BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22607_g1_i2 len=431 path=[519:0-82 1918:83-88 1924:89-91 608:92-107
1957:108-118 635:119-146 370:147-189 704:190-207 43:208-231
2059:232-239 753:240-253 767:254-284 105:285-430]

Length=431
                                                                      Score     E

gb|AAN44146.1|  hypothetical protein SF2650                           85.5    5e-18   Shigella flexneri
gb|AGO88040.1|  hypothetical protein                                  82.8    9e-17   
ref|WP_001896259.1|  hypothetical protein                             68.6    2e-14   
ref|XP_003588326.1|  ATP synthase subunit alpha                       57.0    7e-12   
gb|AGC78945.1|  hypothetical protein                                  54.7    2e-11   
gb|EHN95545.1|  hypothetical protein ESOG_04481                       51.6    4e-11   
gb|EGX75147.1|  hypothetical protein HMPREF9022_02480                 65.9    1e-10   
gb|ELC06673.1|  hypothetical protein WCM_04769                        63.9    5e-10   
gb|ELD18608.1|  hypothetical protein A15U_04539                       63.9    5e-10   
gb|EKZ75334.1|  hypothetical protein O7E_02948                        63.9    5e-10   
ref|WP_005956515.1|  hypothetical protein                             61.6    2e-09   
gb|EFA28344.1|  3,4-dihydroxy-2-butanone-4-phosphate synthase         62.8    2e-09   Haemophilus influenzae HK1212
gb|EQW37646.1|  hypothetical protein G903_04242                       60.8    6e-09   
gb|EGU94755.1|  hypothetical protein HMPREF9349_05376                 56.6    7e-09   
gb|EFE20963.1|  hypothetical protein EDWATA_04070                     57.8    2e-08   Edwardsiella tarda ATCC 23685
emb|CDZ90521.1|  conserved hypothetical protein                       58.5    3e-08   
gb|AHM55305.1|  hypothetical protein CF60_26395                       57.0    6e-08   
ref|WP_014413225.1|  hypothetical protein                             56.6    1e-07   
emb|CDG40808.1|  conserved hypothetical protein                       57.8    3e-07   
emb|CCH69100.1|  conserved hypothetical protein                       54.7    6e-07   
emb|CDX71650.1|  BnaC09g26910D                                        55.1    9e-07   
emb|CDY45547.1|  BnaCnng13060D                                        55.1    1e-06   
emb|CDY01184.1|  BnaA04g06350D                                        55.1    1e-06   
emb|CDY63600.1|  BnaUnng00870D                                        55.5    1e-06   
emb|CDY19671.1|  BnaC09g29270D                                        55.1    1e-06   
ref|XP_003599577.1|  hypothetical protein MTR_3g035650                46.6    2e-06   
ref|XP_007156921.1|  hypothetical protein PHAVU_002G028400g           51.6    4e-06   
gb|EGK56654.1|  hypothetical protein HMPREF9081_2554                  50.8    5e-06   
ref|XP_006837986.1|  hypothetical protein AMTR_s00102p00104790        51.6    8e-06   
gb|AGO87878.1|  hypothetical protein                                  51.2    1e-05   
gb|EDM98343.1|  hypothetical protein BACCAP_03829                     50.1    1e-05   Pseudoflavonifractor capillosus ATCC 29799
gb|EDM97734.1|  hypothetical protein BACCAP_04477                     50.1    1e-05   Pseudoflavonifractor capillosus ATCC 29799
gb|KGN55456.1|  hypothetical protein Csa_4G652690                     50.4    2e-05   
emb|CDW93815.1|  conserved hypothetical protein                       47.8    1e-04   
gb|EFL01765.1|  conserved hypothetical protein                        47.0    1e-04   
emb|CDN41091.1|  hypothetical protein BN871_AB_00890                  47.0    1e-04   
emb|CBA31938.1|  hypothetical protein Csp_D29620                      46.6    1e-04   Curvibacter putative symbiont of Hydra magnipapillata
emb|CCI51800.1|  conserved hypothetical protein                       47.4    1e-04   
emb|CAJ30041.1|  hypothetical protein mgI381                          46.2    2e-04   Magnetospirillum gryphiswaldense
emb|CDN43035.1|  hypothetical protein BN871_CK_00020                  46.6    2e-04   
gb|ABC25210.1|  conserved hypothetical protein                        45.4    3e-04   uncultured marine bacterium Ant4D3
gb|EGC73343.1|  hypothetical protein HMPREF0490_02918                 45.8    3e-04   
gb|KGD56284.1|  hypothetical protein DP49_2425                        45.8    3e-04   
gb|KGD57980.1|  hypothetical protein DP49_5430                        45.8    3e-04   
ref|WP_012468054.1|  hypothetical protein                             45.8    3e-04   
gb|ADI18288.1|  hypothetical protein                                  45.1    4e-04   
gb|KGC56842.1|  hypothetical protein DM75_2176                        45.8    4e-04   
ref|XP_003627937.1|  hypothetical protein MTR_8g040260                38.9    5e-04   
emb|CDN46171.1|  hypothetical protein BN871_LE_00010                  45.1    5e-04   
ref|WP_039847189.1|  hypothetical protein                             45.4    5e-04   
gb|AGC71899.1|  ribokinase                                            45.1    6e-04   
gb|EGW50004.1|  hypothetical protein HMPREF1022_03007                 46.6    7e-04   
ref|WP_003271563.1|  hypothetical protein                             43.9    0.001   



