCF  86

Query  328  RLKC-----RFIACTWVPTACNCDNC  390
             + C      +  C +VP +CNC +C
Sbjct  87   AIDCDLPNKPYGVCAFVPKSCNCTSC  112



>ref|XP_004492831.1| PREDICTED: uncharacterized protein LOC101505966 [Cicer arietinum]
Length=108

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 52/114 (46%), Gaps = 17/114 (15%)
 Frame = +1

Query  73   LPMFALVFSLVIAAGAESLEKSSFNLSLIEEAEKV--LVPVVET-KIEFRDIGDVFGRRK  243
             P  +L+ SL+  +   S        S + EA     +VPV+E  K+E   + D   RRK
Sbjct  2    FPSHSLIISLIFVSILVS------EASFVHEANGSFPMVPVMEAGKMEMMMMND--SRRK  53

Query  244  LGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
            LG F  C +C CC  +    C    CCY + C      F  C++ P ACNC  C
Sbjct  54   LGSFKICALCTCCGGAK-GVCLPSPCCYAINCNIPNRPFGFCSFTPKACNCFGC  106



>gb|ACJ84187.1| unknown [Medicago truncatula]
 gb|AFK45309.1| unknown [Medicago truncatula]
Length=119

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 16/119 (13%)
 Frame = +1

Query  49   TTMNPATALPMFALVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDV  228
            T M P+  L +F+L+F  ++A  A  L +++ +  +        VPV+E       + + 
Sbjct  10   TMMVPSHCL-IFSLIFVSILANEATLLHEANGSFPM--------VPVMEAGKMMMMMMNE  60

Query  229  FGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
              RRKLG F  C IC CC  +    C    CCY + C      F  C+++P ACNC  C
Sbjct  61   -SRRKLGSFRTCAICTCCGGAK-GICIASPCCYAIDCNIPNKPFGLCSFIPKACNCFGC  117



>ref|XP_007139734.1| hypothetical protein PHAVU_008G054900g [Phaseolus vulgaris]
 gb|ESW11728.1| hypothetical protein PHAVU_008G054900g [Phaseolus vulgaris]
Length=109

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 57/120 (48%), Gaps = 21/120 (18%)
 Frame = +1

Query  55   MNPATALPMFALVFSLVIAAGAESLEKSSFNLSLIEEAEKV--LVPVVET-KIEFRDIGD  225
            M PA  L + +L+F  ++A  A          SL++EA     +VP+VE  KIE   + +
Sbjct  1    MMPAHGL-IISLIFVSILANEA----------SLVQEANGSFPMVPLVEAGKIEMMMMMN  49

Query  226  VFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
               RRKLG F  C +C CC  +    C    CCY + C      F  C++ P  CNC  C
Sbjct  50   E-SRRKLGSFQICALCTCCGGAK-GVCLPSPCCYAINCNIPHRPFGFCSFTPKTCNCFGC  107



>ref|XP_009608257.1| PREDICTED: uncharacterized protein LOC104102279 [Nicotiana tomentosiformis]
Length=109

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 51/109 (47%), Gaps = 16/109 (15%)
 Frame = +1

Query  79   MFALVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLGDFP  258
            +F L+F ++I +   S        S +  AE  +VPV+E K+    + +   RRKLG F 
Sbjct  10   LFLLIFFMLITSYGASN-------SHVYGAEPEMVPVIEEKMMVM-LNET--RRKLGSFK  59

Query  259  KCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
             C IC CC  +    C    CCY + C      F  C++ P  CNC  C
Sbjct  60   ICAICTCCGGAK-GYCVPSPCCYAINCNIPHRPFGFCSFTPRTCNCFGC  107



>ref|XP_006391565.1| hypothetical protein EUTSA_v10019335mg [Eutrema salsugineum]
 gb|ESQ28851.1| hypothetical protein EUTSA_v10019335mg [Eutrema salsugineum]
Length=115

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 53/112 (47%), Gaps = 13/112 (12%)
 Frame = +1

Query  70   ALPMFALVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLG  249
            ++ +  L FS+ I     SL+ +    S  EE E  +VP++E K  F  + +   RRKLG
Sbjct  10   SIVLLLLCFSIFITF---SLQANELIPSSKEEGEMRMVPLMEEK--FMVMNET--RRKLG  62