>gb|AAN44146.1| hypothetical protein SF2650 [Shigella flexneri 2a str. 301]
Length=134

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = +3

Query  15   VWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRYPPLL  194
            +WLV+LSDQL IVALVS Y TN LI    ++  E RRSP+   R YAVLA +S  YPP  
Sbjct  1    MWLVILSDQLGIVALVSRYPTNKLIPSGHIRWQEARRSPSLVLRRYAVLATVSSSYPPPS  60

Query  195  GTFRCITHPFATrrqarlpppalpFDLHV*SMPPAFNLSQDQTLQFNS  338
            G+F  ITHP AT RQ       LPFDLHV  +PPAFNLS DQTLQF S
Sbjct  61   GSFPDITHPSAT-RQRSSKRFLLPFDLHVLGLPPAFNLSHDQTLQFKS  107



>gb|AGO88040.1| hypothetical protein [uncultured bacterium 122006-I05]
Length=162

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRY  182
            +S+PVWL++LSDQL I+ALVS YLTN LI HRP+QKH+ + + T + + +A L+ +S  +
Sbjct  52   ISIPVWLIILSDQLPIIALVSFYLTNKLIGHRPIQKHDPKTALTTYPKGFAALSGISPAF  111

Query  183  PPLLGTFRCITHPFATr-rqarlpppalpFDLHV*SMPPAFNLSQDQTLQ  329
              L  +   +T+   TR      P   +  DLHV   PPA  LSQDQTL 
Sbjct  112  AGLSQSLGQVTYALLTRPPVYLFPEGNVLLDLHVLGTPPALVLSQDQTLH  161



>ref|WP_001896259.1| hypothetical protein [Vibrio cholerae]
 gb|EAX56522.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
Length=108

 Score = 68.6 bits (166),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +2

Query  17   VAGRPLRPATDRRLGEPLPHQLANQTSAAPKA*GPKIPHFLP*NVCGISVTFATLSP  187
            +A  PLRPA DRRLGEPLPHQLAN T A P A GPK+P F    +CGIS  F  LSP
Sbjct  1    MADHPLRPARDRRLGEPLPHQLANPTWAYPVAQGPKVPCFALXRLCGISHRFQWLSP  57


 Score = 36.6 bits (83),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  267  FDLHV*SMPPAFNLSQDQTLQFN  335
             DLHV  +PPAFNLS DQTLQ  
Sbjct  84   LDLHVLGLPPAFNLSHDQTLQLK  106



>ref|XP_003588326.1| ATP synthase subunit alpha [Medicago truncatula]
Length=1116

 Score = 57.0 bits (136),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 44/76 (58%), Gaps = 15/76 (20%)
 Frame = +3

Query  3     VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRY  182
             VSVPVWL++  DQL I+ LVSLYLTN LI  R +++    R   FFR            +
Sbjct  996   VSVPVWLIIRKDQLSIIGLVSLYLTNYLILRRLIKQ----RFLAFFR-----------IW  1040

Query  183   PPLLGTFRCITHPFAT  230
             P L G F  ITHPFAT
Sbjct  1041  PELFGRFPRITHPFAT  1056


 Score = 39.3 bits (90),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  266   VRLACVKHAASVQSEPGSNSS  328
             VRLACVKH ASV SEPGSNSS
Sbjct  1087  VRLACVKHIASVPSEPGSNSS  1107



>gb|AGC78945.1| hypothetical protein (mitochondrion) [Vicia faba]
Length=187

 Score = 54.7 bits (130),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 44/76 (58%), Gaps = 15/76 (20%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRY  182
            VSVPVWL++  DQL I+ LVSLYLTN LI  R +++    R   FFR            +
Sbjct  67   VSVPVWLIIRKDQLSIIGLVSLYLTNYLILRRLIKQ----RFLAFFR-----------IW  111

Query  183  PPLLGTFRCITHPFAT  230
            P L G F  ITHPFAT
Sbjct  112  PELFGRFPRITHPFAT  127


 Score = 39.7 bits (91),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  266  VRLACVKHAASVQSEPGSNSSV  331
            VRLACVKH ASV SEPGSNSS 
Sbjct  158  VRLACVKHIASVPSEPGSNSSF  179



>gb|EHN95545.1| hypothetical protein ESOG_04481, partial [Escherichia coli E101]
Length=125