Query  250  DFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
             F  C +C CC  +    C    CCY + C      F  C++ P  CNC  C
Sbjct  63   SFQICSVCTCCGGAK-GLCLPSPCCYAINCNIPNRPFGYCSFTPKTCNCFGC  113



>ref|NP_001236622.1| uncharacterized protein LOC100306040 precursor [Glycine max]
 ref|XP_003534519.1| PREDICTED: uncharacterized protein LOC100787156 [Glycine max]
 gb|ACU14024.1| unknown [Glycine max]
 gb|KHN29279.1| hypothetical protein glysoja_005003 [Glycine soja]
 gb|KHN40465.1| hypothetical protein glysoja_000963 [Glycine soja]
Length=109

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 56/120 (47%), Gaps = 21/120 (18%)
 Frame = +1

Query  55   MNPATALPMFALVFSLVIAAGAESLEKSSFNLSLIEEAEKV--LVPVVET-KIEFRDIGD  225
            M PA  L + +L+F  ++A  A          SL+ EA     +VP+VE  K+E   + +
Sbjct  1    MMPAHGL-IISLIFVSILANEA----------SLVHEANGSFPMVPLVEAGKMEMMMVMN  49

Query  226  VFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
               RRKLG F  C +C CC  +    C    CCY + C      F  C++ P  CNC  C
Sbjct  50   E-SRRKLGSFQICALCTCCGGAK-GMCLPSPCCYAINCNIPHRPFGFCSFTPKTCNCFGC  107



>ref|XP_002886836.1| hypothetical protein ARALYDRAFT_475541 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63095.1| hypothetical protein ARALYDRAFT_475541 [Arabidopsis lyrata subsp. 
lyrata]
Length=113

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 43/87 (49%), Gaps = 10/87 (11%)
 Frame = +1

Query  145  NLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCC  324
            N  L  E EK++VP++E K  F  + +   RRKLG F  C +C CC  +    C    CC
Sbjct  30   NEVLPSEGEKMMVPLMEEK--FMVMNET--RRKLGSFQICSVCTCCGGAK-GLCLPSPCC  84

Query  325  YRLKCR-----FIACTWVPTACNCDNC  390
            Y + C      F  C++ P  CNC  C
Sbjct  85   YAINCNIPNRPFGYCSFTPKTCNCFGC  111



>emb|CAQ58610.1| Unknown gene [Vitis vinifera]
 emb|CAQ58634.1| unknown gene [Vitis vinifera]
Length=89

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 9/87 (10%)
 Frame = +1

Query  157  IEEAEKVLVPVVETKIEFRDIGDVFGRRKLGDFPKCLICRCC--DKSDPK--SCFEKNCC  324
            +   E     VVE  +       + GRRKL  F  CL+C+CC    +DP   +C    CC
Sbjct  1    MRPVESTQYQVVEAALVGSHTSHLDGRRKLAPFQLCLVCKCCAAGGADPTTGTCATMPCC  60

Query  325  YRLKCR-----FIACTWVPTACNCDNC  390
            + + C+     F  C +VP  CNC +C
Sbjct  61   FGIDCQLPNKPFGVCAFVPKTCNCTSC  87



>ref|XP_007032289.1| Uncharacterized protein TCM_017867 [Theobroma cacao]
 gb|EOY03215.1| Uncharacterized protein TCM_017867 [Theobroma cacao]
Length=122

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 38/76 (50%), Gaps = 7/76 (9%)
 Frame = +1

Query  184  PVVETKIEFRDIGDVF--GRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----  342
            PV     E+R +       RRKL  F  CL+C+CC  S   +C    CC+ + C+     
Sbjct  45   PVAVGPTEYRVLQGNADDARRKLAPFQLCLLCKCCTTSAASTCATMPCCFGIDCQLPNKP  104

Query  343  FIACTWVPTACNCDNC  390
            F  C +VP  CNC++C
Sbjct  105  FGVCAFVPKTCNCNSC  120



>ref|XP_009411244.1| PREDICTED: uncharacterized protein LOC103993043 [Musa acuminata 
subsp. malaccensis]
Length=104

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 41/75 (55%), Gaps = 8/75 (11%)
 Frame = +1

Query  181  VPVVETKIEFRDIGDVFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCRFIA---  351
            +PV  T +++  + +V G   L  + +C  CRCC  ++P +C    CCY+L C       
Sbjct  32   IPV--TPVKYLTLANVPGGV-LAGYNQCSDCRCCSTNNPSNCVTTKCCYKLICHEATNPA  88

Query  352  --CTWVPTACNCDNC  390
              C++ P AC+CDNC
Sbjct  89   AICSYRPVACHCDNC  103



>ref|XP_010528640.1| PREDICTED: uncharacterized protein LOC104805696 [Tarenaya hassleriana]
 ref|XP_010528641.1| PREDICTED: uncharacterized protein LOC104805696 [Tarenaya hassleriana]
 ref|XP_010528642.1| PREDICTED: uncharacterized protein LOC104805696 [Tarenaya hassleriana]
Length=117

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 49/109 (45%), Gaps = 13/109 (12%)
 Frame = +1

Query  79   MFALVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLGDFP  258
            +  LVFS  I+    S   S    +     E+ +VP++E K    +      RRKLG F 
Sbjct  15   ILLLVFSSFISF---SQANSGIQANGSSSEEREMVPLMEEKFVLMNET----RRKLGSFQ  67

Query  259  KCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
             C +C CC  S    C    CCY + C      F  C+++P ACNC  C
Sbjct  68   ICSVCTCCGGSK-GLCLPSPCCYAINCNIPNRPFGYCSFIPKACNCFGC  115



>ref|XP_010415072.1| PREDICTED: uncharacterized protein LOC104701128 [Camelina sativa]
Length=115

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 51/106 (48%), Gaps = 14/106 (13%)
 Frame = +1

Query  88   LVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLGDFPKCL  267
            L+FS+ I++  +  E S  +     E E  ++P++E K  F  + +   RRKLG F  C 
Sbjct  17   LLFSIFISSSPQVNEVSPSS----SEGEMKMMPLMEEK--FMVMNET--RRKLGSFQICS  68

Query  268  ICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
            +C CC  +    C    CCY + C      F  C++ P  CNC  C
Sbjct  69   VCTCCGGAK-GLCLPSPCCYAINCNIPNRPFGYCSFTPKTCNCFGC  113



>gb|KHG06088.1| hypothetical protein F383_05586 [Gossypium arboreum]
Length=125

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 47/94 (50%), Gaps = 7/94 (7%)
 Frame = +1

Query  127  LEKSSFNLSLIEEAEKVLVPVVETKIEFRDIG-DVFGRRKLGDFPKCLICRCCDKSDPKS  303
            L K+S   S      K + P  E ++   D+G D   RR+L  F  CL+C+CC  +   +
Sbjct  31   LVKASATASRSNGEYKPVGPT-EYRLLQPDLGKDDGARRRLAPFQLCLLCKCCSATAAST  89

Query  304  CFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
            C    CC+ + C+     F  C +VP  CNC++C
Sbjct  90   CTSMPCCFGIDCQLPNKPFGVCAFVPKTCNCNSC  123



>ref|XP_006381289.1| hypothetical protein POPTR_0006s11440g [Populus trichocarpa]
 gb|ERP59086.1| hypothetical protein POPTR_0006s11440g [Populus trichocarpa]
Length=140

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 54/126 (43%), Gaps = 17/126 (13%)
 Frame = +1

Query  49   TTMNPATALPMFALVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIG--  222
            T MN +  L +  +   +        ++ S  N SL     + + P      E+R IG  
Sbjct  17   TEMNYSMKLAVLVIFLFIPGQLIISPVQPSPVNTSLTAGEFRPMEPA-----EYRLIGRK  71

Query  223  -----DVFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTA  372
                 D   RR+L  F  CL+C+CC  +   +C    CC+ + C+     +  C +VP  
Sbjct  72   GDDHDDDLWRRRLAPFQLCLLCKCCAGAATTNCATMPCCFGIDCQLPNKPYGVCAFVPKT  131

Query  373  CNCDNC  390
            CNC +C
Sbjct  132  CNCTSC  137



>ref|XP_009411245.1| PREDICTED: uncharacterized protein LOC103993044 [Musa acuminata 
subsp. malaccensis]
Length=104

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 46/97 (47%), Gaps = 21/97 (22%)
 Frame = +1