 Score = 51.6 bits (122),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +2

Query  47   DRRLGEPLPHQLANQTSAAPKA*GPKIPHFLP*NVCGISVTFATLSP  187
            DRRLGEPLPH LAN   A P A GPK+P F    +CGIS  F  + P
Sbjct  2    DRRLGEPLPHLLANPIWAHPMARGPKVPLFGLATLCGISYRFQYVIP  48


 Score = 42.4 bits (98),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +3

Query  267  FDLHV*SMPPAFNLSQDQTLQFNS  338
            FDLHV  +PPAFNLS DQTLQF S
Sbjct  75   FDLHVLGLPPAFNLSHDQTLQFKS  98



>gb|EGX75147.1| hypothetical protein HMPREF9022_02480 [Erysipelotrichaceae bacterium 
2_2_44A]
Length=196

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 57/105 (54%), Gaps = 9/105 (9%)
 Frame = +2

Query  29   PLRPATDRRLGEPLPHQLAN--QTSAAPKA*GP-KIPHFLP*NVCGISVTFATLSPTSG-  196
            PLRPAT  RLG PLPHQLAN  Q     +  G   I       + G S  F  LS T G 
Sbjct  3    PLRPATHHRLGGPLPHQLANAPQVHPCSRLDGRFNILSMRSVYLSGFSYRFQQLSRTHGQ  62

Query  197  --YVPMYYSPVRHSPPGEVAPARAAVRLACVKHAASVQSEPGSNS  325
              YV +  SP+  S  G   P R  VRLAC++HAASV  EPGSNS
Sbjct  63   VTYVLLTRSPL--SLFGSKLP-RVFVRLACIRHAASVHPEPGSNS  104



>gb|ELC06673.1| hypothetical protein WCM_04769, partial [Escherichia coli KTE10]
Length=151

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRY  182
            VSVPVWLV+LSDQL IVALVS Y TN LI    ++  E RRSP+   R YAVLA +S  Y
Sbjct  49   VSVPVWLVILSDQLGIVALVSRYPTNKLIPSGHIRWQEARRSPSLVLRHYAVLATVSSSY  108

Query  183  PPLLGTFRCITHPFAT  230
            PP  G+F  ITHP AT
Sbjct  109  PPPSGSFPDITHPSAT  124



>gb|ELD18608.1| hypothetical protein A15U_04539, partial [Escherichia coli KTE210]
Length=151

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRY  182
            VSVPVWLV+LSDQL IVALVS Y TN LI    ++  E RRSP+   R YAVLA +S  Y
Sbjct  49   VSVPVWLVILSDQLGIVALVSRYPTNKLIPSGHIRWQEARRSPSLVLRRYAVLATVSSSY  108

Query  183  PPLLGTFRCITHPFAT  230
            PP  G+F  ITHP AT
Sbjct  109  PPPSGSFPDITHPSAT  124



>gb|EKZ75334.1| hypothetical protein O7E_02948, partial [Escherichia coli O104:H4 
str. Ec11-5604]
 gb|EKZ77907.1| hypothetical protein S7Y_04888, partial [Escherichia coli O104:H4 
str. Ec12-0465]
 gb|EKZ94644.1| hypothetical protein MO7_05239, partial [Escherichia coli O104:H4 
str. Ec11-9941]
Length=151

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRY  182
            VSVPVWLV+LSDQL IVALVS Y TN LI    ++  E RRSP+   R YAVLA +S  Y
Sbjct  49   VSVPVWLVILSDQLGIVALVSRYPTNKLIPSGHIRWQEARRSPSLVLRRYAVLATVSSSY  108

Query  183  PPLLGTFRCITHPFAT  230
            PP  G+F  ITHP AT
Sbjct  109  PPPSGSFPDITHPSAT  124



>ref|WP_005956515.1| hypothetical protein, partial [Fusobacterium necrophorum]
 gb|EHO16112.1| hypothetical protein HMPREF9466_03173, partial [Fusobacterium 
necrophorum subsp. funduliforme 1_1_36S]
Length=126

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 59/106 (56%), Gaps = 8/106 (8%)
 Frame = +2

Query  20   AGR-PLRPATDRRLGEPLPHQLANQTSAAPKA-*GPKIPHFLP*NVCGISVTFATLSPTS  193
             GR PLRPAT   LG PLPHQLAN T ++  A     IP      + GIS+ F  LS + 
Sbjct  1    CGRSPLRPATHHCLGGPLPHQLANGTQSSLLAHLAFMIPPCEKTIISGISIRFQMLSRSK  60

Query  194  GYVPMYYSPVRHSPPGEVAPARAAVRLACVKHAASVQSEPGSNSSV  331
              V   Y+ +  +PP     +  + RLACVKH+ SV  EPGSNSS 
Sbjct  61   RQV--LYALLTRAPP----KSEDSSRLACVKHSVSVHPEPGSNSSF  100