Query  115  GAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLGDFPKCLICRCCDKSD  294
            GA   EK S       +AE   VPV  T +++R + DV    K     +C  CRCC  +D
Sbjct  23   GASDTEKKS-------DAE--YVPV--TPVKYRPVADVRAAYK-----QCSDCRCCSATD  66

Query  295  PKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
               C    CCY L C         C++ PTACNC+NC
Sbjct  67   QSKCETTKCCYELICNEAVNPAANCSFKPTACNCNNC  103



>ref|XP_010922835.1| PREDICTED: uncharacterized protein LOC105046047 [Elaeis guineensis]
Length=116

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 41/86 (48%), Gaps = 13/86 (15%)
 Frame = +1

Query  166  AEKVLVPVVETKIEFRDIGDVFG------RRKLGDFPKCLICRCCDKSDPKSCFEKNCCY  327
            A + ++P     +E+R I           RR+L  F  CL CRCC  +DP +C    CC+
Sbjct  32   ATQYMLPA--NTVEYRPIDRAVAVDGDGNRRELTPFQLCLDCRCCAANDPNNCSSMPCCF  89

Query  328  RLKCR-----FIACTWVPTACNCDNC  390
             + C      F  C +VP  CNC +C
Sbjct  90   GIDCNLPEKPFGVCAFVPKTCNCTSC  115



>ref|XP_004250097.1| PREDICTED: uncharacterized protein LOC101256442 [Solanum lycopersicum]
Length=111

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 48/113 (42%), Gaps = 20/113 (18%)
 Frame = +1

Query  73   LPMFALVFSLVIAAGAESLEKSSFNLSLIE--EAEKVLVPVVETKIEFRDIGDVFGRRKL  246
             P    V ++   A   S  K S  + LIE  +AEK+++ +  T            RRKL
Sbjct  10   FPFLFFVLAMSTHAAPISQAKGSEMVPLIEPGKAEKMMIMLNNT------------RRKL  57

Query  247  GDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
            G F  C +C CC  +    C    CCY + C      F  C++ P  CNC  C
Sbjct  58   GSFQICALCTCCGGAK-AVCLPTPCCYAINCNIPNRPFGYCSFTPKTCNCFGC  109



>ref|XP_009799713.1| PREDICTED: uncharacterized protein LOC104245748 [Nicotiana sylvestris]
Length=109

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 41/85 (48%), Gaps = 9/85 (11%)
 Frame = +1

Query  151  SLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYR  330
            S +  AE  +VPV+E K+    + +   RRKLG F  C IC CC  +    C    CCY 
Sbjct  27   SHVNGAEPEMVPVIEEKMMVM-LNET--RRKLGSFKICAICTCCGGAK-GYCVPSPCCYA  82

Query  331  LKCR-----FIACTWVPTACNCDNC  390
            + C      F  C++ P  CNC  C
Sbjct  83   INCNIPHRPFGFCSFTPRTCNCFGC  107



>emb|CDP04216.1| unnamed protein product [Coffea canephora]
Length=120

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 54/114 (47%), Gaps = 13/114 (11%)
 Frame = +1

Query  73   LPMFALV---FSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRK  243
            L MF ++   F+L   + A  L ++  N +++ E    +VP++E   E   + +   RRK
Sbjct  10   LSMFIIIVFLFNLPTYSHANGLPEAVKNGTVVGEE---MVPMIEPGKEMMLMLNE-SRRK  65

Query  244  LGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
            LG F  C +C CC       C    CCY + C      F  C+++P  CNC  C
Sbjct  66   LGSFQICALCTCCGARG-GYCLPTPCCYAISCNIPNRPFGFCSFLPKTCNCFGC  118



>ref|XP_010513517.1| PREDICTED: uncharacterized protein LOC104789534 [Camelina sativa]
Length=95

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 18/106 (17%)
 Frame = +1

Query  88   LVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLGDFPKCL  267
            +V  +V+ A   S++K         E E  ++P++E K  F  + +   RRKLG F  C 
Sbjct  1    MVMMMVLMANEVSIKKG--------EGEMKMMPLMEEK--FMVMNET--RRKLGSFQICS  48

Query  268  ICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
            +C CC  +    C    CCY + C      F  C++ P  CNC  C
Sbjct  49   VCTCCGGAK-GLCLPSPCCYAINCNIPNRPFGYCSFTPKTCNCFGC  93



>ref|XP_010278904.1| PREDICTED: uncharacterized protein LOC104612940 [Nelumbo nucifera]
Length=139

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 55/120 (46%), Gaps = 24/120 (20%)
 Frame = +1

Query  88   LVFSLVIAAGAESLEKSSFN-------LSLIEEAE-KVLVPVVETKI--EFRDIGDVFGR  237
            L+  L+I     S   S  +       L  +E AE +VL  +VE K   E R       R
Sbjct  22   LIIQLIICDQGRSYNSSRVDGGGGGEGLIPVEVAEYRVLTELVEGKSGEEGRS-----RR  76

Query  238  RKLGDFPKCLICRCCDKS----DPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
            R+L  F  CL+C+CC  S    DP +C    CC+ + C+     +  C +VP  CNC +C
Sbjct  77   RQLAPFQLCLLCKCCTASAGGGDPSTCLSMPCCFGIDCQLPDKPYGVCAFVPKTCNCTSC  136



>ref|XP_009105146.1| PREDICTED: uncharacterized protein LOC103831050 [Brassica rapa]
Length=116

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 12/112 (11%)
 Frame = +1

Query  70   ALPMFALVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLG  249
            ++ +  L FS+ +    ++ E +S   S  EE E  +VP++E K  F  + +   RRKLG
Sbjct  10   SIVLLLLCFSIFVTFSLQANELTS--PSSKEEGEVRMVPLMEEK--FMVMNET--RRKLG  63

Query  250  DFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
             F  C +C CC  +    C    CC+ + C      F  C++ P +CNC  C
Sbjct  64   SFQICSVCTCCGGAK-GVCLPLPCCFAINCNIPNKPFGYCSFTPKSCNCFGC  114



>ref|XP_006353233.1| PREDICTED: uncharacterized protein LOC102596787 [Solanum tuberosum]
Length=111

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 47/113 (42%), Gaps = 20/113 (18%)
 Frame = +1

Query  73   LPMFALVFSLVIAAGAESLEKSSFNLSLIE--EAEKVLVPVVETKIEFRDIGDVFGRRKL  246
             P    V  +   A   S  K S  + LIE  +AEK+++ +  T            RRKL
Sbjct  10   FPFLFFVLVMSTHAAPISQAKGSEMVPLIEPGKAEKMMIMLNNT------------RRKL  57

Query  247  GDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
            G F  C +C CC  +    C    CCY + C      F  C++ P  CNC  C
Sbjct  58   GSFQICALCTCCGGAK-AVCLPTPCCYAINCNIPNRPFGYCSFTPKTCNCFGC  109



>ref|XP_008244241.1| PREDICTED: uncharacterized protein LOC103342393 isoform X1 [Prunus 
mume]
Length=137

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 56/134 (42%), Gaps = 32/134 (24%)
 Frame = +1

Query  58   NPATALPMFA----LVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGD  225
            NP   +P       L  +  IAAG+ + E       +  +    L PV  T  E+R + D
Sbjct  9    NPIKLVPFLIFTALLAITPAIAAGSHADEYQP----IPNQTAGTLQPVGTT--EYRLLID  62

Query  226  VFG--------------RRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FI  348
            V                RR+L  +  CL+C+CC  +   +C    CC+ + C+     F 
Sbjct  63   VLKAPPHDHDDIQRRQKRRRLAPYQLCLLCKCCSAT---TCTSMPCCFGINCQLPNKPFG  119

Query  349  ACTWVPTACNCDNC  390
             C +VP  CNC NC
Sbjct  120  VCAFVPRTCNCTNC  133



>ref|XP_009127395.1| PREDICTED: uncharacterized protein LOC103852230 [Brassica rapa]
Length=115

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 13/112 (12%)
 Frame = +1

Query  70   ALPMFALVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLG  249
            ++ ++ L FS+   +   SL+ +       EE E  +VP++E K    +      RRKLG
Sbjct  10   SIVLWLLCFSIFFTS---SLQANELTTPSKEEGEMRMVPLLEEKYMVMNET----RRKLG  62

Query  250  DFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
             F  C +C CC  +    C    CC+ + C      F  C++ P +CNC  C
Sbjct  63   SFQICSVCTCCGGAK-GLCLPLPCCFAINCNIPNRPFGYCSFTPKSCNCFGC  113