>gb|EFA28344.1| 3,4-dihydroxy-2-butanone-4-phosphate synthase [Haemophilus influenzae 
HK1212]
Length=244

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRY  182
            VSVPVWLV+LSDQL I  LV LY TN LI    +  H   +S TF  R YAVLA +S RY
Sbjct  182  VSVPVWLVILSDQLEIAGLVGLYPTNYLIPLGLILWHAASQSRTFVSRHYAVLATVSRRY  241

Query  183  PP  188
            PP
Sbjct  242  PP  243



>gb|EQW37646.1| hypothetical protein G903_04242, partial [Escherichia coli UMEA 
3053-1]
Length=146

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRY  182
            VSVPVWLV+LSDQL IVALVS Y TN LI    ++  E  RSP+   R YAVLA +S  Y
Sbjct  44   VSVPVWLVILSDQLGIVALVSRYPTNKLIPSGHIRWQEALRSPSLVLRRYAVLATVSSSY  103

Query  183  PPLLGTFRCITHPFAT  230
            PP  G+F  ITHP AT
Sbjct  104  PPPSGSFPDITHPSAT  119



>gb|EGU94755.1| hypothetical protein HMPREF9349_05376 [Escherichia coli MS 79-10]
Length=99

 Score = 56.6 bits (135),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  15   VWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRYPPLL  194
            +WLV+LSDQL IVALVS Y TN LI    ++  E RRSP+   R YAVLA +S  YPP  
Sbjct  1    MWLVILSDQLGIVALVSRYPTNKLIPSGHIRWQEARRSPSLVLRRYAVLATVSSSYPPPS  60

Query  195  GTFRCITHPFAT  230
            G+F  ITHP AT
Sbjct  61   GSFPDITHPSAT  72


 Score = 29.6 bits (65),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +2

Query  263  AVRLACVKHAASVQSEP  313
             VRLACV+ AASVQSEP
Sbjct  83   TVRLACVRPAASVQSEP  99



>gb|EFE20963.1| hypothetical protein EDWATA_04070 [Edwardsiella tarda ATCC 23685]
Length=66

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +3

Query  144  RTYAVLA*LSLRYPPLLGTFRCITHPFATrrqarlpppalpFDLHV*SMPPAFNLSQDQT  323
            R YAVLA +S  YPP  G    ITHP A R++ +     LP DLHV S+PPAFNLS DQT
Sbjct  2    RRYAVLATVSSSYPPPSGRSPDITHPSAARQRRKQAFSLLPLDLHVLSLPPAFNLSHDQT  61

Query  324  LQFNS  338
            LQ  +
Sbjct  62   LQLKA  66



>emb|CDZ90521.1| conserved hypothetical protein [Rhodococcus ruber]
 emb|CDZ90311.1| conserved hypothetical protein [Rhodococcus ruber]
Length=161

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 60/117 (51%), Gaps = 18/117 (15%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTY-------AVL  161
            VSVPVW V LS +L +VALV  Y TN LI           R P   R+T+        VL
Sbjct  55   VSVPVWPVALSGRLPVVALVGRYPTNKLI----------GRGPILHRKTFPPRNMHPEVL  104

Query  162  A*LSLRYPPLLGTFRCITHPFATrrqarlppp-alpFDLHV*SMPPAFNLSQDQTLQ  329
            + +   +P L  +   ITH   TR     P   A  FDLHV S PPAF LSQDQTL+
Sbjct  105  SGIRPSFPGLSRSAGQITHVLLTRSPLIHPASWASSFDLHVLSTPPAFVLSQDQTLR  161



>gb|AHM55305.1| hypothetical protein CF60_26395 [Escherichia coli]
Length=85

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  32   LRPATDRRLGEPLPHQLANQTSAAPKA*GPKIPHFLP*NVCGISVTF  172
            LRPA DRRLGEPLPH LAN   A P A GPK+P F    +CGIS  F
Sbjct  38   LRPARDRRLGEPLPHLLANPIWAHPMARGPKVPLFGLATLCGISYRF  84



>ref|WP_014413225.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415550.1| hypothetical protein RSPPHO_03241, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06580.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum 
DSM 122]
Length=105

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 38/65 (58%), Gaps = 5/65 (8%)
 Frame = +2

Query  38   PATDRRLGEPLPHQLANQTSAAPKA*GPKIPHFLP*NVCGISVTFATLSPTSGYVPMYYS  217
            PATDRRLG PLP QLAN+T A   A       F P  V GIS  F  L  T  YVP  YS
Sbjct  36   PATDRRLGGPLPRQLANRTRADLGA-----KFFPPKGVYGISPRFQGLFRTPRYVPTCYS  90

Query  218  PVRHS  232
            PVRHS
Sbjct  91   PVRHS  95



>emb|CDG40808.1| conserved hypothetical protein [Asaia platycodi SF2.1]
Length=349

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 46/76 (61%), Gaps = 4/76 (5%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRY  182
            VSVPVWL++LSDQL I+ALV LY TN LI  R L     RR      R +AVLA +S  Y
Sbjct  37   VSVPVWLIILSDQLSIIALVGLYPTNKLIERRLLH----RRLAPLTLRYHAVLAPVSRCY  92

Query  183  PPLLGTFRCITHPFAT  230
            PP +      THP AT
Sbjct  93   PPPMDRSLRDTHPSAT  108


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = +2

Query  173  ATLSPTSG-YVPMYYSPVRHSPPGEVAPARAAVRLACVKHAASVQSEPGSNSSV*F  337
            A L+P S  Y P     +R + P    P R+ VRLACVKHAASV+SEPGSNS V F
Sbjct  83   AVLAPVSRCYPPPMDRSLRDTHPSATHPERS-VRLACVKHAASVRSEPGSNSQVQF  137



>emb|CCH69100.1| conserved hypothetical protein [Tetrasphaera elongata Lp2]
Length=130

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 60/110 (55%), Gaps = 4/110 (4%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRY  182
            VSVPVW V LS +L +VALVS YLTN LI    +     R++         +++ +S  +
Sbjct  24   VSVPVWPVALSGRLPVVALVSHYLTNKLIGRESIPD---RKTFQTVEMPLRLVSGISSCF  80

Query  183  PPLLGTFRCITHPFATrr-qarlpppalpFDLHV*SMPPAFNLSQDQTLQ  329
              L  +   +TH   TR         + PFDLHV S PPAF LSQDQTL+
Sbjct  81   QLLFQSLGQVTHVLLTRSPLIGGASSSSPFDLHVLSTPPAFVLSQDQTLR  130



>emb|CDX71650.1| BnaC09g26910D [Brassica napus]
Length=211

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    CLSPSVAGRPLRPATDRRLGEPLPHQLANQTSAAPKA  112
            CLSPSVA  PL PATD RLG+ LPHQLANQT A P+A
Sbjct  129  CLSPSVADHPLGPATDHRLGKLLPHQLANQTRAPPRA  165



>emb|CDY45547.1| BnaCnng13060D [Brassica napus]
Length=236

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    CLSPSVAGRPLRPATDRRLGEPLPHQLANQTSAAPKA  112
            CLSPSVA  PL PATD RLG+ LPHQLANQT A P+A
Sbjct  154  CLSPSVADHPLGPATDHRLGKLLPHQLANQTRAPPRA  190



>emb|CDY01184.1| BnaA04g06350D [Brassica napus]
 emb|CDX95215.1| BnaC09g16550D [Brassica napus]
Length=236

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    CLSPSVAGRPLRPATDRRLGEPLPHQLANQTSAAPKA  112
            CLSPSVA  PL PATD RLG+ LPHQLANQT A P+A
Sbjct  154  CLSPSVADHPLGPATDHRLGKLLPHQLANQTRAPPRA  190



>emb|CDY63600.1| BnaUnng00870D [Brassica napus]
Length=282

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    CLSPSVAGRPLRPATDRRLGEPLPHQLANQTSAAPKA  112
            CLSPSVA  PL PATD RLG+ LPHQLANQT A P+A
Sbjct  154  CLSPSVADHPLGPATDHRLGKLLPHQLANQTRAPPRA  190



>emb|CDY19671.1| BnaC09g29270D [Brassica napus]
Length=244

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    CLSPSVAGRPLRPATDRRLGEPLPHQLANQTSAAPKA  112
            CLSPSVA  PL PATD RLG+ LPHQLANQT A P+A
Sbjct  162  CLSPSVADHPLGPATDHRLGKLLPHQLANQTRAPPRA  198



>ref|XP_003599577.1| hypothetical protein MTR_3g035650 [Medicago truncatula]
 gb|AES69828.1| hypothetical protein MTR_3g035650 [Medicago truncatula]
Length=128

 Score = 46.6 bits (109),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  8    SPSVAGRPLRPATDRRLGEPLPHQLANQTSAAPKA  112
            SP VA  PL PATD RLG+ LPHQLANQT A P A
Sbjct  40   SPLVADHPLGPATDHRLGKLLPHQLANQTRAPPWA  74


 Score = 28.1 bits (61),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/12 (100%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = +1

Query  268  STCMCKACRQRS  303
            STCMCKACRQRS
Sbjct  116  STCMCKACRQRS  127


 Score = 22.3 bits (46),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 17/33 (52%), Gaps = 0/33 (0%)
 Frame = +3

Query  132  TFFRRTYAVLA*LSLRYPPLLGTFRCITHPFAT  230
            +F    Y VLA +S    P  G F  +THP AT
Sbjct  77   SFRSSAYGVLAAVSSCCSPPKGRFLRVTHPSAT  109



>ref|XP_007156921.1| hypothetical protein PHAVU_002G028400g [Phaseolus vulgaris]
 gb|ESW28915.1| hypothetical protein PHAVU_002G028400g [Phaseolus vulgaris]
Length=86