>emb|CDY39290.1| BnaC06g27010D [Brassica napus]
Length=116

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 12/112 (11%)
 Frame = +1

Query  70   ALPMFALVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLG  249
            ++ +  L FS+      ++ E +S   S  EE E  +VP++E K  F  + +   RRKLG
Sbjct  10   SIVLLLLCFSIFATFSLQANELTS--PSFKEEGEVRMVPLMEEK--FMVMNET--RRKLG  63

Query  250  DFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
             F  C +C CC  +    C    CC+ + C      F  C++ P +CNC  C
Sbjct  64   SFQICSVCTCCGGAK-GVCLPLPCCFAINCNIPNKPFGYCSFTPKSCNCFGC  114



>ref|XP_007206003.1| hypothetical protein PRUPE_ppa012325mg [Prunus persica]
 gb|EMJ07202.1| hypothetical protein PRUPE_ppa012325mg [Prunus persica]
Length=174

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 59/128 (46%), Gaps = 18/128 (14%)
 Frame = +1

Query  52   TMNPATALPMFALVFSLVIAAGAESLE--------KSSFNLSLIEEAEKV--LVPVVETK  201
            TM PA  +  F+L+F L +A    + E         S+   +  ++ +KV  LVP+V  +
Sbjct  48   TMMPAHGV-TFSLIFLLFLATVLTTTEASLTHANGSSAVAAAATDKKDKVEPLVPLVGAE  106

Query  202  IEFRDIGDVFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVP  366
              F+ +     RR+LG F  C +C CC  +    C    CCY + C      F  C++ P
Sbjct  107  -NFKTLVMNETRRRLGSFQICALCTCCGGAK-GLCLPSPCCYAINCNIPNRPFGFCSFTP  164

Query  367  TACNCDNC  390
              CNC  C
Sbjct  165  KTCNCFGC  172



>ref|XP_002987896.1| hypothetical protein SELMODRAFT_126915, partial [Selaginella 
moellendorffii]
 ref|XP_002991291.1| hypothetical protein SELMODRAFT_133265, partial [Selaginella 
moellendorffii]
 gb|EFJ07589.1| hypothetical protein SELMODRAFT_133265, partial [Selaginella 
moellendorffii]
 gb|EFJ10970.1| hypothetical protein SELMODRAFT_126915, partial [Selaginella 
moellendorffii]
Length=70

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 5/58 (9%)
 Frame = +1

Query  232  GRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKC-----RFIACTWVPTACNCDNC  390
             RRKLG F +C  C+CC  +  + C+   CCYR+ C      F  C++VP  CNC  C
Sbjct  13   ARRKLGLFRECAPCKCCSDNTRRYCYYTACCYRIDCFAPGLSFGHCSFVPVTCNCLRC  70



>ref|XP_010470431.1| PREDICTED: uncharacterized protein LOC104750343 [Camelina sativa]
Length=117

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 53/107 (50%), Gaps = 16/107 (15%)
 Frame = +1

Query  88   LVFSLVIAAGAESLEKSSFNLSLIE-EAEKVLVPVVETKIEFRDIGDVFGRRKLGDFPKC  264
            L+FS+ I+   ++ E     +S+ E E E  ++P++E K  F  + +   RRKLG F  C
Sbjct  19   LLFSIFISCSHQANE-----VSIKEGEGEMKMMPLMEEK--FMVMNET--RRKLGSFQIC  69

Query  265  LICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
             +C CC  +    C    CCY + C      F  C++ P  CNC  C
Sbjct  70   SVCTCCGGAK-GLCLPSPCCYAINCNIPNRPFGYCSFTPKTCNCFGC  115



>ref|XP_009600430.1| PREDICTED: uncharacterized protein LOC104095890 [Nicotiana tomentosiformis]
Length=123

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 39/80 (49%), Gaps = 8/80 (10%)
 Frame = +1

Query  166  AEKVLVPVVETKIEFRDIGDVFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-  342
            A+  +VP++E K+    + +   RRKLG F  C +C CC  +    C    CCY + C  
Sbjct  45   AKPEMVPLIEEKMMLVMLNE--SRRKLGSFQICSLCTCCGGAK-GYCLPSPCCYAINCNI  101