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    LSPSVAGRPLRPATDRRLGEPLPHQLANQTSAAPKA  112
            LSPSV   PL PATD RLG+ LPHQLANQT A P+A
Sbjct  19   LSPSVVDHPLGPATDHRLGKLLPHQLANQTQAPPRA  54



>gb|EGK56654.1| hypothetical protein HMPREF9081_2554 [Centipeda periodontii DSM 
2778]
Length=59

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQK  110
            VSVP+W  +LSD+LLIVALVS YLTN LIR RP+ +
Sbjct  24   VSVPMWPFILSDRLLIVALVSRYLTNQLIRRRPIDR  59



>ref|XP_006837986.1| hypothetical protein AMTR_s00102p00104790 [Amborella trichopoda]
 gb|ERN00555.1| hypothetical protein AMTR_s00102p00104790 [Amborella trichopoda]
Length=131

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPL  104
            VS+PVWL++LSDQLLIVALVS  L N LIRH PL
Sbjct  84   VSIPVWLIILSDQLLIVALVSYCLANYLIRHEPL  117



>gb|AGO87878.1| hypothetical protein [uncultured bacterium FPPP_33K14]
Length=135

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +3

Query  3    VSVPVWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFF-RRTYAVL  161
            +S+PVWL++LSDQL I+ALV  Y TN LI  RP+ K E + + T   RR Y ++
Sbjct  80   ISIPVWLIILSDQLPIIALVGHYPTNKLIGRRPILKCEPKPALTIVPRRIYCII  133



>gb|EDM98343.1| hypothetical protein BACCAP_03829 [Pseudoflavonifractor capillosus 
ATCC 29799]
Length=84

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 40/68 (59%), Gaps = 9/68 (13%)
 Frame = +2

Query  17   VAGRPLRPATDRRLGEPLPHQLANQTSAAPKA*GPKIPHFLP*N-----VCGISVTFATL  181
            +AG+PL PATDRRLG PLP QLANQT    +A    I  + P +     +CGIS  F  L
Sbjct  1    MAGQPLSPATDRRLGGPLPRQLANQTRGHLRA----INLWQPVSCDSAALCGISSPFGLL  56

Query  182  SPTSGYVP  205
             PT   VP
Sbjct  57   FPTPRQVP  64



>gb|EDM97734.1| hypothetical protein BACCAP_04477 [Pseudoflavonifractor capillosus 
ATCC 29799]
Length=84

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 40/68 (59%), Gaps = 9/68 (13%)
 Frame = +2

Query  17   VAGRPLRPATDRRLGEPLPHQLANQTSAAPKA*GPKIPHFLP*N-----VCGISVTFATL  181
            +AG+PL PATDRRLG PLP QLANQT    +A    I  + P +     +CGIS  F  L
Sbjct  1    MAGQPLSPATDRRLGGPLPRQLANQTRGHLRA----INLWQPVSCDSAALCGISSPFGLL  56

Query  182  SPTSGYVP  205
             PT   VP
Sbjct  57   FPTPRQVP  64



>gb|KGN55456.1| hypothetical protein Csa_4G652690 [Cucumis sativus]
Length=120

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    LSPSVAGRPLRPATDRRLGEPLPHQLANQTSAAPKA  112
            + PSVA  PL PATD RLG+ LPHQLANQT A P+A
Sbjct  13   IFPSVADHPLGPATDHRLGKLLPHQLANQTRAPPRA  48



>emb|CDW93815.1| conserved hypothetical protein [Thiomonas sp. CB2]
Length=99

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   VSVPVWLVVLSDQLLIVALVSLYLTN  80
           VSVPVWLVVLSDQL IVALVSLYLTN
Sbjct  74  VSVPVWLVVLSDQLRIVALVSLYLTN  99



>gb|EFL01765.1| conserved hypothetical protein [Streptomyces sp. SPB78]
Length=69

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 38/75 (51%), Gaps = 13/75 (17%)
 Frame = +2

Query  26   RPLRPATDRRLGEPLPHQLANQTSAAPKA*GPKIPHFLP*NVCGISVTFATLSPTS----  193
            RPLRPAT RRLGEPLPHQLA++  A P       P  L          +  L P S    
Sbjct  1    RPLRPATRRRLGEPLPHQLADRPRAHP------APPELSTAKDAQGSEYPVLDPVSRACP  54

Query  194  ---GYVPMYYSPVRH  229
               G +P  YSPVRH
Sbjct  55   RVQGRLPTCYSPVRH  69



>emb|CDN41091.1| hypothetical protein BN871_AB_00890 [Paenibacillus sp. P22]
Length=61

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 35/61 (57%), Gaps = 3/61 (5%)
 Frame = +2

Query  17   VAGRPLRPATDRRLGEPLPHQLANQTSAAPKA*GPKI---PHFLP*NVCGISVTFATLSP  187
            +A  PLR AT RRLGEPLPHQLAN   A P+A    +   P      + GIS+ F  LS 
Sbjct  1    MADHPLRSATHRRLGEPLPHQLANAPQAHPQATDCSVFPDPSRRRDRISGISIRFRRLSQ  60

Query  188  T  190
            +
Sbjct  61   S  61



>emb|CBA31938.1| hypothetical protein Csp_D29620 [Curvibacter putative symbiont 
of Hydra magnipapillata]
Length=57

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  3   VSVPVWLVVLSDQLLIVALVSLYLTN*LI  89
           VSVPVWLVVLSDQL IV LVSLYLTN LI
Sbjct  29  VSVPVWLVVLSDQLQIVGLVSLYLTNYLI  57



>emb|CCI51800.1| conserved hypothetical protein [Tetrasphaera jenkinsii Ben 74]
Length=103

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 4/106 (4%)
 Frame = +3

Query  15   VWLVVLSDQLLIVALVSLYLTN*LIRHRPLQKHEVRRSPTFFRRTYAVLA*LSLRYPPLL  194
            +W V LS +L +VALVS YLTN LI    +   +  ++     R   +++ +S  +  L 
Sbjct  1    MWPVALSGRLPVVALVSRYLTNKLIGRESIPDRKTFQTVAMRLR---LVSGISSCFQLLF  57

Query  195  GTFRCITHPFATrrqarlpppalp-FDLHV*SMPPAFNLSQDQTLQ  329
             +   +TH   TR        +   FDLHV S PPAF LSQDQTL+
Sbjct  58   QSLGQVTHVLLTRSPLIRGASSSSPFDLHVLSTPPAFVLSQDQTLR  103



>emb|CAJ30041.1| hypothetical protein mgI381 [Magnetospirillum gryphiswaldense 
MSR-1]
Length=43

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  17  VAGRPLRPATDRRLGEPLPHQLANQTSA  100
           +A  PLRPATDRRLGEPLPHQL N+T A
Sbjct  1   MADHPLRPATDRRLGEPLPHQLPNRTRA  28



>emb|CDN43035.1| hypothetical protein BN871_CK_00020 [Paenibacillus sp. P22]
Length=61

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 35/61 (57%), Gaps = 3/61 (5%)
 Frame = +2

Query  17   VAGRPLRPATDRRLGEPLPHQLANQTSAAPKA*GPKI---PHFLP*NVCGISVTFATLSP  187
            +A  PLR AT RRLGEPLPHQLAN   A P+A    +   P      + GIS+ F  LS 
Sbjct  1    MADHPLRSATHRRLGEPLPHQLANAPQAHPQATDCSVFPGPSRRRDRISGISIRFRRLSQ  60

Query  188  T  190
            +
Sbjct  61   S  61



>gb|ABC25210.1| conserved hypothetical protein [uncultured marine bacterium Ant4D3]
Length=35

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  17   VAGRPLRPATDRRLGEPLPHQLANQTSAAPKA*G  118
            +A  PLRPA DRRLGEPLPHQLAN T A   A G
Sbjct  1    MADHPLRPARDRRLGEPLPHQLANLTQAHQIAKG  34



>gb|EGC73343.1| hypothetical protein HMPREF0490_02918, partial [Lachnospiraceae 
bacterium 6_1_37FAA]
Length=58

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  20  AGRPLRPATDRRLGEPLPHQLANQT  94
           A  PLRPATDRRLG PLPHQLANQT
Sbjct  1   AVHPLRPATDRRLGGPLPHQLANQT  25



>gb|KGD56284.1| hypothetical protein DP49_2425 [Burkholderia pseudomallei]
Length=69

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   VSVPVWLVVLSDQLLIVALVSLYLTN  80
           VSVPVWLVVLSDQLLIVALV LY TN
Sbjct  44  VSVPVWLVVLSDQLLIVALVGLYPTN  69



>gb|KGD57980.1| hypothetical protein DP49_5430 [Burkholderia pseudomallei]
Length=62

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   VSVPVWLVVLSDQLLIVALVSLYLTN  80
           VSVPVWLVVLSDQLLIVALV LY TN
Sbjct  37  VSVPVWLVVLSDQLLIVALVGLYPTN  62



>ref|WP_012468054.1| hypothetical protein [Burkholderia multivorans]
 ref|YP_001949473.1| hypothetical protein BMULJ_05098 [Burkholderia multivorans ATCC 
17616]
 dbj|BAG46937.1| conserved hypothetical protein [Burkholderia multivorans ATCC 
17616]
Length=62

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   VSVPVWLVVLSDQLLIVALVSLYLTN  80
           VSVPVWLVVLSDQLLIVALV LY TN
Sbjct  37  VSVPVWLVVLSDQLLIVALVGLYPTN  62



>gb|ADI18288.1| hypothetical protein [uncultured Chromatiales bacterium HF0200_41F04]
Length=41