Query  343  ----FIACTWVPTACNCDNC  390
                F  C++ P  CNC  C
Sbjct  102  PNRPFGFCSFTPKTCNCFGC  121



>ref|XP_006303018.1| hypothetical protein CARUB_v10021174mg [Capsella rubella]
 gb|EOA35916.1| hypothetical protein CARUB_v10021174mg [Capsella rubella]
Length=114

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 40/81 (49%), Gaps = 10/81 (12%)
 Frame = +1

Query  163  EAEKVLVPVVETKIEFRDIGDVFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR  342
            E E ++VP++E K  F  + +   RRKLG F  C +C CC  +    C    CCY + C 
Sbjct  37   EGEMMMVPLMEEK--FMVMNET--RRKLGSFQICSVCTCCGGAK-GLCLPSPCCYAINCN  91

Query  343  -----FIACTWVPTACNCDNC  390
                 F  C++ P  CNC  C
Sbjct  92   IPNRPFGYCSFTPKTCNCFGC  112



>ref|XP_010070148.1| PREDICTED: uncharacterized protein LOC104456935 [Eucalyptus grandis]
 gb|KCW58745.1| hypothetical protein EUGRSUZ_H01385 [Eucalyptus grandis]
Length=116

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 9/81 (11%)
 Frame = +1

Query  166  AEKVLVPVVET-KIEFRDIGDVFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR  342
            AE+ ++P+VE  K E  ++ +   RR+LG F  C +C CC  +    C    CCY + C 
Sbjct  37   AEEEMMPLVEQGKFEMVELNET--RRRLGSFQICALCTCCGGAR-GVCLPSPCCYAINCN  93

Query  343  -----FIACTWVPTACNCDNC  390
                 F  C++ P  CNC  C
Sbjct  94   IPNRPFGFCSFTPKTCNCFGC  114



>ref|XP_001751277.1| predicted protein [Physcomitrella patens]
 gb|EDQ83594.1| predicted protein [Physcomitrella patens]
Length=85

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 41/86 (48%), Gaps = 9/86 (10%)
 Frame = +1

Query  148  LSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCY  327
            L L    E  L P  ET+I     G    RRKLG F +C  C CCDK+  + C    CCY
Sbjct  2    LRLTNGTELQLFPTSETQIHEHVNGT---RRKLGVFRQCSPCTCCDKTR-RWCLPTFCCY  57

Query  328  RLKCR-----FIACTWVPTACNCDNC  390
             + C      +  C+++P +C C  C
Sbjct  58   NILCGVQGLPYGLCSFIPISCACFGC  83



>emb|CDY07445.1| BnaA07g25240D [Brassica napus]
Length=116

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 12/112 (11%)
 Frame = +1

Query  70   ALPMFALVFSLVIAAGAESLEKSSFNLSLIEEAEKVLVPVVETKIEFRDIGDVFGRRKLG  249
            ++ +  L FS+      ++ E +S   S  EE E  +VP++E K  F  + +   RRKLG
Sbjct  10   SIVLLLLCFSIFFTFSLQANELTS--PSSKEEGEVRMVPLMEEK--FMVMNET--RRKLG  63

Query  250  DFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----FIACTWVPTACNCDNC  390
             F  C +C CC  +    C    CC+ + C      F  C++ P +CNC  C
Sbjct  64   SFQICSVCTCCGGAK-GVCLPLPCCFAINCNIPNKPFGYCSFTPKSCNCFGC  114



>ref|XP_008804651.1| PREDICTED: uncharacterized protein LOC103717879 [Phoenix dactylifera]
Length=102

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 37/75 (49%), Gaps = 13/75 (17%)
 Frame = +1

Query  202  IEFRDI-------GDVFGRRKLGDFPKCLICRCCDKSDPKSCFEKNCCYRLKCR-----F  345
            +E+R I       GD   RR+L  F  C  CRCC  +DP +C    CC+ + C      F
Sbjct  28   VEYRPIDRAVAMDGDA-NRRELAPFQLCQECRCCATNDPNNCSSMPCCFSIDCNLPDKPF  86

Query  346  IACTWVPTACNCDNC  390
              C +VP  CNC +C
Sbjct  87   GVCAFVPKTCNCTSC  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506530704576