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +3

Query  267  FDLHV*SMPPAFNLSQDQTLQFNSC  341
            FDLHV  MPPAFNLSQDQTLQF  C
Sbjct  7    FDLHVLGMPPAFNLSQDQTLQFKFC  31



>gb|KGC56842.1| hypothetical protein DM75_2176 [Burkholderia mallei]
Length=84

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   VSVPVWLVVLSDQLLIVALVSLYLTN  80
           VSVPVWLVVLSDQLLIVALV LY TN
Sbjct  59  VSVPVWLVVLSDQLLIVALVGLYPTN  84



>ref|XP_003627937.1| hypothetical protein MTR_8g040260 [Medicago truncatula]
 gb|AET02413.1| hypothetical protein MTR_8g040260 [Medicago truncatula]
Length=241

 Score = 38.9 bits (89),  Expect(3) = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +2

Query  17   VAGRPLRPATDRRLGEPLPHQLANQTSAAPKA  112
            V   PL P TD  LG+ LPHQLANQT A P A
Sbjct  156  VDDHPLGPTTDHHLGKLLPHQLANQTRAPPWA  187


 Score = 26.6 bits (57),  Expect(3) = 5e-04, Method: Compositional matrix adjust.
 Identities = 11/12 (92%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +1

Query  268  STCMCKACRQRS  303
            S CMCKACRQRS
Sbjct  229  SICMCKACRQRS  240


 Score = 23.1 bits (48),  Expect(3) = 5e-04, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 17/33 (52%), Gaps = 0/33 (0%)
 Frame = +3

Query  132  TFFRRTYAVLA*LSLRYPPLLGTFRCITHPFAT  230
            +F    Y VLA +S    P  G F  +THP AT
Sbjct  190  SFRSSAYGVLATVSSCCSPPKGKFLRVTHPSAT  222



>emb|CDN46171.1| hypothetical protein BN871_LE_00010 [Paenibacillus sp. P22]
Length=61

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 34/61 (56%), Gaps = 3/61 (5%)
 Frame = +2

Query  17   VAGRPLRPATDRRLGEPLPHQLANQTSAAPKA*GPKI---PHFLP*NVCGISVTFATLSP  187
            +A  PLR AT RRLGEPLPHQLAN   A P+     +   P      + GIS+ F  LS 
Sbjct  1    MADHPLRSATHRRLGEPLPHQLANAPQAHPQVTDCSVFPDPSRRRDRISGISIRFRRLSQ  60

Query  188  T  190
            +
Sbjct  61   S  61



>ref|WP_039847189.1| hypothetical protein [Salmonella enterica]
 gb|AHQ45933.1| hypothetical protein AU86_22420 [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20092320]
Length=72

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  3   VSVPVWLVVLSDQLLIVALVSLYLTN*LI  89
           VSVPVWLV+LSDQL IVALVS YLTN LI
Sbjct  39  VSVPVWLVILSDQLGIVALVSRYLTNKLI  67



>gb|AGC71899.1| ribokinase [uncultured bacterium A1Q1_fos_4]
Length=76

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  3   VSVPVWLVVLSDQLLIVALVSLYLTN*LI  89
           VSVPVWLVVLSDQL I  LVS YLTN LI
Sbjct  48  VSVPVWLVVLSDQLQIAGLVSFYLTNNLI  76



>gb|EGW50004.1| hypothetical protein HMPREF1022_03007 [Desulfovibrio sp. 6_1_46AFAA]
Length=173

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +2

Query  194  GYVPMYYSPVRHSPPGEVAPARAAVRLACVKHAASVQSEPGSNSSV  331
            G +   YSPVRHS       +   VRLACVKHAASVQSEP SNS V
Sbjct  12   GRLSTRYSPVRHSTRDR---SLFRVRLACVKHAASVQSEPESNSPV  54



>ref|WP_003271563.1| hypothetical protein [Ralstonia solanacearum]
 ref|YP_003744357.1| protein of unknown function [Ralstonia solanacearum CFBP2957]
 ref|YP_003744536.1| protein of unknown function [Ralstonia solanacearum CFBP2957]
 ref|YP_003745806.1| protein of unknown function [Ralstonia solanacearum CFBP2957]
 emb|CBJ41713.1| protein of unknown function [Ralstonia solanacearum CFBP2957]
 emb|CBJ41892.1| protein of unknown function [Ralstonia solanacearum CFBP2957]
 emb|CBJ43196.1| protein of unknown function [Ralstonia solanacearum CFBP2957]
 emb|CCF98209.1| hypothetical protein RSK60_440001 [Ralstonia solanacearum K60-1]
Length=31

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  288  MPPAFNLSQDQTLQFNSCFC*FLSRSLT  371
            MPPAFNLSQDQTLQFN  F  +  RSLT
Sbjct  1    MPPAFNLSQDQTLQFNLLFSLYYERSLT  28



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519548928290